3IS5A

Crystal structure of cdpk kinase domain from toxoplasma gondii, tgme49_018720
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
272
structure length
260
Chain Sequence
NLYFQGTIDDLFIFKRKLGSGAFGDVHLVEERSSGLERVIKTINKDRSQVPMEQIEAEIEVLKSLDHPNIIKIFEVFEDYHNMYIVMETCEGGELLERIVSAQARGKALSEGYVAELMKQMMNALAYFHSQHVVHKDLKPENILFQDTSPHSPIKIIDFGLAELAGTALYMAPEVFKRDVTFKCDIWSAGVVMYFLLTGCLPFTGTSLEEVQQKATYKEPNYAVRPLTPQAVDLLKQMLTKDPERRPSAAQVLHHEWFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CDPK kinase domain from toxoplasma Gondii, TGME49_018720
rcsb
source organism Toxoplasma gondii
molecule tags Transferase
molecule keywords Calcium-dependent protein kinase
total genus 76
structure length 260
sequence length 272
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2009-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3is5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3is5A01
2XYNA 5CZIA 4ZLZA 2ONLC 3F7WA 4LUDA 4WBOA 5CZHA 5K3YA 2VTLA 3PJ8A 3VBQA 4CNHA 3BGZA 3IPHA 4BTKA 3E8DA 5I0BA 4EH5A 1Y57A 4U40A 5KMJA 3VJNA 2YISA 4RJ4A 4BFMA 4WRSA 5FWKK 2WNTA 4XX9A 2LAVA 2RFNA 2QHMA 1H0WA 2W1GA 4E5WA 4UMRA 2GQGA 5KZ0A 4YZNA 4KBCA 4D1ZA 1JPAA 4FKQA 4P90A 3TZ8A 2C6DA 2CHLA 4YBJA 4YJPA 4C3FA 4C2WA 2W1EA 4BN1A 3KL8A 3PYYA 4PNIA 4QNAA 4WKQA 3MI9A 5IA5A 2WQEA 3LCKA 4FSMA 3N51A 3NYNA 3EN4A 4J1RA 2BZHB 5DOSA 3F2NA 4GJ2A 1ZZLA 3L9LA 1YKRA 4D2SA 5AR7A 4H3QA 1FQ1B 1TQIA 4K0YA 3MPMA 3PFQA 4AGWA 3PLSA 4EQMA 2FVDA 3BV3A 4FF8A 3SA0A 5AR8A 4DCAA 4KIQA 2XK8A 5CWZA 1OKZA 2R3RA 3QALE 4G3DA 3KA0A 2OWBA 3CCNA 2B55A 3OT3A 2CN5A 4V05A 3FSFA 4QYFA 3A61A 2X9EA 1OB3A 2JBPA 2Y7JA 3PRFA 5ACBC 5DVRA 3D5UA 2CKPA 5IISA 1Y6AA 1WVYA 4YURA 2ITZA 3SW4A 1MUOA 4CT2A 2ZYBA 1YOJA 2YITA 3KVWA 3HMOA 3R8ZA 4QYEA 5LMKC 1H27A 3OOGA 3OW3A 4XBUA 1DM2A 2GFSA 3Q5ZA 3EL7A 3UNJA 4MBLA 5A4TA 5I3RA 2PVYA 1ZMVA 2Z60A 4QTDA 1CKPA 4XMOA 1NW1A 3ZRKA 4GT4A 3JY9A 5JQ5A 2PVFA 2PZRA 3D5VA 1TKIA 4IANA 4BVUA 3ZBXA 1HCLA 2VTAA 3F88A 2FSMX 4W4WA 4XLVA 2QKRA 5HVKA 4RGJA 4XG2A 1YRPA 4X3JA 4Q9SA 3E93A 4N6YA 4R8QA 5F4NA 3MJ2A 2VTIA 2R0IA 2FUMA 2ITQA 4PTCA 4TYGA 4CRSA 1GZOA 4U0IA 3TNQB 3RM6A 5CQUA 2UZEA 3BGPA 4FIIA 5D7AA 2VWIA 5E8UA 2E9OA 2VTPA 4JBVA 4XV1A 4HJOA 4YJTA 3HGKA 2C47A 3F3UA 5DG5A 3IW5A 3UPZA 3U54A 4NM3A 2PMIA 1WAKA 2OXDA 2GHLA 2FO0A 3GC0A 1Z5MA 2X2LA 3DAKA 2XP2A 4HNIA 1H24A 4K11A 4FG9A 4I20A 5L8KA 2QHNA 4F1OA 4WNMA 1J1BA 4L00A 1PYEA 3ZYAA 3DPKA 1REJA 5ETIA 3F5PA 3PLAE 4CFNA 5LQFA 3DZOA 2YACA 3MPTA 4FSNA 4P5ZA 4EJNA 4X2GA 4I4EA 4OLIA 1MQBA 4GYGA 3V6SA 4OW8A 5DI1A 3QKMA 3OY3A 4CQEA 5J9YA 5A9UA 1SVGA 3BCEA 4S30A 3TXOA 1JAMA 2QU6A 3WBLA 4DFNA 4J52A 3KC3A 4HVSA 4FA2A 1CKIA 4R7IA 4R77A 1CDKA 4H1JA 3UIXA 2JLDA 3LMHA 4DE4A 3EFJA 1URCA 5JN2A 4HNFA 4OTFA 4GVAA 3VBYA 5JMSA 4PP9A 4GJ3A 3H0YA 4TZRA 2PVJA 5J79A 2CPKE 2WMVA 4BB4A 4ZSGA 2YEXA 4U5JA 5AP5A 3LFEA 3DGKA 5E91A 4FTQA 4B9DA 3FI8A 3COKA 3GQLA 5AR5A 2BFXA 1FGIA 3DXQA 2I1MA 3D14A 3IONA 4BIDA 4FEQA 4HOKA 3NUNA 4JL9A 3PJCA 4C0TA 4ERKA 5A3XA 2C1BA 3AC2A 4KIKB 3ZO4A 1H07A 3QYZA 4BCOA 3R1SA 2HELA 4C02A 4RA5A 3ZS5A 3BZ3A 4A4XA 2E9PA 3EQGA 1BUHA 2I40A 3CBLA 3W2QA 3T9TA 2X2MA 5HICA 3VBWA 4YHTA 4ACHA 4RSSA 4F6WA 2WTJA 3FZOA 4ZMEA 3LE6A 4QYYA 5AUXA 3KY2A 4QMYA 2QR8A 3R8MA 4BCJA 3PXQA 4ZSJA 4F0GA 4YUQA 2FA2A 2A27A 2WMBA 4KIKA 3GP0A 3R7OA 4F7NA 1CTPE 1Q5KA 4MF0A 5EHLA 4D1XA 2R4BA 4F7JA 1PXKA 2C5OA 4C4EA 2GFCA 3WF5A 4YP8A 1G5SA 2HIWA 1OIRA 4JIKA 3U55A 3E8CA 3FY2A 3OXTA 3CTHA 1OECA 5FTQA 5TT7A 2QC6A 1ZYSA 4BC6A 3QKKA 5CNOA 1REKA 2BRGA 3CD3A 4R3PA 3GFWA 5M06A 3SXSA 4XUFA 2QCSA 3FL5A 3KGAA 4AZWA 3CQEA 5EYDA 2OZOA 4C2VA 2GTNA 1QPDA 4NUSA 3RAKA 5M56A 4IB1A 2JKKA 2ZM4A 5FLFA 3DKGA 2WTIA 3TIZA 4DG3E 4IAYA 4J8MA 1FOTA 2UVZA 3ZXTA 3FQSA 3R7UA 4DFBA 2BFYA 1XO2B 4UY9A 3I1AA 4XOYA 4RRVA 2BAJA 5B2LA 2VX0A 2QI8A 5JFVA 2GNFA 3FDNA 4M0ZA 3VBVA 3R9HA 4I5MA 4CZTA 3QA8A 3ETAA 1UV5A 5AP6A 4ZZNA 4JIAA 1UKHA 4OTGA 4MNFA 3QGWA 3RMFA 3LKMA 3MV5A 2PVHA 2UW6A 4L01A 4M7IA 5C27A 2VGPA 3QTIA 4FTKA 1ZMWA 3LW0A 1J3HA 5FUTA 4EOOA 4JXFA 4U43A 3IO7A 3P5KA 3G51A 1F3MC 2YM7A 5AX3A 5I4NA 5JGAA 3LQ5A 3UP7A 3MY5A 2OIBA 4IM3A 4CCUA 3F9NA 4M8TA 3R0TA 3UGCA 4BGGA 5IQHA 4RX5A 4HZRA 3A7FA 5E92A 4XP2A 1RDQE 1R1WA 4MD7E 1KE9A 4QTCA 4UYNA 2UZVA 4NZWB 2YIRA 4IHPA 3A7JA 4N70A 2E9UA 4G17A 2JDSA 3ULIA 2YN8A 5AJQA 3N9XA 5BYYA 3QL8A 3PVBA 4ANSA 4B99A 4MEDA 4O7LA 3EN9A 4IX5A 3AD6A 5EHYA 5DFPA 4PL3A 4ONAA 3CQWA 4IVBA 4FEXA 1Q97A 3KU2A 4U3ZA 5CI6A 2XBJA 3TIYA 5JRQA 4GIHA 3L8XA 2PMOX 2YAKA 4R3RA 3TNPC 4HZSA 4ASDA 4I0SA 3R9DA 4FOCA 4CQGA 3A60A 4YJRA 1LEWA 3HZTA 4O0WA 3KXMA 4GG5A 4ID7A 2VTRA 3AQVA 4IC7A 4I5PA 3ORTA 5JZJA 4XNEA 2WQMA 3B8QA 4IQ6A 4XP3A 5FBOA 5L2WA 3PXKA 5M4CA 2NNWB 1FPUA 3DBCA 2IN6A 1H01A 2IWIA 4RVLA 5CU4A 4IAKA 5J95A 3VN9A 3VUTA 3SVVA 4NIFA 3OT8A 3W32A 3ODYX 4FIHA 4YLLA 4AA5A 1A9UA 2O5KA 2ITWA 1CSNA 1H08A 4CYIA 3GU8A 3S00A 4BBFA 4O7RA 2R9SA 1YHWA 3Q04A 3OTUA 1UU8A 4NM5A 2QOCA 4J96A 4KSQA 2ZVAA 3RPOA 1PW2A 1SM2A 3E62A 3MW1A 3UPXA 4A4LA 5DMZA 1RQQA 3CKWA 5GIPE 3DB6A 4ZIMA 1O9UA 4GT5A 4ZTLA 3FC2A 1VJYA 3H9OA 4D2TA 2BRMA 4MH7A 2PYWA 4AZTA 1R39A 2YFXA 3NUYA 5CSWA 5L2TA 1KE5A 3I0OA 5EHOA 1YQJA 4KKEA 2CNQA 4CLJA 4E6QA 3GC9A 3R1QA 3DBEA 5DNRA 3C50A 5HCYA 5AA9A 4Q2AA 4ANQA 4BCHA 4LM5A 2FSOX 2VZ6A 4L53A 1CMKE 4B8LA 3UVPA 4EOKA 4DBXA 3P78A 2GQRA 2G2FA 1WBWA 4EZ5A 4JRNA 1GNGA 3CPBA 2XKEA 4EH4A 3ANRA 4CMUA 4Y5QA 2XNOA 3ZONA 2CDZA 3LOKA 4JDIA 3RCJA 5IA0A 4Q5HA 3MYGA 1E9HA 1O6YA 5DR2A 4AE6A 2UW5A 4FUYA 4HYSA 4C4HA 3MIYA 4X6QC 3ZOSA 5BMSA 2C30A 4IE9A 3DK3A 4BTJA 3KEXA 3QCQA 2VX1A 3OWPA 3HMMA 3QXPA 4RVTA 3R7EA 2Y4IB 4ZJJA 2ZV2A 4BCMA 3MTLA 5AP3A 4HVDA 2JGZA 1YI6A 3PY1A 4ERWA 1M52A 4U45A 3EQHA 4W4VA 5CVHA 2J0LA 4OTIA 5HG9A 4KD1A 4R78A 2A0CX 4EORA 2PZYA 3F5UA 2R3LA 2H34A 5F9EA 3AOXA 5IU2A 2XM9A 2RGPA 4JR7A 3N4UA 3HRCA 4RJ7A 3ZMMA 4OTDA 4DH8A 3KB7A 4YJQA 4E4NA 1OPKA 4O6LA 4C58A 3E8EA 4YTIA 4DITA 1NA7A 3PE1A 4NH1A 4ZLYA 1F5QA 3QLGA 4CD0A 3P08A 4RMZA 3ORZA 4YJVA 3VQHA 4BWPA 2YM4A 4FTNA 5M07A 2PHKA 4HVGA 4L46A 3I7CA 2SRCA 4UZHA 3RAHA 4KKHA 3OBGA 3DA6A 3KK9A 5ETCA 4EZ7A 3BWJA 4X21A 2B54A 3RP9A 3VWAA 3C4XA 4NWMA 3DNDA 4EOSA 3ELJA 2GNLA 4DAWA 5I9YA 4X0MA 4PUZA 4I0TA 5HBJA 2ZMCA 3C0HA 1M14A 3W1FA 3EJ1A 4IVDA 4QMNA 4XG6A 3QHWA 3ZLSA 2FSTX 3OCTA 4XV2A 3C4CA 4DFZE 5CEOA 4CKIA 4FKIA 4I94A 4QMTA 2WMRA 1J7LA 3VF9A 4B8MA 1OVEA 1MRYA 4OGRA 3GCPA 3N4TA 3FPMA 3CPCA 4TYEA 2WD1A 5FD2A 3ORNA 4XG8A 4FSTA 3H30A 1R3CA 3A62A 3VF8A 1QPCA 1XBCA 4E20A 5M53A 5EDRA 4D9UA 3S0OA 4C38A 5AUWA 2IW8A 4BCNA 5BNJA 3UIBA 3E8NA 5E9EA 5CT0A 3CGOA 4FV8A 4AN9A 1UU7A 3PSDA 3Q4TA 4XJ0A 2PL0A 1ZARA 1AD5A 3Q2MA 3HV3A 5EOBA 4FUXA 2W1HA 4CLIA 1GY3A 3I7BA 3IW8A 5J87A 3WZEA 4EI4A 4BCPA 1W7HA 2NO3A 3QFVA 1XHAA 4CTBA 4PTGA 4JT3A 3L8VA 4K9YA 4TWOA 1H4LA 3M42A 2WQOA 4YZMA 4YC8A 1V0PA 2BDJA 3MA6A 3GU7A 1JSTA 1GZKA 1SVHA 2GNHA 3V5WA 3K5VA 3KK8A 4TYJA 3ID6C 4M68A 1UU3A 2C4GA 4WD5A 2J6MA 1JOWB 4L45A 2ZDTA 4LRKA 2J0IA 3IGOA 1WCCA 2I0HA 5LCKA 5AV1A 3FPQA 2W4OA 4BKJA 4RQKA 3R04A 4DT9A 3LCOA 3O8TA 3R9NA 3U6IA 3KREA 2IVVA 3ULZA 2XCKA 3FQHA 5G6VA 4U44A 3G33A 5CEIA 4NCTA 3FLYA 2B9HA 5D10A 3OTVA 3I0QA 4HGSA 3IGGA 4ASEA 3ET7A 2ZAZA 3QF9A 3KRWA 1ZXEA 5ANGA 3U6HA 5AEPA 4FV0A 4BDKA 3EN6A 2BR1A 3PTGA 3PZHA 3UOJA 1V1KA 2BZIB 4O0UA 4FNYA 1FMKA 3HA8A 2B4SB 3JUHA 3HNGA 4FTLA 4XYFA 3BGQA 4BI2A 5IQBA 4BCIA 4O1PA 4FKSA 3POOA 4KS8A 4HPTE 3P4KA 4L68A 4XV9A 3UNZA 4BCFA 1RE8A 4U7ZA 4D9TA 1OGUA 4L42A 3KXHA 1JQHA 3QZHA 2X0GA 4EKLA 2P2IA 4EOMA 4BDCA 5E8VA 1L3RE 5DR9A 4CKJA 3ZCLA 4KSPA 5BX0A 5KZIA 4HVHA 4BGHA 3TUCA 4WG3A 3QWJA 4AT3A 3UG2A 4C36A 4FE2A 2CNUA 3P7BA 4XG9A 5HI2A 4EBVA 3EN5A 3P9JA 4JG6A 3QUEA 3Q6WA 2JFLA 1H1RA 3NR9A 5HG7A 5AIRA 5JRSA 4MXCA 4ITIA 3VUMA 4YSJA 3GGFA 2YA9A 3EQPA 3VNTA 5IUGA 4BTFA 2Z02A 5GJGA 1ZMUA 3SXFA 2V22A 4QD6A 5D7VA 5AM7A 5DWRA 3GOPA 4IXPA 3D4QA 4TYHB 3LFFA 4CSVA 5A46A 3DDPA 3QAME 4FV6A 4DEBA 4IAFA 4K1BA 5ICPA 2B0QA 4YMJA 2E9NA 3HP2A 3GCUA 5KCVA 1K3AA 4I92A 2IJMA 4WG4A 4BBMA 5B7VA 5K0XA 4QPAA 1PMVA 3P7AA 3PPZA 2QOLA 2OICA 3FHRA 4UV0A 1ZYJA 1DI9A 5GZ9A 3WE4A 3GENA 3RWQA 4FSQA 3S3IA 5E4HA 1G8AA 3FQEA 4X6RA 5FBNC 3TCPA 2BALA 4YO4A 2ZV8A 4Z7GA 4E6AA 4WBBB 5KKRC 3KXNA 3RTPA 3C4FA 2XNPA 3LFDA 3MH2A 4MYGA 1Q4LA 1OKVA 5CSHA 4AZVA 4F9WA 5BUEA 2GNIA 4MCVA 4AA4A 4FGBA 5FGKA 5KMMA 3LQ3A 2I0VA 2XKDA 2R3GA 4LYNA 5CI7A 4FT3A 3G0FA 1WBOA 4ZZMA 5JFXA 4FZDB 2FYSA 3U4WA 4AE9A 4KWPA 1YOLA 4PV0A 4CMTA 4ARKA 1OPJA 4MXXA 5EQEA 2RFDA 5JFWA 1KSWA 3QQUA 4BZNA 3TACA 5L8LA 4JAIA 1J91A 2R3QA 4LUEA 2R5TA 3ORPA 3II5A 5CSVA 5CVFA 3KRJA 3FZRA 5EG3A 4D4RA 4N4SA 4EUUA 3UO6A 3OXIA 4ALWA 3UOKA 5JEBA 3H0ZA 2QO9A 1Q8TA 4UALA 3ACJA 5IH5A 3DDQA 4I6QA 4YJSA 4O96A 2X8EA 2BPMA 5F94A 3JYAA 5EKOA 2EUFB 2JKOA 3FZSA 3WILA 4GFOA 4JG7A 3BHTA 3KN6A 3S2PA 4O7YA 1WBTA 4C8BA 2JBOA 5AA8A 5KKRB 5JFSA 5J9LA 3Q4ZA 2ZM1A 4FKTA 2JIUA 3MVHA 2EB2A 3Q4UA 3FL4A 3KKVA 2BZKB 3AC5A 3NGAA 4KINA 4W4YA 5C8MA 2HWPA 4OAVB 4EHEA 4Q5EA 3R71A 3S95A 3W8LA 2OXXA 3O0GA 3PDTA 2VNYA 4ZK5A 5L3AA 3QQLA 3C4ZA 2XIKA 1WBNA 4ACMA 5CEPA 3SRVB 3Q6UA 3VBXA 2ZJWA 5AM6A 3TV6A 4BCGA 4A4OA 4O7NA 5EKNA 2HWOA 4EKKA 2C6TA 2J0JA 4IIRA 4ZOGA 4ANMA 1Q61A 4AW2A 3BE2A 2GTMA 3ZRLA 3U87A 4IWPA 2PUUA 2VWWA 3LFAA 1IA9A 3E87A 5FTOA 4O2PA 4O0XA 2GNGA 1M7QA 5KMLA 4YC3A 3OFMA 4AQCA 3EWHA 3FUPA 4MXOA 4MVFA 1OIUA 3O17A 1OZ1A 3V04A 2DWBA 3RWPA 2WMTA 1GZNA 3HV7A 4E73A 2REIA 1NY3A 1XJDA 2BVAA 4M84A 4ZY4A 5FEEA 2JITA 4FVPA 4LV5A 3DLZA 1J7UA 1PMNA 5EI2A 3PIYA 3RHXA 4Z3VA 1K9AA 5E8TA 4FT0A 4MXYA 5IKWA 3VUKA 5M44A 3SW7A 2R2PA 3WZDA 4HYIA 1ZAOA 3FMLA 3REPA 5C8KA 1F0QA 4R5YA 2OF4A 3PWDA 3R30A 4OBPA 4QTAA 5T3QA 2O65A 2VWUA 5KMOA 3BHUA 4GCJA 2C0IA 3V5TA 4AZFA 4L3JA 3VW6A 3AD4A 3HVCA 2O63A 3SOCA 4XG7A 3Q9ZA 4H3PA 3MFTA 5CU2A 5HCZA 2FGIA 4LG4A 4A9RA 2BKZA 4AOTA 2UZBA 4WSQA 4RFZA 2XRWA 3GQIA 3MB7A 3BRBA 3EHAA 3UIUA 4CV9A 3UC3A 3GC7A 1FINA 2C3KA 2OF2A 5KMKA 3VUHA 2Z2WA 3NYOA 2J4ZA 4AW0A 5EFQA 3CY3A 4C4IA 4G5PA 4AG8A 4C37A 4UEUA 4NKAA 1Q41A 3CJFA 4IJ9A 4TYIA 4I5CA 2GNJA 4NJDA 5CSXA 4TTHB 2PTKA 2WTKB 2RG5A 2HCKA 4IVCA 4JBPA 4V04A 4EH7A 4E7WA 3QUDA 4ZY5A 5AUYA 3PXYA 3QWKA 5E8ZA 3S1HA 4D4YA 5M4FA 2PULA 4FKGA 4NM7A 3A4OX 4QMQA 5KBQA 4S32A 2QODA 4BDIA 3ZO3A 3V5PA 2I0EA 3GXLA 3KRRA 3R73A 4FKRA 2ACXA 4FTOA 4NFMA 4F4PA 1G8SA 5AV4A 2OH4A 4R7BA 3NW7A 2WB8A 3OW4A 3TUDA 4FT7A 3ZLXA 5CALA 5IQAA 3CS9A 2GS6A 2PK9A 1PXNA 5AIKA 4USFA 3UZRA 2XK9A 3MJ1A 5HO6A 3VO3A 2Z7LA 3RI1A 3UVRA 3KF7A 2Z8CA 4NTSA 4MX9A 2X8DA 3BV2A 1R0PA 3BLQA 4RZVA 2OZAB 2HENA 2W4KA 3NX8A 3SC1A 3SG8A 3FAAA 2WKMA 2WTWA 5K0KA 2HW7A 2OXYA 4XRJA 4AGCA 3LXPA 4J8NA 5BUJA 4S2ZA 3WZUA 4J53A 4ITHA 4EQCA 3G0EA 5AAEA 2PWLA 3BQCA 5IA3A 3A2CA 4DBNA 5L6PA 4EK3A 2WMAA 4WNKA 3QD4A 3MVJA 3JVRA 4FSUA 4NW5A 4EK5A 5K4JA 2V7OA 2QNJA 3EYHA 4WUAA 5B2KA 1I09A 3IKAA 3OWKA 4K2RA 4IZYA 4QPMA 2JKMA 4V01A 1NVSA 1B38A 3FZPA 4FV5A 2G1TA 3QTXA 3V8TA 1NVRA 4ZSLA 2UVXA 3S4QA 3QUPA 1BL6A 4FNWA 4RWLA 1GJOA 3NZ0A 2WGJA 4U97A 5D41A 4BWKA 5HGIA 4BKZA 4NJ3A 4O7VA 4X3FB 4LL0A 1YOMA 3VHKA 3MA3A 1XH5A 4CZUA 2E2BA 4M13A 5EW3A 5FEQA 5IQCA 3OUNB 3QCSA 1UVRA 4U6RA 3C7QA 4X7QA 1ZLTA 4FIEA 3ZC6A 1IAJA 2PVLA 4G6NA 3PXZA 5I9UA 3QRJA 4MBIA 4KIPA 4UMTA 4ALVA 1APME 4R1VA 4AFJA 4J7BA 5EI8A 3KN5A 5D12A 4Z9LA 5HO8A 3MS9A 3WF6A 2JDRA 2W1IA 5M55A 2C3JA 2YM5A 1BLXA 4TWPA 3WZJA 4F6SA 2Q0NA 2VTNA 2WMQA 4UMPA 3RPRA 3UO4A 1OPLA 3FLWA 3L8PA 3W55A 4BTMA 5K4IA 4BY9E 4I93A 4CG9A 1TVOA 3DJ7A 3MB6A 4AX8A 2BIYA 3R63A 4IAZA 3RJCA 1T45A 4RT7A 4RJ6A 1YWNA 4WUNA 3ZDIA 4QP2A 5BVEA 4OR5A 3NUAA 3KCKA 3H9RA 3QRIA 4D55A 3U6JA 3MY0A 2PZPA 3F3VA 5CXHA 4YHJA 4FKJA 2X2KA 4AW5A 1VYWA 4DH7A 3KXZA 1JWHA 4FV7A 4EOJA 5BVWA 4EONA 4C34A 3JS2A 2JEDA 1H28A 2BAKA 3BBTB 3KXGA 2UZUE 3R9RA 5JZNA 4QP1A 1YHSA 2VWVA 5F95A 5CF6A 3RVGA 1XR1A 2QOKA 3BU5A 2BZJA 4FV9A 3ZSHA 3MGYA 1IA8A 3OXZA 4UXLA 4YNOA 3EKKA 3UG1A 4E5BA 5HLPA 2ITUA 1YI3A 2C6KA 1ZY4A 5CEMA 2BAQA 4QQCA 2O2UA 5T68A 3FE3A 3CTQA 5DE2A 4H39A 3VULA 1ZY5A 1Q8YA 3R1NA 4E4LA 2XKCA 4YTCA 3MIAA 5JKGA 2A19B 5DBXA 5CAPA 4NSTA 3R7YA 4YR8A 2OW3A 3PJ1A 4YU2A 4TPTA 1W83A 2WU6A 2JIIA 3LFSA 4TWCA 4RPVA 4FI1A 5CAOA 3KQ7A 5DEYA 5ITAA 4DG0E 4IB0A 4DT8A 2BDFA 4QMUA 2A4LA 5CVGA 3VS4A 1PKGA 4WA9A 3RZBA 4I3ZA 2CKOA 3IDCA 4W9XA 3F6XA 3W16A 2J0KA 4O6EA 1PYXA 3OHTA 4UWBA 1SNXA 3PE2A 4RIOA 3EMGA 3LAUA 4ZTSA 3ZM9A 4QO9A 2ONLA 4FTRA 3WYYA 5AP2A 2OKRA 3VJOA 3F3ZA 3HUCA 3TV4A 5AUVA 2UZOA 3KVXA 3E5AA 3D94A 4DFYA 2OJGA 3BHYA 3RBWA 2GCDA 4E8AA 4FZ7A 4AZSA 4JR3A 3QRUA 2V62A 4G2FA 1UKIA 4H3BA 1WVXA 2XH5A 3HRBA 3PY0A 3CLYA 4Y85A 4GW8A 3L9NA 4HCTA 2QO7A 4MWHA 4FG8A 5HD7A 4NU1A 2JD5A 2XEYA 3QTUA 1QCFA 4IC8A 2BTRA 3ZZEA 4QMWA 3G2FA 3Q32A 5FTGA 4RC4A 4IDTA 3SX9A 3Q96A 4QYHA 4YBKA 4EL9A 1XBAA 3TN8A 2WO6A 3TG1A 3LFQA 5CANA 2YIQA 3HDNA 2DQ7X 5CF4A 4FV1A 3QA0A 3UZPA 2X4ZA 3O23A 2V0DA 3PJ3A 4EHVA 4RZWA 5J7BA 4MBJA 2QOHA 2XA4A 3RAIA 4NM0A 5M57A 1A06A 3DJ6A 2HYYA 1OITA 1BKXA 3RM7A 3ZRMA 4YTFA 1YW2A 4FTCA 2PUNA 5M4IA 2GS2A 2P0CA 4EBWA 2XJ1A 4O2ZA 4U42A 4UMUA 3WF7A 3LM5A 2ZOQA 2Y6OA 3FI2A 2VTMA 1B39A 1Q8UA 2WPAA 1EH4A 3WF8A 4IJPA 1XQZA 4G5JA 2W9ZB 4NT4A 3Q9YA 4QOXA 4ZY6A 3NWWA 2E9VA 4I1ZA 3FXXA 3O8UA 3ZTXA 5CNNA 3A4PA 2GS7A 4AF3A 3CD8A 5A6NA 3IW7A 2PVRA 2OJJA 4CV8A 4F0IA 2B9IA 4D0XA 3P79A 2ZM3A 2UZDA 1M2RA 2A2AA 2HOGA 5BVOA 4Y5HA 4C4JA 1PKDA 4DA5A 1OL1A 4ENYA 2XNNA 3RGFA 4AACA 5AP7A 4N6ZA 2G2IA 3ZM4A 1Z9XA 3OEZA 2P4IA 4Y72A 4YZ9A 1IRKA 4ANBA 1P14A 1PXLA 1MRVA 4ASXA 3E92A 4L9IA 4TW9A 5HCXA 2Y6MA 3F66A 4AOIA 4OTRA 4FV4A 3D83A 2HZNA 2QD9A 1A48A 1UA2A 2VO0A 4AP7A 4NTTA 5IUHA 2CNVA 4GUBA 4BCKA 2J5EA 3OWLA 4YC6A 3UOLA 3VC4A 4FMQA 4GKHA 3R7VA 3BI6A 5IA4A 4LGHA 4NEUA 5BYLA 1E1XA 4EHGA 3PXRA 4ZLOA 3DNEA 4BDAA 2HZ0A 2YDJA 4ZTRA 4IEBA 4CCBA 1L8TA 1ZRZA 4DLIA 4RJ8A 2I0YA 2B53A 1JLUE 3D7ZA 4S34A 3ZH8A 5EK7A 4QTEA 5E1EA 2IO6A 4HGEA 2AC5A 2W1ZA 1PJKA 3V3VA 3UYSA 3R7IA 4CMOA 2J2IB 5A4QA 2IZUA 5IEVA 3A8XA 4MWIA 2PE0A 5HOAA 3AGMA 4RVMA 1R78A 1KOBA 4DEAA 4DGGA 4GMYA 1J7IA 4FTUA 1PMUA 5FQDC 4I4FA 5FP6A 4YGAA 3R8PA 4G6OA 1Y6BA 2YCSA 3DK7A 4JDKA 1KE7A 5HTIA 4FV2A 5L4QA 3GU5A 1P4FA 4CFUA 2OIDA 3F61A 3EQIA 3IW6A 4ZTQA 5FDXA 2ZB1A 2ITNA 3GCVA 4JS8A 5L2QA 4JJRA 3NCGA 4PRJA 4QMOA 3R83A 2QG7A 2IPXA 1OIQA 2HXQA 2CCIA 3FLSA 3LLTA 2CCHA 4E1ZA 1PHKA 4KA3A 1GIIA 2PVNA 4FSZA 5FM3A 1OMWA 3FMNA 3UYTA 3DBDA 2YABA 3QC9A 1OI9A 3PG1A 3QZIA 3R2YA 2A1AB 5IH4A 5IQEA 2QOQA 4MD9E 5AR4A 4GFGA 1V0BA 4P5QA 2CGWA 3BYUA 4GV1A 3IDBA 3QHRA 1U54A 5IQDA 2W7XA 4CZYB 3FMKA 1O6KA 1UWHA 4LMNA 4D2RA 2IW9A 5JK3A 3EN7A 3NLBA 4ZTHA 2PVMA 1M17A 1OM1A 2EXEA 4C4FA 3DOGA 4U81A 4I6HA 3DAEA 4G9CA 4BDEA 2ITVA 4EHZA 5IZFA 1S9IA 2C0OA 4LMUA 1PXOA 2RL5A 2GSFA 2PMNX 4JVGA 4R5SA 2RKUA 5EYMA 5AP0A 3BIZA 1FBNA 2VO6A 3CSVA 3FEGA 4RIWA 4DTBA 1JBPE 4BYIA 4F9AA 1OL7A 4DGLC 3QU0A 3AT4A 1P4OA 3L9MA 5H3QA 4CFMA 3E88A 3EH9A 4S33A 2PVKA 2UVYA 4OTQA 4QT1A 3UO5A 3HEGA 2YCFA 3G6GA 3R8VA 5KHWA 4IZ5A 3UODA 3UDBA 5IEYA 3V51A 4IWQA 1M7NA 2OGVA 4FVRA 2QONA 3QCXA 4FT5A 3E63A 3HP5A 5TE0A 3ZSGA 4PP7A 4F1TA 1M2PA 4MD8E 2GQSA 3FKNA 3WE8A 4IADA 5KUPA 2QOFA 2J0MB 3M11A 4H58A 4UWCA 5HX6A 4MXAA 2OU7A 3TWJA 4KABA 3FMJA 5IH6A 4K18A 1YWRA 1FVRA 3WIKA 4GIIA 2PUIA 4X2FA 4EYJA 5M08A 2YHVA 4GYIA 4DH3A 1QPJA 5M51A 4XEYA 4UWYA 2R3KA 4PWNA 4O0YA 5HVJA 4F64A 4IH8A 4OUCA 2C6EA 5HESA 4QQ5A 2ETKA 3IS5A 2C3IB 3L9PA 1OUYA 4KBKA 2CKEA 2Z7RA 4ENXA 3QX4A 4UYAA 4RWKA 2C68A 3NW6A 1QPEA 4CG8A 4IM0A 5HNGA 3K5UA 5D9HA 3QYWA 2VTHA 4O0TA 4NFNA 2JDTA 5CS6A 3TEIA 3PWYA 3PVGA 4I6BA 1Q3DA 3BKBA 2HXLA 3V5QA 4ZZOA 4GS6A 3PJ2A 3U4UA 3EZVA 1KWPA 1OKWA 2QQ7A 3VHEA 4BZOA 1FGKA 3ALNA 4AN2A 2QLQA 3OUKA 2FB8A 5CASA 4L52A 4MKCA 3F69A 2OBJA 2ZMDA 3VW8A 3V01A 3FLZA 1QL6A 3K54A 3HUBA 4JQ8A 3LLAA 5AV2A 4HGTA 3UQGA 5CQWA 3QTWA 2OG8A 3AT3A 5IUIA 1OUKA 1WBPA 4EK8A 5E1SA 3FI3A 1XH6A 4H05A 4UN0C 3PG3A 2BRNA 1JKTA 5GJFA 2OIQA 2ETMA 3AC1A 3CJGA 4D28A 4YLKA 5E90A 1JSUA 5F20A 3W33A 5C26A 2PSQA 4JX7A 2OI4X 4FZAB 5EYKA 2UW0A 2XCHA 4RG0A 2XB7A 5GNKA 4G9RA 4QP8A 3R02A 2QO2A 4ZSEA 5LWMA 2R64A 5FRIA 3HX4A 4BHZA 3SRVA 4FKWA 3TDVA 1UNLA 3JPVA 4TN6A 3ZUUA 4Y73A 3QTQA 1XKKA 4PX6A 1W0XC 4AGUA 4BZDA 4C3RA 4J95A 3POZA 4IX3A 4JNWA 4U41A 4PPAA 5DT4A 3R7GA 4GVJA 2ERZE 2Y4IC 4G31A 1UU9A 3GUBA 4IZAA 4ANNA 1ERKA 1YXXA 4ITJA 4X2NA 5J1WA 3SLSA 4FV3A 4I5HA 4LI5A 4GFMA 2VNWA 2OK1A 4FX3A 5DGZA 4ACGA 2QOIA 2QOOA 2JAMA 3TT0A 2H9VA 2QVSE 4B7TA 1Y8GA 1KV1A 2BDWA 2ITXA 4LOPA 5AR2A 3A99A 2VTQA 2CGVA 3O8PA 3TTJA 3FMDA 4N0SA 3LQ8A 4MXZA 5CAQA 3GB2A 3ORMA 4DC2A 4Y95A 2QKWB 4EK6A 4D4SA 4RC2A 5AADA 2X6EA 4PDPA 3ZHPC 4QMPA 1SYKA 4U9AA 3NDMA 3QTZA 2BTSA 4F08A 4RWIA 3VS1A 4UXQA 1Y91A 2OO8X 5KO1A 2P3GX 2OZAA 2R3FA 3FLNC 4PMPA 2VV9A 3ODZX 3TNWA 1PXPA 4ZJVA 2CGUA 4TNDA 5CXZA 3LMIA 2UW9A 3TZ9A 1YDTE 3G90X 2P2HA 3L8SA 3U9CA 1BMKA 4CTCA 1SMHA 3VUGA 2W9FB 4EOIA 4IVAA 1H26A 4IWDA 4FSRA 5DH3A 4L44A 2UZLA 2ESMA 3FI4A 3PVUA 2W4JA 1FVVA 3MTFA 5D11A 3NIEA 5H8EA 4BDDA 3DXPA 2C6LA 3Q60A 3VRZA 2R3JA 4O83A 5EW8A 2CMWA 4O7TA 2J50A 2ZDUA 3ORLA 2XIXA 2BIKB 3R1YA 1ZYDA 4XG3A 4QNYA 4B6LA 2QOBA 2UZWE 3BYSA 3A7GA 3P7CA 4RQVA 3NEWA 4KRDA 5L2IA 4AFEA 3C4EA 5DT0A 4DFUA 5GZ8A 1ND4A 3RZFA 5L8JA 4OT6A 4CFFA 3AXWA 2VWYA 3KRLA 5IMEA 4O81A 5AMNA 3KXXA 3DKOA 1WZYA 3GC8A 3QQKA 4BBEA 4E4MA 3I6UA 3LPBA 3T3VA 3FKOA 2ETRA 4C7TA 2C5YA 2C6MA 2DYLA 2O64A 4DHFA 5LMBA 2JAVA 3ZC5A 5C1QB 2X81A 4RBLA 3PIZA 1IR3A 3UQCA 2F7EE 4RA4A 3HMPA 3BEAA 2BMCA 4R6VA 3IW4A 2XVDA 5HLWA 1JKKA 4ZJIA 4RX9A 4F7SA 4QQJA 3NAYA 5G1XA 3FLQA 3FSKA 3LFCA 3QTSA 4LRMA 5ANKA 1LUFA 1YI4A 3D7TB 5ANOA 3ANQA 4QYGA 3NVKI 3R22A 4RLLA 3C9WA 4USDA 5AAFA 4EUTA 5B2MA 1K2PA 4QMLA 3LVPA 3MY1A 2XMYA 3UC4A 5HE0A 2YCRA 4GH2A 4L3LA 3ORKA 3WYXA 4ACCA 3A8WA 4BGQA 5CY3A 3RHKA 5IQFA 2VN9A 3TUBA 5CF5A 3JXWA 2GU8A 1S9JA 3GU4A 5GZAA 3ATSA 2VD5A 3LJ2A 3BBWA 4PDSA 2VTTA 3A7HA 4PL5A 5AWMA 5H8BA 4JQ7A 4EH2A 5LOHA 3C5IA 5BVFA 2R7BA 1SVEA 4C33A 4F09A 4Z7HA 5HE1A 1KOAA 2HK5A 5E8WA 4FG7A 5HIDA 2IG7A 5EQYA 3TDWA 1BI8A 4FC0A 5HX8A 1H1PA 1NT2A 2HY81 4HPUE 5B0XA 5C03A 1OBGA 4F63A 1DAWA 4J99A 3Q4CA 3ZSIA 1XWSA 3FC1X 4M3QA 4RC3A 4KB8A 4WNPA 4Y8DA 2R0UA 2F7ZE 4RJ3A 5DHJA 2XK3A 5DRBA 3SKCA 3QQJA 5CX9A 4IX6A 3D9VA 3CIKA 4OTPA 4I24A 4R7HA 4X3FA 3RK7A 3K3IA 4DGNA 3AMBA 3QTRA 2RFEA 4O7WA 3IOKA 3IECA 3GCSA 4O27B 3EQBA 4LQMA 4IW0A 4QMSA 4AN3A 4DH1A 3QD2B 5A14A 5H2UA 3ZO1A 1OKYA 3GEQA 4X3FC 3EQCA 2WMUA 4XV3A 2FSLX 2BCJA 3I81A 5DT3A 4GL9A 1YDRE 5FG8A 5HU3A 4DGOA 4JBQA 1TQPA 4XG4A 3RINA 5EM8A 4WSYA 5IF1A 4FK6A 1ATPE 2W5BA 3F2RA 3KF4A 4TKSA 1OL2A 3COHA 4F65A 3CTJA 4AA0A 2B7AA 3IDPA 3B2WA 3PP1A 4I22A 4GKIA 4YJNA 3RAWA 1U59A 1FMOE 2EU9A 1H25A 4IFGA 2WIHA 4IAIA 5DRDA 2OJ9A 2XRUA 3D15A 4CGAA 5ETAA 5CSPA 2OSCA 2F9GA 3G9LX 4F9BA 3LCSA 3FZ1A 4P2KA 3KCFA 4EK4A 2WELA 3LMGA 4BIBA 4W4XA 3RPSA 2BROA 4FKPA 3VS0A 4MTAA 3V8WA 1JSVA 5CTPA 2W1DA 3F3TA 3DTWA 2CKQA 2XM8A 4TT7A 4S31A 5GINE 2J7TA 3DBQA 5A54A 3EFLA 3H3CA 5HNIX 4HCVA 2PY3A 4UZDA 2YWVA 3ZLYA 3OF0A 2GDOA 3NMUF 2PUPA 3D0EA 3QRTA 3A7IA 2WQNA 3HV6A 3Q9XA 2V7AA 4FTIA 2XF0A 4OTWA 4EC8A 1ZOEA 3HKOA 4NK9A 3OG7A 4PQNA 3TKUA 1IEPA 3WOWA 3OY1A 5I9ZA 4PY1A 4KRCA 3R01A 3ZZWA 3ORIA 3ZLWA 2PZ5A 4A7CA 5BVNA 4KS7A 5IPJA 3UNKA 2AUHA 5HKMA 1DS5A 4JLCA 1BYGA 2RSVA 3O96A 3TL8A 4O38A 2KULA 4RVKA 3ZEWA 3OCGA 5AFVA 3GU6A 4UBAA 3EYGA 4WHZA 3QQGA 3V5LA 1IAHA 4LGGA 4PDOA 5CAUA 2UZNA 3BU6A 3PPJA 3QLFA 3COMA 4IAAA 5J5SA 4ZS4A 4BWXA 4P7EA 2IZSA 2XS0A 2C5XA 3CP9A 3W2SA 1ZYLA 4XRLA 3SOAA 3BYMA 4A9YA 3PIXA 2RIOA 3TM0A 5AUTA 4BDHA 4IX4A 4KIOA 1FVTA 4FTMA 3VQUA 4A06A 4RJ5A 2PZIA 3G9NA 3HLLA 5K5NA 4EH6A 3PRIA 2Z7QA 3DCVA 3NYVA 3ZUVA 3THBA 4DEIA 5L6OA 2HAKA 4K77A 4FIFA 4BDJA 5GIOE 4YZDA 4YO6A 5FDPA 4J71A 4QPSA 4APPA 2NRYA 5AR3A 3JVSA 3FMEA 5HTBA 2X39A 2DS1A 2WZJA 4K6ZA 2HW6A 3E3PA 2AC3A 5CEKA 4JDJA 3I5ZA 4BR3A 4FIGA 4G34A 4X2JA 1GOLA 2I6LA 1PXMA 2B1PA 3I79A 4XH6A 5AUZA 4TY1A 3IOPA 3D5WA 4F1MA 4F99A 4M12A 2C1AA 3K3JA 4IMYA 3LZBA 2YDIA 4LL5A 4G16A 4YSMA 3AC8A 5DIAA 4ZTMA 4M14A 4RIXB 3MVMA 3RNYA 4FKLA 3TNHA 5A6OA 5C4LA 3PA3A 1J1CA 4C3PA 4HVIA 3W10A 5HORA 3VIDA 1ZZ2A 3COIA 4JI9A 4X2KA 4I21A 3OCSA 4YPDA 1GZ8A 4D5HA 4QMVA 4Z16A 5TOZA 3DTCA 5JH6A 3PXFA 4KUJA 4FT9A 3HRFA 2OJIA 2XIZA 3I5NA 4TWNA 4WOVA 2VO7A 3ZDUA 3MVLA 3LFBA 4FZ6A 4E4XA 4AS0A 4BYJA 2C0TA 4HW7A 2IVTA 3R9OA 4V0GA 5IDPA 5JSMA 4CXAA 1R0EA 2VWZA 4TXCA 4CRLA 4RIYA 4ZAUA 5EM5A 2G15A 3F5XA 3HL7A 2AYPA 3FYKX 3LCDA 4CKRA 4K8AA 4LFIA 4DN5A 5FP5A 3ZFMA 5KMNA 3LJ1A 4BRXA 2I7QA 2YDKA 4JQEA 3IQ7A 4EZ3A 3DQWA 1H1WA 1Q3WA 2DUVA 2WMWA 3HYHA 4L8MA 3LJ0A 3LXNA 1G3NA 4UB7A 1QMZA 3VUIA 3OMVA 3Q2JA 4D0WA 3OBJA 3QGYA 4EOPA 5BPYA 1H0VA 1KV2A 4V0GB 5TKDA 2YIYA 3F82A 1V0OA 4L3PA 5EYCA 5EM7A 1IG1A 4DGMA 4LOQA 2RFSA 5JQ8A 5DEWA 4XHKB 5C8NA 2BKKA 5HLNA 1W98A 5BVDA 2ITTA 3AMYA 4MF1A 4FYOA 2VUWA 2RF9A 3VS2A 4GK4A 2W05A 1OBDA 5L2SA 3EZRA 4JOAA 4W9WA 4F6UA 3PUPA 4RX8A 2CLXA 4USEA 3FKLA 4PF4A 3NPCA 3E64A 2YM3A 2W0JA 3C0GA 3DV3A 4FTTA 2G9XA 4UMQA 3MSSA 4EH8A 2WTVA 3PA4A 3H10A 3QZFA 3TZ7A 2EXMA 3EFWA 5EH0A 4PPBA 3FXZA 3K2LA 4FSYA 2Y8OA 1KE6A 2C5NA 3O7LD 2Q0BA 3FJQE 3FZTA 4MQ1A 4PTEA 3ZXZA 2CSNA 3MN3A 2C6OA 2VU3A 4M97A 5LVLA 3MESA 3TJDA 4ANOA 3EB0A 4GK2A 5HHWA 4MHAA 2JDOA 4XLIA 2WEIA 3TV7A 3R00A 5AV0A 3RK5A 4A07A 2OH0E 3SDJA 4QP3A 5KNJA 1PF8A 4FL1A 4O91A 2WU7A 3C0IA 1PXIA 2GPHA 3IG7A 4M15A 3TI1A 4DG2E 3D2IA 1HOWA 1OIYA 3MWUA 4BHNA 4IB3A 1SZMA 2VTSA 4FICA 2IVSA 3OWJA 3PSBA 5AV3A 4EYMA 4EH3A 3PZEA 3E7OA 3VVHA 2WIPA 4U8ZA 4PPCA 1VEBA 2UW7A 3CE3A 3NUSA 3SQQA 4HYHA 3WI6A 4APCA 3ATTA 1HCKA 3C4WA 4IBMA 3VBTA 1MQ4A 3MFUA 2P55A 4EEVA 3R21A 3SAYA 3OOMA 3AT2A 5FEDA 3ZFXA 4RX7A 3BEGA 3SHEA 3R8LA 5CLPA 5LVOA 3BYVA 4J97A 3VS6A 2R7IA 2W1CA 3I6WA 4BCQA 2VO3A 4D1SA 5LMAA 5I5ZA 3KULB 3AD5A 1DAYA 4F9CA 3MH0A 4KBAA 4BDFA 1LEZA 2PE2A 2R3PA 2WHBA 4XBRA 2JKQA 2OJFE 2ZV7A 3O50A 2QURA 3F7ZA 4MNEB 4CFWA 2X1NA 2J5FA 3TJCA 2W1FA 3OVVA 3R28A 3DU8A 4FBXA 4G6LA 4XP0A 3GOKA 2Y9QA 3VAPA 3RPVA 3SD0A 1YXUA 5EM6A 3T3UA 3P23A 4O0VA 3UE4A 3UTOA 2JFMA 4MAOA 4AW1A 1Q62A 3WZKA 3TKIA 2V55A 5DLSA 3U51A 2BUJA 4NCTC 4DYMA 2WQBA 2PU8A 5BMMA 2OLCA 2XJ0A 2XK4A 4E5AX 3AC4A 1U4DA 4LV8A 2X8IA 3OP5A 5ETFA 1M2QA 5J1VA 4BICA 3ITZA 1VYZA 5K5XA 5M4UA 3QQFA 5EDQA 3C51A 4FKUA 3RCDA 3G15A 3WARA 4GU6A 3KFAA 3BYOA 4LRJA 4ZS0A 2VTOA 3OS3A 2F57A 3P86A 5GHVA 3QXOA 5A4CA 2YIXA 3CY2A 5FXSA 4AAAA 3ZFYA 1W8CA 3LM0A 4HYUA 3PP0A 4JBOA 2CJMA 5EW9A 5A4EA 3D5XA 2YM8A 2WOTA 3TZMA 5I9VA 3VS5A 2HZIA 1Z57A 2IZRA 4DCEA 3FYJX 4MNEA 4O0RA 4A9UA 4AOJA 2F2CB 3BQRA 2UW4A 5FXQA 4PNKA 2XKFA 4PMTA 4Y46A 3AMAA 4IFCA 3OC1A 3DLSA 4YJUA 3GBZA 4K33A 3Q5IA 2B52A 5KX8A 3DY7A 5ANEA 2VAGA 3Q53A 4FODA 5H9BA 5HQ0A 4DEDA 4II5A 2WAJA 4E3CA 4D58A 1YWVA 3W2CA 5HZNA 3E3BX 1JKLA 4P4CA 4EOLA 3TNIA 1LP4A 2W99B 1XH8A 4CEGA 2J51A 2YM6A 5IQIA 4QRCA 1U46A 3OCBA 3QQHA 3DBFA 5HG5A 2XK6A 4ZTNA 4C59A 3DK6A 2YWPA 4ZEGA 1RW8A 2VGOA 2W06A 4JRVA 4YTHA 1Y8YA 4FNXA 1JNKA 3MDYA 3ZEPA 3Q3BA 2P33A 2QLUA 2XZSA 3QX2A 3CR0A 4I6FA 4M67A 3BE9A 4O22A 3V5JA 5J9ZA 1E1VA 4FZFB 4BIEA 3C5UA 2C5VA 4EWQA 2JDVA 2CGXA 2YJRA 1P2AA 4JDHA 4C57A 3DT1A 1UNGA 2EXCX 4H1MA 4J98A 5I9XA 3I60A 4NW6A 1NVQA 3EL8A 2F49A 5CT7A 3D2KA 5HU9A 3LHJA 3RNIA 4DLJA 5LXMA 3HA6A 3U9NA 1B6CB 3LIJA 1WMKA 1RJBA 2WEVA 3DXNA 4AT4A 5EQPA 4ACDA 1YVJA 2YZLA 3Q52A 1W82A 3R6XA 4EWHA 3H4JA 3WF9A 5E8YA 2R3OA 2ZB0A 4GEOA 4B0GA 4TNBA 2NPQA 3FWQA 4EOQA 5HBEA 3BELA 5ACKA 4FKVA 1VZOA 3BLHA 2J90A 5HIEA 3NUXA 3P0MA 4C4GA 4F0FA 5JT2A 2CN8A 1BL7A 4O0SA 5BYZA 2WTCA 5EOLA 3ZUTA 4G3FA 4YLJA 3MH3A 5ANJA 3ZO2A 3W2OA 3T8OA 4Z55A 2NP8A 5TF9A 4CYJA 2XUUA 2B9JA 3CC6A 3MFSA 1VR2A 3ACKA 4OT5A 5LARA 5KE0A 5IMXA 4M69A 5LCJA 4ANLA 3PSCA 3E7VA 4PMSA 2GHMA 4QP6A 3UBDA 4W8DA 3VRYA 2O0UA 3CQUA 4JG8A 3UMWA 2W17A 1GAGA 2XNBA 2YIWA 4AXAA 4B4LA 3NVMB 2WOUA 2Y4PA 3QD0A 4AZEA 5FXRA 3NSZA 3UZTA 1AGWA 3NS9A 3RK9A 5K9IA 2FH9A 3NNUA 4JX3A 4GSBA 2F2UA 4RIYB 3SG9A 4E26A 3TTIA 4NL0A 5EDPA 4O84A 3FXWA 4YHFA 4EJ7A 3W2RA 3GVUA 3HECA 4FVQA 2X9FA 4FOBA 4I41A 5HNBA 5LVMA 4DTAA 4YJOA 3W18A 4RFYA 3W2PA 4FKOA 1T46A 3F2AA 4IACA 4D5KA 1LR4A 5LVPA 4FK3A 3UJGA 1H1SA 3TKHA 5E8SA 1ZWSA 3VUDA 2OFUA 3DJ5A 1U5QA 3OEFX 2XBAA 4U79A 1BX6A 2VX3A 1U5RA 3ENHA 4KKGA 1PY5A 2UW8A 5CEQA 4OAUC 5IDNA 2PE1A 4RFMA 4UX9A 3UQFA 2HY0A 1TQMA 2BHHA 4D2VA 2QU5A 3O51A 4QQTA 5J5TA 1KE8A 2X7FA 2V5QA 2C3LA 1P5EA 4DFLA 3HV4A 1PMEA 3UMXA 3SXRA 4BI1A 3IK3A 2XIRA 4FIJA 4OTHA 5I9WA 3W8QA 2G2HA 4GRBA 3NUUA 5D1JA 1H1QA 5DA3A 1UNHA 5C01A 2ITPA 3O71A 1OL5A 3UP2A 2XNGA 2F7XE 5A4LA 3QBNA 4EH9A 2O8YA 1WFCA 3RALA 2R3NA 2C69A 4XCUA 3QZGA 4ZMFA 2UV2A 3JY0A 5J8IA 4DTKA 5AX9A 2IW6A 4L67A 2WMXA 5C4KA 2EB3A 4AT5A 3G5DA 3MH1A 4L43A 4M0YA 3FY0A 3NNVA 2W5AA 3B8RA 1UWJA 3MFRA 5LJJA 2NRUA 1ZOHA 3ALOA 4O86A 3HMIA 4YZBA 2YLEA 3MBLA 3LCTA 4ZXTA 4C61A 3BHHA 4JAJA 3GI3A 4W8EA 1H8FA 4HGLA 5CENA 5GJDA 2BHEA 2VWXA 4EQUA 1H00A 3DZQA 3FMMA 1XBBA 3M1SA 5I3OA 4BKYA 4ZP5A 4KAOA 4BL1A 4NYEA 4MK0A 2HZ4A 3F5GA 3AC3A 3KMWA 2EWAA 3NAXA 3NCZA 4R1YA 3ROYA 5JGBA 5KBRA 4ALUA 3BU3A 3CKXA 4RIWB 4MQ2A 4LGDA 4O21A 4EC9A 1O6LA 4TRLA 2YERA 4RIXA 5AUUA 3KRXA 3F3WA 4NKSA 5IA2A 4IWOA 1AQ1A 4GT3A 5HE3A 4WG5A 3EFKA 4G3EA 3BX5A 4BI0A 3EOCA 4PMMA 4DEGA 3DQXA 4BDGA 1JKSA 3P1AA 4QP7A 2GMXA 3GCQA 2ITYA 3GNIB 4D4VA 1Q8ZA 3EIDA 1I44A 3FMHA 2W5HA 3QKLA 1YDSE 4FL2A 5H8GA 4XS2A 3DB8A 4F9YA 4AGDA 4KNBA 5CYIA 1CKJA 1OL6A 4WNOA 2GHGA 5AAGA 4RWJA 3BWFA 3FHIA 2WFYA 4FYNA 4L7SA 3N4VA 3M2WA 4OBOA 3DKCA 4XOZA 3UOHA 4AUAA 3ZU7A 5HBHA 3V8SA 4E6DA 4DEHA 2XYUA 2PPQA 2ZV9A 5JGDA 2YZAA 2YLFA 5IQGA 4CFVA 1Q99A 5EI6A 1IASA 1BI7A 3HDMA 1CM8A 2R3MA 5LWNA 5CF8A 3FBVA 3O2MA 5LVNA 2B9FA 4QP4A 5M09A 3HV5A 3AG9A 4IM2A 3PY3A 3CXWA 4YPSA 4I23A 4O1OA 3V6RA 3T9IA 4QTBA 5LMKA 5F1ZA 3NUPA 3EKNA 3RKBA 3H9FA 4AU8A 3DFAA 2IZTA 4C62A 2WTKC 3I4BA 4N57A 1STCE 4GK3A 4L7FA 4M69B 4E6CA 5FM2A 2R3IA 4U80A 4A9TA 5HD4A 4H36A 2X4FA 5TR6A 2UZTA 4YNEA 2C6IA 3QC4A 3QCYA 4OBQA 3QRKA 3LFNA 3LXLA 5HIBA 2X6DA 4FGRA 1W84A 3ROCA 4F7LA 2XNEA 4G1WA 5ANDA 4Y83A 3ENMA 4DF3A 1WBVA 4M66A 3C13A 5CU3A 4O7ZA 3O7LB 2QR7A 4WIHA 1DI8A 4G3GA 3D7TA 3MPAA 3SV0A 3DS6A 3EQRA 5E7RA 1PRYA 4DEEA 4DH5A 3QD3A 3DAJA 2Y0AA 4IZ7A 5DR6A 3R8UA 4O82A 1U54B 5IA1A 5J7HA 2EVAA 1MP8A 1ZOGA 4A9SA 4FR4A 5KMIA 1WVWA 5ANIA 3U8WA 2WXVA 1GIJA 3BLRA 4HCUA 3ZBFA 3EQFA 1LPUA 1X8BA 2UUEA 2XIYA 4U3YA 3KULA 4QP9A 2IVUA 3KMUA 3NIZA 3AGLA 3L1SA 2YJSA 5IG1A 3GT8A 2PMLX 3VS3A 4RLKA 4CT1A 3EQDA 4DFXE 3OD6X 3LXKA 3SGCA 4O7SA 2XJ2A 4L6QA 5HG8A 2WMSA 5HO7A 3DKFA 4I0RA 2R3HA 1Q24A 2JC6A 3BPRA 3R2BA 4GUEA 4FEWA 1Q8WA 4CVAA 3PA5A 3HAVA 5T6KA 5CU6A 4Q9ZA 4PL4A 2G01A 2O3PA 5TO8A 3C1XA 3GFEA 4PDYA 4DINA 3HMNA 2H8HA 4LOOA 4TL0A 5CAVA 2QG5A 3BHVA 4R3CA 5HE2A 1WBSA 5E8XA 5C9CA 3RPYA 4C35A 1PXJA 3B2TA 1URWA 3PVWA 3FV8A 4WT6A 4IDVA 2BRBA 4TYHA 3UVQA 4ZSAA 1JVPP 3NNXA 4GG7A 4CFXA 4D2WA 2J9MA 5IEXA 5L6WL 2Q83A 1XH4A 4FL3A 3JR1A 4YZCA 2LGCA 4IB5A 4NIFB 4WO5A 4BDBA 1YHVA 1YXSA 2VTJA 2ITOA 3VS7A 3HAMA 3NNWA 2RG6A 5BQ0A 5HEZA 5KHXA 4FTAA 4FEUA 2UW3A 2H96A 5HTCA 5DPVA 3G6HA 5HVYA 4D2PA 2X7GA 2CLQA 2VWBA 2JIVA 3NYXA 5AP1A 3UIMA 1YXTA 2W96B 2XEZA 2OFVA 1NXKA 3DFCB 4E93A 4FSWA 5BVKA 1YXVA 2WTDA 2KTYA 2VRXA 5DN3A 1MRUA 3KMMA 3OZ6A 2H6DA 4QMZA 4FEVA 4ORKA 4QMMA 2F4JA 2XK7A 1ZYCA 2ERKA 3Q9WA 4GU9A 5CU0A 5AP4A 2Z7SA 2BRHA 4AWIA 4ASZA 3OROA 2YCQA 4WRGA 2X7OA 1XH9A 3NRMA 1SNUA 4BF2A 1KUTA 2XNMA 3ORXA 1XH7A 4F70A 3ERKA 4FNZA 4FTJA 3PPKA 5DYJA 4G3CA 3CGFA 3NW5A 4QMXA 5BUIA 3WIGA 3CEKA 1GIHA 2BILB 2YAAA
chains in the Genus database with same CATH superfamily
2XYNA 5CZIA 4ZLZA 2ONLC 3F7WA 4LUDA 4WBOA 5CZHA 5K3YA 2VTLA 3PJ8A 3VBQA 4CNHA 3BGZA 3IPHA 4BTKA 3E8DA 5I0BA 4EH5A 2X0OA 1Y57A 4U40A 5KMJA 3VJNA 2YISA 4RJ4A 4BFMA 4WRSA 5FWKK 2WNTA 4XX9A 2LAVA 2RFNA 2QHMA 1H0WA 2W1GA 4E5WA 4UMRA 2GQGA 5KZ0A 4YZNA 3W0QA 4KBCA 4D1ZA 1JPAA 4FKQA 4P90A 3TZ8A 2C6DA 2CHLA 4YBJA 4YJPA 4C3FA 4C2WA 2XAMA 2W1EA 4BN1A 3KL8A 3PYYA 4PNIA 4QNAA 4WKQA 3MI9A 5IA5A 2WQEA 3LCKA 4FSMA 3N51A 3NYNA 3EN4A 4J1RA 2BZHB 5DOSA 3F2NA 4GJ2A 1ZZLA 3L9LA 1YKRA 4D2SA 5AR7A 4H3QA 1FQ1B 1TQIA 4K0YA 3MPMA 3PFQA 4AGWA 3PLSA 4EQMA 2FVDA 3BV3A 4FF8A 3SA0A 5AR8A 4DCAA 4KIQA 2XK8A 5CWZA 1OKZA 2R3RA 3QALE 4G3DA 3P5JC 3KA0A 2OWBA 3CCNA 2B55A 3OT3A 2CN5A 4V05A 3FSFA 4QYFA 3A61A 2X9EA 1OB3A 2JBPA 2Y7JA 3PRFA 5ACBC 5DVRA 3D5UA 2CKPA 5IISA 1Y6AA 1WVYA 4YURA 2ITZA 3SW4A 1MUOA 4CT2A 2ZYBA 1YOJA 2YITA 3KVWA 3HMOA 3R8ZA 4QYEA 5LMKC 1H27A 3OOGA 3OW3A 4XBUA 1DM2A 2GFSA 3Q5ZA 3EL7A 3UNJA 4MBLA 5A4TA 5I3RA 2PVYA 1ZMVA 2Z60A 4QTDA 1CKPA 4XMOA 1NW1A 3ZRKA 4GT4A 3JY9A 5JQ5A 2PVFA 2PZRA 3D5VA 1TKIA 4IANA 4BVUA 3ZBXA 1HCLA 2VTAA 3F88A 2FSMX 4W4WA 4XLVA 2QKRA 5HVKA 4RGJA 4XG2A 1YRPA 4X3JA 4Q9SA 3E93A 4N6YA 4R8QA 5F4NA 3MJ2A 2VTIA 2R0IA 2FUMA 2ITQA 4PTCA 4TYGA 4CRSA 1GZOA 4U0IA 3TNQB 3RM6A 5CQUA 2UZEA 3BGPA 4FIIA 5D7AA 2VWIA 5E8UA 2E9OA 2VTPA 4JBVA 4XV1A 4HJOA 4YJTA 3HGKA 2C47A 3F3UA 5DG5A 3IW5A 3UPZA 3U54A 4NM3A 2PMIA 1WAKA 2OXDA 2GHLA 2FO0A 3GC0A 1Z5MA 2X2LA 3DAKA 2XP2A 4HNIA 1H24A 4K11A 4FG9A 4I20A 5L8KA 2QHNA 4F1OA 4WNMA 1J1BA 4L00A 1PYEA 3ZYAA 3DPKA 2AEGA 1REJA 5ETIA 3F5PA 3PLAE 4CFNA 5LQFA 3DZOA 2YACA 3MPTA 4FSNA 4P5ZA 4EJNA 4X2GA 4I4EA 4OLIA 1MQBA 4GYGA 3V6SA 4OW8A 5DI1A 3QKMA 3OY3A 4CQEA 5J9YA 5A9UA 1SVGA 3BCEA 4S30A 3TXOA 1JAMA 2QU6A 3WBLA 4DFNA 4J52A 3KC3A 4HVSA 4FA2A 1CKIA 4R7IA 4R77A 1CDKA 4H1JA 3UIXA 2JLDA 3LMHA 4DE4A 3EFJA 1URCA 5JN2A 4HNFA 4OTFA 4GVAA 3VBYA 5JMSA 4PP9A 4GJ3A 3H0YA 4TZRA 2PVJA 4FRFA 5J79A 2CPKE 2WMVA 4BB4A 4ZSGA 2YEXA 4U5JA 5AP5A 3LFEA 3DGKA 5E91A 4FTQA 4B9DA 3FI8A 3COKA 3GQLA 5AR5A 2BFXA 1FGIA 3DXQA 2I1MA 3D14A 3IONA 4BIDA 4FEQA 4HOKA 3NUNA 4JL9A 3PJCA 4C0TA 4ERKA 5A3XA 2C1BA 3AC2A 4KIKB 3ZO4A 1H07A 3QYZA 4BCOA 3R1SA 2HELA 4C02A 4RA5A 3ZS5A 2A98A 3BZ3A 4A4XA 2E9PA 3EQGA 5BV3A 1BUHA 2I40A 3CBLA 3W2QA 3T9TA 2X2MA 5HICA 3VBWA 4YHTA 4ACHA 4RSSA 4F6WA 2WTJA 3FZOA 4ZMEA 3LE6A 4QYYA 5AUXA 3KY2A 4QMYA 2QR8A 3R8MA 4BCJA 3PXQA 4ZSJA 4F0GA 4YUQA 2FA2A 2A27A 2WMBA 4KIKA 3GP0A 3R7OA 4F7NA 1CTPE 1Q5KA 4MF0A 5EHLA 4D1XA 2R4BA 4F7JA 1PXKA 2C5OA 4C4EA 2GFCA 3WF5A 4YP8A 1G5SA 2HIWA 1OIRA 4JIKA 3U55A 3E8CA 3FY2A 3OXTA 3CTHA 1OECA 5FTQA 5TT7A 2QC6A 1ZYSA 4BC6A 3QKKA 5CNOA 2X0PA 1REKA 2BRGA 3CD3A 4R3PA 3GFWA 4QDEA 5M06A 3SXSA 4XUFA 2IEWA 2QCSA 3FL5A 3KGAA 1TFFA 4AAYA 4AZWA 3W0NA 3CQEA 5EYDA 2OZOA 4C2VA 2GTNA 1QPDA 4NUSA 3RAKA 5M56A 4IB1A 2JKKA 2ZM4A 5FLFA 3DKGA 2WTIA 3TIZA 4DG3E 4IAYA 4J8MA 1FOTA 2UVZA 3ZXTA 3FQSA 3R7UA 4DFBA 2BFYA 1XO2B 4UY9A 3I1AA 4XOYA 4RRVA 2BAJA 5B2LA 2VX0A 2QI8A 5JFVA 2GNFA 3FDNA 4M0ZA 3VBVA 3R9HA 4I5MA 4CZTA 3QA8A 3ETAA 1UV5A 5AP6A 4ZZNA 4JIAA 1UKHA 4OTGA 4MNFA 3QGWA 3RMFA 3LKMA 3MV5A 2PVHA 2UW6A 4L01A 4M7IA 5C27A 2VGPA 3QTIA 4FTKA 1ZMWA 3LW0A 1J3HA 5FUTA 4EOOA 4JXFA 4U43A 3IO7A 3P5KA 3G51A 1F3MC 2YM7A 5AX3A 5I4NA 5JGAA 3LQ5A 3UP7A 3MY5A 2OIBA 4IM3A 4CCUA 3F9NA 4M8TA 3R0TA 3UGCA 4BGGA 5IQHA 4RX5A 4HZRA 3A7FA 5E92A 4XP2A 1RDQE 1R1WA 4MD7E 1KE9A 4QTCA 4UYNA 2UZVA 4NZWB 2YIRA 4IHPA 3A7JA 4N70A 2E9UA 4G17A 2JDSA 3ULIA 2YN8A 5AJQA 3N9XA 5BYYA 3QL8A 3PVBA 4ANSA 4B99A 4MEDA 4O7LA 3EN9A 4IX5A 3AD6A 5EHYA 5DFPA 4PL3A 4ONAA 3CQWA 4IVBA 4FEXA 1Q97A 3KU2A 4U3ZA 5CI6A 2XBJA 3TIYA 5JRQA 4GIHA 3L8XA 2PMOX 2YAKA 4R3RA 3TNPC 4HZSA 4ASDA 4I0SA 3R9DA 4FOCA 4CQGA 3A60A 4YJRA 1LEWA 3HZTA 4O0WA 3KXMA 4GG5A 4ID7A 2VTRA 3AQVA 4IC7A 4I5PA 3ORTA 5JZJA 4XNEA 2WQMA 3B8QA 4IQ6A 4XP3A 5FBOA 5L2WA 3PXKA 5M4CA 2NNWB 1FPUA 3DBCA 2IN6A 1H01A 2IWIA 4RVLA 5CU4A 4IAKA 5J95A 3VN9A 3VUTA 3SVVA 4NIFA 3OT8A 3W32A 3ODYX 4FIHA 4YLLA 4AA5A 1A9UA 2O5KA 2ITWA 1CSNA 1H08A 4CYIA 3GU8A 3S00A 4BBFA 4O7RA 2R9SA 1YHWA 3Q04A 3OTUA 1UU8A 4NM5A 2QOCA 4J96A 4KSQA 3AKKA 2ZVAA 3RPOA 1PW2A 1SM2A 3E62A 3MW1A 3UPXA 4A4LA 5DMZA 1RQQA 3CKWA 5GIPE 3DB6A 4ZIMA 1O9UA 4GT5A 4ZTLA 3FC2A 1VJYA 3H9OA 4D2TA 2BRMA 4MH7A 2PYWA 4AZTA 1R39A 2YFXA 3NUYA 5CSWA 5L2TA 1KE5A 3I0OA 5EHOA 1YQJA 4KKEA 2CNQA 4CLJA 4E6QA 3GC9A 3R1QA 3DBEA 5DNRA 3C50A 5HCYA 5AA9A 4Q2AA 4ANQA 4BCHA 4LM5A 2FSOX 2VZ6A 4L53A 1CMKE 4B8LA 3UVPA 4EOKA 4DBXA 3P78A 2GQRA 2G2FA 1WBWA 4EZ5A 4JRNA 1GNGA 3CPBA 2XKEA 4EH4A 3ANRA 4CMUA 4Y5QA 2XNOA 3ZONA 2CDZA 3LOKA 4JDIA 3RCJA 5IA0A 4Q5HA 3MYGA 1E9HA 1O6YA 5DR2A 4AE6A 2UW5A 4FUYA 4HYSA 4C4HA 3MIYA 4X6QC 3ZOSA 5BMSA 2C30A 4IE9A 3DK3A 4BTJA 3KEXA 3O5AA 3QCQA 2VX1A 3OWPA 3HMMA 3QXPA 4RVTA 3R7EA 2Y4IB 4ZJJA 2ZV2A 4BCMA 3MTLA 5AP3A 4HVDA 2JGZA 1YI6A 3PY1A 4ERWA 1M52A 4U45A 3EQHA 4W4VA 5CVHA 2J0LA 4OTIA 5HG9A 4KD1A 4R78A 2A0CX 4EORA 2PZYA 3F5UA 2R3LA 2H34A 5F9EA 3AOXA 5IU2A 2XM9A 3W0PA 2RGPA 4JR7A 3N4UA 4LV7A 3HRCA 4RJ7A 3ZMMA 4OTDA 4DH8A 3KB7A 4YJQA 4E4NA 1OPKA 4O6LA 4C58A 3E8EA 4YTIA 4DITA 1NA7A 3PE1A 4NH1A 4ZLYA 1F5QA 3QLGA 4CD0A 3P08A 4RMZA 3ORZA 4YJVA 3VQHA 4BWPA 2YM4A 4FTNA 5M07A 2PHKA 4HVGA 4L46A 3I7CA 2SRCA 4UZHA 3RAHA 4KKHA 3OBGA 3DA6A 3KK9A 5ETCA 4EZ7A 3BWJA 4JMQA 4X21A 2B54A 3RP9A 3VWAA 3C4XA 4NWMA 3DNDA 4EOSA 3ELJA 2GNLA 4DAWA 5I9YA 4X0MA 4PUZA 4I0TA 5HBJA 2ZMCA 3C0HA 1M14A 3W1FA 3EJ1A 4IVDA 4QMNA 4XG6A 3QHWA 3ZLSA 2FSTX 3OCTA 4XV2A 3C4CA 4DFZE 5CEOA 4CKIA 4FKIA 4I94A 4QMTA 2WMRA 1J7LA 3VF9A 4B8MA 1OVEA 1MRYA 4OGRA 3GCPA 3N4TA 3FPMA 3CPCA 4TYEA 2WD1A 5FD2A 3ORNA 4XG8A 4FSTA 3H30A 1R3CA 3A62A 3VF8A 1QPCA 1XBCA 4E20A 1TZDA 5EDRA 4D9UA 5M53A 3S0OA 4C38A 5AUWA 2IW8A 4BCNA 5BNJA 3UIBA 3E8NA 5E9EA 5CT0A 3CGOA 4FV8A 4AN9A 1UU7A 3PSDA 4DDIA 3Q4TA 4XJ0A 2PL0A 1ZARA 1AD5A 3Q2MA 3HV3A 5EOBA 4FUXA 2W1HA 4CLIA 1GY3A 3I7BA 3IW8A 5J87A 3WZEA 4EI4A 4BCPA 1W7HA 2NO3A 3QFVA 1XHAA 4CTBA 4PTGA 4JT3A 3L8VA 4K9YA 4TWOA 1H4LA 3M42A 2WQOA 4YZMA 4YC8A 1V0PA 2BDJA 3MA6A 3GU7A 1JSTA 1GZKA 1SVHA 2GNHA 3V5WA 3K5VA 3KK8A 4TYJA 3ID6C 4M68A 1UU3A 2C4GA 4WD5A 2J6MA 2XALA 1JOWB 4L45A 2ZDTA 4LRKA 2J0IA 3IGOA 1WCCA 2I0HA 5LCKA 5AV1A 3FPQA 2W4OA 4BKJA 4RQKA 3R04A 4DT9A 3LCOA 3O8TA 3R9NA 3U6IA 3KREA 2IVVA 3ULZA 2XCKA 3FQHA 5G6VA 4DHZA 4U44A 3G33A 5CEIA 4NCTA 3FLYA 2B9HA 5D10A 3OTVA 3I0QA 4HGSA 3IGGA 4ASEA 3ET7A 2ZAZA 3QF9A 3KRWA 1ZXEA 5ANGA 3U6HA 5AEPA 4FV0A 4BDKA 3EN6A 2BR1A 3PTGA 3PZHA 3UOJA 1V1KA 2BZIB 4O0UA 4FNYA 1FMKA 3HA8A 2B4SB 3JUHA 3HNGA 4FTLA 4XYFA 3BGQA 4BI2A 5IQBA 4BCIA 4O1PA 4FKSA 3POOA 4KS8A 4HPTE 3P4KA 4L68A 4XV9A 3UNZA 4BCFA 1RE8A 4U7ZA 4D9TA 1OGUA 4L42A 3KXHA 1JQHA 3QZHA 2X0GA 4EKLA 2P2IA 4EOMA 4BDCA 5E8VA 1L3RE 5DR9A 4CKJA 2XAOA 3ZCLA 4KSPA 5BX0A 5KZIA 4HVHA 4BGHA 3TUCA 4WG3A 3QWJA 4AT3A 3UG2A 4C36A 4FE2A 2CNUA 3P7BA 4XG9A 5HI2A 4EBVA 3EN5A 3P9JA 4JG6A 3QUEA 3Q6WA 2JFLA 1H1RA 3NR9A 5HG7A 5AIRA 5JRSA 4MXCA 4ITIA 3VUMA 4YSJA 3GGFA 2YA9A 3EQPA 3VNTA 5IUGA 4BTFA 2Z02A 5GJGA 1ZMUA 3SXFA 2V22A 4QD6A 5D7VA 5AM7A 5DWRA 3GOPA 4IXPA 3D4QA 4TYHB 3LFFA 4CSVA 5A46A 3DDPA 3QAME 4FV6A 4DEBA 4IAFA 4K1BA 5ICPA 2B0QA 4YMJA 2E9NA 3HP2A 3GCUA 5KCVA 1K3AA 4I92A 2IJMA 4WG4A 4BBMA 5B7VA 5K0XA 4QPAA 1PMVA 3P7AA 3PPZA 2QOLA 2OICA 3FHRA 4UV0A 1ZYJA 1DI9A 5GZ9A 3WE4A 3GENA 3RWQA 4FSQA 3S3IA 5E4HA 1G8AA 3FQEA 4X6RA 5FBNC 3TCPA 2BALA 4YO4A 2ZV8A 4Z7GA 4E6AA 4WBBB 5KKRC 3KXNA 3RTPA 3C4FA 2XNPA 3LFDA 3MH2A 4MYGA 1Q4LA 1OKVA 5CSHA 4AZVA 4F9WA 5BUEA 1VLRA 2GNIA 4MCVA 4AA4A 4FGBA 5FGKA 5KMMA 3LQ3A 2I0VA 2XKDA 2R3GA 4LYNA 5CI7A 4FT3A 3G0FA 1WBOA 4ZZMA 5JFXA 4FZDB 2FYSA 3U4WA 4AE9A 4KWPA 1YOLA 4PV0A 4CMTA 4ARKA 1OPJA 4MXXA 5EQEA 2RFDA 5JFWA 1KSWA 3QQUA 4BZNA 3TACA 5L8LA 4JAIA 1J91A 2R3QA 4LUEA 2R5TA 3ORPA 3II5A 5CSVA 5CVFA 3KRJA 3FZRA 5EG3A 4D4RA 4N4SA 4EUUA 4AXDA 3UO6A 3OXIA 4ALWA 3UOKA 5JEBA 3H0ZA 2QO9A 1Q8TA 4UALA 3ACJA 5IH5A 3DDQA 4I6QA 4YJSA 4O96A 2X8EA 2BPMA 5F94A 3JYAA 5EKOA 2EUFB 2JKOA 3FZSA 3WILA 4GFOA 4JG7A 3BHTA 3KN6A 3S2PA 4O7YA 1WBTA 4C8BA 2JBOA 5AA8A 4O4DA 5KKRB 5JFSA 5J9LA 3Q4ZA 2ZM1A 4FKTA 2JIUA 3MVHA 2EB2A 3Q4UA 3FL4A 3KKVA 2BZKB 3AC5A 3NGAA 4KINA 4W4YA 5C8MA 2HWPA 4OAVB 1ST0A 4EHEA 4Q5EA 3R71A 3S95A 3W8LA 2OXXA 3O0GA 3PDTA 2VNYA 4ZK5A 5L3AA 3QQLA 3C4ZA 2XIKA 1WBNA 4ACMA 5CEPA 3SRVB 3Q6UA 3VBXA 2ZJWA 5AM6A 3TV6A 4BCGA 4A4OA 4O7NA 5EKNA 2HWOA 4EKKA 2C6TA 2J0JA 4IIRA 4ZOGA 4ANMA 4FJVA 1Q61A 4AW2A 3BE2A 2GTMA 2AQXA 3U87A 3ZRLA 4BJJA 4IWPA 2PUUA 2VWWA 3LFAA 1IA9A 3E87A 5FTOA 4O2PA 4O0XA 2GNGA 1M7QA 5KMLA 4YC3A 3OFMA 4AQCA 3EWHA 3FUPA 4MXOA 4MVFA 1OIUA 3O17A 1OZ1A 