The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
272
|
structure length |
260
|
Chain Sequence |
b'NLYFQGTIDDLFIFKRKLGSGAFGDVHLVEERSSGLERVIKTINKDRSQVPMEQIEAEIEVLKSLDHPNIIKIFEVFEDYHNMYIVMETCEGGELLERIVSAQARGKALSEGYVAELMKQMMNALAYFHSQHVVHKDLKPENILFQDTSPHSPIKIIDFGLAELAGTALYMAPEVFKRDVTFKCDIWSAGVVMYFLLTGCLPFTGTSLEEVQQKATYKEPNYAVRPLTPQAVDLLKQMLTKDPERRPSAAQVLHHEWFKQ'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of CDPK kinase domain from toxoplasma Gondii, TGME49_018720
rcsb |
molecule keywords |
Calcium-dependent protein kinase
|
source organism |
Toxoplasma gondii
|
molecule tags |
Transferase
|
total genus |
76
|
structure length |
260
|
sequence length |
272
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
2.7.11.17: Calcium/calmodulin-dependent protein kinase. |
pdb deposition date | 2009-08-25 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transferase(Phosphotransferase); domain 1 | Transferase(Phosphotransferase) domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |