3IS5A

Crystal structure of cdpk kinase domain from toxoplasma gondii, tgme49_018720
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
272
structure length
260
Chain Sequence
NLYFQGTIDDLFIFKRKLGSGAFGDVHLVEERSSGLERVIKTINKDRSQVPMEQIEAEIEVLKSLDHPNIIKIFEVFEDYHNMYIVMETCEGGELLERIVSAQARGKALSEGYVAELMKQMMNALAYFHSQHVVHKDLKPENILFQDTSPHSPIKIIDFGLAELAGTALYMAPEVFKRDVTFKCDIWSAGVVMYFLLTGCLPFTGTSLEEVQQKATYKEPNYAVRPLTPQAVDLLKQMLTKDPERRPSAAQVLHHEWFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CDPK kinase domain from toxoplasma Gondii, TGME49_018720
rcsb
molecule keywords Calcium-dependent protein kinase
molecule tags Transferase
source organism Toxoplasma gondii
total genus 76
structure length 260
sequence length 272
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2009-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3is5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3is5A01
5HCZA 2WNTA 5LARA 5I9YA 3LMIA 4L52A 4UMUA 2VWUA 3R7GA 5L8KA 1YXSA 3WYXA 2JAVA 2UW4A 3POOA 5HORA 2G2FA 1M2QA 3K2LA 4WD5A 4DEHA 3RZFA 4EOOA 5AADA 4X2FA 4KS8A 3TKHA 2XJ1A 4LGHA 4LV8A 5B2MA 3D0EA 4L7SA 4O7ZA 2XIKA 2CN8A 4NEUA 5HE3A 3QTQA 3GUBA 4BC6A 3KC3A 4CV9A 1YWRA 3F3TA 2QR8A 3D5VA 2IJMA 3ORMA 3PLSA 4PX6A 3HA8A 5F20A 2XK7A 3KXGA 4AS0A 2ZV9A 3QX4A 3ZXZA 3E3BX 1FOTA 3IDPA 3COHA 4A9TA 3EB0A 4AN3A 3W2PA 3W16A 3ZFMA 2IN6A 1LP4A 4TT7A 4JJRA 2YN8A 1Z57A 4ITIA 2A1AB 5DR6A 4E6DA 4EHEA 5KMIA 4X3FB 4EH9A 4FSWA 4D9TA 5KHWA 3QTRA 4M66A 3ZLYA 2W96B 4BL1A 2FSMX 4DC2A 4FIJA 4K1BA 3LFDA 4U80A 2JKOA 4YLJA 2R0IA 3KK9A 3MY0A 5HE0A 3VF9A 4XEYA 4CKIA 3I7CA 4EI4A 4X7QA 5ANJA 4J97A 2F7XE 3RM7A 3R9DA 2WMRA 3E62A 5IG1A 2Y7JA 3FZSA 5HNGA 2CGVA 2J5EA 3UE4A 1Z9XA 4ZK5A 3OW3A 5CASA 4BTKA 1UV5A 2W0JA 5ANOA 2YCRA 4OW8A 4YLKA 1Q4LA 2Z7SA 1CMKE 3EKNA 2FVDA 5I9WA 1YQJA 3FMDA 5HIEA 4KKHA 5JSMA 4DCAA 5CU4A 4K77A 5I9XA 2JDSA 2UZDA 3AGLA 4GYIA 4AACA 3QWKA 2I0VA 4FKQA 4E4XA 3OROA 3ODYX 4GYGA 3NVMB 2W4JA 3BI6A 3R02A 4BY9E 2Y4IB 2QD9A 4GG7A 3VNTA 2VNYA 2WMQA 2XNOA 3PJCA 2R3OA 4RRVA 3V5WA 2OU7A 2WOTA 5C1QB 3F6XA 4L45A 4O22A 3EFWA 5EK7A 3V5TA 2QG7A 5HCYA 2W05A 2VV9A 1IAJA 3C5IA 4JS8A 5A3XA 5JH6A 4XG2A 3MBLA 4MBLA 5KE0A 3RMFA 3ZM4A 5M4CA 3LVPA 3BBTB 3R9RA 3TCPA 3NUXA 4G31A 4X3FC 2B55A 3IOKA 3VRZA 4FT0A 2YIQA 3CY3A 3AG9A 4MXZA 4EZ7A 1PXJA 2G15A 3KMWA 3NYXA 1OECA 5CEMA 4IAAA 4U7ZA 2Z7QA 2XNPA 1XBBA 3GC8A 2UVXA 3ZLWA 4NU1A 3ZC6A 3NPCA 3BYUA 1SVHA 2ZM1A 3Q4TA 5DRBA 3OBJA 3ORXA 5HVJA 3ULZA 1UNHA 5GNKA 4N70A 2WMUA 3I4BA 3R21A 3B8RA 4AXAA 3U6HA 2YM7A 4XG7A 4YUQA 1U54A 4IAYA 2NO3A 2C1AA 2IZUA 5I5ZA 4F9AA 5EHYA 3UPXA 5M55A 3CPBA 3FZPA 4FKWA 1DAWA 1WBPA 1LPUA 3O17A 1YDRE 4MF1A 3ZRKA 3NYOA 4L9IA 4QTDA 3G0FA 5L6WL 3OW4A 3QAME 4CCUA 4PMMA 3LQ5A 4C37A 3BHHA 2Y4IC 3MSSA 3TUBA 2GTMA 1YRPA 4JOAA 5K0KA 4CZTA 3ATTA 3NCGA 4PWNA 3UP7A 3P5KA 2ZV8A 3ZDIA 3Q5IA 5HQ0A 3VC4A 3QTUA 4MXYA 2HY81 3OHTA 4IANA 3KA0A 3UNZA 3W2RA 4ASEA 2GQSA 4G3FA 5LMAA 5HE1A 3PWYA 2B9HA 5J7HA 2BDWA 3PIXA 3DAEA 3Q4UA 3FXZA 4F1OA 4F99A 4AWIA 4L67A 4E6AA 3PZHA 3CIKA 3FSFA 3MTFA 5HTIA 4FV2A 4GU6A 4HZSA 3ZU7A 4IX4A 5JFXA 4CGAA 4F6WA 2UW9A 4I0RA 4DTAA 4PDOA 4IAIA 4D1XA 3I0QA 4ZIMA 3PDTA 2ITUA 3UOKA 4U42A 1URCA 2C3KA 3QGWA 3QCSA 3L9MA 3EQRA 3SG8A 4FVQA 1CKIA 4MXAA 4LL0A 4JVGA 1XQZA 4MHAA 2VAGA 4XG3A 4YO4A 5IQBA 4BGGA 3P08A 3NIZA 4HGLA 2A19B 3RPYA 5IDNA 4BDDA 3RINA 4HOKA 1PF8A 1ZMVA 2J4ZA 1IRKA 2WTKB 3D2IA 3EFKA 3IGGA 3MIAA 3TWJA 5KHXA 3TDVA 4FL1A 3I79A 4FV6A 3W8LA 3OCTA 4FUYA 2RSVA 3RK5A 2FYSA 2XF0A 5A54A 4GIIA 2ETRA 3IK3A 5FQDC 2XRWA 1GJOA 2OGVA 1PMUA 4R1VA 4FVRA 3A8XA 2WQOA 3EFJA 5IF1A 4FV0A 2WQNA 1OIQA 4LGDA 3UOHA 3ITZA 2WKMA 4OLIA 1M17A 1NA7A 2R3HA 4UV0A 4PNKA 1Q8YA 1ZOEA 4FTOA 1NY3A 4MWIA 1GNGA 2YABA 4XHKB 4PPBA 2YWVA 2OZAA 1PYXA 4F0IA 4FODA 1U5RA 2VD5A 3EQGA 4LOQA 5LVLA 4IZYA 4QMWA 2PZ5A 4IB1A 4HVSA 1O6KA 4FK3A 4IWDA 4NTTA 2GMXA 1FMOE 3H0YA 3HLLA 3PG1A 4ZSEA 3ELJA 5EYKA 3TNHA 4RFZA 3UGCA 3VS2A 2IPXA 2IO6A 1GIIA 5CQWA 1Q5KA 3ZMMA 4E73A 3QYWA 4R3PA 5DE2A 2UZOA 1H1QA 3HEGA 4YHTA 5C03A 5TF9A 5IA3A 5E8WA 2O0UA 3TJCA 4HVHA 4XCUA 1NW1A 4Z7HA 1XHAA 4Y5HA 4GH2A 1M2RA 1ZLTA 2IVSA 3H9RA 4IQ6A 1YDTE 1XH4A 3C0HA 2IVTA 4MNFA 4YO6A 4B4LA 4E26A 5KX8A 1B38A 3RTPA 4IMYA 3EQBA 3FC2A 1WVYA 4UEUA 4O7NA 5ETCA 5CENA 1WVWA 3KRXA 4LM5A 4WUAA 2G2HA 4IZAA 4C38A 4FOBA 5D10A 3AC2A 1YWVA 4EUUA 1U5QA 1Y6AA 2Z60A 4U0IA 4OTQA 3VUKA 3P9JA 4GG5A 3E7OA 3U6JA 2IZTA 2X7OA 4AFJA 2R5TA 4AT3A 3FE3A 4UYAA 4ZLOA 3R83A 3Q5ZA 3UIXA 4EC9A 4ZJJA 1ZOGA 4NCTC 5LQFA 4QMQA 4E6CA 3RPSA 2PVYA 2UV2A 4BYJA 2R3QA 4FYNA 2WIHA 4D2VA 4EC8A 4F1TA 4ZTLA 3U51A 3ENHA 4YZDA 3R30A 5AV1A 4DEIA 1LR4A 2R7IA 4ZEGA 1W84A 3PA5A 4O7YA 4FV9A 3TV7A 4MYGA 5M44A 3R7VA 2UZUE 1ZY5A 2WIPA 2XK8A 4S32A 5BYZA 4BCOA 4GS6A 3QUPA 4ZJIA 5J5SA 4Q2AA 5D7AA 5AV4A 1GAGA 2BR1A 5ETAA 1YI6A 4FKLA 4G9CA 2BRGA 4ZAUA 4WNMA 4DTKA 3LQ3A 3IW5A 3VUIA 4E5BA 2JBOA 4G6NA 3EQHA 4ACHA 2Y0AA 3DK6A 4NFMA 3V5PA 3R6XA 1MQ4A 3HDMA 2QO7A 5J87A 3VWAA 1OKZA 3E7VA 2YITA 4F6SA 2YAAA 2RF9A 4BI1A 3L9PA 4GJ2A 4XOYA 4BN1A 4ZS0A 2BFYA 3UZPA 5IQEA 3HAVA 5KMLA 3PSCA 4WG3A 5BVEA 3COMA 5AM6A 2VTMA 4R78A 3UO5A 1ZAOA 4B6LA 3V01A 2O8YA 3F5GA 3QC9A 4FKGA 3V5LA 3A60A 2FSTX 1H08A 5E8UA 1YXUA 4LOPA 2XBAA 1ATPE 4O7SA 5HCXA 5AJQA 1UU9A 3G2FA 4Y46A 3A7IA 3AMYA 3DDPA 4EJNA 5HTBA 3QRTA 2V55A 3K5VA 3FPQA 3LLAA 4QT1A 4GKIA 4I4FA 3SRVB 3I6UA 5CU3A 5DI1A 5HO6A 5TR6A 4EHVA 3QYZA 4W9XA 4Q5EA 2X9FA 3FXXA 2O2UA 3I60A 3JVSA 4KIPA 4WRGA 3NMUF 4QTCA 2FUMA 2ZV7A 1VYWA 1NVRA 3PPJA 2G9XA 3QZGA 4FKIA 3NSZA 4IFCA 4IZ7A 4M97A 4Y72A 3T3UA 2HOGA 2EVAA 1DM2A 2ZMDA 1PXLA 4ACGA 1OL7A 5DH3A 2IZSA 3VUMA 4EJ7A 1GZNA 3DNEA 3AOXA 2XA4A 2GHLA 5BMSA 3PSDA 4I5PA 4EOKA 1XWSA 2X8EA 3DCVA 4EH7A 1YI4A 1OPJA 3VS4A 4CSVA 1URWA 3BYVA 4P2KA 5H9BA 2PE0A 4BIBA 1JOWB 2I0EA 5EM5A 4D2WA 2XJ0A 3DKGA 3ERKA 3LFNA 3CJFA 4ANBA 5HZNA 3P7AA 5HNBA 4CG8A 3E8DA 3TV4A 5IDPA 4TZRA 4C61A 4A07A 4RJ8A 3RALA 3ZYAA 5BUIA 4IB3A 4KIKB 3FEGA 3MH1A 1KUTA 2VRXA 3DDQA 4HCUA 3KMMA 2PWLA 4PMTA 1W83A 4FV8A 4RPVA 1OPLA 3KXMA 2RFSA 3AMBA 4PRJA 2ZM4A 3VS5A 5FM3A 2G2IA 3MA3A 2QOQA 3F7ZA 5TO8A 3UMWA 1IA9A 3HUBA 4FKSA 3OWKA 4EONA 2EB3A 1YHWA 4RVMA 4OBOA 3M42A 3TIYA 3HRFA 2GS6A 2CKPA 4CV8A 4BI2A 3F5UA 3IS5A 3JYAA 3W32A 1JSVA 2Y6MA 5CVFA 4DFLA 5HGIA 3NUYA 4KD1A 4TYHA 4G2FA 4IJ9A 4YLLA 3VS0A 2IW9A 5KMNA 3H4JA 1QPDA 4FC0A 3ORPA 3Q9XA 4AW1A 4AZVA 5DYJA 4H3QA 2QC6A 5CSXA 5CAVA 2C47A 3DQWA 2IVUA 3W8QA 2P33A 3UQCA 3OWLA 3DB6A 2WTWA 4LRMA 4FTKA 3QRKA 4U79A 4YMJA 3CP9A 3QQKA 2OXDA 3UJGA 4ANSA 3FJQE 2CNVA 4ZXTA 4YBKA 3FKLA 2Z8CA 2V7AA 5H2UA 3DKOA 5IH5A 3QLFA 2QOOA 1CM8A 1H1PA 4GFOA 2BRNA 3DBFA 1PXMA 5TE0A 4WIHA 1M7NA 5EI2A 2R4BA 5HLWA 5IPJA 3LE6A 1YOLA 2YIYA 2UW5A 4QMNA 1XH9A 1MRYA 3DT1A 5KMJA 3C7QA 5GZ8A 1H01A 2BIKB 4ZP5A 3FL5A 3DLSA 3WILA 2A4LA 4XJ0A 2UZNA 4W4VA 3W2QA 2F2UA 4BF2A 1Q3DA 4F4PA 3D7TA 2UZVA 3FBVA 2ZOQA 4RQVA 2C69A 4IXPA 4CFFA 2Q0BA 3ZXTA 2VTQA 1WBWA 4RWKA 1SM2A 4XV1A 2XNNA 5CF5A 5CZHA 3VW8A 5AP0A 5A46A 3TZ9A 4ZTRA 3MY5A 2JKKA 2CCHA 2X81A 4RWLA 4D2TA 4CRLA 4DEEA 2I6LA 4L68A 3F5XA 3RVGA 3V8SA 4BFMA 2GNJA 5DT0A 4A9YA 1O9UA 3PJ1A 4MD9E 4UN0C 4MNEA 3OZ6A 5A6OA 3SXRA 3FMMA 5EQYA 2WEVA 1XO2B 4FTRA 2OH0E 5J95A 3VS7A 3ANQA 4IM2A 1YOMA 3B2TA 1Y6BA 4U81A 4WSQA 4EWHA 1Y57A 3IW8A 3AD4A 3OXZA 4EKKA 3PXRA 5CEIA 4FMQA 1NT2A 1OIRA 1H1SA 5T68A 3EWHA 4F70A 2GFCA 2J7TA 3TI1A 4RA5A 1JQHA 5A4EA 4DITA 4IADA 2J90A 4USFA 3LM5A 3OTVA 5KZIA 4G34A 5CVHA 2I1MA 3QRJA 3R8VA 2ZDUA 4ACCA 3AC4A 4I93A 5AX3A 2BKKA 3JXWA 5FWKK 4UMPA 3FAAA 1H25A 3SOAA 4EKLA 4DF3A 4IEBA 4IC7A 3F3UA 4RVKA 3RK7A 3N4VA 3DS6A 4L42A 2ITWA 5C27A 4NIFA 3KN6A 5HIBA 2VWBA 3PVUA 4R1YA 5AUYA 4AUAA 2Y8OA 2PHKA 4TRLA 3VHKA 4LMNA 3KKVA 2VTJA 3E5AA 5HICA 5AP7A 1NVSA 2GHGA 1OKYA 2YM4A 2A2AA 2BRMA 2P0CA 4FKOA 4RX5A 1HOWA 4X2JA 2GFSA 4L3JA 4QMPA 3KGAA 3VUTA 2QR7A 4QYEA 3TTIA 1FMKA 1K2PA 4Z9LA 3MY1A 3LOKA 3QRUA 4QPSA 4K2RA 5J79A 4OBPA 5KNJA 3RI1A 5C01A 3BCEA 4YU2A 4L3PA 3UP2A 4JRVA 3RCJA 3SDJA 5IQAA 3AC1A 1O6YA 3QCYA 2VX1A 2W9ZB 3A62A 2FSLX 4YTCA 2JIVA 4APPA 1V0OA 4AW2A 3GVUA 5D1JA 4AGUA 4PNIA 3ORLA 5M09A 4U6RA 4E5AX 2OIDA 1ZRZA 2W5BA 2BHHA 4E5WA 3PWDA 1AQ1A 3QQFA 3CGOA 5HU9A 3R63A 4PMSA 3RHKA 1Q8ZA 3GCSA 4X2KA 1TQIA 2BAJA 2JDOA 2WU6A 3LCSA 1MP8A 3MGYA 3K3JA 1H4LA 4NT4A 4NL0A 4FKJA 2WZJA 2ITXA 2JFMA 5IQDA 3N9XA 5CF8A 1BL6A 2BZJA 3TDWA 3G33A 4YNEA 3OY1A 4JG6A 3S2PA 3SA0A 2PE2A 4PPAA 4FOCA 1F3MC 5EG3A 4BR3A 4JX3A 5CYIA 3MVJA 3NW5A 4UY9A 4AT4A 2PUUA 2OKRA 4FNZA 4KRCA 4APCA 4H3BA 1QPJA 3GCVA 4GVAA 4IZ5A 1PXIA 2O63A 3IQ7A 3UYTA 4QQTA 2OW3A 3CBLA 3ORNA 2C6LA 2NP8A 3LKMA 4XMOA 3F7WA 2XYUA 4QMOA 3OOGA 4NKSA 3O23A 3A7FA 4JBVA 4X6RA 3ZS5A 4K0YA 4NJ3A 4F0GA 5C8NA 3FQHA 4RX9A 4EK4A 4M7IA 5EDRA 4ZTQA 3OC1A 2UW7A 3GFEA 2ZV2A 2VTIA 3PXKA 5L2SA 4RIWB 1XH5A 4Y5QA 1KE8A 5D9HA 4IFGA 4BB4A 2BRBA 4B99A 3A4PA 4BDBA 4DEDA 4FSNA 3FWQA 3ORTA 4HGSA 5DFPA 1PXPA 2WMWA 2XM8A 2GU8A 3DTCA 1JVPP 3F69A 4YC8A 1OB3A 3Q4CA 2UW8A 3NW7A 5JRSA 4MF0A 4FIFA 4R5YA 3WE4A 4AOJA 3GCPA 4QMSA 1B6CB 2UVYA 3HMIA 4IW0A 4MQ1A 3WF6A 3NNUA 5IMXA 4O7RA 4FVPA 4N6ZA 5LWMA 5AIRA 1QCFA 4UMTA 4N4SA 5DEYA 5ANIA 4CKRA 4IB0A 3JPVA 3PE2A 4IB5A 4RX8A 3EKKA 2QOIA 4AE9A 4AZTA 2XH5A 5EYDA 1W7HA 3NNXA 4EK5A 3V5QA 2VTLA 2CGUA 4O81A 4G1WA 4G3DA 2OSCA 4RC3A 2Q83A 4E6QA 3GXLA 3OG7A 1RW8A 5ACBC 3TUDA 2ZJWA 5DBXA 5G1XA 3LIJA 1JSUA 5JQ8A 2DWBA 5DEWA 5E91A 4F63A 3F2RA 2YDIA 5FEEA 3LXLA 3R9HA 1OMWA 2CLQA 5AR2A 2OK1A 4OAUC 4RIXA 1BYGA 2O65A 3U4WA 4GK2A 3TNPC 3DY7A 2ZB1A 5FGKA 4CLJA 3KF7A 2VWVA 4PTEA 3TACA 2ZM3A 4V04A 2Q0NA 5FXRA 4K11A 3F3WA 3WF8A 2C3IB 3R1NA 3WZUA 4WOVA 2UUEA 3MVHA 5D12A 3UVQA 5I9UA 4R7BA 3C50A 1Q8UA 3D15A 1K9AA 4QQCA 2W1HA 5ICPA 3BWJA 3D9VA 5FXSA 2ONLA 3I7BA 4HVDA 5GINE 4D0WA 5HBHA 5AP5A 4F7NA 3OS3A 3VS6A 2CHLA 5DVRA 2C3JA 3DFAA 2V5QA 2X2MA 3BEGA 3FMLA 4IACA 4FE2A 2JIIA 4NM7A 2DQ7X 2QLQA 1SNXA 1OUYA 3RNIA 4H39A 4H3PA 3FL4A 3B2WA 4FBXA 4I1ZA 2OXYA 2P3GX 2UW6A 4MBJA 4CMTA 4CTCA 1Q8WA 4FK6A 1J7IA 3FMJA 2QOKA 4WBBB 2C6MA 2W5HA 2BUJA 5AP1A 3DFCB 5FP6A 3PXQA 4QP6A 2VTNA 4L46A 1ERKA 3KN5A 4XYFA 4WHZA 3W2CA 5DR9A 4D5HA 3O8UA 3UIUA 4AGCA 4AA5A 3L9LA 4CXAA 2Z7LA 3MH2A 4FTMA 3U9CA 4X6QC 3TL8A 4OTIA 4I5MA 3ETAA 4WNOA 4CMOA 4EQUA 2OZAB 5E1EA 3NIEA 1RE8A 2EXEA 3FZ1A 3R8ZA 2YERA 2X8DA 5EYMA 5IUIA 5CY3A 2W4OA 4YGAA 3GU6A 4QNAA 4Z16A 5KZ0A 3DZQA 2QO2A 5FTGA 3NVKI 1GY3A 1UKIA 3ZCLA 3TNWA 2X7GA 5A14A 2ZMCA 1Y8GA 3BV3A 3QFVA 3IONA 4FF8A 3C4ZA 4JT3A 4PL4A 3EQCA 2XK3A 4NK9A 1SMHA 4MX9A 4C4GA 3PTGA 2YM3A 3ZUVA 3GQIA 3QD0A 4ZZMA 3FI8A 1JKTA 3FXWA 3KRWA 5CSHA 2OIQA 4GK3A 3MYGA 2NPQA 4RJ3A 5F4NA 4LGGA 3DPKA 5A4QA 3NW6A 3R71A 3OUKA 4M15A 3Q32A 4TW9A 2X8IA 2HYYA 4BCKA 2R3KA 4ZOGA 4FG9A 2VTPA 5EOBA 3ATSA 4TYIA 4JQEA 3PYYA 4AZFA 2VGPA 1VYZA 4O0TA 4DGMA 3FZOA 3LCDA 3N4TA 1MRUA 2XK6A 4KABA 3PZEA 5HD7A 2XCHA 4E4LA 4EZ5A 4YZCA 4FSYA 3ET7A 4L3LA 4O2ZA 5BQ0A 4JX7A 5CANA 5HLPA 5JGBA 2OWBA 2HZ0A 2JLDA 3HZTA 3KULA 4Y73A 3OVVA 3GCQA 3ZSIA 2HWOA 3PG3A 4FSZA 4W4YA 1G8AA 4O7WA 3GCUA 3I5ZA 4BTMA 5J1VA 5FM2A 1Q97A 2C5NA 5C26A 3QD2B 3DQXA 3JS2A 4K9YA 4IBMA 4CQEA 1JLUE 2P4IA 1Y8YA 4FSQA 3O51A 4KUJA 1I44A 3FQSA 3MW1A 3NEWA 3KF4A 4R3RA 4ZMEA 3UIMA 3SGCA 1KSWA 4PY1A 3DJ7A 3G15A 3RWPA 4ZTNA 4FEXA 3EQFA 3WZEA 4OTDA 2ETKA 3BLQA 4V01A 4AFEA 2CSNA 4O0XA 3G5DA 2X2KA 5DG5A 4U3ZA 4CYIA 4MK0A 2GNHA 3VIDA 3QC4A 5AUVA 2XKCA 4BVUA 4RG0A 1A48A 5EI8A 5C8MA 2UW0A 4IDVA 2RG5A 2PVNA 2BFXA 2QOCA 2RGPA 4C35A 3EN5A 4P5ZA 2WMXA 3PPZA 5DT3A 3PSBA 4S34A 4XP0A 5HG9A 5DNRA 4O82A 2UZBA 2Y6OA 5FTOA 4ARKA 3R7IA 4BI0A 3KXHA 4IX5A 1YWNA 4M84A 3S4QA 1XJDA 2YDKA 4N6YA 5FXQA 4O86A 1BX6A 3S95A 2R3JA 3H3CA 4UWBA 4RZWA 3ZOSA 4QOXA 2NRYA 3POZA 5EH0A 4NH1A 3EMGA 5CVGA 5DRDA 5AV3A 5A9UA 3LPBA 5AM7A 2WTVA 3VQUA 4FTJA 3V5JA 4FT3A 2R3MA 1OPKA 3E3PA 3C9WA 4FT7A 3H9FA 5I3OA 4CQGA 2XB7A 4AX8A 5I3RA 3QQLA 4TWPA 2EUFB 3FI2A 3GU4A 4HJOA 5IU2A 3ZO4A 5JGDA 3MH3A 3CQUA 4DFUA 3F3ZA 5HG7A 2GNFA 4D4SA 3V8TA 4EQMA 5K5XA 5HIDA 4TYJA 2AC5A 2VWXA 4YTHA 5LVOA 4C3FA 3F2AA 3L8VA 3O7LD 5JZNA 5LVMA 4NM0A 4M13A 3WZDA 5HESA 1YW2A 3ZEPA 2PL0A 5E8VA 3BGQA 4H36A 3G6HA 3VN9A 4G16A 4C58A 3Q60A 4U9AA 5EYCA 2PUNA 3U87A 3KQ7A 3UQFA 2XM9A 5AWMA 2EXMA 3NRMA 5HX6A 2QU6A 1FGIA 1TKIA 4LG4A 4DFNA 3G51A 4WG5A 5ANGA 4U3YA 5E1SA 5J5TA 1WBNA 2I0HA 4EQCA 2ZAZA 3PY1A 4TL0A 4FNWA 4HZRA 3Q6UA 2CLXA 4FIIA 5C4LA 3FY2A 4ZTSA 4CTBA 2VWIA 1JKKA 4UB7A 4CCBA 5L2QA 4JR7A 4R3CA 3QCXA 3K54A 2C6EA 5GJGA 1WVXA 3RAHA 5AP3A 4ASZA 1UVRA 4LYNA 2B1PA 2HY0A 3FSKA 3QTZA 4V0GA 3NAYA 3TT0A 4CYJA 4MWHA 4EORA 2XBJA 4II5A 4X3FA 3VBVA 2OJ9A 5L2TA 5HVYA 4FL2A 4IVBA 3HV3A 3HUCA 4JBQA 1P4FA 2B52A 4TNBA 4Y95A 4AG8A 1OKVA 2ITPA 3CTHA 1KWPA 3BEAA 3C0IA 3MN3A 4IAZA 4C4EA 4RLLA 3RCDA 4RSSA 1S9JA 3OMVA 4AF3A 3Q2JA 3WF9A 2F4JA 3BHVA 1OBGA 4GVJA 2PZYA 5BVOA 3ZONA 1J7UA 4QMXA 5FDXA 3I5NA 3Q53A 3IW4A 4IIRA 2Z2WA 4E4NA 4EBWA 5EQEA 3MB6A 4PDYA 4CZYB 3HVCA 3F82A 1GZKA 3S3IA 1XH8A 3U6IA 4DLJA 3P7BA 4XP3A 4D2SA 3BYSA 3KMUA 2JFLA 5JFSA 4PL3A 2F57A 5L8JA 3TZ7A 3OT3A 3OBGA 4ZSGA 5KMOA 4IH8A 5CAOA 4FKVA 3BQRA 4YC6A 4M68A 3DU8A 3SLSA 4NW6A 4EYJA 2GHMA 4DG3E 4YHFA 5CWZA 3P78A 5CT0A 3RPVA 3DOGA 2RFDA 3NAXA 5EFQA 3SC1A 4JIKA 3C51A 2UW3A 1OL1A 3HYHA 4USEA 5LWNA 1PRYA 2C5XA 4GRBA 1HCKA 1M2PA 4M0YA 4HYHA 4CT2A 5IA5A 5LXMA 4FR4A 3I0OA 3MH0A 4H1MA 3TZ8A 3S0OA 4MQ2A 2RL5A 3HMMA 5EDQA 4CFWA 4DGNA 4ZLYA 2F2CB 4FSRA 3AC8A 3P1AA 4I92A 4KS7A 5FRIA 3W10A 3DXPA 3CD8A 4IAFA 4L01A 5CEKA 4IAKA 4D2PA 1JSTA 3QHRA 3F88A 3WOWA 2QO9A 3TN8A 2R3PA 3OT8A 4GEOA 3VJNA 4DINA 3EZRA 3FZRA 3KXNA 2XNBA 2R9SA 2CGWA 2EXCX 5HI2A 3GC9A 4J71A 3UDBA 2R3FA 4I6HA 3WARA 3CQEA 4YZ9A 1OBDA 3CQWA 1Q41A 1R0EA 3ALOA 5M57A 2GS7A 3ZO1A 5E92A 4EOLA 4F7LA 3HRBA 2XIRA 4Y83A 5BVWA 4HYSA 2VTSA 5AR8A 3JY0A 1M14A 3NS9A 5IA4A 5KCVA 3KFAA 4BDKA 4JDHA 5T6KA 1W98A 2HXQA 2XEYA 3BPRA 3KRLA 3M2WA 4A7CA 2YCQA 3WIGA 1PXKA 5AUTA 1OIUA 2E9OA 2J0IA 3LFFA 4NWMA 4CMUA 1REJA 1FBNA 4AOIA 4JXFA 4BDIA 2PUPA 2WFYA 2QHNA 3NYVA 3QL8A 5T3QA 3VUGA 4BIEA 4BHZA 3VVHA 3IECA 5AR7A 4GW8A 3W55A 4GSBA 3V04A 1T46A 2OJFE 1SNUA 1V0BA 2W1CA 4GT4A 4O1OA 5JQ5A 2WGJA 4U8ZA 5BVNA 4FTQA 4XG4A 2XIYA 1KE7A 5DA3A 4C57A 2VNWA 5IEXA 4R6VA 2C5YA 3MVMA 4ACMA 5DGZA 2ESMA 4LUDA 4QP4A 2YCFA 2VGOA 3TNIA 4TYGA 1XH7A 3GOPA 4FIEA 4JBOA 4EEVA 2HZNA 2ITZA 4X21A 5F95A 2PMOX 2J0MB 5B2KA 4KSQA 5CQUA 2C5OA 4YJRA 3LMGA 4KBKA 3TZMA 5A4LA 4CT1A 4BDEA 1ZZLA 2R2PA 5M07A 5GJFA 2GDOA 4XUFA 1OI9A 4F1MA 3GC0A 2FH9A 1CSNA 3IW6A 4FTNA 2VTRA 1STCE 2OXXA 2V7OA 3RAWA 4I0TA 4F08A 4C7TA 4FZAB 3P0MA 3QRIA 4EK3A 2PYWA 1OIYA 1WFCA 4TPTA 3TEIA 5J9ZA 1JKSA 2SRCA 3ZRMA 4CKJA 2JC6A 2YZAA 4TXCA 4D0XA 3LM0A 4BWXA 3QWJA 5HO8A 5DPVA 2VWWA 3DAJA 3K5UA 3Q6WA 4OR5A 4DT8A 3QKKA 5K4IA 3PP0A 3FMHA 4O1PA 3KU2A 3MA6A 4QPMA 3SOCA 3SXFA 4A4OA 2GNLA 3GOKA 4IE9A 3BHUA 3QU0A 4O27B 5FBOA 4I21A 3O2MA 4F9BA 4UX9A 4UMRA 5HVKA 1YXXA 4F9CA 4FGRA 2HK5A 3NUAA 3NNVA 2HENA 2WTIA 2YLFA 4QMVA 2A0CX 2VX0A 4EL9A 4ITJA 4QTEA 3VBYA 2QLUA 5IUGA 2BRHA 3QKMA 3QD3A 5HE2A 3HX4A 4HVIA 3SVVA 4PUZA 4MD8E 2PVFA 2QOLA 1CTPE 4TN6A 4NM3A 4DT9A 3CY2A 3R7OA 4RWJA 2R3RA 3HV7A 4AN2A 2V62A 1V0PA 4UALA 2QI8A 2YACA 3V8WA 4NJDA 3ZBXA 5FEDA 4Q9ZA 3IKAA 4XRJA 1ZY4A 2PMNX 5HX8A 2PE1A 3ZZWA 3W1FA 4FV5A 5HOAA 3IDCA 5JEBA 4QMZA 5EOLA 3FHRA 2RFNA 4USDA 2DS1A 4OTPA 3VBXA 3NWWA 4ENYA 3NGAA 4O7TA 3A61A 2E9NA 3BIZA 3FLYA 5E90A 5BVDA 5CAPA 5KUPA 2Z02A 3ZZEA 1Z5MA 2J6MA 1KE6A 3QQJA 1RDQE 3NUNA 4DAWA 2WTCA 3F3VA 4F9WA 1MUOA 2XNMA 3ACKA 4TTHB 3F5PA 5AUXA 4PTCA 3W2SA 4CFMA 2F7EE 3LMHA 1FINA 3R1YA 3ZRLA 1WAKA 5AAEA 3ZLXA 5BVFA 1WZYA 4PF4A 1BI7A 4DYMA 4CD0A 5L6PA 2UVZA 5BMMA 3AT3A 3DKFA 3D14A 3TKUA 2XYNA 3U8WA 2WQMA 3COIA 4RC4A 5DN3A 3H9OA 4JI9A 3THBA 1IR3A 4FTTA 1PXOA 3SW4A 3BQCA 3UVRA 4ANNA 3UOJA 3UC4A 2BKZA 4NZWB 1H1RA 3D83A 3E87A 4ZSLA 4S31A 3WE8A 4I5CA 5CEPA 3AT2A 3FC1X 3MWUA 2BZIB 5M4FA 5IH6A 2REIA 3T9TA 3ACJA 3BU6A 2WAJA 4M69B 4WSYA 4BGHA 3R9NA 5LCJA 3AMAA 4ASXA 1ZWSA 1Q62A 2C6DA 4K18A 3DJ5A 2ITYA 2I40A 3SW7A 4LV5A 2RG6A 4JDIA 1ZXEA 2H34A 3DJ6A 4WG4A 5AMNA 3RAKA 4O7LA 3GFWA 3N4UA 2X2LA 3IG7A 4FNYA 3PJ2A 3F66A 3NYNA 2QURA 4ZTMA 4EHZA 2QKRA 3KRJA 4KA3A 5IEYA 2QODA 4WO5A 4JAIA 4GT3A 4BWKA 4XG8A 2PVLA 3FPMA 3O96A 4FI1A 2O3PA 3D7ZA 1OKWA 5KMKA 3DBEA 4BDHA 1R39A 1SYKA 5FLFA 1SVEA 3BU3A 4FYOA 4G5PA 3ZUTA 4RJ7A 5HG8A 4ITHA 5DHJA 1ZYLA 4R5SA 4YR8A 4EOPA 4C59A 5HO7A 4ZS4A 3FYKX 4FGBA 3TXOA 4F64A 4YZNA 2HW7A 3C4WA 1OL6A 4EH3A 1J91A 2GNGA 3EH9A 5CSPA 1OGUA 2LGCA 2BPMA 4IX3A 2C4GA 5FD2A 3SRVA 2ITVA 4M67A 5HHWA 4RVTA 4ZY4A 2UZTA 1RQQA 2JGZA 5M51A 3UOLA 4FEQA 4KAOA 5CXHA 4ZZNA 5HTCA 1P4OA 1YVJA 3PY0A 4UZHA 3C13A 4ERWA 4UZDA 5DMZA 2F9GA 1BKXA 3G9LX 4O0WA 3DAKA 5ANEA 5IA1A 3BZ3A 3RBWA 1FVTA 4J7BA 3LXKA 1REKA 3NUPA 3MI9A 3RPRA 3W33A 4FKRA 4QMUA 5CU0A 5LCKA 4O38A 4E1ZA 4FTLA 2YLEA 2JD5A 4ACDA 3CS9A 1QPEA 2W1GA 4LOOA 2NRUA 4D4YA 3BLHA 4DH3A 5I0BA 2VO6A 4D1SA 2CJMA 2OG8A 2ONLC 2X6EA 1SVGA 4O91A 5TT7A 5E9EA 4CFVA 1EH4A 2AYPA 2YA9A 3GU8A 4YC3A 5IQHA 4PMPA 2GSFA 3KCKA 3S1HA 4GFGA 3HECA 2PK9A 3PY3A 4L7FA 4O84A 2H9VA 5EI6A 1JAMA 5CI7A 3P86A 4W8EA 4C36A 2PTKA 2YAKA 4KIKA 1O6LA 2OJJA 1R3CA 2GCDA 3D5WA 3UG2A 3DK3A 3CPCA 3OUNB 3VUHA 5BUEA 4MCVA 1M7QA 3H0ZA 4QQ5A 2QCSA 1IEPA 4F65A 5I9VA 2B53A 1H27A 3PA3A 4JNWA 3SV0A 1I09A 4U40A 5ACKA 2W7XA 2HCKA 4DN5A 4FTCA 4Q9SA 2VO7A 4IM3A 2CN5A 2JKQA 4FZFB 4JIAA 4MAOA 3QZIA 1YXVA 3PA4A 4EOIA 2WMSA 4EOQA 2FB8A 2OH4A 4QPAA 5TKDA 1P5EA 2OO8X 5EHLA 2GQGA 1OL2A 5M4IA 3CD3A 3HV4A 4XH6A 4AU8A 3LCOA 4EZ3A 5BX0A 5L2IA 4O7VA 3LCTA 1QPCA 3U9NA 2QNJA 3FI4A 3ORIA 4QP3A 3D4QA 1H24A 3LCKA 4RIYA 4ERKA 4H05A 1GOLA 3C4XA 4CFNA 3NUUA 2HXLA 4L53A 3CJGA 3PRIA 4ZSJA 3TJDA 2I0YA 4JG8A 5EKNA 3KL8A 1IAHA 4DHFA 1U54B 3R8PA 1GIJA 3ZEWA 3E93A 1KV1A 3O71A 3QTSA 4NUSA 4YSJA 1FGKA 2Z7RA 2QOHA 5LJJA 1UNGA 4OTGA 3Q3BA 1W0XC 5H8BA 4FG8A 5LVPA 2YJSA 5E4HA 3R73A 3NCZA 5A6NA 4FICA 3UG1A 4N57A 1WCCA 2C5VA 1SZMA 3L8XA 2C3LA 4I4EA 4Y8DA 3GENA 1NXKA 3F2NA 2C6KA 3O8PA 3TM0A 3E8NA 4JG7A 1UU3A 4IVCA 4X2NA 3GNIB 5J8IA 3VBWA 3PPKA 4J8MA 3KEXA 3UODA 2B9JA 3QGYA 2R64A 1WBTA 4F9YA 3JVRA 5GZ9A 1TVOA 2OF4A 2C30A 1H00A 4RC2A 1PW2A 4YBJA 5LMKA 5IQCA 4FZDB 4DH1A 1YHVA 4LI5A 5CZIA 3BE2A 4P5QA 2OFVA 4PDPA 4B0GA 3SKCA 2J9MA 4RJ6A 3RAIA 4G5JA 4QP9A 1Y91A 4MXOA 4G3EA 3FV8A 3UNJA 5AUUA 3C4FA 3KVWA 5ETIA 4QYYA 3R2BA 3HGKA 3VRYA 1WBOA 3C5UA 3ALNA 3DA6A 3EN9A 4DGLC 4FTUA 5JKGA 5L8LA 2QU5A 2XCKA 1OL5A 3R8UA 2QQ7A 3M1SA 3OD6X 3ANRA 1KV2A 4UXQA 4EYMA 1Q61A 2YIWA 4XV9A 2IW8A 3UO4A 4ALWA 4WT6A 3I81A 4X3JA 4BCMA 5IH4A 2XVDA 3GT8A 5EM7A 3LLTA 2EU9A 2BAQA 4OUCA 4QYHA 3BELA 1OITA 3HMPA 3HAMA 4O96A 5FDPA 2BCJA 1APME 3JY9A 3MPMA 4BTFA 4H1JA 4TY1A 5HG5A 3WI6A 3A7GA 4ID7A 2WQEA 2PVRA 4FKPA 2J5FA 4IC8A 2C6OA 4LL5A 5BYLA 2BTRA 3BE9A 3AD6A 5M08A 2FO0A 2WPAA 1GZOA 1YOJA 4XG9A 3HMNA 2C0OA 2IW6A 1J1BA 1JBPE 2XMYA 3H10A 4DGOA 2YISA 1W8CA 4P7EA 5CALA 4FSUA 4R8QA 4NFNA 2OIBA 3D2KA 5K3YA 4WUNA 3M11A 4BCNA 1L3RE 3UMXA 2FSOX 2HIWA 3RWQA 4L43A 2J0LA 4UWCA 4KSPA 1MRVA 3E88A 4XX9A 4PP9A 1JWHA 4BRXA 4QD6A 4DFYA 5KBQA 4V0GB 1KOBA 2XKFA 3DZOA 3FZTA 4IVDA 5EM8A 5CF4A 2X39A 1XBCA 3QD4A 4JR3A 5JFWA 3UYSA 4EH5A 5KO1A 2JBPA 2VWZA 3CTQA 3R00A 4CRSA 4GL9A 5FG8A 4EBVA 3R7YA 1YXTA 5IZFA 4UBAA 4CVAA 3KVXA 3OEFX 3BRBA 1WMKA 3E8EA 3SHEA 1BL7A 4A9SA 5JK3A 3CLYA 4FTAA 4YTIA 3Q04A 4ZTHA 4C3RA 2IZRA 4O83A 3FLQA 4JDJA 4OT6A 4DH5A 1DI8A 2ZYBA 3ZLSA 5IMEA 3DK7A 4N0SA 3AXWA 3PXYA 4XV3A 5CT7A 1Q3WA 4LQMA 3SG9A 3L1SA 2W06A 1IG1A 3PVGA 4BCGA 2PY3A 2ETMA 4YJUA 4YHJA 2WEIA 3P4KA 2O5KA 3AQVA 1ZYCA 3OFMA 2PZRA 4KKEA 5CLPA 5M06A 3WBLA 3CEKA 2GPHA 4YJQA 4U45A 1G5SA 4GIHA 4AW0A 3RGFA 4QO9A 3QQUA 4IX6A 3N51A 4RBLA 2FGIA 1R78A 2WU7A 2QONA 2XJ2A 4LFIA 2W1EA 2WTDA 4BBMA 5DWRA 5AUZA 4AN9A 1H0WA 3MIYA 4BCFA 3OXTA 2J0JA 1ZOHA 4TWOA 2ZDTA 3FMNA 5CAUA 5F94A 4OBQA 4MVFA 3LHJA 5IA0A 4MH7A 5EW8A 4OGRA 4C34A 2YJRA 1AGWA 3A7HA 5H3QA 4F7JA 2C6TA 1PKDA 1TQMA 4GK4A 3LQ8A 1L8TA 4YURA 3QLGA 5IQFA 4FKTA 1R0PA 3SXSA 4QP8A 3SX9A 2E9VA 3QF9A 4RIWA 2JAMA 4DH7A 4EHGA 4CG9A 5G6VA 3BWFA 4K6ZA 3MFRA 4DFBA 4NW5A 5DLSA 1DAYA 4GJ3A 4RJ5A 4U43A 4J53A 3L8SA 4DGGA 1F5QA 4RVLA 3U4UA 2UZLA 3VULA 4WNPA 4I23A 3RHXA 2GNIA 2C0IA 3ORKA 3HRCA 3ZTXA 3T9IA 2XZSA 4EH4A 2JITA 4OTHA 2X6DA 4EOJA 1VEBA 2VTAA 2WMVA 4RLKA 5D7VA 4D58A 1BUHA 1XH6A 4EH2A 2YDJA 1BMKA 5EDPA 4AGDA 3ZO3A 5JMSA 2QKWB 3RNYA 1KOAA 4ENXA 1Q8TA 3IPHA 3DNDA 5AP6A 2BVAA 4QMLA 4P90A 2OICA 3RP9A 4FG7A 5KKRB 5EHOA 1VZOA 3LZBA 3PUPA 3MFUA 3QBNA 3IGOA 3R04A 4GKHA 4YZBA 3RKBA 5CTPA 4DE4A 2CNUA 2QOBA 2X1NA 2CGXA 3QALE 4QYFA 4YNOA 2ITNA 4BCHA 5A4TA 3DXNA 4FT9A 4QRCA 4IJPA 3PRFA 3HMOA 4L00A 4XLIA 2JKMA 5J7BA 4DBXA 3ULIA 1OM1A 4C8BA 4AQCA 2WOUA 4BZDA 2P55A 4MKCA 4J96A 2OFUA 1TQPA 2VX3A 3II5A 4C4IA 3LW0A 4GCJA 1R1WA 4CLIA 5C9CA 3UIBA 4I94A 4AP7A 3GGFA 4OTFA 4QQJA 4ANQA 3PJ3A 2XKDA 4U41A 4YJSA 3DBDA 1IASA 2Y4PA 5GZAA 1ZZ2A 2YEXA 4GU9A 3ZO2A 4BWPA 2VWYA 1RJBA 1G8SA 4H58A 5IQGA 3AD5A 5IEVA 2J0KA 1JKLA 4O2PA 5K0XA 5HNIX 4EK8A 3R7UA 4FV3A 4XBUA 2AUHA 2PSQA 4ZZOA 2CMWA 4FT5A 2F7ZE 3QTXA 5HBEA 4BCIA 2YCSA 2WD1A 4PQNA 5AR3A 4OTWA 3RK9A 3RJCA 3GU7A 2CPKE 2XRUA 1U46A 3OWJA 3SD0A 3C0GA 2A27A 1CDKA 3C4EA 3MB7A 2WELA 3Q9YA 2W1DA 3R8MA 3Q2MA 4BDFA 2VZ6A 4Q5HA 5CEOA 5KKRC 4C33A 1XR1A 3B8QA 5FP5A 3FMEA 4C4FA 1J3HA 3P7CA 2OLCA 4UXLA 1E1VA 4I41A 2WMTA 5TOZA 4ASDA 2B54A 3FY0A 3FDNA 4PTGA 3UQGA 1XKKA 4ZMFA 3BGPA 4ANLA 4M3QA 4ANOA 5AUWA 4E3CA 1FVVA 4FSMA 5M4UA 4YJOA 1AD5A 3R22A 3T3VA 4DEGA 2YZLA 3LJ0A 2QVSE 3ZUUA 2HWPA 3SQQA 5HEZA 4E7WA 3MJ2A 4FUXA 1WBSA 4CFUA 4PP7A 3FKNA 2JDVA 3WZJA 4X2GA 1E9HA 4TYHB 1JNKA 2ZB0A 5EW9A 4XLVA 4QP2A 3CR0A 3VO3A 2PU8A 3EN7A 4D28A 2P2IA 3EIDA 4FIHA 1KE5A 2GTNA 2PZIA 3HA6A 2W4KA 3WYYA 3TNQB 2YM8A 4BKZA 4UYNA 2WMAA 2PZPA 2E9UA 3HV6A 4MD7E 3ZSHA 3FHIA 3MV5A 2PUIA 3W2OA 1PKGA 4DFXE 3ZFXA 4HW7A 3BX5A 2JDRA 3NUSA 1KE9A 4KB8A 2WO6A 1P2AA 5CI6A 3G6GA 1P14A 3ORZA 2WTKC 5CNOA 5F1ZA 5J1WA 2XP2A 1UKHA 3KREA 5KMMA 3IOPA 3V6RA 4KINA 3U55A 4YP8A 4BDGA 2VO3A 2R3NA 4YJPA 4G3GA 3QCQA 2VTHA 3F61A 3QQHA 4R7HA 4C3PA 5FEQA 3KCFA 4C4JA 3G90X 4ZY5A 4X0MA 2CDZA 3V6SA 3BHYA 1PHKA 4O0SA 4RX7A 4DCEA 4S30A 1FPUA 4A9RA 2HZ4A 2G1TA 3OXIA 5FUTA 4DTBA 2R0UA 3D7TB 5GIOE 1PMNA 1M52A 4FL3A 2ITTA 4S2ZA 1YDSE 3D94A 1YKRA 3ZC5A 4OAVB 5AAFA 3V51A 3RPOA 5JZJA 5AFVA 2IWIA 4I20A 3WIKA 4RT7A 4B7TA 4BBEA 1J7LA 5AR4A 4A06A 4IHPA 2V0DA 3WF5A 3ZSGA 3UTOA 4C02A 4RQKA 4WRSA 5A4CA 3NNWA 4ALVA 4FZ7A 4R7IA 5GIPE 1WBVA 2J50A 4FNXA 3R1QA 2QOFA 5HU3A 5CS6A 4MNEB 5H8GA 1V1KA 4RWIA 4AGWA 5DOSA 2W17A 3I1AA 2V22A 3MPAA 1H28A 1W82A 5E8XA 2R3GA 3IO7A 2B0QA 2BTSA 1H0VA 2XS0A 4HNFA 4BDAA 3QX2A 4I3ZA 4QTAA 5ETFA 5CEQA 5AX9A 1B39A 3C4CA 4I24A 3EQIA 1PXNA 2P2HA 5C8KA 4JDKA 4ZJVA 3UBDA 4G6OA 3EYGA 4U97A 4GMYA 5IA2A 5D11A 4G6LA 4I6QA 3BGZA 2UZWE 3G9NA 2CKQA 4FEUA 3AC5A 3KB7A 3TIZA 2HZIA 3R1SA 3VBTA 3ZHPC 2XK9A 3PP1A 4W4XA 2ERZE 3EZVA 5E8ZA 5JFVA 5GHVA 2YM6A 3IW7A 4WNKA 5DT4A 5E8YA 4QP7A 5FBNC 4IWPA 2VN9A 4KRDA 4NIFB 4AA4A 2OZOA 4AZEA 2R3LA 4FX3A 4DLIA 3ZM9A 3KY2A 3GBZA 3TV6A 4JQ8A 4TWNA 5DR2A 3A8WA 3SAYA 3PJ8A 3HL7A 3FUPA 5AAGA 2BZHB 3EJ1A 4B8MA 3EQPA 1HCLA 3QA0A 3QXPA 4FIGA 4BDCA 5L4QA 4HNIA 2JDTA 3EN6A 4LUEA 4B8LA 4DEBA 4QMMA 4ALUA 4HGEA 4MTAA 1DI9A 1S9IA 4D55A 2JIUA 3K3IA 3EOCA 3VF8A 3CSVA 2H96A 2PPQA 4MXCA 3AC3A 3R0TA 1FVRA 4DFZE 4RFMA 3E63A 4NSTA 2XIXA 4GUBA 2J2IB 1LEZA 4OT5A 3BBWA 4FA2A 4KWPA 2W1ZA 4JQ7A 4PL5A 3DKCA 3NZ0A 4BKYA 4QP1A 4P4CA 3FKOA 4D9UA 4O0YA 4BDJA 1OUKA 5B2LA 3BKBA 1IA8A 3QHWA 4F7SA 2BILB 4C4HA 2VUWA 4ANMA 4QMTA 3E92A 1UWHA 2E9PA 2RKUA 5CAQA 4GT5A 4O21A 4XV2A 4G17A 4CEGA 3A99A 2YIXA 4NCTA 3UPZA 3U54A 3PLAE 3LJ1A 3EL7A 2C1BA 5CSWA 2W5AA 4J99A 1LUFA 3LFQA 3UZRA 2YHVA 4W8DA 4RMZA 2W99B 2IG7A 1PJKA 4DBNA 2O64A 3MVLA 3ZFYA 4BKJA 4IDTA 3JUHA 3OCBA 4ZLZA 3QQGA 1GZ8A 3CE3A 5BVKA 3GB2A 3T8OA 3ID6C 1G3NA 3KRRA 3NLBA 4YPSA 4J8NA 3GU5A 4O6EA 1QL6A 3GI3A 2WXVA 4JL9A 4AW5A 2X4ZA 2BDFA 2W1IA 4MEDA 3RZBA 4QNYA 5BYYA 1VJYA 4IWQA 2DYLA 2HW6A 2KTYA 3KXXA 2C6IA 3FLSA 4UWYA 3EQDA 3FQEA 3DBCA 5K5NA 3NX8A 4CFXA 2OJGA 3OTUA 4BBFA 3EYHA 4WBOA 3ZBFA 1T45A 4ZSAA 2PVMA 2ERKA 1PYEA 2CKEA 3I6WA 3VJOA 4RFYA 4FSTA 4BHNA 3GEQA 4C0TA 2WB8A 5HLNA 3CGFA 4L44A 3LFSA 5JN2A 2C68A 4JRNA 3Q96A 3OF0A 4A4LA 5CXZA 4O0RA 3A2CA 1H07A 2RIOA 4HCVA 1F0QA 5FTQA 4IWOA 3FYJX 3REPA 4PPCA 3R9OA 4EK6A 5K9IA 3KK8A 2X9EA 2XUUA 5I4NA 4C2VA 5AR5A 3NDMA 3CKXA 5K4JA 3Q9WA 3AGMA 3PFQA 4RIYB 3WF7A 4CNHA 1PMEA 2LAVA 4YJVA 4E20A 5E7RA 5L3AA 2E2BA 3EL8A 3QA8A 1PY5A 4D2RA 3AT4A 2BZKB 2W1FA 5CNNA 3BYOA 4J52A 2G01A 3R7EA 3V3VA 1X8BA 2BALA 3GQLA 3ZDUA 2R7BA 3MPTA 4F09A 5GJDA 4HYIA 3VS1A 4BICA 4U5JA 1U59A 4KBCA 3CXWA 2GS2A 3QZFA 1ZYJA 2UZEA 5JRQA 2BIYA 1BLXA 2BAKA 3DGKA 4Z7GA 4MXXA 2XNEA 4AAAA 4C2WA 1UA2A 3VQHA 4TKSA 4Z3VA 4D1ZA 4YJTA 4GV1A 3DTWA 4YSMA 2HAKA 3JR1A 3P23A 5JT2A 2CCIA 4JAJA 4A9UA 4Z55A 2AC3A 4RIXB 5AIKA 1A06A 4BCPA 4GUEA 2J51A 5CX9A 3OY3A 1BI8A 4E8AA 3EN4A 2EB2A 4F0FA 1J1CA 4KBAA 2BMCA 2DUVA 2B4SB 3TTJA 3VAPA 2OF2A 5L6OA 2OI4X 3QUDA 1A9UA 4AZSA 4M8TA 2XIZA 2VTTA 5E8TA 2H8HA 5H8EA 4IM0A 5J9LA 1OVEA 4RA4A 4RGJA 3UNKA 2WHBA 2JEDA 1H26A 4KKGA 1ZMUA 3S00A 4F6UA 4HPTE 4OTRA 5LOHA 2W9FB 3LJ2A 3PXFA 4Y85A 3ZH8A 4UMQA 5AP2A 3FLWA 4MBIA 4BCQA 3BLRA 3O7LB 2OBJA 4XRLA 3CC6A 3R8LA 4EOSA 5BNJA 1ND4A 1UWJA 4L6QA 1Q99A 4EUTA 4D4RA 4XG6A 3QUEA 3W18A 3ENMA 5B0XA 3E64A 4LMUA 4JBPA 2B7AA 3MESA 3PXZA 5E8SA 2VTOA 5BUJA 4V05A 4FEWA 2XEZA 2HELA 4FZ6A 1QMZA 5IQIA 3D5UA 2F49A 3KXZA 3OEZA 4AT5A 3CKWA 4TNDA 4HGTA 3VBQA 3LFBA 3L8PA 3FLNC 3HP2A 3DV3A 4O0VA 5F9EA 4W4WA 2VO0A 4RZVA 3DBQA 3VHEA 2PVKA 4DEAA 3TUCA 2GQRA 3DXQA 5C4KA 1UNLA 2B9IA 3OCSA 3A7JA 3LXPA 1ZMWA 3UVPA 4K8AA 5LMKC 2ACXA 4U44A 4AA0A 3G0EA 5LVNA 4DG0E 4J95A 3Q4ZA 4HCTA 4I22A 5HBJA 1DS5A 5M56A 3A4OX 3HNGA 4FV7A 2XKEA 2PVHA 3E8CA 5AV2A 1PMVA 