3ISCA

Binary complex of human dna polymerase beta with an abasic site (thf) in the gapped dna
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA polymerase beta substrate specificity: side chain modulation of the "A-rule".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 110
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3iscA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 3iscA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 3iscA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3iscA03
5KG2A 4QZBA 4NLNA 2P6UA 3RB0A 3PV8A 2AGQA 1UA0A 5HRKA 4FHWA 1S0MA 1XU4A 2JZBB 4O0IA 4KLQA 3UQ0A 2FPLA 4DFPA 3RB4A 4XRHA 4I2AA 3SV3A 4MFAA 4ED0A 3UPQA 2HHTA 2BPCA 4AT7B 4RWNA 3QZ7A 7ICTA 3C1YA 2ASJA 1XSLA 5KFRA 2RDJA 9ICHA 3RJEA 4TUPA 3H37A 2ZH3A 5KFPA 1VFGA 4JWNA 9ICSA 2DR5A 4O3RA 4AT8A 2Q66A 3Q8PB 5J2FA 4RUCA 4J9PA 4DQRA 9ICTA 4RQ1A 4YMNA 4RWOA 9ICKA 4KMUA 4WC0A 1KSPA 3QE9Y 4ECZA 3G6YA 4EBJA 4WC3A 5KFXA 3T3FA 1OU5A 1L3SA 1A76A 1NK9A 5HREA 3QEAZ 4YVZA 7ICRA 2A1JB 2BCRA 2ISOA 2UVVA 3GDXA 3RJHA 4WCWA 3KTQA 2Q0ZX 4DL5A 4KLMA 4GXIA 3OGUA 2XCAA 1T7PA 7ICJA 4YMOA 4RPYA 1XWLA 2PI4A 4DS5A 4YD2A 4DFMA 5F2VO 4BXOA 2ZH6A 4KITB 4DOBA 5KT5A 4M47A 2VANA 1NJWA 3RRGA 1R89A 4I28A 2R8IA 4C8MA 4RQ5A 2XCPA 5KG5A 2BQRA 4UD4A 3JPSA 1V9PA 1JX4A 8ICSA 1MIYA 4QWCA 5CR0A 9ICAA 3PX6A 2KZZA 1TFYA 4ECSA 2P66A 8ICEA 5KFIA 4Z6EA 4DFKA 4BWMA 2KN7A 4NY8A 9ICWA 4Z6CA 3NTUA 2BCVA 4KLUA 4RWQA 3KHHA 5KFOA 1XS9D 3HWTA 1MQ2A 3ISDA 3PO5A 2UVUA 5DB7A 1ZQMA 1ZQWA 7ICIA 8ICFA 7ICSA 1ZQAA 4DF4A 4NLZA 5J2JA 1R8AA 1EXNA 2ATLA 3HJ1A 1TAUA 7ICKA 2C2DA 4PPXA 2W9BA 5KFEA 2BR0A 1JAJA 4EP7A 4UB2A 2R8JA 3RR8A 2NRWA 2UVRA 4ZH4A 5C5JA 1DGSA 3TI0A 1ZQPA 5J0YA 1KFDA 5DB8A 5L1LA 4O3QA 5HHHA 2BCSA 2J6TA 1UA1A 4EYIB 4M04A 1UETA 3EWAA 5DG7A 4IG8A 4KLEA 3PY8A 4RQ3A 4DSEA 3AUOA 1JXLA 7ICVA 5HRIA 4O3SA 1JIHA 1K1SA 2DVIA 3BQ1A 3LWLA 5KG7A 4JK1A 3RBEA 3T5JA 2M2WA 5HR9A 4X4RA 4F92B 3GIIA 5J2HA 4EYHB 3Q8QB 2HW3A 5CA7A 1D9DA 4X4QA 2JEFA 4F5NA 2FLLA 4FHYA 4E80A 3TANA 4Z6DA 4UB4A 1ZQLA 1ZQBA 4I2IA 4I2GA 1XSPA 2DPIA 2XGQA 1NKBA 4AT9B 2ZH7A 4QZHA 4DL6A 3RH6A 1XC9A 1NJXA 4I2EA 4AT8B 3JPRA 2RDIA 3NGDA 4DSLA 1BNOA 3M8RA 1MIWA 4TURA 1ZQTA 4YXMA 4M0AA 2BPGA 2F1IA 3PX0A 3Q8KA 4IR1A 2ZHBA 4F5QA 3LDAA 3RB6A 2XC9A 4IQUA 1UEUA 4QZAA 4KTQA 1U4BA 5CHGA 5KG3A 4J9MA 1Z00A 9ICUA 4TUSA 4XUSA 4EEYA 4ED8A 4O5EA 4F5RA 2PXIA 4MFCA 4KLOA 4DEZA 2PFQA 3UXNA 3ORYA 1NKEA 4RU9A 1NK0A 4PHAA 5D49A 4QWEA 2IHMA 2V4QA 4F8RA 4O5KA 3MBYA 3AQLA 2ID1A 2HHWA 2ZH8A 5KFYA 3G6XA 1JN3A 3THVA 8ICHA 4IRKA 4WC5A 1CUKA 8ICTA 1ZJMA 2O5AA 3PW0A 5KFUA 4DLGA 3OUYA 4F4XA 1ZQZA 1D9FA 4KLSA 4MF8A 4WBYA 5KFNA 5KG0A 3G6VA 3HW8A 5DBAA 1T4GA 4DSFA 3N4MB 4J9OA 3K4GA 1ZQEA 5DQGA 5EWGA 1NKCA 4I29A 3UXOA 3RBDA 1QTMA 1ZQJA 3MR6A 1RZTA 1DK3A 1TK0A 1RYSA 4NLGA 4DL7A 3V7JA 4GXJA 3FDSA 4F4ZA 2AQ4A 4B9NA 2W8KA 4F4YA 2KFZA 3WFPA 4Q45A 2VA8A 2ZHAA 4QZEA 1H38A 4O9MA 2C22A 5KT4A 4NM1A 2BCQA 3AQMA 5DEDA 1ZQHA 3Q8MA 4ED7A 5F9NA 3V6HA 2ZUCA 4FBTA 4M5DA 4IQWA 1AROP 4ECTA 4JV2A 2MAXA 2DR9A 4TQSA 4DF8A 4XQ8A 2FLPA 2C28A 5DB9A 7ICOA 1PZNA 5HHIA 4YR0A 4PHPA 1QSYA 3GFKB 3Q8LA 3MR3A 1NK8A 4WC4A 5HC9A 2VA3A 1PX5A 5DQHA 2BPFA 3BQTA 3ISCA 5KFMA 2AGOA 4QZDA 4KN7A 4RPXA 4ECRA 4NXZA 4DLEA 4P4MA 5J29A 1NJYA 5DECA 4UAZA 1ZETA 4YG2A 4XA5A 3RR7A 3C5FA 2HVHA 4Z6FA 4R63A 8ICXA 4UD5A 3PX4A 4X4VA 2LYHA 3H39A 4YXJA 3C2LA 9ICNA 4C8OA 1WOTA 5KFVA 1WCLA 2H5XA 2ZH4A 3B0YA 2XY7A 5L1JA 3HPOA 3AU6A 4X5VA 1D8YA 2HHPA 4X0AA 3MGIA 3OJSA 3H4BA 1TK8A 3PW5A 4YR3A 5DQIA 4C8LA 3JZ0A 1KFTA 9ICFA 4KLJA 1MQ3A 5IIMA 3GIKA 3UPSA 8ICMA 2JEJA 1ZQUA 3OUYB 8ICBA 4UB3A 3PMNA 3MGHA 5KFTA 3MDCA 2KZMA 1KNYA 4X0BA 5J0SA 8ICVA 4ECXA 4S3NA 1BPZA 3SV4A 3BDPA 4Q44A 4BGDA 3QZ8A 4DL2A 1XSNA 1S0VA 4RQ4A 2HHXA 4WC6A 5L9XA 4QW9A 2IMWP 2M2TA 4IQTA 2IBKA 4J9SA 3M8SA 4M9NA 2V9WA 4FH3A 7ICUA 5IIJA 1Y88A 5KG1A 1K1QA 2HHUA 1X9WA 1Q79A 2ZUBA 4WC1A 8ICZA 1QSSA 4R8UB 5HRFA 2KZ3A 1SL0A 4UQGA 2RFFA 1SZPA 3H8WA 3MFHA 4EZ9A 3H8SA 3H38A 5J0PA 5KFFA 4BWJA 1SL1A 1X9SA 5L1KA 2ZTEA 3BJYA 3B0XA 9ICXA 3KHGA 3PW4A 1MIVA 3KHLA 1BPEA 3C2KA 5DG8A 5J0TA 4FHVA 5KFWA 4BDPA 5DGBA 9ICQA 4K4GA 4F2RA 2C2EA 4WC7A 2JEGA 2BCUA 3ZD8A 4BXOB 2XO7A 5BPCA 3GV5B 3H4DA 1RYRA 4KLFA 1SKSA 2ALZA 7ICPA 1ZQVA 9ICEA 1VJ7A 4X4NA 5D4BA 3PVXA 4I2FA 3EPIA 9ICGA 3PMLA 1TKDA 1L3VA 3V6JA 4E0DA 3HJ4A 2P6RA 3BQ2A 4YCXA 4R64A 5CWRA 4R66A 3RJIA 5KG4A 2KFNA 4PHEA 2ASDA 4J9QA 1TV9A 4DQIA 4WC2A 4PH5A 3H40A 5J0XA 3TQ1A 1TFWA 4R65A 1CEZA 5KFSA 3OHBA 1T3NA 4B9LA 1BNPA 3IHQB 2BGWA 1UT8A 3OVSA 2GWSA 2IHNA 1JXEA 3GIMA 4P4OA 2M2UA 1ZYQA 3C2MA 1MC8A 1DOQA 5KG6A 4GLXA 3HX0A 3JPOA 8ICYA 1V4AA 2ZH1A 2W9CA 3EYZA 1S0OA 4YMMA 4RUAA 2I1QA 3N97B 1ZQNA 4NLKA 4F3OA 4J9KA 1ZQRA 1TK5A 1X9MA 4KLGA 2AJQA 8ICRA 3ZDCA 2JZBA 3M9MB 3GILA 5J2KA 1ZQYA 2FMPA 4IRDA 3L9DA 2PFNA 4P2HA 1TAQA 1LB2B 1R8CA 3C66A 4MEXA 4DSKA 5J2IA 3QEBZ 4MFFA 5J0OA 5TZVA 3TAQA 4X4TA 4ELVA 4PGQA 3JPTA 4M9LA 3RH4A 4X4SA 1ZQQA 3LWMA 1NK4A 9ICIA 1KEJA 3RTVA 2XY5A 3KHRA 4DOCA 3PO4A 4EBDA 1MSWD 2Y1IA 3OSNA 1ZQCA 2ZJ5A 5HRBA 8ICNA 3ISBA 5DDMA 5DBCA 4QZGA 4FHPA 3WFOA 4F4KA 4KN4A 4F50A 4ECYA 4R8UA 2FMSA 2KP7A 4GC7A 4M9GA 1NK7A 1S10A 4JV1A 4M9HA 2O1PA 1IXRA 4PGYA 3PW2A 4JV0A 2R8HA 5DGAA 3BQ0A 2HHVA 5KFZA 4F5PA 2FMQA 2ASLA 4B9SA 2FPMA 3C23A 5KFKA 3JPPA 3TFRA 2R8GA 4B9VA 4I2DA 2V4RA 1ZQKA 2IA6A 4B9MA 4X4OA 3OSPA 1S76D 2M9NA 5IIIA 4I2CA 2MUTA 3WFRE 3V6KA 4YP3A 5IINA 1U49A 2VA2A 4ELUA 1BPBA 4KLTA 4TQRA 5DLFA 5KFGA 4ECQA 1RXWA 3PNCA 3MR2A 4QWAA 3C21A 1QLNA 2Y1JA 1BPYA 4MF2A 7ICFA 4LZGA 5BOMA 5HMMA 5J2CA 2A1JA 4O3PA 5JUMA 3Q8SB 4ECUA 2DPJA 4ED2A 1DK2A 5KFBA 4DOAA 3IM1A 1NZPA 4RT2A 2PFOA 3HIYA 2ZH2A 3RJJA 4AT7A 3OV7A 4QZ9A 1ZQOA 1X2IA 4K4IA 3RJKA 5J2EA 4UBBA 2I9GA 5HRHA 4X4UA 3M9OB 2J6SA 1NJZA 4K4HA 3SZ2A 4UAWA 2WTFA 4F4WA 2AU0A 4EBCA 4ATBB 8ICOA 4EBKA 3WFQE 2BHNA 4LZDA 3RRHA 3OJUA 1NO5A 5KFJA 4AT9A 2R8KA 3UQ2A 3JYYA 1KDHA 2HHSA 4LT6A 2ZH9A 3SYZA 1N48A 1U9LA 3GIJA 2KTQA 4QZFA 1D8LA 2B21A 3ZDEA 4M9JA 4O3NA 3OVBA 4G3IA 2ZJ8A 2BKEA 4ECWA 4M2YA 5EWFA 3EW9A 4GXKA 4DQPA 4QW8A 2W9CB 4O5CA 7ICGA 5DLGA 4QWDA 7ICLA 5HMLA 1N56A 4CCHA 2ISPA 1S0NA 4E7XA 1BVSA 4QWBA 3GQCA 5J2AA 4B9UA 3C1ZA 4YFKA 1WCNA 1Z00B 5KFAA 3V72A 1KRPA 4YQWA 4NM2A 2M2VA 4DQQA 3OVAA 2UVWA 2NRZA 8ICCA 1RPLA 2ZJAA 3C18A 4UBCA 4DL3A 1JQRA 1KFSA 3TARA 4I2JA 4JUZA 5D46A 4Q43A 3JPNA 3T5LA 4RQ6A 4DWIA 1S9FA 4J9NA 2C2RA 4F5OA 4X4PA 4FS2A 4NKUA 2F1JA 4F91B 4B9TA 5HRLA 1S77D 4M6WA 4HYKA 5KT7A 1FA0A 5DG9A 5EOZA 4EBEA 2XGPA 4KLDA 4KLHA 1F5AA 4J9LA 7ICHA 1UEVA 4C8KA 4ECVA 1HJPA 4IQVA 1LV5A 3HP6A 1ZQIA 1U48A 4IRCA 4GC6A 1NK5A 3RJGA 4Q8EA 3H3AA 2ZTCA 9ICMA 2FPKA 3H8JA 2BQUA 3AU2A 5IIOA 2XY6A 3M9NB 4DFJA 4JWMA 8ICIA 4WBZA 4RNMA 1NK6A 1ZQGA 1ZJNA 4EZ6A 1SKWA 4RT3A 5KFDA 2ZUDA 3RH5A 4UB1A 2ZH5A 2AGPA 2PFPA 2DRBA 5J0WA 5DDYA 1UT5A 2NRTA 3WFSC 5KT6A 5J2DA 4LVSA 5EWEA 3RAXA 1KLNA 3FYHA 3V7LA 5HP4A 1L5UA 2W9BB 1COOA 1R8BA 4DQSA 4FHXA 5CP2A 1L3UA 5CB1A 4UB5A 4RNOA 5F9LA 3SI8A 1BGXT 5CJ7A 3K75D 8ICGA 2PI5A 2DR7A 5KFLA 8ICQA 4ATBA 9ICLA 3EZ5A 4ELTA 3ZDBA 2HHQA 2ZTDA 1U45A 4E8FA 3LQCB 3H7IA 4RZRA 4RWPA 4P4PA 1NOMA 1ZQXA 9ICVA 9ICJA 1C7YA 4RQ0A 9ICOA 3ETLA 4ED6A 2BDPA 2BQ3A 5HRGA 2FLNA 4F2SA 4ED3A 3PR5B 1ZQDA 5J0UA 4KLIA 3RB3A 5L1IA 3EPGA 1SL2A 5HRDA 3JPQA 5KFHA 3UXPA 4FH5A 8ICUA 7ICEA 3HT3A 5DBBA 4I27A 4XQ7A 1T8EA 2BE3A 4PHDA 2DFLA 4TUQA 2MUTB 1TFRA 1JMSA 1BPDA 2W9MA 1HUOA 1XO1A 4MEYA 3ZDDA 3MDAA 4QZIA 5HNKA 1QSLA 1KTQA 3NYBA 3Q8RB 1B43A 3PW7A 2OWOA 1IM4A 3E2EA 4J9RA 5KT2A 5J0QA 1A77A 4QZCA 4YN4A 4RQ2A 4F93B 5KFCA 5IILA 4QZ8A 4M6WB 9ICPA 4YR2A 4DSJA 4FBUA 4IR9A 3OHAA 5BOLA 7ICMA 2J6UA 8ICKA 1B22A 1S97A 5J2BA 4FS1A 8ICLA 1ZQFA 5KFQA 2F1HA 8ICWA 4RQ7A 5KT3A 5KTQA 2DR8A 2DRAA 3ZDAA 2NRKA 4PGXA 4UAYA 4YD1A 1ZQSA 3LK9A 3MFIA 3PR4A 1U47A 1L3TA 3TAPA 9ICBA 2PBEA 3RAQA 5IIKA 3GV8B 2W8LA 8ICAA 4O3OA 4C8NA 8ICJA 2JEIA 4DL4A 4DSIA 4ED1A 1YLQA 4RNNA 5J0RA 3MR5A 3T5HA 3TFSA 1RXVA 8ICPA 2NRXA 3MABA 4FO6A 4DO9A 2AQ0A 2NRVA 1BPXA 3AQKA 4I2BA 3ZD9A 4NKTA 1Z3EB 3V7KA 2HVIA 5J2GA 3C5GA 1TVAA 4RQ8A 3T5KA 1HUZA 7ICNA 5DKWA 2W9AA 9ICRA 5DB6A 1SKRA 4KLLA 4I2HA 3RJFA 4Q8FA 4DS4A 9ICCA 1Q78A 7ICQA 3AQNA 3GV7B 4RPZA
chains in the Genus database with same CATH superfamily
4QZBA 2D6FC 5HRKA 2JZBB 2FPLA 4DFPA 4I2AA 2RHFA 3C1YA 3H37A 3TADA 5KFPA 3QU4A 4O3RA 3Q8PB 4IC9A 4RUCA 3QE9Y 5HREA 4YVZA 2UVVA 2Q0ZX 4CRXA 2LPEA 1XWLA 5AM5A 2PI4A 3N7PD 4DS5A 4U7CA 4YD2A 5ALVA 3JCFA 4KITB 1R89A 2K8BB 4RQ5A 5EE3A 5KG5A 1JX4A 2KZZA 1TFYA 8ICEA 5KFIA 4DFKA 4BWMA 5CHEA 2D3DA 4Z6CA 3NTUA 2BCVA 4KLUA 2ZIUB 2W55A 1ZQMA 2OEHA 3NKUA 5GTIU 2C2DA 4PPXA 2H3FA 4EP7A 3RR8A 5ALGA 4P0QA 2QB0A 5C5JA 1ZQPA 4O3QA 3SMVA 5HHHA 1UETA 5AKXA 3EWAA 4DSEA 2JMGA 1JXLA 3QUCA 3BQ7A 3RBEA 5KG7A 4JK1A 1Q3UA 4F92B 5J2HA 2HW3A 1D9DA 2JEFA 2FLLA 2LM1A 4E80A 3M6ZA 4I2GA 1NKBA 4BJQA 4PL1A 4YXMA 4M0AA 2F1IA 3RB6A 4FZLA 5KG3A 1Z00A 4XUSA 5ALHA 4MFCA 4F8RA 4O5KA 3MBYA 2ZH8A 5KFYA 4IRKA 4WC5A 1CUKA 8ICTA 3PW0A 3H0MB 4DLGA 2YMPA 2B6GA 3B9JA 4WBYA 3R9KA 5KFNA 4DSFA 3N4MB 1J97A 4I29A 2H3QA 5EWGA 2KSOA 2K8AA 1ZQJA 2RLTA 2EWRA 4NLGA 5AM4A 3V7JA 2M0NA 2KFZA 2G5IB 2O6KA 3AQMA 2C22A 5KT4A 1C20A 2BCQA 1ZQHA 5F9NA 5AKJA 2KG5A 4JMUA 4O67A 2DR9A 4TQSA 4DF8A 4XQ8A 1AQ6A 2W04A 5ALSA 4PHPA 4PL2A 3GFKB 4WC4A 4US8A 2BPFA 3BQTA 3ISCA 2AHOB 4RQNA 4RPXA 5J29A 1WG8A 1DXSA 2G07A 3PZPA 8ICXA 4R63A 2K4IA 3H0RB 9ICNA 4G9BA 5KFVA 2H5XA 1KKXA 4AYBF 3B0YA 3AU6A 4X5VA 1D8YA 3H4BA 4YR3A 5DQIA 4C8LA 3JZ0A 1KFTA 1F44A 4KLJA 3J81j 2E3TA 3SENA 4FO1A 2E8MA 1ZQUA 4X0BA 2KEYA 3A0HU 3SV4A 3QZ8A 4DL2A 1XSNA 4RQ4A 5B3PA 4NXVA 2V9WA 5IIJA 2CN1A 5HRFA 1SL0A 2NO4A 3H38A 3H8WA 3H8SA 4WOYA 5J0PA 3ALRA 1X9SA 1WYGA 3HILA 3C2KA 5DG8A 9ICQA 4NLBA 2C2EA 2JEGA 1OXJA 4RQMA 3MGVA 9ICEA 5TISU 5D4BA 2P35A 4PJ0U 3PVXA 4I2FA 3PMLA 3WK8A 2JH1A 5AKLA 2Q4TA 4WC2A 4PH5A 1BNPA 3IHQB 2BGWA 2GWSA 2IHNA 4P4OA 1ZYQA 8ICYA 3RF9A 2ZH1A 1ZQRA 1TK5A 2LBOA 2KKPA 4CE6A 8ICRA 3M9MB 5D61A 4C80A 2XIDA 3ER9B 4DSKA 5TZVA 4K97A 4ELVA 3RH4A 4X4SA 1ZQQA 3LWMA 1NK4A 1KEJA 5JU5A 3K1ZA 3WKEA 3ISBA 5DBCA 4QZGA 2FMSA 4ECYA 2JR5A 4M9HA 3DV9A 2O1PA 1IXRA 3HJ1A 3BQ0A 1SXEA 4B9VA 3C23A 3D2SA 2R8GA 4X4OA 2IA6A 1S76D 5IIIA 2W03A 5IINA 4YP3A 2VA2A 1BPBA 3PHZA 2HMXA 1MN8A 2KICA 5AM0A 4LZGA 2YX8A 3PSFA 3PSPA 3Q8SB 4ED2A 3IM1A 4RT2A 2PFOA 3HIYA 3QUTA 1X2IA 4X4UA 3M9OB 2Y0SF 2K60A 4ATBB 8ICOA 2MRLA 3WFQE 2R8KA 3UQ2A 3JYYA 2HHSA 3SYZA 1U9LA 2A3VA 2KTQA 4M9JA 1Q3VA 4G3IA 1Q79A 7ICGA 3EW9A 2W9CB 2FCLA 5KAFU 3OVAA 8ICCA 3QU5A 3T5LA 4DWIA 3IV6A 2C2RA 4J9NA 3U26A 2DL0A 5F3XB 4B9TA 2XICA 5AM2A 4KLHA 3I1YA 1A6SA 4J9LA 7ICHA 4Q8EA 2FPKA 5AIBA 2DKZA 1K5OA 2XY6A 3M9NB 4DFJA 3QXGA 3UMGA 4RNMA 4F72A 4EZ6A 4RT3A 3FM9A 2ZH5A 2AGPA 5J0WA 1PUZA 3I76A 1ZD5A 2NRTA 4ZOHC 3WFSC 1KLNA 1L8OA 5AKYA 2GLEA 4FHXA 5CB1A 4LEZA 4RNOA 5F9LA 3K75D 1Z1BA 5ALZA 2B51A 4E8FA 3H7IA 4RZRA 3UM9A 4RQ0A 4KX5A 2FDRA 2FJ6A 2FLNA 3PR5B 4Y2VA 1X42A 5C0YA 2KK0A 4EEBA 3EPGA 3JPQA 3UXPA 4XQ7A 1T8EA 2DFLA 2W9MA 1JMSA 4N7RA 1XO1A 4MEYA 4UAUA 2ZIWA 3Q8RB 4FE3A 1IM4A 3E2EA 1A77A 4YN4A 4OJ5A 1Q46A 5IILA 4YR2A 2NV3A 1QCKA 3M1YA 3CYMA 4FS1A 1ZQFA 2WFAA 2WHEA 5AKGA 4UAYA 9ICBA 3LK9A 3PR4A 1U47A 4Y2JA 8ICJA 1PK3A 5A0LA 3MR5A 3AQKA 2AQ0A 1BPXA 1Z3EB 2K89A 9ICRA 2LMRA 3AM9A 1YZ6A 2K4HA 1N61A 3E58A 4DS4A 3D2QA 3M6KA 2AGQA 1UA0A 1S0MA 1XU4A 3UQ0A 2W54A 3LYSA 4XRHA 3CRXA 4MFAA 4AT7B 2HHTA 2QARA 1XSLA 1YZ7A 1PVPA 3RJEA 1VFGA 1ZRNA 3IG5A 2Q66A 9ICTA 4DQRA 1KL9A 4RWOA 9ICKA 4WC0A 1A76A 5ALUA 3QEAZ 4K9AA 2A1JB 2BCRA 3RJHA 3AEVA 3KTQA 7ICJA 4GXIA 3OGUA 4YMOA 4RPYA 4BXOA 4DOBA 5KT5A 1NJWA 3BS7A 4C8MA 2XCPA 2KHVA 1MIYA 1OW5A 4Z6EA 3QUBA 3D6JA 4O6AA 5KFOA 1XS9D 3HWTA 3PO5A 4OAHA 1JUDA 1ZQWA 2EANA 8ICFA 4CF3A 4NLZA 2EZYA 4DF4A 7ICSA 1EXNA 5ALMA 1JAJA 5KFEA 2BR0A 2YTUA 2UVRA 4ZH4A 3ZDDA 1DGSA 1HEKA 1UA1A 4M04A 3NVOA 4NL9C 4OJPA 3F2CA 1ZXIA 2ZIVB 2DVIA 4NXUA 3BQ1A 4X4RA 3T5JA 1P7DA 2M2WA 5ALXA 3ZI4A 3Q8QB 5CA7A 4X4QA 5ALQA 4F5NA 2JHDA 4FHYA 4UB4A 4I2IA 5AKHA 2DPIA 4AT9B 3F5AA 4DL6A 1XC9A 3JPRA 2RDIA 1BNOA 1MIWA 3M8RA 2LM4A 4TURA 2BPGA 3Q8KA 2YMQA 3LDAA 1UEUA 4QZAA 1U4BA 5CHGA 4J9MA 1B4FA 2Z7JA 4TUSA 4O5EA 2PXIA 1LKYB 2HCFA 3ORYA 2KIWA 1NKEA 4RU9A 4PHAA 5KAIU 5D49A 3AQLA 2ID1A 1O03A 3G6XA 2E5SA 3THVA 1SV0A 2O5AA 2F8KA 1SIJA 2DQNB 2QKQA 4KLSA 5KG0A 3HW8A 5DBAA 1T4GA 3K4GA 4WQKA 1X66A 2F44A 1TK0A 4B9NA 1ZD4A 4F4YA 2IOFA 2MSNA 5DEDA 3SAFA 4UATA 4NL9A 1UHUA 1AROP 4ECTA 3H0LB 2FLPA 5DB9A 1QSYA 1NK8A 2HDOA 2EAOA 2F77X 2AGOA 5KFMA 4QZDA 4EEDA 4KN7A 1VLBA 3L3FX 4P4MA 1NJYA 4DFDA 3F2BA 4XA5A 3C5FA 2HVHA 4Z6FA 4UD5A 4YXJA 2XY7A 5EE9A 2HHPA 4X0AA 3MGIA 3OJSA 1TK8A 1ZRMA 1LVHA 3AQEA 4EEKA 1MQ3A 2KZMA 5KFTA 4MHVA 4S3NA 3BDPA 3BS5B 3H8MA 4BGDA 4IQTA 3TACB 2KE7A 4FH3A 2NO5A 2HHUA 1X9WA 3KZIU 4AP9A 3AL0B 4EZ9A 5CRXA 4BWJA 1SL1A 4UB6U 3KHLA 1BPEA 2BDUA 4BDPA 5DGBA 2BCUA 3NVVA 5BPCA 1RYRA 1SKSA 2ALZA 9ICGA 5CFTA 1TKDA 3TADC 3AN1A 3HJ4A 2JGAA 5CWRA 4PHEA 1TV9A 1MA7A 3O0FA 2WAQC 3NVZA 1CEZA 5KFSA 3OHBA 1T3NA 4B9LA 2PMZC 1UT8A 1IIPA 3OVSA 1JXEA 3GIMA 2M2UA 1L8LA 1V4AA 5KG6A 3HX0A 2W9CA 1S0OA 4RUAA 4F3OA 4J9KA 4KLGA 1X9MA 1COKA 2FMPA 3L9DA 1R8CA 1FO4A 2YY6A 5ALLA 3C66A 4MEXA 5ALJA 2MU2A 5J0OA 4X4TA 3JPTA 9ICIA 3PSIA 2XY5A 3KHRA 4DOCA 3PO4A 1QQ7A 4EBDA 1KW4A 1MSWD 1RDFA 3FC4A 1S10A 4M9GA 2ZH3A 3PW2A 4PGYA 1VJ5A 4F5PA 2LYBA 3OSPA 4I2CA 2MUTA 1ZD2P 1U49A 4O3MA 1ED1A 4JLXA 1RXWA 4ECQA 4P0QB 5KNIA 3MR2A 2Y1JA 1BPYA 4MF2A 5HMMA 2A1JA 4O3PA 2ESEA 4OJLA 4DOAA 1QQ6A 2ZH2A 3OV7A 4QZ9A 5HRHA 1NJZA 2ZXIA 4UAWA 2AU0A 4EBCA 2BHNA 4LZDA 2DWQA 3RRHA 1NO5A 1N48A 4WH5A 3UMBA 3LVWA 5ALPA 1V97A 4O3NA 3WK9A 2ZJ8A 4GXKA 7ICLA 4QWDA 5DLGA 1N60A 1BVSA 1ECWA 1Z00B 5K4LA 5KFAA 2VJ5A 4OAFA 4YQWA 4NM2A 2UVWA 1RM6C 3WK7A 3WU2U 2ZJAA 3C18A 4DL3A 3TARA 3IG8A 3JPNA 1XNSA 2H3VA 1S9FA 5AKEA 3S6JA 4FS2A 2F8LA 2CRXA 4F91B 4NKUA 1S77D 2DF4B 5EOZA 4GFJA 2XGPA 1F5AA 2EZZA 3E0FA 2WF5A 4IQVA 4NXXA 4IRCA 1DGJA 3HKZF 4GC6A 1NK5A 2ZTCA 3QU2A 2OH2A 3D2NA 3H8JA 4NXTA 3AU2A 4EX6A 1ZQGA 1ZJNA 2F3NA 1FFVA 2DRBA 1ZOLA 4Y2PA 1UT5A 3V7LA 5G5HA 2W9BB 4KM5A 4DQSA 3BZKA 4AYBC 2E8NA 4UB5A 3SI8A 2PI5A 3CK6A 2DR7A 5KFLA 9ICLA 3WK5A 2HHQA 1SWWA 1N5WA 3LQCB 1VDVA 4P4PA 1ZQXA 9ICVA 2HOIA 3F5EA 9ICOA 2QARB 5HRGA 1V85A 2F76X 3RB3A 2PKEA 8ICUA 2EAPA 5DBBA 3HT3A 2JH7A 2HBJA 4I27A 2BE3A 1BPDA 1KTQA 5J0QA 2GA9D 9ICPA 4IR9A 3OHAA 5BOLA 7ICMA 4NXWA 5KFQA 2F1HA 5KT3A 2HOFA 5KTQA 2KMDA 4JB3A 3GZFA 2DR8A 2I5HA 4PGXA 2B0CA 2PBEA 3RAQA 4C8NA 4DL4A 4NJ8A 1YLQA 1RXVA 3AMZA 2NRXA 3QU7A 4DO9A 4I2BA 3HKZC 3V7KA 2HVIA 3T5KA 4O69A 4UAVA 2W9AA 2KIVA 5DB6A 1SKRA 3RJFA 9ICCA 2EDUA 7ICQA 3AQNA 4LEVA 5KG2A 4NLNA 3RB0A 3PV8A 4O0IA 5ALEA 2WF9A 5CFSA 4ED0A 2KJ9A 2OYYA 4EV6A 7ICTA 3BS5A 2ASJA 2KSOB 2VJ4A 5KFRA 9ICHA 5L1MA 4JWNA 2DR5A 5AM1A 4J9PA 4RQ1A 4YMNA 4KMUA 1KSPA 3G6YA 4EBJA 4WC3A 1L3SA 2YMLA 1NK9A 4P0PB 7ICRA 2ISOA 1L7NA 3GDXA 4DL5A 5AI9A 2XCAA 1T7PA 3KBBA 2KNJA 4DFMA 2YQEA 4OJOA 4M47A 3RRGA 4I28A 2BQRA 4UD4A 3JPSA 1V9PA 4QWCA 9ICAA 4ECSA 4O68A 3KKAC 4NY8A 9ICWA 4RWQA 3KHHA 1MQ2A 3ISDA 5B3QA 7ICIA 1R8AA 3MC1A 5J2JA 2W9BA 1SZHA 2R8JA 2EZXA 1SWVA 1D8BA 2ODGA 4BUGA 5DB8A 5L1LA 2BCSA 4IG8A 5AK3A 3PY8A 4RQ3A 7ICVA 3AUOA 5HRIA 5ALNA 4O3SA 1JIHA 1K1SA 4XJEA 3F53A 5HR9A 1V38A 3CNHA 3EUB2 4Z6DA 1ZQLA 1ZQBA 2ZH7A 2XGQA 3T79A 1KN5A 3K1RB 4AT8B 4KX3A 3NGDA 4OCZA 2LYAA 3PX0A 2ZHBA 4F5QA 4IQUA 4KTQA 5AHXA 3F2DA 4ED8A 2ZXHA 4F5RA 4K99A 1RQNA 5HR6A 1FIQA 4KLOA 4DEZA 2JXJA 3UXNA 3VCBA 4PZOA 2IHMA 3WKCA 5KFUA 2KJ8A 1CI4A 1ZQZA 4MF8A 2WB1C 3G6VA 5ALTA 4J9OA 1ZQEA 3RBDA 1QTMA 1RZTA 1X40A 1RYSA 4DL7A 5FP0A 4GXJA 4WQLA 2AQ4A 5J8YA 2W8KA 3WFPA 4Q45A 2VA8A 4QZEA 4NM1A 3HRDD 5ALWA 3HJEA 3QUQA 2ZUCA 4FBTA 4IQWA 4HX0A 2HI0A 1T94A 2C28A 1PZNA 5HHIA 4YR0A 3NRZA 3MR3A 2VA3A 1PX5A 3TKAA 2Y9UA 2ES6A 4NXZA 1X6IA 5DECA 1ZETA 4YG2A 5AKKA 2N1RA 3PX4A 3C2LA 4OD0A 4C8OA 3IDWA 1WOTA 1WCLA 4FZMA 3IN5A 2QB0B 2ZIWB 4QNLA 5IIMA 3GIKA 2EH9A 3UPSA 8ICMA 2JEJA 3OUYB 8ICBA 4UB3A 3MGHA 3MDCA 8ICVA 4Q44A 1S0VA 3M7DA 4WC6A 5AKIA 1L7PA 4QW9A 2M2TA 5AI0A 2EAMA 5KG1A 1Y88A 3PSTA 1K1QA 2ZUBA 4OJ6A 1S5LU 3MCRA 3NVWA 3WK4A 5AK4A 5L1KA 2LHTA 3BJYA 2ZTEA 4J03A 4Y2QA 3KHGA 3PW4A 1UCVA 9ICXA 1MIVA 4C4SA 1FEZA 4K4GA 4WC7A 1O08A 5EE1A 4KLFA 2XO7A 7ICPA 5JRTA 1F0MA 2W3RA 5AI8A 1L3VA 5ALYA 2ZIVA 2P6RA 3BQ2A 4YCXA 1Z4OA 4R64A 4R66A 2H3IA 2LI6A 2YN4A 2WB1F 5J0XA 3TQ1A 1TFWA 2MA1A 4R65A 2ZIXB 4Y2RA 4ICAA 2A1AA 3C2MA 1FFUA 1PVQA 4WJ3B 4YMMA 2I1QA 1ZQNA 4NLKA 3N7SC 1B0XA 2AJQA 2G06A 4P2HA 1LB2B 2VKQA 3QEBZ 2YB1A 3TAQA 4M9LA 3ER8C 1NZBA 3N28A 2HBKA 1ZQCA 8ICNA 5DDMA 3WFOA 5ALRA 4KN4A 5AKZA 1JROA 5GTHU 4R8UA 2HHVA 1OUQA 4JV0A 2R8HA 5DGAA 1R8BA 2ZH6A 5KFZA 2FMQA 4B9SA 2ASLA 2YB4A 5JTIA 3TFRA 4I2DA 2V4RA 4B9MA 3KKAA 2M9NA 1GO3F 3V6KA 4ELUA 1KNYA 4KLTA 4TQRA 4QWAA 3C21A 1A0PA 3N7RC 5J2CA 4ECUA 4Y2YA 5H2FU 2DPJA 5KFBA 1DK2A 1SV4A 2FI1A 3RJJA 1ZQOA 4K4IA 5J2EA 4K4HA 3SZ2A 2WTFA 1X9XA 4EGWA 3UMCA 4CDGA 4LT6A 2WF7A 3GIJA 4QZFA 1D8LA 1JI7A 1N5XA 2BKEA 5EWFA 3QYPA 2JV3A 3QU9A 4CCHA 4E7XA 4B9UA 3C1ZA 4YFKA 1WCNA 1KRPA 4UB8U 2M2VA 1SB3C 1ZD3A 1RPLA 2K8CB 4UBCA 2HOQA 3KZXA 5T14A 4JUZA 5D46A 2IOHA 4CF5A 4UARA 5ALIA 2KV2A 3SQIA 1KQQA 1FA0A 5DG9A 4C4RA 4EBEA 1UEVA 2D8CA 4ECVA 1LV5A 3OTQA 4FFDA 2IOFK 9ICMA 5AI5A 5CFUA 5IIOA 4JWMA 4WBZA 2ZUDA 3RH5A 4UB1A 3EF2A 3ERCC 5DDYA 4IS7A 2CPRA 5KT6A 5EWEA 3RAXA 3FYHA 5HP4A 1L5UA 3K7DA 1WUDA 1L3UA 2HN2A 1BGXT 5CJ7A 8ICGA 4PZNA 3L5KA 2HSZA 4ELTA 2ZIXA 1U45A 2IUBA 1TE2A 1NOMA 1RG6A 1C7YA 2G5HB 3ETLA 4F2SA 4ED3A 5J0UA 3GU3A 4CF4A 3NS1A 5HRDA 4FH5A 7ICEA 2KKVA 5HR7A 4TUQA 1HUOA 1TFRA 1Z1VA 3MDAA 4U6PA 4QZIA 2L5YA 5HNKA 1QSLA 3DDHA 2KVSA 4P0PA 3PW7A 4J9RA 3VC8A 5KT2A 2EQYA 5KFCA 4QZ8A 4M6WB 4QIWF 4DSJA 5J2BA 2YMMA 4RQ7A 2Y0SC 1UPHA 3ZDAA 1L3TA 5IIKA 3GV8B 2W8LA 2LKYA 4O3OA 2JEIA 4DSIA 4ED1A 4RNNA 1IV8A 4DCCA 3T5HA 5AI4A 8ICPA 3MABA 3ZD9A 4NKTA 2IHOA 5J2GA 3NRWA 3C5GA 1TVAA 7ICNA 5DKWA 4KLLA 5EE0A 3GV7B 2JRZA 5AK5A 2P6UA 3OPXA 4FHWA 4KLQA 3RB4A 4Y2SA 3SV3A 4IL6U 3UPQA 2BPCA 4RWNA 3QZ7A 2RDJA 4TUPA 2K4PA 9ICSA 4AT8A 1UQVA 5J2FA 2WF6A 2BBJA 2W43A 4ECZA 2G0AA 5KFXA 3T3FA 1OU5A 4NLCA 4WCWA 4EELA 2KJ5A 4KLMA 4UASA 4Y2UA 1WWVA 2KOBA 5F2VO 1HIWA 5AM3A 4KB6A 2VANA 5G5GA 3BZCA 2R8IA 8ICSA 2FE9A 5CR0A 2OHFA 3PX6A 2P66A 2W11A 2KN7A 3ONNA 4LJXA 2BBHA 2DBYA 5DB7A 2UVUA 1ZQAA 2ATLA 2H3ZA 1PK1B 1TAUA 7ICKA 4K98A 1T3QA 4UB2A 1SGGA 2NRWA 1F5SA 4C7ZA 3TI0A 2J6TA 5J0YA 1KFDA 1IG6A 4EYIB 1Z4NA 5DG7A 4KLEA 3WK6A 1L7OA 3LWLA 3GIIA 4EYHB 2KVCA 3KFUF 3TANA 2Y9TA 3CW2C 2RP5A 1XSPA 2A19A 4QZHA 4I2EA 3RH6A 1NJXA 4DSLA 1ZQ1C 4A8EA 2E8OA 1ZQTA 4Y2XA 4IR1A 2XC9A 2KD1A 9ICUA 4EEYA 3SAGA 5AIAA 2PFQA 1NK0A 4QWEA 2V4QA 1QQ5A 1N63A 2HHWA 8ICHA 1S8OA 1JN3A 5AICA 1ZJMA 3WKAA 3OUYA 4F4XA 1D9FA 2B56A 5DQGA 1NKCA 3UXOA 3MR6A 2PMZF 1DK3A 5J8YC 1N62A 3FDSA 4F4ZA 2OXOA 2ZHAA 1H38A 4O9MA 1JALA 2CXYA 3Q8MA 4ED7A 2GAFD 3V6HA 1L7MA 4M5DA 4JV2A 2MAXA 4OAIZ 7ICOA 2F2AB 3Q8LA 2OCEA 5HC9A 1URJA 5DQHA 4LEYA 3CP8A 4ECRA 2R18A 4DLEA 2AXTU 4K96A 4UAZA 5ALDA 4C4TA 3RR7A 4X4VA 2LYHA 3H39A 1NI3A 1KBUA 2VIXA 1GPJA 4I0UA 2ZH4A 5L1JA 3HPOA 4NWIA 5B66U 3PW5A 1PVRA 9ICFA 5ALKA 3PMNA 3A0BU 5J0SA 4ECXA 1BPZA 2HHXA 4F71A 5L9XA 4US9A 2IMWP 2IBKA 4J9SA 3M8SA 2QB1A 1PK1A 4C0ZA 4M9NA 7ICUA 1XO0A 2QLTA 4CGZA 2B4VA 4WC1A 8ICZA 1QSSA 4R8UB 2KZ3A 4UQGA 2E8PA 1SZPA 3MFHA 2RFFA 5KFFA 1SXDA 2GOLA 5ALFA 3B0XA 4QJFB 5B5EU 5J0TA 4FHVA 5KFWA 1LKYA 2XVTA 4F2RA 3ZD8A 4BXOB 3H4DA 3GV5B 2K4EA 1ZQVA 1VJ7A 4X4NA 3EPIA 4KMOB 2RQ5A 3DEEA 3V6JA 4E0DA 2HN1A 3RJIA 5KG4A 2KFNA 2ASDA 4J9QA 4DQIA 1L6NA 3H40A 2E1EA 2WAQF 4B6JA 1MC8A 1DOQA 4GLXA 3JPOA 3EYZA 3N97B 3C28A 3SR6A 2G08A 3ZDCA 2JZBA 3GILA 5J2KA 1ZQYA 4IRDA 2PFNA 1TAQA 5J2IA 1J2NA 4MFFA 2DUYA 4PGQA 2BZFA 3NVYA 3IP4B 3RTVA 5D62A 5E79U 3ED5A 4JLZA 2Y1IA 3OSNA 5HRBA 2ZJ5A 3AQFA 5JTGA 1YT3A 4FHPA 4F4KA 4F50A 2KP7A 3ICXA 4GC7A 1NK7A 4JV1A 1RQLA 2FPMA 3JPPA 5KFKA 1ZQKA 1Q8KA 3WFRE 3ETRA 3C29A 3RFAA 4FZNA 5DLFA 5KFGA 4K8VA 3PNCA 1QLNA 7ICFA 5BOMA 2OM6A 5JUMA 2G09A 1Z19A 1NZPA 4AT7A 4K9BA 3RJKA 4UBBA 2I9GA 2J6SA 2ZIUA 4F4WA 4EBKA 4AT9A 3OJUA 5KFJA 1KDHA 2ZH9A 3NWIA 2KHQA 4EENA 2B21A 3ZDEA 3SD7A 3OVBA 4ECWA 4M2YA 4O5CA 4DQPA 4QW8A 5CEHA 2GH1A 1J2MA 4NV0A 5HMLA 4USAA 1N56A 1X6JA 2ISPA 5AI6A 1S0NA 4QWBA 3QX7A 5J2AA 3GQCA 3FAHA 3V72A 2WF8A 4DQQA 2NRZA 4OO1J 1JQRA 1KFSA 2W7PA 4I2JA 4Q43A 4GIBA 4RQ6A 1N2XA 2DGZA 4X4PA 4F5OA 2F1JA 5HRLA 4M6WA 4HYKA 5KT7A 4KLDA 4C8KA 1HJPA 3HP6A 1ZQIA 1U48A 3RJGA 3H3AA 2W3SA 2BQUA 2GO7A 3L4PA 3WKBA 2W7OA 1SV0C 8ICIA 1NK6A 1SKWA 3SEIA 5KFDA 3OWGA 2PFPA 3KD3A 4Y2TA 4LVSA 5J2DA 1COOA 2ZG6A 4LEWA 5CP2A 1CRXA 2HBLA 8ICQA 4ATBA 2AH5A 3EZ5A 3ZDBA 2ZTDA 5AK6A 3WKDA 4RWPA 3NASA 9ICJA 4ED6A 2BDPA 2BQ3A 3SAHA 4KLIA 1ZQDA 3KOOA 1DRGA 4C7YA 5L1IA 3NUQA 1SL2A 5KFHA 1WWUA 1TAMA 4PHDA 2MUTB 2NYVA 3NYBA 1B43A 2OWOA 5D63A 2E1FA 4QZCA 4CNQA 4RQ2A 4QIWC 4F93B 2HBMA 4BX9C 4FBUA 1B22A 1NNLA 1M6YA 2J6UA 8ICKA 4UW9A 1S97A 8ICLA 8ICWA 1QH9A 2DKXA 4ACOA 2DRAA 2I6XA 2NRKA 4EX7A 1ZQSA 4YD1A 3IRUA 3MFIA 3TAPA 3LVVA 1JRPA 8ICAA 5J0RA 3TFSA 4FO6A 4HAIA 2NRVA 3QNMA 2XI9A 5KL8B 2RRDA 5KL1B 4RQ8A 1HUZA 4MKPA 3I28A 4OAGA 4I2HA 1RYUA 4Q8FA 1Q78A 4RPZA 5ALOA
chains in the Genus database with same CATH topology