3V04A 2DWBA 3RWPA 2WMTA 1GZNA 3HV7A 4E73A 2REIA 1NY3A 1XJDA 2BVAA 4M84A 4ZY4A 5FEEA 2JITA 4FVPA 4LV5A 3DLZA 1J7UA 1PMNA 5EI2A 3PIYA 3RHXA 4Z3VA 1K9AA 5E8TA 4FT0A 4MXYA 5IKWA 3VUKA 5M44A 3SW7A 2R2PA 3WZDA 4HYIA 1ZAOA 3FMLA 3REPA 5C8KA 1F0QA 4R5YA 2OF4A 3PWDA 3R30A 4OBPA 4QTAA 5T3QA 2O65A 2VWUA 5KMOA 3BHUA 4GCJA 2C0IA 3V5TA 4AZFA 4L3JA 3VW6A 3AD4A 3HVCA 2O63A 3SOCA 4XG7A 3Q9ZA 4H3PA 3MFTA 5CU2A 5HCZA 2FGIA 4LG4A 4A9RA 2BKZA 4AOTA 2UZBA 4WSQA 4RFZA 2XRWA 3GQIA 3MB7A 3BRBA 3EHAA 3UIUA 4CV9A 3UC3A 3GC7A 1FINA 2C3KA 2OF2A 5KMKA 3VUHA 2Z2WA 3NYOA 2J4ZA 4AW0A 5EFQA 3CY3A 4C4IA 4G5PA 4AG8A 4C37A 4UEUA 4NKAA 1Q41A 3CJFA 4IJ9A 4TYIA 4I5CA 2GNJA 4NJDA 5CSXA 4AXFA 4TTHB 2PTKA 2WTKB 2RG5A 2HCKA 4IVCA 4JBPA 4V04A 4EH7A 4E7WA 3QUDA 4ZY5A 5AUYA 3PXYA 3QWKA 5E8ZA 3S1HA 4D4YA 5M4FA 2PULA 4FKGA 4NM7A 3A4OX 4QMQA 5KBQA 4S32A 2QODA 4BDIA 3ZO3A 3V5PA 2I0EA 3GXLA 1W2CA 3KRRA 3R73A 3NFGB 4FKRA 2ACXA 3ML1A 4FTOA 4NFMA 4F4PA 1G8SA 5AV4A 2OH4A 4R7BA 3NW7A 2WB8A 3OW4A 3TUDA 4FT7A 3ZLXA 5CALA 5IQAA 3CS9A 2GS6A 2PK9A 1PXNA 5AIKA 4USFA 3UZRA 2XK9A 3MJ1A 5HO6A 3VO3A 2Z7LA 3RI1A 3UVRA 3KF7A 2Z8CA 4NTSA 4MX9A 2X8DA 3BV2A 1R0PA 3BLQA 4O4CA 4RZVA 2OZAB 2HENA 2W4KA 3NX8A 3SC1A 3SG8A 3FAAA 2WKMA 2WTWA 5K0KA 2HW7A 2OXYA 4XRJA 4AGCA 3LXPA 4J8NA 5BUJA 4S2ZA 3WZUA 4J53A 4ITHA 4EQCA 3G0EA 5AAEA 3BL7A 2PWLA 3BQCA 5IA3A 3A2CA 4DBNA 5L6PA 4EK3A 2WMAA 4WNKA 3QD4A 2XARA 3MVJA 3JVRA 4FSUA 4NW5A 4EK5A 5K4JA 2V7OA 2QNJA 3EYHA 4WUAA 5B2KA 1I09A 3IKAA 3OWKA 4K2RA 4IZYA 4QPMA 2JKMA 4V01A 1NVSA 1B38A 3FZPA 4FV5A 2G1TA 3QTXA 3V8TA 1NVRA 4ZSLA 2UVXA 3S4QA 3QUPA 1BL6A 4FNWA 4RWLA 1GJOA 3NZ0A 2WGJA 4U97A 5D41A 4BWKA 5HGIA 4BKZA 4NJ3A 4O7VA 4X3FB 4LL0A 1YOMA 3VHKA 3MA3A 1XH5A 4CZUA 2E2BA 4M13A 5EW3A 5FEQA 5IQCA 3OUNB 3QCSA 1UVRA 4U6RA 3C7QA 4X7QA 1ZLTA 4FIEA 3ZC6A 1IAJA 2PVLA 4G6NA 3PXZA 5I9UA 3QRJA 4MBIA 4KIPA 4UMTA 4ALVA 1APME 4R1VA 4AFJA 4J7BA 5EI8A 3KN5A 5D12A 4Z9LA 5HO8A 1G8JA 3MS9A 3WF6A 2JDRA 2W1IA 5M55A 2C3JA 2YM5A 1BLXA 4TWPA 3WZJA 4F6SA 2Q0NA 2VTNA 2WMQA 4UMPA 3RPRA 3UO4A 1OPLA 3FLWA 3L8PA 3W55A 4BTMA 5K4IA 4BY9E 4I93A 4CG9A 1TVOA 3DJ7A 3MB6A 4AX8A 2BIYA 3R63A 4IAZA 3RJCA 1T45A 4RT7A 4RJ6A 1YWNA 4WUNA 3ZDIA 4QP2A 5BVEA 4OR5A 3NUAA 3KCKA 3H9RA 3QRIA 4D55A 3U6JA 3MY0A 2PZPA 3F3VA 5CXHA 4YHJA 4FKJA 2X2KA 4AW5A 1VYWA 4DH7A 3KXZA 1JWHA 4FV7A 4EOJA 5BVWA 4EONA 4C34A 3JS2A 2JEDA 1H28A 2BAKA 3BBTB 3KXGA 2UZUE 3R9RA 5JZNA 4QP1A 1YHSA 2VWVA 5F95A 5CF6A 3RVGA 1XR1A 2QOKA 3BU5A 2BZJA 4FV9A 3ZSHA 3MGYA 1IA8A 3OXZA 4UXLA 4YNOA 3EKKA 3UG1A 4E5BA 5HLPA 2ITUA 1YI3A 2C6KA 1ZY4A 5CEMA 2BAQA 4QQCA 2O2UA 5T68A 3FE3A 3CTQA 5DE2A 4H39A 3VULA 1ZY5A 1Q8YA 3R1NA 4E4LA 2XKCA 4YTCA 3MIAA 5JKGA 2A19B 5DBXA 5CAPA 4NSTA 3R7YA 4YR8A 2OW3A 3PJ1A 4YU2A 4TPTA 1W83A 2WU6A 2JIIA 3LFSA 4TWCA 4RPVA 4FI1A 5CAOA 3KQ7A 5DEYA 5ITAA 4DG0E 4IB0A 4DT8A 2BDFA 4QMUA 2A4LA 5CVGA 3VS4A 1PKGA 4WA9A 3RZBA 4I3ZA 2CKOA 3IDCA 4W9XA 3F6XA 3W16A 2J0KA 4O6EA 1PYXA 3OHTA 4UWBA 1SNXA 3PE2A 4RIOA 3AKLA 3EMGA 3LAUA 4ZTSA 3ZM9A 4QO9A 2ONLA 4FTRA 3WYYA 5AP2A 2OKRA 3VJOA 3F3ZA 3HUCA 3TV4A 5AUVA 2UZOA 3KVXA 3E5AA 3D94A 4DFYA 2OJGA 3BHYA 3RBWA 2GCDA 4E8AA 4FZ7A 4AZSA 4JR3A 3QRUA 2V62A 4G2FA 1UKIA 4H3BA 1WVXA 2XH5A 3HRBA 3PY0A 3CLYA 4Y85A 4GW8A 3UDTA 3L9NA 4HCTA 2QO7A 4MWHA 4FG8A 5HD7A 4NU1A 2JD5A 2XEYA 3QTUA 1QCFA 4IC8A 2BTRA 3ZZEA 4QMWA 3G2FA 3Q32A 5FTGA 4RC4A 4IDTA 3SX9A 3Q96A 4QYHA 4YBKA 4EL9A 1XBAA 3TN8A 2WO6A 3TG1A 3LFQA 5CANA 2YIQA 3HDNA 2DQ7X 5CF4A 4FV1A 3QA0A 3UZPA 2X4ZA 3O23A 2V0DA 3PJ3A 4EHVA 4RZWA 5J7BA 4MBJA 2ZFYA 2QOHA 2XA4A 3RAIA 4NM0A 5M57A 1A06A 3DJ6A 2HYYA 1OITA 1BKXA 3RM7A 3ZRMA 4YTFA 1YW2A 4FTCA 2PUNA 5M4IA 2GS2A 2P0CA 4EBWA 2XJ1A 4O2ZA 4U42A 4UMUA 3WF7A 3LM5A 2ZOQA 2Y6OA 3FI2A 2VTMA 1B39A 1Q8UA 2WPAA 1EH4A 3WF8A 4IJPA 1XQZA 4G5JA 2W9ZB 4NT4A 3Q9YA 4QOXA 4ZY6A 3NWWA 2E9VA 4I1ZA 3FXXA 3O8UA 3ZTXA 5CNNA 3TMOA 3A4PA 2GS7A 4AF3A 3CD8A 5A6NA 3IW7A 2PVRA 2OJJA 4CV8A 4F0IA 2B9IA 4D0XA 3P79A 2ZM3A 2UZDA 1M2RA 2A2AA 2HOGA 5BVOA 4Y5HA 4C4JA 1PKDA 4DA5A 1OL1A 4ENYA 2XNNA 3RGFA 4AACA 5AP7A 4N6ZA 2G2IA 3ZM4A 1Z9XA 3OEZA 2P4IA 4Y72A 4YZ9A 1IRKA 4ANBA 4MUQA 1P14A 1PXLA 1MRVA 4ASXA 3E92A 4L9IA 4TW9A 5HCXA 2Y6MA 3F66A 4AOIA 4OTRA 4FV4A 3D83A 2HZNA 2QD9A 1A48A 1UA2A 2VO0A 4AP7A 4AXCA 4NTTA 4AQKA 5IUHA 2CNVA 4GUBA 4BCKA 2J5EA 3OWLA 4YC6A 3UOLA 3VC4A 4FMQA 4GKHA 3R7VA 3BI6A 5IA4A 4LGHA 4NEUA 5BYLA 1E1XA 4EHGA 3PXRA 4ZLOA 3DNEA 4BDAA 2HZ0A 2YDJA 4ZTRA 4IEBA 4CCBA 1L8TA 1ZRZA 4DLIA 4RJ8A 2I0YA 2B53A 1JLUE 3D7ZA 4S34A 3ZH8A 5EK7A 4QTEA 5E1EA 2IO6A 4HGEA 2AC5A 2W1ZA 1PJKA 3NFFB 3V3VA 3UYSA 3R7IA 4CMOA 2J2IB 5A4QA 2IZUA 5IEVA 3TYKA 3A8XA 4MWIA 2PE0A 5HOAA 3AGMA 4RVMA 1R78A 1KOBA 4DEAA 4DGGA 4GMYA 1J7IA 4FTUA 1PMUA 5FQDC 4I4FA 5FP6A 4YGAA 3R8PA 4G6OA 1Y6BA 2YCSA 3DK7A 4JDKA 1KE7A 5HTIA 4FV2A 5L4QA 3GU5A 1P4FA 4CFUA 2OIDA 3F61A 3EQIA 3IW6A 4ZTQA 5FDXA 2ZB1A 2ITNA 3GCVA 4JS8A 5L2QA 4JJRA 3NCGA 4PRJA 4QMOA 3R83A 2QG7A 2IPXA 1OIQA 2HXQA 2CCIA 3FLSA 3LLTA 2CCHA 4E1ZA 1PHKA 4KA3A 1GIIA 2PVNA 4FSZA 5FM3A 1OMWA 3FMNA 3UYTA 3DBDA 2YABA 3QC9A 1OI9A 3PG1A 3QZIA 3R2YA 2A1AB 5IH4A 5IQEA 2QOQA 4MD9E 5AR4A 4GFG