1UU7A 3H30A 2CKOA 3EFLA 2I7QA 5LMBA 3BV2A 2NNWB 4R77A 3WZKA 1MQBA 3OCGA 4A4XA 4WKQA 4AOTA 4J98A 4IVAA 3L9NA 5IKWA 4D4VA 3PIYA 5EQPA 5AV0A 5CU6A 4BZNA 5CU2A 1H8FA 4NTSA 3O50A 2X4FA 1GIHA 1ZYSA 3COKA 2Y9QA 3QXOA 4W9WA 5EM6A 4XNEA 2YFXA 3CTJA 4PV0A 3MJ1A 4ONAA 3BYMA 3HP5A 3P79A 4EH6A 2QHMA 4G3CA 4NKAA 4RJ4A 4BYIA 4AE6A 3NR9A 4RIOA 4E4MA 4HVGA 2EWAA 3UZTA 4LRKA 4HYUA 3QTWA 3VS3A 3LFEA 5HD4A 1H1WA 3LFCA 3O8TA 4I6FA 2WTJA 4XP2A 3D5XA 3HKOA 3DB8A 4I0SA 5I9ZA 4I6BA 2KULA 4BTJA 5DIAA 3R28A 3QKLA 3ODZX 2ITOA 4FTIA 4M0ZA 2RFEA 3KULB 5AA8A 4B9DA 3MS9A 3CCNA 3PE1A 1CKPA 1E1XA 4FEVA 3IDBA 2C0TA 4KIOA 4M12A 5ANKA 4LRJA 5IISA 3GP0A 4YJNA 3C1XA 4DA5A 4D5KA 4CZUA 5J9YA 3MTLA 2WMBA 2QG5A 4KIQA 1NVQA 3ROYA 3OOMA 2PMLX 4ZY6A 5D41A 2X7FA 3Q52A 1JPAA 4KNBA 2FA2A 3OWPA 2B9FA 2XK4A 4FV4A 1UU8A 4FV1A 2H6DA 4O6LA 4QYGA 4S33A 5CSVA 3HV5A 4DG2E 4BCJA 5ITAA 1YHSA 3LFAA 4BIDA 5KBRA 3QZHA 5AA9A 5AEPA 3FMKA 3VUDA 4GFMA 4WA9A 3UO6A 3R2YA 2BDJA 4E93A 4EWQA 4FKUA 2PVJA 3O0GA 3LAUA 5JGAA 3EHAA 3MFSA 1ZARA 3LXNA 4YPDA 2PMIA 4TWCA 3UC3A 1VR2A 4DH8A 2PULA 3BHTA 4EOMA 3MFTA 3TG1A 2VU3A 4HPUE 1LEWA 3FI3A 5AP4A 5EW3A 5HKMA 4QTBA 3F9NA 3TKIA 4K33A 1K3AA 4I5HA 2OJIA 4BZOA 4YZMA 2BHEA 3R01A 1YI3A 4J1RA 2ITQA 3QTIA 3DLZA 1U4DA 4AZWA 3BU5A 3Q9ZA 5L2WA 3VW6A 2WQBA 4C62A 4L8MA 1Q24A 2ZVAA 3HDNA 2YWPA 5CF6A 2CNQA 2YM5A 1XBAA 4G9RA 5ANDA 4QMYA 4BGQA 4PDSA 5B7VA 4EH8A 4XBRA 4XOZA 2BROA 4M69A 4NM5A 4NYEA 3ROCA 5EKOA 3FLZA 3RM6A 1FQ1B 4JLCA 4TYEA 1CKJA 5IUHA 3PVWA 4M14A 4XS2A 2XNGA 4YTFA 2X0GA 3MDYA 3OP5A 3GC7A 4O0UA 5M53A 2YIRA 3PVBA 2IVVA 2R3IA 5BPYA 1ZYDA 4ORKA 1OZ1A 3PIZA
chains in the Genus database with same CATH superfamily
5HCZA 2WNTA 5LARA 5I9YA 3LMIA 4L52A 4UMUA 2VWUA 3R7GA 5L8KA 1YXSA 3WYXA 2JAVA 2UW4A 3POOA 5HORA 2G2FA 1M2QA 3K2LA 4WD5A 4DEHA 3RZFA 4EOOA 5AADA 4X2FA 4KS8A 3TKHA 2XJ1A 4LGHA 4LV8A 5B2MA 3D0EA 4L7SA 4O7ZA 2XIKA 2CN8A 4NEUA 4AXFA 5HE3A 3QTQA 2XAOA 3GUBA 4BC6A 3KC3A 4CV9A 1YWRA 3F3TA 2QR8A 3D5VA 2IJMA 3ORMA 3PLSA 4PX6A 3HA8A 5F20A 2XK7A 3KXGA 4AS0A 2ZV9A 3QX4A 3ZXZA 4O4DA 3E3BX 1FOTA 3IDPA 3COHA 4A9TA 3EB0A 4AN3A 3W2PA 3W16A 3ZFMA 2IN6A 1LP4A 4TT7A 4JJRA 2YN8A 1Z57A 4ITIA 2A1AB 5DR6A 4E6DA 4EHEA 5KMIA 1W2FA 4X3FB 4EH9A 4FSWA 4D9TA 5KHWA 3QTRA 4M66A 3ZLYA 2W96B 4BL1A 2FSMX 4DC2A 4FIJA 4K1BA 3LFDA 4U80A 2JKOA 4YLJA 2R0IA 3KK9A 3MY0A 5HE0A 3VF9A 4XEYA 4CKIA 3I7CA 4EI4A 4X7QA 5ANJA 4J97A 2F7XE 3RM7A 3R9DA 2WMRA 3E62A 5IG1A 2Y7JA 3FZSA 5HNGA 2CGVA 2J5EA 3UE4A 1Z9XA 4ZK5A 3OW3A 5CASA 4BTKA 1UV5A 2W0JA 5ANOA 2YCRA 4OW8A 4YLKA 1Q4LA 2Z7SA 1CMKE 3EKNA 2FVDA 5I9WA 1YQJA 3FMDA 5HIEA 4KKHA 5JSMA 4DCAA 5CU4A 4K77A 5I9XA 2JDSA 2UZDA 3AGLA 4GYIA 4AACA 3QWKA 2I0VA 4FKQA 4E4XA 3OROA 3ODYX 4GYGA 3NVMB 2W4JA 3BI6A 3R02A 4BY9E 2Y4IB 2QD9A 4GG7A 3VNTA 2VNYA 2WMQA 2XNOA 3PJCA 2R3OA 4RRVA 3V5WA 2OU7A 2WOTA 5C1QB 3F6XA 4L45A 4O22A 3EFWA 5EK7A 3V5TA 2QG7A 5HCYA 2W05A 2VV9A 1IAJA 3C5IA 4JS8A 5A3XA 5JH6A 4XG2A 3MBLA 4MBLA 5KE0A 3RMFA 3ZM4A 5M4CA 3LVPA 3BBTB 3R9RA 3TCPA 3NUXA 4G31A 4X3FC 2B55A 3IOKA 3VRZA 4FT0A 2YIQA 3CY3A 3AG9A 4MXZA 4EZ7A 1PXJA 2G15A 3KMWA 3NYXA 1OECA 5CEMA 4IAAA 4U7ZA 2Z7QA 2XNPA 1XBBA 3GC8A 2UVXA 3ZLWA 4NU1A 3ZC6A 3NPCA 3BYUA 1SVHA 2ZM1A 3Q4TA 5DRBA 3OBJA 3ORXA 5HVJA 3ULZA 1UNHA 5GNKA 4N70A 2WMUA 3I4BA 3R21A 3B8RA 4AXAA 3U6HA 2YM7A 4XG7A 4YUQA 1U54A 4IAYA 2NO3A 2C1AA 2IZUA 5I5ZA 4F9AA 5EHYA 3UPXA 5M55A 3CPBA 3FZPA 4FKWA 1DAWA 1WBPA 1LPUA 3O17A 1YDRE 4MF1A 3ZRKA 3NYOA 4L9IA 4QTDA 3G0FA 5L6WL 3OW4A 3QAME 4CCUA 4PMMA 3LQ5A 4C37A 3BHHA 2Y4IC 3MSSA 3TUBA 2GTMA 1YRPA 4JOAA 5K0KA 4CZTA 3ATTA 3NCGA 4PWNA 3UP7A 3P5KA 2ZV8A 3ZDIA 3Q5IA 5HQ0A 3VC4A 3QTUA 4MXYA 2HY81 3OHTA 4IANA 3KA0A 3UNZA 3W2RA 4ASEA 2GQSA 4G3FA 5LMAA 5HE1A 3PWYA 2B9HA 5J7HA 2BDWA 3PIXA 3DAEA 3Q4UA 3FXZA 4F1OA 4F99A 4AWIA 4L67A 4E6AA 3PZHA 3CIKA 3FSFA 3MTFA 5HTIA 4FV2A 4GU6A 4HZSA 3ZU7A 4IX4A 5JFXA 4CGAA 4F6WA 2UW9A 4I0RA 4DTAA 4PDOA 4IAIA 4D1XA 3I0QA 4ZIMA 3PDTA 2ITUA 3UOKA 4U42A 1URCA 2C3KA 3QGWA 3QCSA 3L9MA 3EQRA 3SG8A 4FVQA 3PFYA 1CKIA 4MXAA 4LL0A 4JVGA 1XQZA 4MHAA 2VAGA 4XG3A 4YO4A 5IQBA 4BGGA 3P08A 3NIZA 4HGLA 2A19B 3RPYA 5IDNA 4BDDA 3RINA 4HOKA 1PF8A 1ZMVA 2J4ZA 1IRKA 2WTKB 3D2IA 3EFKA 3IGGA 3MIAA 3TWJA 5KHXA 3TDVA 4FL1A 3I79A 4FV6A 3W8LA 3OCTA 4FUYA 2RSVA 3RK5A 2FYSA 2XF0A 5A54A 4GIIA 2ETRA 3IK3A 5FQDC 2XRWA 1GJOA 2OGVA 1PMUA 4R1VA 4FVRA 3A8XA 2WQOA 3EFJA 5IF1A 4FV0A 2WQNA 1OIQA 4LGDA 3UOHA 3ITZA 2WKMA 4OLIA 1M17A 1NA7A 2R3HA 4UV0A 4PNKA 1Q8YA 1ZOEA 4FTOA 1NY3A 4MWIA 4AQKA 1GNGA 2YABA 4XHKB 4PPBA 2YWVA 2OZAA 1PYXA 4F0IA 4FODA 1U5RA 2VD5A 3EQGA 4LOQA 5LVLA 4IZYA 4QMWA 2PZ5A 4IB1A 4HVSA 1O6KA 4FK3A 4IWDA 4NTTA 2GMXA 1FMOE 3H0YA 3HLLA 3PG1A 4ZSEA 3ELJA 5EYKA 3TNHA 4RFZA 3UGCA 3VS2A 2IPXA 2IO6A 1GIIA 5CQWA 1Q5KA 3ZMMA 4E73A 3QYWA 4R3PA 5DE2A 2UZOA 1H1QA 3HEGA 4YHTA 5C03A 5TF9A 5IA3A 5E8WA 2O0UA 3TJCA 4HVHA 4XCUA 1NW1A 4Z7HA 1XHAA 4Y5HA 4GH2A 1M2RA 1ZLTA 2IVSA 3H9RA 4LV7A 4IQ6A 1YDTE 1XH4A 3C0HA 2IVTA 4MNFA 4YO6A 4B4LA 4E26A 5KX8A 1B38A 3RTPA 4IMYA 3EQBA 3FC2A 1WVYA 4UEUA 4O7NA 5ETCA 5CENA 1WVWA 3KRXA 4LM5A 4WUAA 2G2HA 4IZAA 4C38A 4FOBA 5D10A 3AC2A 