5KG2A 4QZBA 4NLNA 2P6UA 3RB0A 3PV8A 2AGQA 1UA0A 5HRKA 4FHWA 1S0MA 1XU4A 2JZBB 4O0IA 4KLQA 3UQ0A 2FPLA 4DFPA 3RB4A 4XRHA 4I2AA 3SV3A 4MFAA 4ED0A 3UPQA 2HHTA 2BPCA 4AT7B 4RWNA 3QZ7A 7ICTA 3C1YA 2ASJA 1XSLA 5KFRA 2RDJA 9ICHA 3RJEA 4TUPA 3H37A 2ZH3A 5KFPA 1VFGA 4JWNA 9ICSA 2DR5A 4O3RA 4AT8A 2Q66A 3Q8PB 5J2FA 4RUCA 4J9PA 4DQRA 9ICTA 4RQ1A 4YMNA 4RWOA 9ICKA 4KMUA 4WC0A 1KSPA 3QE9Y 4ECZA 3G6YA 4EBJA 4WC3A 5KFXA 3T3FA 1OU5A 1L3SA 1A76A 1NK9A 5HREA 3QEAZ 4YVZA 7ICRA 2A1JB 2BCRA 2ISOA 2UVVA 3GDXA 3RJHA 4WCWA 3KTQA 2Q0ZX 4DL5A 4KLMA 4GXIA 3OGUA 2XCAA 1T7PA 7ICJA 4YMOA 4RPYA 1XWLA 2PI4A 4DS5A 4YD2A 4DFMA 5F2VO 4BXOA 2ZH6A 4KITB 4DOBA 5KT5A 4M47A 2VANA 1NJWA 3RRGA 1R89A 4I28A 2R8IA 4C8MA 4RQ5A 2XCPA 5KG5A 2BQRA 4UD4A 3JPSA 1V9PA 1JX4A 8ICSA 1MIYA 4QWCA 5CR0A 9ICAA 3PX6A 2KZZA 1TFYA 4ECSA 2P66A 8ICEA 5KFIA 4Z6EA 4DFKA 4BWMA 2KN7A 4NY8A 9ICWA 4Z6CA 3NTUA 2BCVA 4KLUA 4RWQA 3KHHA 5KFOA 1XS9D 3HWTA 1MQ2A 3ISDA 3PO5A 2UVUA 5DB7A 1ZQMA 1ZQWA 7ICIA 8ICFA 7ICSA 1ZQAA 4DF4A 4NLZA 5J2JA 1R8AA 1EXNA 2ATLA 3HJ1A 1TAUA 7ICKA 2C2DA 4PPXA 2W9BA 5KFEA 2BR0A 1JAJA 4EP7A 4UB2A 2R8JA 3RR8A 2NRWA 2UVRA 4ZH4A 5C5JA 1DGSA 3TI0A 1ZQPA 5J0YA 1KFDA 5DB8A 5L1LA 4O3QA 5HHHA 2BCSA 2J6TA 1UA1A 4EYIB 4M04A 1UETA 3EWAA 5DG7A 4IG8A 4KLEA 3PY8A 4RQ3A 4DSEA 3AUOA 1JXLA 7ICVA 5HRIA 4O3SA 1JIHA 1K1SA 2DVIA 3BQ1A 3LWLA 5KG7A 4JK1A 3RBEA 3T5JA 2M2WA 5HR9A 4X4RA 4F92B 3GIIA 5J2HA 4EYHB 3Q8QB 2HW3A 5CA7A 1D9DA 4X4QA 2JEFA 4F5NA 2FLLA 4FHYA 4E80A 3TANA 4Z6DA 4UB4A 1ZQLA 1ZQBA 4I2IA 4I2GA 1XSPA 2DPIA 2XGQA 1NKBA 4AT9B 2ZH7A 4QZHA 4DL6A 3RH6A 1XC9A 1NJXA 4I2EA 4AT8B 3JPRA 2RDIA 3NGDA 4DSLA 1BNOA 3M8RA 1MIWA 4TURA 1ZQTA 4YXMA 4M0AA 2BPGA 2F1IA 3PX0A 3Q8KA 4IR1A 2ZHBA 4F5QA 3LDAA 3RB6A 2XC9A 4IQUA 1UEUA 4QZAA 4KTQA 1U4BA 5CHGA 5KG3A 4J9MA 1Z00A 9ICUA 4TUSA 4XUSA 4EEYA 4ED8A 4O5EA 4F5RA 2PXIA 4MFCA 4KLOA 4DEZA 2PFQA 3UXNA 3ORYA 1NKEA 4RU9A 1NK0A 4PHAA 5D49A 4QWEA 2IHMA 2V4QA 4F8RA 4O5KA 3MBYA 3AQLA 2ID1A 2HHWA 2ZH8A 5KFYA 3G6XA 1JN3A 3THVA 8ICHA 4IRKA 4WC5A 1CUKA 8ICTA 1ZJMA 2O5AA 3PW0A 5KFUA 4DLGA 3OUYA 4F4XA 1ZQZA 1D9FA 4KLSA 4MF8A 4WBYA 5KFNA 5KG0A 3G6VA 3HW8A 5DBAA 1T4GA 4DSFA 3N4MB 4J9OA 3K4GA 1ZQEA 5DQGA 5EWGA 1NKCA 4I29A 3UXOA 3RBDA 1QTMA 1ZQJA 3MR6A 1RZTA 1DK3A 1TK0A 1RYSA 4NLGA 4DL7A 3V7JA 4GXJA 3FDSA 4F4ZA 2AQ4A 4B9NA 2W8KA 4F4YA 2KFZA 3WFPA 4Q45A 2VA8A 2ZHAA 4QZEA 1H38A 4O9MA 2C22A 5KT4A 4NM1A 2BCQA 3AQMA 5DEDA 1ZQHA 3Q8MA 4ED7A 5F9NA 3V6HA 2ZUCA 4FBTA 4M5DA 4IQWA 1AROP 4ECTA 4JV2A 2MAXA 2DR9A 4TQSA 4DF8A 4XQ8A 2FLPA 2C28A 5DB9A 7ICOA 1PZNA 5HHIA 4YR0A 4PHPA 1QSYA 3GFKB 3Q8LA 3MR3A 1NK8A 4WC4A 5HC9A 2VA3A 1PX5A 5DQHA 2BPFA 3BQTA 3ISCA 5KFMA 2AGOA 4QZDA 4KN7A 4RPXA 4ECRA 4NXZA 4DLEA 4P4MA 5J29A 1NJYA 5DECA 4UAZA 1ZETA 4YG2A 4XA5A 3RR7A 3C5FA 2HVHA 4Z6FA 4R63A 8ICXA 4UD5A 3PX4A 4X4VA 2LYHA 3H39A 4YXJA 3C2LA 9ICNA 4C8OA 1WOTA 5KFVA 1WCLA 2H5XA 2ZH4A 3B0YA 2XY7A 5L1JA 3HPOA 3AU6A 4X5VA 1D8YA 2HHPA 4X0AA 3MGIA 3OJSA 3H4BA 1TK8A 3PW5A 4YR3A 5DQIA 4C8LA 3JZ0A 1KFTA 9ICFA 4KLJA 1MQ3A 5IIMA 3GIKA 3UPSA 8ICMA 2JEJA 1ZQUA 3OUYB 8ICBA 4UB3A 3PMNA 3MGHA 5KFTA 3MDCA 2KZMA 1KNYA 4X0BA 5J0SA 8ICVA 4ECXA 4S3NA 1BPZA 3SV4A 3BDPA 4Q44A 4BGDA 3QZ8A 4DL2A 1XSNA 1S0VA 4RQ4A 2HHXA 4WC6A 5L9XA 4QW9A 2IMWP 2M2TA 4IQTA 2IBKA 4J9SA 3M8SA 4M9NA 2V9WA 4FH3A 7ICUA 5IIJA 1Y88A 5KG1A 1K1QA 2HHUA 1X9WA 1Q79A 2ZUBA 4WC1A 8ICZA 1QSSA 4R8UB 5HRFA 2KZ3A 1SL0A 4UQGA 2RFFA 1SZPA 3H8WA 3MFHA 4EZ9A 3H8SA 3H38A 5J0PA 5KFFA 4BWJA 1SL1A 1X9SA 5L1KA 2ZTEA 3BJYA 3B0XA 9ICXA 3KHGA 3PW4A 1MIVA 3KHLA 1BPEA 3C2KA 5DG8A 5J0TA 4FHVA 5KFWA 4BDPA 5DGBA 9ICQA 4K4GA 4F2RA 2C2EA 4WC7A 2JEGA 2BCUA 3ZD8A 4BXOB 2XO7A 5BPCA 3GV5B 3H4DA 1RYRA 4KLFA 1SKSA 2ALZA 7ICPA 1ZQVA 9ICEA 1VJ7A 4X4NA 5D4BA 3PVXA 4I2FA 3EPIA 9ICGA 3PMLA 1TKDA 1L3VA 3V6JA 4E0DA 3HJ4A 2P6RA 3BQ2A 4YCXA 4R64A 5CWRA 4R66A 3RJIA 5KG4A 2KFNA 4PHEA 2ASDA 4J9QA 1TV9A 4DQIA 4WC2A 4PH5A 3H40A 5J0XA 3TQ1A 1TFWA 4R65A 1CEZA 5KFSA 3OHBA 1T3NA 4B9LA 1BNPA 3IHQB 2BGWA 1UT8A 3OVSA 2GWSA 2IHNA 1JXEA 3GIMA 4P4OA 2M2UA 1ZYQA 3C2MA 1MC8A 1DOQA 5KG6A 4GLXA 3HX0A 3JPOA 8ICYA 1V4AA 2ZH1A 2W9CA 3EYZA 1S0OA 4YMMA 4RUAA 2I1QA 3N97B 1ZQNA 4NLKA 4F3OA 4J9KA 1ZQRA 1TK5A 1X9MA 4KLGA 2AJQA 8ICRA 3ZDCA 2JZBA 3M9MB 3GILA 5J2KA 1ZQYA 2FMPA 4IRDA 3L9DA 2PFNA 4P2HA 1TAQA 1LB2B 1R8CA 3C66A 4MEXA 4DSKA 5J2IA 3QEBZ 4MFFA 5J0OA 5TZVA 3TAQA 4X4TA 4ELVA 4PGQA 3JPTA 4M9LA 3RH4A 4X4SA 1ZQQA 3LWMA 1NK4A 9ICIA 1KEJA 3RTVA 2XY5A 3KHRA 4DOCA 3PO4A 4EBDA 1MSWD 2Y1IA 3OSNA 1ZQCA 2ZJ5A 5HRBA 8ICNA 3ISBA 5DDMA 5DBCA 4QZGA 4FHPA 3WFOA 4F4KA 4KN4A 4F50A 4ECYA 4R8UA 2FMSA 2KP7A 4GC7A 4M9GA 1NK7A 1S10A 4JV1A 4M9HA 2O1PA 1IXRA 4PGYA 3PW2A 4JV0A 2R8HA 5DGAA 3BQ0A 2HHVA 5KFZA 4F5PA 2FMQA 2ASLA 4B9SA 2FPMA 3C23A 5KFKA 3JPPA 3TFRA 2R8GA 4B9VA 4I2DA 2V4RA 1ZQKA 2IA6A 4B9MA 4X4OA 3OSPA 1S76D 2M9NA 5IIIA 4I2CA 2MUTA 3WFRE 3V6KA 4YP3A 5IINA 1U49A 2VA2A 4ELUA 1BPBA 4KLTA 4TQRA 5DLFA 5KFGA 4ECQA 1RXWA 3PNCA 3MR2A 4QWAA 3C21A 1QLNA 2Y1JA 1BPYA 4MF2A 7ICFA 4LZGA 5BOMA 5HMMA 5J2CA 2A1JA 4O3PA 5JUMA 3Q8SB 4ECUA 2DPJA 4ED2A 1DK2A 5KFBA 4DOAA 3IM1A 1NZPA 4RT2A 2PFOA 3HIYA 2ZH2A 3RJJA 4AT7A 3OV7A 4QZ9A 1ZQOA 1X2IA 4K4IA 3RJKA 5J2EA 4UBBA 2I9GA 5HRHA 4X4UA 3M9OB 2J6SA 1NJZA 4K4HA 3SZ2A 4UAWA 2WTFA 4F4WA 2AU0A 4EBCA 4ATBB 8ICOA 4EBKA 3WFQE 2BHNA 4LZDA 3RRHA 3OJUA 1NO5A 5KFJA 4AT9A 2R8KA 3UQ2A 3JYYA 1KDHA 2HHSA 4LT6A 2ZH9A 3SYZA 1N48A 1U9LA 3GIJA 2KTQA 4QZFA 1D8LA 2B21A 3ZDEA 4M9JA 4O3NA 3OVBA 4G3IA 2ZJ8A 2BKEA 4ECWA 4M2YA 5EWFA 3EW9A 4GXKA 4DQPA 4QW8A 2W9CB 4O5CA 7ICGA 5DLGA 4QWDA 7ICLA 5HMLA 1N56A 4CCHA 2ISPA 1S0NA 4E7XA 1BVSA 4QWBA 3GQCA 5J2AA 4B9UA 3C1ZA 4YFKA 1WCNA 1Z00B 5KFAA 3V72A 1KRPA 4YQWA 4NM2A 2M2VA 4DQQA 3OVAA 2UVWA 2NRZA 8ICCA 1RPLA 2ZJAA 3C18A 4UBCA 4DL3A 1JQRA 1KFSA 3TARA 4I2JA 4JUZA 5D46A 4Q43A 3JPNA 3T5LA 4RQ6A 4DWIA 1S9FA 4J9NA 2C2RA 4F5OA 4X4PA 4FS2A 4NKUA 2F1JA 4F91B 4B9TA 5HRLA 1S77D 4M6WA 4HYKA 5KT7A 1FA0A 5DG9A 5EOZA 4EBEA 2XGPA 4KLDA 4KLHA 1F5AA 4J9LA 7ICHA 1UEVA 4C8KA 4ECVA 1HJPA 4IQVA 1LV5A 3HP6A 1ZQIA 1U48A 4IRCA 4GC6A 1NK5A 3RJGA 4Q8EA 3H3AA 2ZTCA 9ICMA 2FPKA 3H8JA 2BQUA 3AU2A 5IIOA 2XY6A 3M9NB 4DFJA 4JWMA 8ICIA 4WBZA 4RNMA 1NK6A 1ZQGA 1ZJNA 4EZ6A 1SKWA 4RT3A 5KFDA 2ZUDA 3RH5A 4UB1A 2ZH5A 2AGPA 2PFPA 2DRBA 5J0WA 5DDYA 1UT5A 2NRTA 3WFSC 5KT6A 5J2DA 4LVSA 5EWEA 3RAXA 1KLNA 3FYHA 3V7LA 5HP4A 1L5UA 2W9BB 1COOA 1R8BA 4DQSA 4FHXA 5CP2A 1L3UA 5CB1A 4UB5A 4RNOA 5F9LA 3SI8A 1BGXT 5CJ7A 3K75D 8ICGA 2PI5A 2DR7A 5KFLA 8ICQA 4ATBA 9ICLA 3EZ5A 4ELTA 3ZDBA 2HHQA 2ZTDA 1U45A 4E8FA 3LQCB 3H7IA 4RZRA 4RWPA 4P4PA 1NOMA 1ZQXA 9ICVA 9ICJA 1C7YA 4RQ0A 9ICOA 3ETLA 4ED6A 2BDPA 2BQ3A 5HRGA 2FLNA 4F2SA 4ED3A 3PR5B 1ZQDA 5J0UA 4KLIA 3RB3A 5L1IA 3EPGA 1SL2A 5HRDA 3JPQA 5KFHA 3UXPA 4FH5A 8ICUA 7ICEA 3HT3A 5DBBA 4I27A 4XQ7A 1T8EA 2BE3A 4PHDA 2DFLA 4TUQA 2MUTB 1TFRA 1JMSA 1BPDA 2W9MA 1HUOA 1XO1A 4MEYA 3ZDDA 3MDAA 4QZIA 5HNKA 1QSLA 1KTQA 3NYBA 3Q8RB 1B43A 3PW7A 2OWOA 1IM4A 3E2EA 4J9RA 5KT2A 5J0QA 1A77A 4QZCA 4YN4A 4RQ2A 4F93B 5KFCA 5IILA 4QZ8A 4M6WB 9ICPA 4YR2A 4DSJA 4FBUA 4IR9A 3OHAA 5BOLA 7ICMA 2J6UA 8ICKA 1B22A 1S97A 5J2BA 4FS1A 8ICLA 1ZQFA 5KFQA 2F1HA 8ICWA 4RQ7A 5KT3A 5KTQA 2DR8A 2DRAA 3ZDAA 2NRKA 4PGXA 4UAYA 4YD1A 1ZQSA 3LK9A 3MFIA 3PR4A 1U47A 1L3TA 3TAPA 9ICBA 2PBEA 3RAQA 5IIKA 3GV8B 2W8LA 8ICAA 4O3OA 4C8NA 8ICJA 2JEIA 4DL4A 4DSIA 4ED1A 1YLQA 4RNNA 5J0RA 3MR5A 3T5HA 3TFSA 1RXVA 8ICPA 2NRXA 3MABA 4FO6A 4DO9A 2AQ0A 2NRVA 1BPXA 3AQKA 4I2BA 3ZD9A 4NKTA 1Z3EB 3V7KA 2HVIA 5J2GA 3C5GA 1TVAA 4RQ8A 3T5KA 1HUZA 7ICNA 5DKWA 2W9AA 9ICRA 5DB6A 1SKRA 4KLLA 4I2HA 3RJFA 4Q8FA 4DS4A 9ICCA 1Q78A 7ICQA 3AQNA 3GV7B 4RPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KG2 A;  4QZB A;  4NLN A;  2P6U A;  3RB0 A;  3PV8 A;  2AGQ A;  1UA0 A;  5HRK A;  4FHW A;  1S0M A;  1XU4 A;  2JZB B;  4O0I A;  4KLQ A;  3UQ0 A;  2FPL A;  4DFP A;  3RB4 A;  4XRH A;  4I2A A;  3SV3 A;  4MFA A;  4ED0 A;  3UPQ A;  2HHT A;  2BPC A;  4AT7 B;  4RWN A;  3QZ7 A;  7ICT A;  3C1Y A;  2ASJ A;  1XSL A;  5KFR A;  2RDJ A;  9ICH A;  3RJE A;  4TUP A;  3H37 A;  2ZH3 A;  5KFP A;  1VFG A;  4JWN A;  9ICS A;  2DR5 A;  4O3R A;  4AT8 A;  2Q66 A;  3Q8P B;  5J2F A;  4RUC A;  4J9P A;  4DQR A;  9ICT A;  4RQ1 A;  4YMN A;  4RWO A;  9ICK A;  4KMU A;  4WC0 A;  1KSP A;  3QE9 Y;  4ECZ A;  3G6Y A;  4EBJ A;  4WC3 A;  5KFX A;  3T3F A;  1OU5 A;  1L3S A;  1A76 A;  1NK9 A;  5HRE A;  3QEA Z;  4YVZ A;  7ICR A;  2A1J B;  2BCR A;  2ISO A;  2UVV A;  3GDX A;  3RJH A;  4WCW A;  3KTQ A;  2Q0Z X;  4DL5 A;  4KLM A;  4GXI A;  3OGU A;  2XCA A;  1T7P A;  7ICJ A;  4YMO A;  4RPY A;  1XWL A;  2PI4 A;  4DS5 A;  4YD2 A;  4DFM A;  5F2V O;  4BXO A;  2ZH6 A;  4KIT B;  4DOB A;  5KT5 A;  4M47 A;  2VAN A;  1NJW A;  3RRG A;  1R89 A;  4I28 A;  2R8I A;  4C8M A;  4RQ5 A;  2XCP A;  5KG5 A;  2BQR A;  4UD4 A;  3JPS A;  1V9P A;  1JX4 A;  8ICS A;  1MIY A;  4QWC A;  5CR0 A;  9ICA A;  3PX6 A;  2KZZ A;  1TFY A;  4ECS A;  2P66 A;  8ICE A;  5KFI A;  4Z6E A;  4DFK A;  4BWM A;  2KN7 A;  4NY8 A;  9ICW A;  4Z6C A;  3NTU A;  2BCV A;  4KLU A;  4RWQ A;  3KHH A;  5KFO A;  1XS9 D;  3HWT A;  1MQ2 A;  3ISD A;  3PO5 A;  2UVU A;  5DB7 A;  1ZQM A;  1ZQW A;  7ICI A;  8ICF A;  7ICS A;  1ZQA A;  4DF4 A;  4NLZ A;  5J2J A;  1R8A A;  1EXN A;  2ATL A;  3HJ1 A;  1TAU A;  7ICK A;  2C2D A;  4PPX A;  2W9B A;  5KFE A;  2BR0 A;  1JAJ A;  4EP7 A;  4UB2 A;  2R8J A;  3RR8 A;  2NRW A;  2UVR A;  4ZH4 A;  5C5J A;  1DGS A;  3TI0 A;  1ZQP A;  5J0Y A;  1KFD A;  5DB8 A;  5L1L A;  4O3Q A;  5HHH A;  2BCS A;  2J6T A;  1UA1 A;  4EYI B;  4M04 A;  1UET A;  3EWA A;  5DG7 A;  4IG8 A;  4KLE A;  3PY8 A;  4RQ3 A;  4DSE A;  3AUO A;  1JXL A;  7ICV A;  5HRI A;  4O3S A;  1JIH A;  1K1S A;  2DVI A;  3BQ1 A;  3LWL A;  5KG7 A;  4JK1 A;  3RBE A;  3T5J A;  2M2W A;  5HR9 A;  4X4R A;  4F92 B;  3GII A;  5J2H A;  4EYH B;  3Q8Q B;  2HW3 A;  5CA7 A;  1D9D A;  4X4Q A;  2JEF A;  4F5N A;  2FLL A;  4FHY A;  4E80 A;  3TAN A;  4Z6D A;  4UB4 A;  1ZQL A;  1ZQB A;  4I2I A;  4I2G A;  1XSP A;  2DPI A;  2XGQ A;  1NKB A;  4AT9 B;  2ZH7 A;  4QZH A;  4DL6 A;  3RH6 A;  1XC9 A;  1NJX A;  4I2E A;  4AT8 B;  3JPR A;  2RDI A;  3NGD A;  4DSL A;  1BNO A;  3M8R A;  1MIW A;  4TUR A;  1ZQT A;  4YXM A;  4M0A A;  2BPG A;  2F1I A;  3PX0 A;  3Q8K A;  4IR1 A;  2ZHB A;  4F5Q A;  3LDA A;  3RB6 A;  2XC9 A;  4IQU A;  1UEU A;  4QZA A;  4KTQ A;  1U4B A;  5CHG A;  5KG3 A;  4J9M A;  1Z00 A;  9ICU A;  4TUS A;  4XUS A;  4EEY A;  4ED8 A;  4O5E A;  4F5R A;  2PXI A;  4MFC A;  4KLO A;  4DEZ A;  2PFQ A;  3UXN A;  3ORY A;  1NKE A;  4RU9 A;  1NK0 A;  4PHA A;  5D49 A;  4QWE A;  2IHM A;  2V4Q A;  4F8R A;  4O5K A;  3MBY A;  3AQL A;  2ID1 A;  2HHW A;  2ZH8 A;  5KFY A;  3G6X A;  1JN3 A;  3THV A;  8ICH A;  4IRK A;  4WC5 A;  1CUK A;  8ICT A;  1ZJM A;  2O5A A;  3PW0 A;  5KFU A;  4DLG A;  3OUY A;  4F4X A;  1ZQZ A;  1D9F A;  4KLS A;  4MF8 A;  4WBY A;  5KFN A;  5KG0 A;  3G6V A;  3HW8 A;  5DBA A;  1T4G A;  4DSF A;  3N4M B;  4J9O A;  3K4G A;  1ZQE A;  5DQG A;  5EWG A;  1NKC A;  4I29 A;  3UXO A;  3RBD A;  1QTM A;  1ZQJ A;  3MR6 A;  1RZT A;  1DK3 A;  1TK0 A;  1RYS A;  4NLG A;  4DL7 A;  3V7J A;  4GXJ A;  3FDS A;  4F4Z A;  2AQ4 A;  4B9N A;  2W8K A;  4F4Y A;  2KFZ A;  3WFP A;  4Q45 A;  2VA8 A;  2ZHA A;  4QZE A;  1H38 A;  4O9M A;  2C22 A;  5KT4 A;  4NM1 A;  2BCQ A;  3AQM A;  5DED A;  1ZQH A;  3Q8M A;  4ED7 A;  5F9N A;  3V6H A;  2ZUC A;  4FBT A;  4M5D A;  4IQW A;  1ARO P;  4ECT A;  4JV2 A;  2MAX A;  2DR9 A;  4TQS A;  4DF8 A;  4XQ8 A;  2FLP A;  2C28 A;  5DB9 A;  7ICO A;  1PZN A;  5HHI A;  4YR0 A;  4PHP A;  1QSY A;  3GFK B;  3Q8L A;  3MR3 A;  1NK8 A;  4WC4 A;  5HC9 A;  2VA3 A;  1PX5 A;  5DQH A;  2BPF A;  3BQT A;  3ISC A;  5KFM A;  2AGO A;  4QZD A;  4KN7 A;  4RPX A;  4ECR A;  4NXZ A;  4DLE A;  4P4M A;  5J29 A;  1NJY A;  5DEC A;  4UAZ A;  1ZET A;  4YG2 A;  4XA5 A;  3RR7 A;  3C5F A;  2HVH A;  4Z6F A;  4R63 A;  8ICX A;  4UD5 A;  3PX4 A;  4X4V A;  2LYH A;  3H39 A;  4YXJ A;  3C2L A;  9ICN A;  4C8O A;  1WOT A;  5KFV A;  1WCL A;  2H5X A;  2ZH4 A;  3B0Y A;  2XY7 A;  5L1J A;  3HPO A;  3AU6 A;  4X5V A;  1D8Y A;  2HHP A;  4X0A A;  3MGI A;  3OJS A;  3H4B A;  1TK8 A;  3PW5 A;  4YR3 A;  5DQI A;  4C8L A;  3JZ0 A;  1KFT A;  9ICF A;  4KLJ A;  1MQ3 A;  5IIM A;  3GIK A;  3UPS A;  8ICM A;  2JEJ A;  1ZQU A;  3OUY B;  8ICB A;  4UB3 A;  3PMN A;  3MGH A;  5KFT A;  3MDC A;  2KZM A;  1KNY A;  4X0B A;  5J0S A;  8ICV A;  4ECX A;  4S3N A;  1BPZ A;  3SV4 A;  3BDP A;  4Q44 A;  4BGD A;  3QZ8 A;  4DL2 A;  1XSN A;  1S0V A;  4RQ4 A;  2HHX A;  4WC6 A;  5L9X A;  4QW9 A;  2IMW P;  2M2T A;  4IQT A;  2IBK A;  4J9S A;  3M8S A;  4M9N A;  2V9W A;  4FH3 A;  7ICU A;  5IIJ A;  1Y88 A;  5KG1 A;  1K1Q A;  2HHU A;  1X9W A;  1Q79 A;  2ZUB A;  4WC1 A;  8ICZ A;  1QSS A;  4R8U B;  5HRF A;  2KZ3 A;  1SL0 A;  4UQG A;  2RFF A;  1SZP A;  3H8W A;  3MFH A;  4EZ9 A;  3H8S A;  3H38 A;  5J0P A;  5KFF A;  4BWJ A;  1SL1 A;  1X9S A;  5L1K A;  2ZTE A;  3BJY A;  3B0X A;  9ICX A;  3KHG A;  3PW4 A;  1MIV A;  3KHL A;  1BPE A;  3C2K A;  5DG8 A;  5J0T A;  4FHV A;  5KFW A;  4BDP A;  5DGB A;  9ICQ A;  4K4G A;  4F2R A;  2C2E A;  4WC7 A;  2JEG A;  2BCU A;  3ZD8 A;  4BXO B;  2XO7 A;  5BPC A;  3GV5 B;  3H4D A;  1RYR A;  4KLF A;  1SKS A;  2ALZ A;  7ICP A;  1ZQV A;  9ICE A;  1VJ7 A;  4X4N A;  5D4B A;  3PVX A;  4I2F A;  3EPI A;  9ICG A;  3PML A;  1TKD A;  1L3V A;  3V6J A;  4E0D A;  3HJ4 A;  2P6R A;  3BQ2 A;  4YCX A;  4R64 A;  5CWR A;  4R66 A;  3RJI A;  5KG4 A;  2KFN A;  4PHE A;  2ASD A;  4J9Q A;  1TV9 A;  4DQI A;  4WC2 A;  4PH5 A;  3H40 A;  5J0X A;  3TQ1 A;  1TFW A;  4R65 A;  1CEZ A;  5KFS A;  3OHB A;  1T3N A;  4B9L A;  1BNP A;  3IHQ B;  2BGW A;  1UT8 A;  3OVS A;  2GWS A;  2IHN A;  1JXE A;  3GIM A;  4P4O A;  2M2U A;  1ZYQ A;  3C2M A;  1MC8 A;  1DOQ A;  5KG6 A;  4GLX A;  3HX0 A;  3JPO A;  8ICY A;  1V4A A;  2ZH1 A;  2W9C A;  3EYZ A;  1S0O A;  4YMM A;  4RUA A;  2I1Q A;  3N97 B;  1ZQN A;  4NLK A;  4F3O A;  4J9K A;  1ZQR A;  1TK5 A;  1X9M A;  4KLG A;  2AJQ A;  8ICR A;  3ZDC A;  2JZB A;  3M9M B;  3GIL A;  5J2K A;  1ZQY A;  2FMP A;  4IRD A;  3L9D A;  2PFN A;  4P2H A;  1TAQ A;  1LB2 B;  1R8C A;  3C66 A;  4MEX A;  4DSK A;  5J2I A;  3QEB Z;  4MFF A;  5J0O A;  5TZV A;  3TAQ A;  4X4T A;  4ELV A;  4PGQ A;  3JPT A;  4M9L A;  3RH4 A;  4X4S A;  1ZQQ A;  3LWM A;  1NK4 A;  9ICI A;  1KEJ A;  3RTV A;  2XY5 A;  3KHR A;  4DOC A;  3PO4 A;  4EBD A;  1MSW D;  2Y1I A;  3OSN A;  1ZQC A;  2ZJ5 A;  5HRB A;  8ICN A;  3ISB A;  5DDM A;  5DBC A;  4QZG A;  4FHP A;  3WFO A;  4F4K A;  4KN4 A;  4F50 A;  4ECY A;  4R8U A;  2FMS A;  2KP7 A;  4GC7 A;  4M9G A;  1NK7 A;  1S10 A;  4JV1 A;  4M9H A;  2O1P A;  1IXR A;  4PGY A;  3PW2 A;  4JV0 A;  2R8H A;  5DGA A;  3BQ0 A;  2HHV A;  5KFZ A;  4F5P A;  2FMQ A;  2ASL A;  4B9S A;  2FPM A;  3C23 A;  5KFK A;  3JPP A;  3TFR A;  2R8G A;  4B9V A;  4I2D A;  2V4R A;  1ZQK A;  2IA6 A;  4B9M A;  4X4O A;  3OSP A;  1S76 D;  2M9N A;  5III A;  4I2C A;  2MUT A;  3WFR E;  3V6K A;  4YP3 A;  5IIN A;  1U49 A;  2VA2 A;  4ELU A;  1BPB A;  4KLT A;  4TQR A;  5DLF A;  5KFG A;  4ECQ A;  1RXW A;  3PNC A;  3MR2 A;  4QWA A;  3C21 A;  1QLN A;  2Y1J A;  1BPY A;  4MF2 A;  7ICF A;  4LZG A;  5BOM A;  5HMM A;  5J2C A;  2A1J A;  4O3P A;  5JUM A;  3Q8S B;  4ECU A;  2DPJ A;  4ED2 A;  1DK2 A;  5KFB A;  4DOA A;  3IM1 A;  1NZP A;  4RT2 A;  2PFO A;  3HIY A;  2ZH2 A;  3RJJ A;  4AT7 A;  3OV7 A;  4QZ9 A;  1ZQO A;  1X2I A;  4K4I A;  3RJK A;  5J2E A;  4UBB A;  2I9G A;  5HRH A;  4X4U A;  3M9O B;  2J6S A;  1NJZ A;  4K4H A;  3SZ2 A;  4UAW A;  2WTF A;  4F4W A;  2AU0 A;  4EBC A;  4ATB B;  8ICO A;  4EBK A;  3WFQ E;  2BHN A;  4LZD A;  3RRH A;  3OJU A;  1NO5 A;  5KFJ A;  4AT9 A;  2R8K A;  3UQ2 A;  3JYY A;  1KDH A;  2HHS A;  4LT6 A;  2ZH9 A;  3SYZ A;  1N48 A;  1U9L A;  3GIJ A;  2KTQ A;  4QZF A;  1D8L A;  2B21 A;  3ZDE A;  4M9J A;  4O3N A;  3OVB A;  4G3I A;  2ZJ8 A;  2BKE A;  4ECW A;  4M2Y A;  5EWF A;  3EW9 A;  4GXK A;  4DQP A;  4QW8 A;  2W9C B;  4O5C A;  7ICG A;  5DLG A;  4QWD A;  7ICL A;  5HML A;  1N56 A;  4CCH A;  2ISP A;  1S0N A;  4E7X A;  1BVS A;  4QWB A;  3GQC A;  5J2A A;  4B9U A;  3C1Z A;  4YFK A;  1WCN A;  1Z00 B;  5KFA A;  3V72 A;  1KRP A;  4YQW A;  4NM2 A;  2M2V A;  4DQQ A;  3OVA A;  2UVW A;  2NRZ A;  8ICC A;  1RPL A;  2ZJA A;  3C18 A;  4UBC A;  4DL3 A;  1JQR A;  1KFS A;  3TAR A;  4I2J A;  4JUZ A;  5D46 A;  4Q43 A;  3JPN A;  3T5L A;  4RQ6 A;  4DWI A;  1S9F A;  4J9N A;  2C2R A;  4F5O A;  4X4P A;  4FS2 A;  4NKU A;  2F1J A;  4F91 B;  4B9T A;  5HRL A;  1S77 D;  4M6W A;  4HYK A;  5KT7 A;  1FA0 A;  5DG9 A;  5EOZ A;  4EBE A;  2XGP A;  4KLD A;  4KLH A;  1F5A A;  4J9L A;  7ICH A;  1UEV A;  4C8K A;  4ECV A;  1HJP A;  4IQV A;  1LV5 A;  3HP6 A;  1ZQI A;  1U48 A;  4IRC A;  4GC6 A;  1NK5 A;  3RJG A;  4Q8E A;  3H3A A;  2ZTC A;  9ICM A;  2FPK A;  3H8J A;  2BQU A;  3AU2 A;  5IIO A;  2XY6 A;  3M9N B;  4DFJ A;  4JWM A;  8ICI A;  4WBZ A;  4RNM A;  1NK6 A;  1ZQG A;  1ZJN A;  4EZ6 A;  1SKW A;  4RT3 A;  5KFD A;  2ZUD A;  3RH5 A;  4UB1 A;  2ZH5 A;  2AGP A;  2PFP A;  2DRB A;  5J0W A;  5DDY A;  1UT5 A;  2NRT A;  3WFS C;  5KT6 A;  5J2D A;  4LVS A;  5EWE A;  3RAX A;  1KLN A;  3FYH A;  3V7L A;  5HP4 A;  1L5U A;  2W9B B;  1COO A;  1R8B A;  4DQS A;  4FHX A;  5CP2 A;  1L3U A;  5CB1 A;  4UB5 A;  4RNO A;  5F9L A;  3SI8 A;  1BGX T;  5CJ7 A;  3K75 D;  8ICG A;  2PI5 A;  2DR7 A;  5KFL A;  8ICQ A;  4ATB A;  9ICL A;  3EZ5 A;  4ELT A;  3ZDB A;  2HHQ A;  2ZTD A;  1U45 A;  4E8F A;  3LQC B;  3H7I A;  4RZR A;  4RWP A;  4P4P A;  1NOM A;  1ZQX A;  9ICV A;  9ICJ A;  1C7Y A;  4RQ0 A;  9ICO A;  3ETL A;  4ED6 A;  2BDP A;  2BQ3 A;  5HRG A;  2FLN A;  4F2S A;  4ED3 A;  3PR5 B;  1ZQD A;  5J0U A;  4KLI A;  3RB3 A;  5L1I A;  3EPG A;  1SL2 A;  5HRD A;  3JPQ A;  5KFH A;  3UXP A;  4FH5 A;  8ICU A;  7ICE A;  3HT3 A;  5DBB A;  4I27 A;  4XQ7 A;  1T8E A;  2BE3 A;  4PHD A;  2DFL A;  4TUQ A;  2MUT B;  1TFR A;  1JMS A;  1BPD A;  2W9M A;  1HUO A;  1XO1 A;  4MEY A;  3ZDD A;  3MDA A;  4QZI A;  5HNK A;  1QSL A;  1KTQ A;  3NYB A;  3Q8R B;  1B43 A;  3PW7 A;  2OWO A;  1IM4 A;  3E2E A;  4J9R A;  5KT2 A;  5J0Q A;  1A77 A;  4QZC A;  4YN4 A;  4RQ2 A;  4F93 B;  5KFC A;  5IIL A;  4QZ8 A;  4M6W B;  9ICP A;  4YR2 A;  4DSJ A;  4FBU A;  4IR9 A;  3OHA A;  5BOL A;  7ICM A;  2J6U A;  8ICK A;  1B22 A;  1S97 A;  5J2B A;  4FS1 A;  8ICL A;  1ZQF A;  5KFQ A;  2F1H A;  8ICW A;  4RQ7 A;  5KT3 A;  5KTQ A;  2DR8 A;  2DRA A;  3ZDA A;  2NRK A;  4PGX A;  4UAY A;  4YD1 A;  1ZQS A;  3LK9 A;  3MFI A;  3PR4 A;  1U47 A;  1L3T A;  3TAP A;  9ICB A;  2PBE A;  3RAQ A;  5IIK A;  3GV8 B;  2W8L A;  8ICA A;  4O3O A;  4C8N A;  8ICJ A;  2JEI A;  4DL4 A;  4DSI A;  4ED1 A;  1YLQ A;  4RNN A;  5J0R A;  3MR5 A;  3T5H A;  3TFS A;  1RXV A;  8ICP A;  2NRX A;  3MAB A;  4FO6 A;  4DO9 A;  2AQ0 A;  2NRV A;  1BPX A;  3AQK A;  4I2B A;  3ZD9 A;  4NKT A;  1Z3E B;  3V7K A;  2HVI A;  5J2G A;  3C5G A;  1TVA A;  4RQ8 A;  3T5K A;  1HUZ A;  7ICN A;  5DKW A;  2W9A A;  9ICR A;  5DB6 A;  1SKR A;  4KLL A;  4I2H A;  3RJF A;  4Q8F A;  4DS4 A;  9ICC A;  1Q78 A;  7ICQ A;  3AQN A;  3GV7 B;  4RPZ A; 
#chains in the Genus database with same CATH topology
 4QZB A;  2D6F C;  5HRK A;  2JZB B;  2FPL A;  4DFP A;  4I2A A;  2RHF A;  3C1Y A;  3H37 A;  3TAD A;  5KFP A;  3QU4 A;  4O3R A;  3Q8P B;  4IC9 A;  4RUC A;  3QE9 Y;  5HRE A;  4YVZ A;  2UVV A;  2Q0Z X;  4CRX A;  2LPE A;  1XWL A;  5AM5 A;  2PI4 A;  3N7P D;  4DS5 A;  4U7C A;  4YD2 A;  5ALV A;  3JCF A;  4KIT B;  1R89 A;  2K8B B;  4RQ5 A;  5EE3 A;  5KG5 A;  1JX4 A;  2KZZ A;  1TFY A;  8ICE A;  5KFI A;  4DFK A;  4BWM A;  5CHE A;  2D3D A;  4Z6C A;  3NTU A;  2BCV A;  4KLU A;  2ZIU B;  2W55 A;  1ZQM A;  2OEH A;  3NKU A;  5GTI U;  2C2D A;  4PPX A;  2H3F A;  4EP7 A;  3RR8 A;  5ALG A;  4P0Q A;  2QB0 A;  5C5J A;  1ZQP A;  4O3Q A;  3SMV A;  5HHH A;  1UET A;  5AKX A;  3EWA A;  4DSE A;  2JMG A;  1JXL A;  3QUC A;  3BQ7 A;  3RBE A;  5KG7 A;  4JK1 A;  1Q3U A;  4F92 B;  5J2H A;  2HW3 A;  1D9D A;  2JEF A;  2FLL A;  2LM1 A;  4E80 A;  3M6Z A;  4I2G A;  1NKB A;  4BJQ A;  4PL1 A;  4YXM A;  4M0A A;  2F1I A;  3RB6 A;  4FZL A;  5KG3 A;  1Z00 A;  4XUS A;  5ALH A;  4MFC A;  4F8R A;  4O5K A;  3MBY A;  2ZH8 A;  5KFY A;  4IRK A;  4WC5 A;  1CUK A;  8ICT A;  3PW0 A;  3H0M B;  4DLG A;  2YMP A;  2B6G A;  3B9J A;  4WBY A;  3R9K A;  5KFN A;  4DSF A;  3N4M B;  1J97 A;  4I29 A;  2H3Q A;  5EWG A;  2KSO A;  2K8A A;  1ZQJ A;  2RLT A;  2EWR A;  4NLG A;  5AM4 A;  3V7J A;  2M0N A;  2KFZ A;  2G5I B;  2O6K A;  3AQM A;  2C22 A;  5KT4 A;  1C20 A;  2BCQ A;  1ZQH A;  5F9N A;  5AKJ A;  2KG5 A;  4JMU A;  4O67 A;  2DR9 A;  4TQS A;  4DF8 A;  4XQ8 A;  1AQ6 A;  2W04 A;  5ALS A;  4PHP A;  4PL2 A;  3GFK B;  4WC4 A;  4US8 A;  2BPF A;  3BQT A;  3ISC A;  2AHO B;  4RQN A;  4RPX A;  5J29 A;  1WG8 A;  1DXS A;  2G07 A;  3PZP A;  8ICX A;  4R63 A;  2K4I A;  3H0R B;  9ICN A;  4G9B A;  5KFV A;  2H5X A;  1KKX A;  4AYB F;  3B0Y A;  3AU6 A;  4X5V A;  1D8Y A;  3H4B A;  4YR3 A;  5DQI A;  4C8L A;  3JZ0 A;  1KFT A;  1F44 A;  4KLJ A;  3J81 j;  2E3T A;  3SEN A;  4FO1 A;  2E8M A;  1ZQU A;  4X0B A;  2KEY A;  3A0H U;  3SV4 A;  3QZ8 A;  4DL2 A;  1XSN A;  4RQ4 A;  5B3P A;  4NXV A;  2V9W A;  5IIJ A;  2CN1 A;  5HRF A;  1SL0 A;  2NO4 A;  3H38 A;  3H8W A;  3H8S A;  4WOY A;  5J0P A;  3ALR A;  1X9S A;  1WYG A;  3HIL A;  3C2K A;  5DG8 A;  9ICQ A;  4NLB A;  2C2E A;  2JEG A;  1OXJ A;  4RQM A;  3MGV A;  9ICE A;  5TIS U;  5D4B A;  2P35 A;  4PJ0 U;  3PVX A;  4I2F A;  3PML A;  3WK8 A;  2JH1 A;  5AKL A;  2Q4T A;  4WC2 A;  4PH5 A;  1BNP A;  3IHQ B;  2BGW A;  2GWS A;  2IHN A;  4P4O A;  1ZYQ A;  8ICY A;  3RF9 A;  2ZH1 A;  1ZQR A;  1TK5 A;  2LBO A;  2KKP A;  4CE6 A;  8ICR A;  3M9M B;  5D61 A;  4C80 A;  2XID A;  3ER9 B;  4DSK A;  5TZV A;  4K97 A;  4ELV A;  3RH4 A;  4X4S A;  1ZQQ A;  3LWM A;  1NK4 A;  1KEJ A;  5JU5 A;  3K1Z A;  3WKE A;  3ISB A;  5DBC A;  4QZG A;  2FMS A;  4ECY A;  2JR5 A;  4M9H A;  3DV9 A;  2O1P A;  1IXR A;  3HJ1 A;  3BQ0 A;  1SXE A;  4B9V A;  3C23 A;  3D2S A;  2R8G A;  4X4O A;  2IA6 A;  1S76 D;  5III A;  2W03 A;  5IIN A;  4YP3 A;  2VA2 A;  1BPB A;  3PHZ A;  2HMX A;  1MN8 A;  2KIC A;  5AM0 A;  4LZG A;  2YX8 A;  3PSF A;  3PSP A;  3Q8S B;  4ED2 A;  3IM1 A;  4RT2 A;  2PFO A;  3HIY A;  3QUT A;  1X2I A;  4X4U A;  3M9O B;  2Y0S F;  2K60 A;  4ATB B;  8ICO A;  2MRL A;  3WFQ E;  2R8K A;  3UQ2 A;  3JYY A;  2HHS A;  3SYZ A;  1U9L A;  2A3V A;  2KTQ A;  4M9J A;  1Q3V A;  4G3I A;  1Q79 A;  7ICG A;  3EW9 A;  2W9C B;  2FCL A;  5KAF U;  3OVA A;  8ICC A;  3QU5 A;  3T5L A;  4DWI A;  3IV6 A;  2C2R A;  4J9N A;  3U26 A;  2DL0 A;  5F3X B;  4B9T A;  2XIC A;  5AM2 A;  4KLH A;  3I1Y A;  1A6S A;  4J9L A;  7ICH A;  4Q8E A;  2FPK A;  5AIB A;  2DKZ A;  1K5O A;  2XY6 A;  3M9N B;  4DFJ A;  3QXG A;  3UMG A;  4RNM A;  4F72 A;  4EZ6 A;  4RT3 A;  3FM9 A;  2ZH5 A;  2AGP A;  5J0W A;  1PUZ A;  3I76 A;  1ZD5 A;  2NRT A;  4ZOH C;  3WFS C;  1KLN A;  1L8O A;  5AKY A;  2GLE A;  4FHX A;  5CB1 A;  4LEZ A;  4RNO A;  5F9L A;  3K75 D;  1Z1B A;  5ALZ A;  2B51 A;  4E8F A;  3H7I A;  4RZR A;  3UM9 A;  4RQ0 A;  4KX5 A;  2FDR A;  2FJ6 A;  2FLN A;  3PR5 B;  4Y2V A;  1X42 A;  5C0Y A;  2KK0 A;  4EEB A;  3EPG A;  3JPQ A;  3UXP A;  4XQ7 A;  1T8E A;  2DFL A;  2W9M A;  1JMS A;  4N7R A;  1XO1 A;  4MEY A;  4UAU A;  2ZIW A;  3Q8R B;  4FE3 A;  1IM4 A;  3E2E A;  1A77 A;  4YN4 A;  4OJ5 A;  1Q46 A;  5IIL A;  4YR2 A;  2NV3 A;  1QCK A;  3M1Y A;  3CYM A;  4FS1 A;  1ZQF A;  2WFA A;  2WHE A;  5AKG A;  4UAY A;  9ICB A;  3LK9 A;  3PR4 A;  1U47 A;  4Y2J A;  8ICJ A;  1PK3 A;  5A0L A;  3MR5 A;  3AQK A;  2AQ0 A;  1BPX A;  1Z3E B;  2K89 A;  9ICR A;  2LMR A;  3AM9 A;  1YZ6 A;  2K4H A;  1N61 A;  3E58 A;  4DS4 A;  3D2Q A;  3M6K A;  2AGQ A;  1UA0 A;  1S0M A;  1XU4 A;  3UQ0 A;  2W54 A;  3LYS A;  4XRH A;  3CRX A;  4MFA A;  4AT7 B;  2HHT A;  2QAR A;  1XSL A;  1YZ7 A;  1PVP A;  3RJE A;  1VFG A;  1ZRN A;  3IG5 A;  2Q66 A;  9ICT A;  4DQR A;  1KL9 A;  4RWO A;  9ICK A;  4WC0 A;  1A76 A;  5ALU A;  3QEA Z;  4K9A A;  2A1J B;  2BCR A;  3RJH A;  3AEV A;  3KTQ A;  7ICJ A;  4GXI A;  3OGU A;  4YMO A;  4RPY A;  4BXO A;  4DOB A;  5KT5 A;  1NJW A;  3BS7 A;  4C8M A;  2XCP A;  2KHV A;  1MIY A;  1OW5 A;  4Z6E A;  3QUB A;  3D6J A;  4O6A A;  5KFO A;  1XS9 D;  3HWT A;  3PO5 A;  4OAH A;  1JUD A;  1ZQW A;  2EAN A;  8ICF A;  4CF3 A;  4NLZ A;  2EZY A;  4DF4 A;  7ICS A;  1EXN A;  5ALM A;  1JAJ A;  5KFE A;  2BR0 A;  2YTU A;  2UVR A;  4ZH4 A;  3ZDD A;  1DGS A;  1HEK A;  1UA1 A;  4M04 A;  3NVO A;  4NL9 C;  4OJP A;  3F2C A;  1ZXI A;  2ZIV B;  2DVI A;  4NXU A;  3BQ1 A;  4X4R A;  3T5J A;  1P7D A;  2M2W A;  5ALX A;  3ZI4 A;  3Q8Q B;  5CA7 A;  4X4Q A;  5ALQ A;  4F5N A;  2JHD A;  4FHY A;  4UB4 A;  4I2I A;  5AKH A;  2DPI A;  4AT9 B;  3F5A A;  4DL6 A;  1XC9 A;  3JPR A;  2RDI A;  1BNO A;  1MIW A;  3M8R A;  2LM4 A;  4TUR A;  2BPG A;  3Q8K A;  2YMQ A;  3LDA A;  1UEU A;  4QZA A;  1U4B A;  5CHG A;  4J9M A;  1B4F A;  2Z7J A;  4TUS A;  4O5E A;  2PXI A;  1LKY B;  2HCF A;  3ORY A;  2KIW A;  1NKE A;  4RU9 A;  4PHA A;  5KAI U;  5D49 A;  3AQL A;  2ID1 A;  1O03 A;  3G6X A;  2E5S A;  3THV A;  1SV0 A;  2O5A A;  2F8K A;  1SIJ A;  2DQN B;  2QKQ A;  4KLS A;  5KG0 A;  3HW8 A;  5DBA A;  1T4G A;  3K4G A;  4WQK A;  1X66 A;  2F44 A;  1TK0 A;  4B9N A;  1ZD4 A;  4F4Y A;  2IOF A;  2MSN A;  5DED A;  3SAF A;  4UAT A;  4NL9 A;  1UHU A;  1ARO P;  4ECT A;  3H0L B;  2FLP A;  5DB9 A;  1QSY A;  1NK8 A;  2HDO A;  2EAO A;  2F77 X;  2AGO A;  5KFM A;  4QZD A;  4EED A;  4KN7 A;  1VLB A;  3L3F X;  4P4M A;  1NJY A;  4DFD A;  3F2B A;  4XA5 A;  3C5F A;  2HVH A;  4Z6F A;  4UD5 A;  4YXJ A;  2XY7 A;  5EE9 A;  2HHP A;  4X0A A;  3MGI A;  3OJS A;  1TK8 A;  1ZRM A;  1LVH A;  3AQE A;  4EEK A;  1MQ3 A;  2KZM A;  5KFT A;  4MHV A;  4S3N A;  3BDP A;  3BS5 B;  3H8M A;  4BGD A;  4IQT A;  3TAC B;  2KE7 A;  4FH3 A;  2NO5 A;  2HHU A;  1X9W A;  3KZI U;  4AP9 A;  3AL0 B;  4EZ9 A;  5CRX A;  4BWJ A;  1SL1 A;  4UB6 U;  3KHL A;  1BPE A;  2BDU A;  4BDP A;  5DGB A;  2BCU A;  3NVV A;  5BPC A;  1RYR A;  1SKS A;  2ALZ A;  9ICG A;  5CFT A;  1TKD A;  3TAD C;  3AN1 A;  3HJ4 A;  2JGA A;  5CWR A;  4PHE A;  1TV9 A;  1MA7 A;  3O0F A;  2WAQ C;  3NVZ A;  1CEZ A;  5KFS A;  3OHB A;  1T3N A;  4B9L A;  2PMZ C;  1UT8 A;  1IIP A;  3OVS A;  1JXE A;  3GIM A;  2M2U A;  1L8L A;  1V4A A;  5KG6 A;  3HX0 A;  2W9C A;  1S0O A;  4RUA A;  4F3O A;  4J9K A;  4KLG A;  1X9M A;  1COK A;  2FMP A;  3L9D A;  1R8C A;  1FO4 A;  2YY6 A;  5ALL A;  3C66 A;  4MEX A;  5ALJ A;  2MU2 A;  5J0O A;  4X4T A;  3JPT A;  9ICI A;  3PSI A;  2XY5 A;  3KHR A;  4DOC A;  3PO4 A;  1QQ7 A;  4EBD A;  1KW4 A;  1MSW D;  1RDF A;  3FC4 A;  1S10 A;  4M9G A;  2ZH3 A;  3PW2 A;  4PGY A;  1VJ5 A;  4F5P A;  2LYB A;  3OSP A;  4I2C A;  2MUT A;  1ZD2 P;  1U49 A;  4O3M A;  1ED1 A;  4JLX A;  1RXW A;  4ECQ A;  4P0Q B;  5KNI A;  3MR2 A;  2Y1J A;  1BPY A;  4MF2 A;  5HMM A;  2A1J A;  4O3P A;  2ESE A;  4OJL A;  4DOA A;  1QQ6 A;  2ZH2 A;  3OV7 A;  4QZ9 A;  5HRH A;  1NJZ A;  2ZXI A;  4UAW A;  2AU0 A;  4EBC A;  2BHN A;  4LZD A;  2DWQ A;  3RRH A;  1NO5 A;  1N48 A;  4WH5 A;  3UMB A;  3LVW A;  5ALP A;  1V97 A;  4O3N A;  3WK9 A;  2ZJ8 A;  4GXK A;  7ICL A;  4QWD A;  5DLG A;  1N60 A;  1BVS A;  1ECW A;  1Z00 B;  5K4L A;  5KFA A;  2VJ5 A;  4OAF A;  4YQW A;  4NM2 A;  2UVW A;  1RM6 C;  3WK7 A;  3WU2 U;  2ZJA A;  3C18 A;  4DL3 A;  3TAR A;  3IG8 A;  3JPN A;  1XNS A;  2H3V A;  1S9F A;  5AKE A;  3S6J A;  4FS2 A;  2F8L A;  2CRX A;  4F91 B;  4NKU A;  1S77 D;  2DF4 B;  5EOZ A;  4GFJ A;  2XGP A;  1F5A A;  2EZZ A;  3E0F A;  2WF5 A;  4IQV A;  4NXX A;  4IRC A;  1DGJ A;  3HKZ F;  4GC6 A;  1NK5 A;  2ZTC A;  3QU2 A;  2OH2 A;  3D2N A;  3H8J A;  4NXT A;  3AU2 A;  4EX6 A;  1ZQG A;  1ZJN A;  2F3N A;  1FFV A;  2DRB A;  1ZOL A;  4Y2P A;  1UT5 A;  3V7L A;  5G5H A;  2W9B B;  4KM5 A;  4DQS A;  3BZK A;  4AYB C;  2E8N A;  4UB5 A;  3SI8 A;  2PI5 A;  3CK6 A;  2DR7 A;  5KFL A;  9ICL A;  3WK5 A;  2HHQ A;  1SWW A;  1N5W A;  3LQC B;  1VDV A;  4P4P A;  1ZQX A;  9ICV A;  2HOI A;  3F5E A;  9ICO A;  2QAR B;  5HRG A;  1V85 A;  2F76 X;  3RB3 A;  2PKE A;  8ICU A;  2EAP A;  5DBB A;  3HT3 A;  2JH7 A;  2HBJ A;  4I27 A;  2BE3 A;  1BPD A;  1KTQ A;  5J0Q A;  2GA9 D;  9ICP A;  4IR9 A;  3OHA A;  5BOL A;  7ICM A;  4NXW A;  5KFQ A;  2F1H A;  5KT3 A;  2HOF A;  5KTQ A;  2KMD A;  4JB3 A;  3GZF A;  2DR8 A;  2I5H A;  4PGX A;  2B0C A;  2PBE A;  3RAQ A;  4C8N A;  4DL4 A;  4NJ8 A;  1YLQ A;  1RXV A;  3AMZ A;  2NRX A;  3QU7 A;  4DO9 A;  4I2B A;  3HKZ C;  3V7K A;  2HVI A;  3T5K A;  4O69 A;  4UAV A;  2W9A A;  2KIV A;  5DB6 A;  1SKR A;  3RJF A;  9ICC A;  2EDU A;  7ICQ A;  3AQN A;  4LEV A;  5KG2 A;  4NLN A;  3RB0 A;  3PV8 A;  4O0I A;  5ALE A;  2WF9 A;  5CFS A;  4ED0 A;  2KJ9 A;  2OYY A;  4EV6 A;  7ICT A;  3BS5 A;  2ASJ A;  2KSO B;  2VJ4 A;  5KFR A;  9ICH A;  5L1M A;  4JWN A;  2DR5 A;  5AM1 A;  4J9P A;  4RQ1 A;  4YMN A;  4KMU A;  1KSP A;  3G6Y A;  4EBJ A;  4WC3 A;  1L3S A;  2YML A;  1NK9 A;  4P0P B;  7ICR A;  2ISO A;  1L7N A;  3GDX A;  4DL5 A;  5AI9 A;  2XCA A;  1T7P A;  3KBB A;  2KNJ A;  4DFM A;  2YQE A;  4OJO A;  4M47 A;  3RRG A;  4I28 A;  2BQR A;  4UD4 A;  3JPS A;  1V9P A;  4QWC A;  9ICA A;  4ECS A;  4O68 A;  3KKA C;  4NY8 