1YWVA 4EUUA 1U5QA 1Y6AA 2Z60A 4U0IA 4OTQA 3VUKA 3P9JA 4GG5A 3E7OA 3U6JA 2IZTA 2X7OA 4AFJA 2R5TA 4AT3A 3FE3A 4UYAA 4ZLOA 3R83A 3Q5ZA 4FJVA 3UIXA 4EC9A 4ZJJA 1ZOGA 1VLRA 4NCTC 5LQFA 4QMQA 4E6CA 3RPSA 2PVYA 2UV2A 4BYJA 2R3QA 4FYNA 2WIHA 4D2VA 4EC8A 4F1TA 4ZTLA 3U51A 3ENHA 4YZDA 3R30A 5AV1A 4DEIA 1LR4A 2R7IA 4ZEGA 1W84A 3PA5A 4O7YA 4FV9A 3TV7A 4MYGA 5M44A 3R7VA 2UZUE 1ZY5A 2WIPA 2XK8A 4S32A 5BYZA 4BCOA 4GS6A 3QUPA 4ZJIA 4DDIA 5J5SA 4Q2AA 5D7AA 5AV4A 1GAGA 2BR1A 5ETAA 1YI6A 4FKLA 4G9CA 2BRGA 4ZAUA 4WNMA 1W2CA 4DTKA 3LQ3A 3IW5A 3VUIA 2XALA 4E5BA 2JBOA 4G6NA 3EQHA 4ACHA 2Y0AA 3DK6A 4NFMA 3V5PA 3R6XA 1MQ4A 3HDMA 2QO7A 5J87A 3VWAA 1OKZA 3E7VA 2YITA 4F6SA 2YAAA 2RF9A 4BI1A 4AXEA 3L9PA 4GJ2A 3BL9A 4XOYA 4BN1A 4ZS0A 2BFYA 3UZPA 5IQEA 3HAVA 5KMLA 3PSCA 4WG3A 5BVEA 3COMA 5AM6A 2VTMA 4R78A 3UO5A 1ZAOA 4B6LA 3V01A 2O8YA 3F5GA 3QC9A 4FKGA 3V5LA 3A60A 2FSTX 1H08A 5E8UA 1YXUA 4LOPA 2XBAA 1ATPE 4O7SA 5HCXA 5AJQA 1UU9A 3G2FA 4Y46A 3A7IA 3AMYA 3DDPA 4EJNA 5HTBA 3QRTA 2V55A 3K5VA 3FPQA 3LLAA 4QT1A 4GKIA 4I4FA 3SRVB 3I6UA 5CU3A 5DI1A 5HO6A 5TR6A 4EHVA 3QYZA 4W9XA 4Q5EA 2X9FA 3FXXA 2O2UA 3I60A 3JVSA 4KIPA 4WRGA 3NMUF 4QTCA 2FUMA 2ZV7A 1VYWA 1NVRA 3PPJA 2G9XA 3QZGA 4FKIA 3NSZA 4IFCA 4IZ7A 4M97A 4Y72A 3T3UA 2HOGA 3PUFC 2EVAA 1DM2A 2ZMDA 1PXLA 4ACGA 1OL7A 5DH3A 2IZSA 3VUMA 4EJ7A 1GZNA 3DNEA 3AOXA 2XA4A 2GHLA 5BMSA 3PSDA 4I5PA 4EOKA 1XWSA 2X8EA 3DCVA 4EH7A 1YI4A 1OPJA 3VS4A 4CSVA 1URWA 3BYVA 4P2KA 5H9BA 2PE0A 4BIBA 1JOWB 2I0EA 5EM5A 4D2WA 3W0MA 2XJ0A 3DKGA 3ERKA 3LFNA 3CJFA 4ANBA 5HZNA 3P7AA 5HNBA 4CG8A 3E8DA 3TV4A 5IDPA 4TZRA 4C61A 4A07A 4RJ8A 3RALA 3ZYAA 5BUIA 4IB3A 4KIKB 3FEGA 3MH1A 1KUTA 2VRXA 3DDQA 4HCUA 3KMMA 2PWLA 4PMTA 1W83A 4FV8A 4RPVA 1OPLA 3KXMA 2RFSA 3AMBA 4PRJA 2ZM4A 3VS5A 5FM3A 2G2IA 3MA3A 1OGYA 2QOQA 3F7ZA 5TO8A 3UMWA 1IA9A 3HUBA 4FKSA 3OWKA 4EONA 2EB3A 1YHWA 4RVMA 4OBOA 3M42A 3TIYA 3HRFA 2GS6A 2CKPA 4CV8A 4BI2A 3F5UA 3IS5A 3JYAA 3W32A 1JSVA 2Y6MA 5CVFA 4DFLA 5HGIA 3NUYA 4KD1A 4TYHA 4G2FA 4IJ9A 4YLLA 3VS0A 2IW9A 5KMNA 3H4JA 1QPDA 4FC0A 3W0NA 3ORPA 3Q9XA 4AW1A 4AZVA 5DYJA 4H3QA 2QC6A 5CSXA 5CAVA 2C47A 3DQWA 2IVUA 3W8QA 2P33A 3UQCA 3OWLA 3DB6A 2WTWA 4LRMA 4FTKA 3QRKA 4U79A 4YMJA 3CP9A 3QQKA 2OXDA 3UJGA 4ANSA 3FJQE 2CNVA 4ZXTA 4YBKA 3FKLA 2Z8CA 2V7AA 5H2UA 3DKOA 5IH5A 3QLFA 2QOOA 1CM8A 1H1PA 4GFOA 2BRNA 3DBFA 1PXMA 5TE0A 4WIHA 1M7NA 5EI2A 2R4BA 5HLWA 5IPJA 3LE6A 1YOLA 2YIYA 2UW5A 4QMNA 1XH9A 1MRYA 3DT1A 5KMJA 3C7QA 5GZ8A 1H01A 2BIKB 4ZP5A 3FL5A 3DLSA 3WILA 2A4LA 4XJ0A 2UZNA 4W4VA 3W2QA 2F2UA 4BF2A 1Q3DA 4F4PA 3D7TA 2UZVA 3FBVA 2ZOQA 4RQVA 2C69A 4IXPA 4CFFA 2Q0BA 3ZXTA 2VTQA 1WBWA 4RWKA 1SM2A 4XV1A 2XNNA 5CF5A 5CZHA 3VW8A 5AP0A 5A46A 2XAMA 3TZ9A 4ZTRA 3MY5A 2JKKA 2CCHA 2X81A 4RWLA 4D2TA 4CRLA 4DEEA 2I6LA 4L68A 3F5XA 3RVGA 3V8SA 4BFMA 2GNJA 5DT0A 4A9YA 1O9UA 3PJ1A 4MD9E 4UN0C 4MNEA 3OZ6A 5A6OA 3SXRA 3FMMA 5EQYA 2WEVA 1XO2B 4FTRA 2OH0E 5J95A 3VS7A 3ANQA 4IM2A 1YOMA 3B2TA 1Y6BA 4U81A 4WSQA 4EWHA 1Y57A 3IW8A 3AD4A 3OXZA 4EKKA 3PXRA 5CEIA 4FMQA 1NT2A 1OIRA 1H1SA 5T68A 3EWHA 4F70A 2GFCA 2J7TA 3TI1A 4RA5A 1JQHA 5A4EA 4DITA 4IADA 2J90A 4USFA 3LM5A 3OTVA 5KZIA 4G34A 5CVHA 2I1MA 3QRJA 3R8VA 2ZDUA 4ACCA 3AC4A 4I93A 5AX3A 2BKKA 3JXWA 5FWKK 4UMPA 3FAAA 1H25A 3SOAA 4EKLA 4DF3A 4IEBA 4IC7A 3F3UA 4RVKA 3RK7A 3N4VA 3DS6A 4L42A 2ITWA 5C27A 4NIFA 3KN6A 5HIBA 2VWBA 3PVUA 4R1YA 5AUYA 4AUAA 2Y8OA 2PHKA 4TRLA 3VHKA 4LMNA 3KKVA 2VTJA 3E5AA 5HICA 5AP7A 1NVSA 2GHGA 1OKYA 2YM4A 3W0RA 2A2AA 2BRMA 2P0CA 4FKOA 4RX5A 1HOWA 4X2JA 2GFSA 4L3JA 4QMPA 3KGAA 3VUTA 2QR7A 4QYEA 3TTIA 1FMKA 1K2PA 4Z9LA 3MY1A 3LOKA 3QRUA 4QPSA 4K2RA 5J79A 4OBPA 5KNJA 3RI1A 5C01A 3BCEA 4YU2A 1G8JA 4L3PA 3UP2A 4JRVA 3RCJA 3SDJA 5IQAA 3AC1A 1O6YA 3QCYA 2VX1A 2W9ZB 3A62A 4O4CA 2FSLX 4YTCA 2JIVA 4APPA 1V0OA 4AW2A 3GVUA 4FRFA 5D1JA 4PNIA 4AGUA 3ORLA 4F78A 5M09A 4U6RA 4E5AX 2OIDA 1ZRZA 2W5BA 2BHHA 4E5WA 3PWDA 1AQ1A 3QQFA 3CGOA 5HU9A 3R63A 4AXDA 4PMSA 3RHKA 1Q8ZA 3GCSA 4X2KA 1TQIA 2BAJA 2JDOA 2WU6A 3LCSA 1MP8A 3NFGB 3MGYA 3K3JA 1H4LA 4NT4A 4NL0A 4FKJA 2WZJA 2ITXA 2JFMA 5IQDA 3N9XA 5CF8A 1BL6A 2BZJA 3TDWA 3G33A 4YNEA 3OY1A 4JG6A 3S2PA 3SA0A 2PE2A 4PPAA 4FOCA 1F3MC 5EG3A 4BR3A 4JX3A 5CYIA 3MVJA 3NW5A 4UY9A 4AT4A 2PUUA 2OKRA 4FNZA 4KRCA 4APCA 4H3BA 1QPJA 3GCVA 4GVAA 4IZ5A 1PXIA 2O63A 3IQ7A 3UYTA 4QQTA 2OW3A 3CBLA 3ORNA 2C6LA 2NP8A 3LKMA 4XMOA 3F7WA 2XYUA 4QMOA 3OOGA 4NKSA 3O23A 3A7FA 4JBVA 4X6RA 3ZS5A 4K0YA 4NJ3A 4F0GA 5C8NA 3FQHA 4RX9A 4EK4A 4M7IA 5EDRA 4ZTQA 3OC1A 2UW7A 3GFEA 2ZV2A 2VTIA 3PXKA 5L2SA 4RIWB 1XH5A 4Y5QA 1KE8A 5D9HA 4IFGA 4BB4A 2BRBA 4B99A 3A4PA 4BDBA 4DEDA 4FSNA 4LDTA 3FWQA 3ORTA 4HGSA 5DFPA 1PXPA 2WMWA 2XM8A 2GU8A 3DTCA 1JVPP 3F69A 4YC8A 1OB3A 3Q4CA 2UW8A 3NW7A 5JRSA 4MF0A 4FIFA 4R5YA 3WE4A 4AOJA 3GCPA 4QMSA 1B6CB 2UVYA 3HMIA 4IW0A 4MQ1A 3WF6A 3NNUA 5IMXA 4O7RA 3W0OA 4FVPA 4N6ZA 5LWMA 5AIRA 1QCFA 4UMTA 4N4SA 5DEYA 5ANIA 4CKRA 4IB0A 3JPVA 3PE2A 4IB5A 4RX8A 3EKKA 2QOIA 4AE9A 4AZTA 2XH5A 5EYDA 1W7HA 3NNXA 4EK5A 3V5QA 2VTLA 2CGUA 4O81A 4G1WA 4G3DA 2OSCA 4RC3A 2Q83A 4E6QA 3GXLA 3OG7A 1RW8A 5ACBC 3TUDA 2ZJWA 5DBXA 5G1XA 3LIJA 1JSUA 5JQ8A 2DWBA 5DEWA 5E91A 4F63A 3F2RA 2YDIA 2IF8A 5FEEA 3LXLA 3R9HA 1OMWA 2CLQA 5AR2A 2OK1A 4OAUC 4RIXA 1BYGA 2O65A 3U4WA 4GK2A 3TNPC 3DY7A 2ZB1A 5FGKA 4CLJA 3KF7A 2VWVA 4PTEA 3TACA 2ZM3A 3UDSA 4V04A 2Q0NA 5FXRA 4K11A 3F3WA 3WF8A 2C3IB 3R1NA 3WZUA 4WOVA 2UUEA 3MVHA 5D12A 3UVQA 5I9UA 4R7BA 3C50A 1Q8UA 3D15A 1K9AA 4QQCA 2W1HA 5ICPA 3BWJA 3D9VA 5FXSA 2ONLA 3I7BA 4HVDA 5GINE 4D0WA 5HBHA 5AP5A 4F7NA 3OS3A 3VS6A 2CHLA 5DVRA 2C3JA 3DFAA 2V5QA 2X2MA 3BEGA 3FMLA 4IACA 4FE2A 2JIIA 4NM7A 2DQ7X 2QLQA 1SNXA 1OUYA 3RNIA 4H39A 4H3PA 3FL4A 3B2WA 4FBXA 4I1ZA 2OXYA 2P3GX 2UW6A 4MBJA 4CMTA 4CTCA 1Q8WA 4FK6A 1J7IA 3FMJA 3BLAA 2QOKA 4WBBB 2C6MA 2W5HA 2BUJA 5AP1A 3DFCB 5FP6A 3PXQA 4QP6A 2VTNA 4L46A 1ERKA 3KN5A 4XYFA 4WHZA 3W2CA 5DR9A 4D5HA 3O8UA 3UIUA 4AGCA 4AA5A 3L9LA 4CXAA 2Z7LA 3MH2A 4FTMA 3U9CA 4X6QC 3TL8A 4OTIA 4I5MA 3ETAA 4WNOA 4CMOA 4EQUA 2OZAB 5E1EA 3NIEA 1RE8A 2EXEA 3FZ1A 3R8ZA 2YERA 2X8DA 5EYMA 5IUIA 5CY3A 2W4OA 4YGAA 3GU6A 4QNAA 4Z16A 5KZ0A 3DZQA 2QO2A 5FTGA 3NVKI 1GY3A 1UKIA 3ZCLA 3TNWA 2X7GA 5A14A 2ZMCA 1Y8GA 3BV3A 3QFVA 3IONA 4FF8A 3C4ZA 4JT3A 4PL4A 3EQCA 1ST0A 2XK3A 4NK9A 1SMHA 4MX9A 4C4GA 3PTGA 2YM3A 3ZUVA 3GQIA 3QD0A 4ZZMA 3FI8A 1JKTA 3FXWA 3KRWA 5CSHA 2OIQA 4GK3A 3MYGA 2NPQA 4RJ3A 5F4NA 4LGGA 3DPKA 5A4QA 3NW6A 3R71A 3OUKA 4M15A 3Q32A 4TW9A 2X8IA 2HYYA 4BCKA 2R3KA 4ZOGA 4FG9A 2VTPA 5EOBA 3ATSA 4TYIA 4JQEA 3PYYA 4AZFA 2VGPA 1VYZA 4O0TA 4DGMA 3FZOA 3LCDA 3N4TA 1MRUA 2XK6A 4KABA 3PZEA 5HD7A 2XCHA 4E4LA 4EZ5A 4YZCA 4FSYA 3ET7A 4L3LA 4O2ZA 5BQ0A 4JX7A 5CANA 5HLPA 5JGBA 2OWBA 2HZ0A 2JLDA 3HZTA 3KULA 4Y73A 3OVVA 3GCQA 3ZSIA 2HWOA 3PG3A 4FSZA 4W4YA 1G8AA 4O7WA 3GCUA 3I5ZA 4BTMA 5J1VA 5FM2A 1Q97A 2C5NA 5C26A 3QD2B 3DQXA 3JS2A 4K9YA 4IBMA 4CQEA 1JLUE 2P4IA 1Y8YA 4FSQA 3O51A 4KUJA 1I44A 3FQSA 3MW1A 3NEWA 3KF4A 4R3RA 4ZMEA 3UIMA 3W0PA 3SGCA 1KSWA 4PY1A 3DJ7A 3G15A 3RWPA 4ZTNA 4FEXA 3EQFA 3WZEA 4OTDA 2ETKA 3BLQA 4V01A 4AFEA 2CSNA 4O0XA 3G5DA 2X2KA 5DG5A 4U3ZA 4CYIA 4MK0A 2GNHA 3VIDA 3QC4A 5AUVA 2XKCA 4BVUA 4RG0A 1A48A 5EI8A 5C8MA 2UW0A 4IDVA 2RG5A 2PVNA 2BFXA 2QOCA 2RGPA 4C35A 3EN5A 4O4EA 4P5ZA 2WMXA 1XMMA 3PPZA 5DT3A 3PSBA 2A98A 4S34A 4XP0A 5DNRA 5HG9A 4O82A 1TFFA 2UZBA 2Y6OA 5FTOA 4ARKA 3R7IA 4BI0A 3KXHA 4IX5A 1YWNA 4M84A 3S4QA 1XJDA 2YDKA 4N6YA 5FXQA 4O86A 1BX6A 3S95A 2R3JA 3H3CA 4UWBA 4RZWA 3ZOSA 4QOXA 2NRYA 3POZA 5EH0A 4NH1A 3EMGA 5CVGA 5DRDA 5AV3A 5A9UA 3LPBA 5AM7A 2WTVA 3VQUA 4FTJA 3V5JA 4FT3A 2R3MA 1OPKA 3E3PA 3C9WA 4FT7A 3H9FA 5I3OA 4CQGA 2XB7A 4AX8A 5I3RA 4DHIB 3QQLA 2AEGA 4TWPA 2EUFB 3FI2A 3GU4A 4HJOA 3AKLA 5IU2A 3ZO4A 5JGDA 3MH3A 3CQUA 4DFUA 3F3ZA 5HG7A 2GNFA 4D4SA 3V8TA 4EQMA 5K5XA 5HIDA 4TYJA 2AC5A 2VWXA 4YTHA 5LVOA 4C3FA 3F2AA 3L8VA 3O7LD 5JZNA 5LVMA 4NM0A 4M13A 3WZDA 5HESA 1YW2A 3ZEPA 2PL0A 5E8VA 3BGQA 4H36A 3G6HA 3VN9A 4G16A 4C58A 3Q60A 4U9AA 5EYCA 2PUNA 3U87A 3KQ7A 3UQFA 2XM9A 5AWMA 2EXMA 3NRMA 5HX6A 2QU6A 1FGIA 1TKIA 4LG4A 5BV3A 4DFNA 3G51A 4WG5A 5ANGA 4U3YA 5E1SA 5J5TA 1WBNA 2I0HA 4EQCA 2ZAZA 3PY1A 4TL0A 4QEBA 4FNWA 4HZRA 3Q6UA 2CLXA 4FIIA 5C4LA 3FY2A 4ZTSA 4CTBA 2VWIA 1JKKA 4UB7A 4CCBA 5L2QA 4JR7A 4R3CA 3W0QA 3QCXA 3K54A 2C6EA 5GJGA 1WVXA 3RAHA 5AP3A 4ASZA 1UVRA 4LYNA 2B1PA 2HY0A 3FSKA 3QTZA 4V0GA 3NAYA 3TT0A 4CYJA 4MWHA 4EORA 2XBJA 3NFFB 4II5A 4X3FA 3VBVA 2OJ9A 5L2TA 3P5JC 5HVYA 4FL2A 4IVBA 3HV3A 3HUCA 4JBQA 1P4FA 2B52A 4TNBA 4Y95A 4AG8A 1OKVA 2ITPA 3CTHA 1KWPA 3BEAA 3C0IA 3MN3A 4IAZA 4C4EA 4RLLA 3RCDA 4RSSA 1S9JA 3OMVA 4AF3A 3Q2JA 3WF9A 2F4JA 3BHVA 1OBGA 4GVJA 2PZYA 5BVOA 3ZONA 1J7UA 4QMXA 5FDXA 3I5NA 3Q53A 3IW4A 4IIRA 2Z2WA 4E4NA 4EBWA 5EQEA 3MB6A 4PDYA 4CZYB 3HVCA 3F82A 1GZKA 3S3IA 1XH8A 3U6IA 4DLJA 3P7BA 4XP3A 4D2SA 3BYSA 3KMUA 2JFLA 5JFSA 4PL3A 2F57A 5L8JA 3TZ7A 3OT3A 3OBGA 4ZSGA 5KMOA 4IH8A 5CAOA 4FKVA 3BQRA 4YC6A 4M68A 3DU8A 3SLSA 4NW6A 4EYJA 2GHMA 4DG3E 4YHFA 5CWZA 3P78A 5CT0A 4QDEA 3RPVA 3DOGA 2RFDA 3NAXA 5EFQA 3SC1A 4JIKA 3C51A 2UW3A 1OL1A 3HYHA 4USEA 5LWNA 1PRYA 2C5XA 4GRBA 1HCKA 1M2PA 4M0YA 4HYHA 4CT2A 5IA5A 5LXMA 4FR4A 3I0OA 3MH0A 4H1MA 3TZ8A 3S0OA 4MQ2A 2RL5A 3HMMA 5EDQA 4CFWA 4MUQA 4DGNA 4ZLYA 2F2CB 4FSRA 3AC8A 3P1AA 4I92A 4KS7A 5FRIA 3W10A 3DXPA 3CD8A 4IAFA 4L01A 5CEKA 4IAKA 4D2PA 1JSTA 3QHRA 3F88A 3WOWA 2QO9A 3TN8A 2R3PA 3OT8A 4GEOA 3VJNA 4DINA 3EZRA 3FZRA 3KXNA 2XNBA 2R9SA 2CGWA 2EXCX 5HI2A 3GC9A 4J71A 3UDBA 2R3FA 4I6HA 3WARA 3CQEA 4YZ9A 1OBDA 3CQWA 1Q41A 1R0EA 3ALOA 5M57A 2GS7A 3ZO1A 5E92A 4EOLA 4F7LA 3HRBA 2XIRA 4Y83A 5BVWA 4HYSA 2VTSA 5AR8A 3JY0A 1M14A 3NS9A 5IA4A 5KCVA 3KFAA 4BDKA 4JDHA 5T6KA 1W98A 2HXQA 2XEYA 3BPRA 3KRLA 3M2WA 4A7CA 2YCQA 3WIGA 1PXKA 5AUTA 1OIUA 2E9OA 2J0IA 3LFFA 4NWMA 4CMUA 1REJA 1FBNA 4AOIA 4JXFA 4BDIA 2PUPA 2WFYA 2QHNA 3NYVA 3QL8A 5T3QA 3VUGA 4BIEA 4BHZA 3VVHA 3IECA 5AR7A 4GW8A 3W55A 4GSBA 3V04A 1T46A 2OJFE 1SNUA 1V0BA 2W1CA 4GT4A 4O1OA 5JQ5A 2WGJA 4U8ZA 5BVNA 4FTQA 4XG4A 2XIYA 1KE7A 5DA3A 4C57A 2VNWA 5IEXA 4R6VA 2C5YA 3MVMA 4ACMA 5DGZA 2ESMA 4LUDA 4QP4A 2YCFA 2VGOA 3TNIA 4TYGA 1XH7A 3GOPA 4FIEA 3O5AA 3BL7A 4JBOA 4EEVA 2HZNA 2ITZA 4X21A 5F95A 2PMOX 2J0MB 5B2KA 4KSQA 5CQUA 2C5OA 4YJRA 3LMGA 4KBKA 3TZMA 5A4LA 4CT1A 4BDEA 1ZZLA 2R2PA 5M07A 5GJFA