A;  9ICW A;  4RWQ A;  3KHH A;  1MQ2 A;  3ISD A;  5B3Q A;  7ICI A;  1R8A A;  3MC1 A;  5J2J A;  2W9B A;  1SZH A;  2R8J A;  2EZX A;  1SWV A;  1D8B A;  2ODG A;  4BUG A;  5DB8 A;  5L1L A;  2BCS A;  4IG8 A;  5AK3 A;  3PY8 A;  4RQ3 A;  7ICV A;  3AUO A;  5HRI A;  5ALN A;  4O3S A;  1JIH A;  1K1S A;  4XJE A;  3F53 A;  5HR9 A;  1V38 A;  3CNH A;  3EUB 2;  4Z6D A;  1ZQL A;  1ZQB A;  2ZH7 A;  2XGQ A;  3T79 A;  1KN5 A;  3K1R B;  4AT8 B;  4KX3 A;  3NGD A;  4OCZ A;  2LYA A;  3PX0 A;  2ZHB A;  4F5Q A;  4IQU A;  4KTQ A;  5AHX A;  3F2D A;  4ED8 A;  2ZXH A;  4F5R A;  4K99 A;  1RQN A;  5HR6 A;  1FIQ A;  4KLO A;  4DEZ A;  2JXJ A;  3UXN A;  3VCB A;  4PZO A;  2IHM A;  3WKC A;  5KFU A;  2KJ8 A;  1CI4 A;  1ZQZ A;  4MF8 A;  2WB1 C;  3G6V A;  5ALT A;  4J9O A;  1ZQE A;  3RBD A;  1QTM A;  1RZT A;  1X40 A;  1RYS A;  4DL7 A;  5FP0 A;  4GXJ A;  4WQL A;  2AQ4 A;  5J8Y A;  2W8K A;  3WFP A;  4Q45 A;  2VA8 A;  4QZE A;  4NM1 A;  3HRD D;  5ALW A;  3HJE A;  3QUQ A;  2ZUC A;  4FBT A;  4IQW A;  4HX0 A;  2HI0 A;  1T94 A;  2C28 A;  1PZN A;  5HHI A;  4YR0 A;  3NRZ A;  3MR3 A;  2VA3 A;  1PX5 A;  3TKA A;  2Y9U A;  2ES6 A;  4NXZ A;  1X6I A;  5DEC A;  1ZET A;  4YG2 A;  5AKK A;  2N1R A;  3PX4 A;  3C2L A;  4OD0 A;  4C8O A;  3IDW A;  1WOT A;  1WCL A;  4FZM A;  3IN5 A;  2QB0 B;  2ZIW B;  4QNL A;  5IIM A;  3GIK A;  2EH9 A;  3UPS A;  8ICM A;  2JEJ A;  3OUY B;  8ICB A;  4UB3 A;  3MGH A;  3MDC A;  8ICV A;  4Q44 A;  1S0V A;  3M7D A;  4WC6 A;  5AKI A;  1L7P A;  4QW9 A;  2M2T A;  5AI0 A;  2EAM A;  5KG1 A;  1Y88 A;  3PST A;  1K1Q A;  2ZUB A;  4OJ6 A;  1S5L U;  3MCR A;  3NVW A;  3WK4 A;  5AK4 A;  5L1K A;  2LHT A;  3BJY A;  2ZTE A;  4J03 A;  4Y2Q A;  3KHG A;  3PW4 A;  1UCV A;  9ICX A;  1MIV A;  4C4S A;  1FEZ A;  4K4G A;  4WC7 A;  1O08 A;  5EE1 A;  4KLF A;  2XO7 A;  7ICP A;  5JRT A;  1F0M A;  2W3R A;  5AI8 A;  1L3V A;  5ALY A;  2ZIV A;  2P6R A;  3BQ2 A;  4YCX A;  1Z4O A;  4R64 A;  4R66 A;  2H3I A;  2LI6 A;  2YN4 A;  2WB1 F;  5J0X A;  3TQ1 A;  1TFW A;  2MA1 A;  4R65 A;  2ZIX B;  4Y2R A;  4ICA A;  2A1A A;  3C2M A;  1FFU A;  1PVQ A;  4WJ3 B;  4YMM A;  2I1Q A;  1ZQN A;  4NLK A;  3N7S C;  1B0X A;  2AJQ A;  2G06 A;  4P2H A;  1LB2 B;  2VKQ A;  3QEB Z;  2YB1 A;  3TAQ A;  4M9L A;  3ER8 C;  1NZB A;  3N28 A;  2HBK A;  1ZQC A;  8ICN A;  5DDM A;  3WFO A;  5ALR A;  4KN4 A;  5AKZ A;  1JRO A;  5GTH U;  4R8U A;  2HHV A;  1OUQ A;  4JV0 A;  2R8H A;  5DGA A;  1R8B A;  2ZH6 A;  5KFZ A;  2FMQ A;  4B9S A;  2ASL A;  2YB4 A;  5JTI A;  3TFR A;  4I2D A;  2V4R A;  4B9M A;  3KKA A;  2M9N A;  1GO3 F;  3V6K A;  4ELU A;  1KNY A;  4KLT A;  4TQR A;  4QWA A;  3C21 A;  1A0P A;  3N7R C;  5J2C A;  4ECU A;  4Y2Y A;  5H2F U;  2DPJ A;  5KFB A;  1DK2 A;  1SV4 A;  2FI1 A;  3RJJ A;  1ZQO A;  4K4I A;  5J2E A;  4K4H A;  3SZ2 A;  2WTF A;  1X9X A;  4EGW A;  3UMC A;  4CDG A;  4LT6 A;  2WF7 A;  3GIJ A;  4QZF A;  1D8L A;  1JI7 A;  1N5X A;  2BKE A;  5EWF A;  3QYP A;  2JV3 A;  3QU9 A;  4CCH A;  4E7X A;  4B9U A;  3C1Z A;  4YFK A;  1WCN A;  1KRP A;  4UB8 U;  2M2V A;  1SB3 C;  1ZD3 A;  1RPL A;  2K8C B;  4UBC A;  2HOQ A;  3KZX A;  5T14 A;  4JUZ A;  5D46 A;  2IOH A;  4CF5 A;  4UAR A;  5ALI A;  2KV2 A;  3SQI A;  1KQQ A;  1FA0 A;  5DG9 A;  4C4R A;  4EBE A;  1UEV A;  2D8C A;  4ECV A;  1LV5 A;  3OTQ A;  4FFD A;  2IOF K;  9ICM A;  5AI5 A;  5CFU A;  5IIO A;  4JWM A;  4WBZ A;  2ZUD A;  3RH5 A;  4UB1 A;  3EF2 A;  3ERC C;  5DDY A;  4IS7 A;  2CPR A;  5KT6 A;  5EWE A;  3RAX A;  3FYH A;  5HP4 A;  1L5U A;  3K7D A;  1WUD A;  1L3U A;  2HN2 A;  1BGX T;  5CJ7 A;  8ICG A;  4PZN A;  3L5K A;  2HSZ A;  4ELT A;  2ZIX A;  1U45 A;  2IUB A;  1TE2 A;  1NOM A;  1RG6 A;  1C7Y A;  2G5H B;  3ETL A;  4F2S A;  4ED3 A;  5J0U A;  3GU3 A;  4CF4 A;  3NS1 A;  5HRD A;  4FH5 A;  7ICE A;  2KKV A;  5HR7 A;  4TUQ A;  1HUO A;  1TFR A;  1Z1V A;  3MDA A;  4U6P A;  4QZI A;  2L5Y A;  5HNK A;  1QSL A;  3DDH A;  2KVS A;  4P0P A;  3PW7 A;  4J9R A;  3VC8 A;  5KT2 A;  2EQY A;  5KFC A;  4QZ8 A;  4M6W B;  4QIW F;  4DSJ A;  5J2B A;  2YMM A;  4RQ7 A;  2Y0S C;  1UPH A;  3ZDA A;  1L3T A;  5IIK A;  3GV8 B;  2W8L A;  2LKY A;  4O3O A;  2JEI A;  4DSI A;  4ED1 A;  4RNN A;  1IV8 A;  4DCC A;  3T5H A;  5AI4 A;  8ICP A;  3MAB A;  3ZD9 A;  4NKT A;  2IHO A;  5J2G A;  3NRW A;  3C5G A;  1TVA A;  7ICN A;  5DKW A;  4KLL A;  5EE0 A;  3GV7 B;  2JRZ A;  5AK5 A;  2P6U A;  3OPX A;  4FHW A;  4KLQ A;  3RB4 A;  4Y2S A;  3SV3 A;  4IL6 U;  3UPQ A;  2BPC A;  4RWN A;  3QZ7 A;  2RDJ A;  4TUP A;  2K4P A;  9ICS A;  4AT8 A;  1UQV A;  5J2F A;  2WF6 A;  2BBJ A;  2W43 A;  4ECZ A;  2G0A A;  5KFX A;  3T3F A;  1OU5 A;  4NLC A;  4WCW A;  4EEL A;  2KJ5 A;  4KLM A;  4UAS A;  4Y2U A;  1WWV A;  2KOB A;  5F2V O;  1HIW A;  5AM3 A;  4KB6 A;  2VAN A;  5G5G A;  3BZC A;  2R8I A;  8ICS A;  2FE9 A;  5CR0 A;  2OHF A;  3PX6 A;  2P66 A;  2W11 A;  2KN7 A;  3ONN A;  4LJX A;  2BBH A;  2DBY A;  5DB7 A;  2UVU A;  1ZQA A;  2ATL A;  2H3Z A;  1PK1 B;  1TAU A;  7ICK A;  4K98 A;  1T3Q A;  4UB2 A;  1SGG A;  2NRW A;  1F5S A;  4C7Z A;  3TI0 A;  2J6T A;  5J0Y A;  1KFD A;  1IG6 A;  4EYI B;  1Z4N A;  5DG7 A;  4KLE A;  3WK6 A;  1L7O A;  3LWL A;  3GII A;  4EYH B;  2KVC A;  3KFU F;  3TAN A;  2Y9T A;  3CW2 C;  2RP5 A;  1XSP A;  2A19 A;  4QZH A;  4I2E A;  3RH6 A;  1NJX A;  4DSL A;  1ZQ1 C;  4A8E A;  2E8O A;  1ZQT A;  4Y2X A;  4IR1 A;  2XC9 A;  2KD1 A;  9ICU A;  4EEY A;  3SAG A;  5AIA A;  2PFQ A;  1NK0 A;  4QWE A;  2V4Q A;  1QQ5 A;  1N63 A;  2HHW A;  8ICH A;  1S8O A;  1JN3 A;  5AIC A;  1ZJM A;  3WKA A;  3OUY A;  4F4X A;  1D9F A;  2B56 A;  5DQG A;  1NKC A;  3UXO A;  3MR6 A;  2PMZ F;  1DK3 A;  5J8Y C;  1N62 A;  3FDS A;  4F4Z A;  2OXO A;  2ZHA A;  1H38 A;  4O9M A;  1JAL A;  2CXY A;  3Q8M A;  4ED7 A;  2GAF D;  3V6H A;  1L7M A;  4M5D A;  4JV2 A;  2MAX A;  4OAI Z;  7ICO A;  2F2A B;  3Q8L A;  2OCE A;  5HC9 A;  1URJ A;  5DQH A;  4LEY A;  3CP8 A;  4ECR A;  2R18 A;  4DLE A;  2AXT U;  4K96 A;  4UAZ A;  5ALD A;  4C4T A;  3RR7 A;  4X4V A;  2LYH A;  3H39 A;  1NI3 A;  1KBU A;  2VIX A;  1GPJ A;  4I0U A;  2ZH4 A;  5L1J A;  3HPO A;  4NWI A;  5B66 U;  3PW5 A;  1PVR A;  9ICF A;  5ALK A;  3PMN A;  3A0B U;  5J0S A;  4ECX A;  1BPZ A;  2HHX A;  4F71 A;  5L9X A;  4US9 A;  2IMW P;  2IBK A;  4J9S A;  3M8S A;  2QB1 A;  1PK1 A;  4C0Z A;  4M9N A;  7ICU A;  1XO0 A;  2QLT A;  4CGZ A;  2B4V A;  4WC1 A;  8ICZ A;  1QSS A;  4R8U B;  2KZ3 A;  4UQG A;  2E8P A;  1SZP A;  3MFH A;  2RFF A;  5KFF A;  1SXD A;  2GOL A;  5ALF A;  3B0X A;  4QJF B;  5B5E U;  5J0T A;  4FHV A;  5KFW A;  1LKY A;  2XVT A;  4F2R A;  3ZD8 A;  4BXO B;  3H4D A;  3GV5 B;  2K4E A;  1ZQV A;  1VJ7 A;  4X4N A;  3EPI A;  4KMO B;  2RQ5 A;  3DEE A;  3V6J A;  4E0D A;  2HN1 A;  3RJI A;  5KG4 A;  2KFN A;  2ASD A;  4J9Q A;  4DQI A;  1L6N A;  3H40 A;  2E1E A;  2WAQ F;  4B6J A;  1MC8 A;  1DOQ A;  4GLX A;  3JPO A;  3EYZ A;  3N97 B;  3C28 A;  3SR6 A;  2G08 A;  3ZDC A;  2JZB A;  3GIL A;  5J2K A;  1ZQY A;  4IRD A;  2PFN A;  1TAQ A;  5J2I A;  1J2N A;  4MFF A;  2DUY A;  4PGQ A;  2BZF A;  3NVY A;  3IP4 B;  3RTV A;  5D62 A;  5E79 U;  3ED5 A;  4JLZ A;  2Y1I A;  3OSN A;  5HRB A;  2ZJ5 A;  3AQF A;  5JTG A;  1YT3 A;  4FHP A;  4F4K A;  4F50 A;  2KP7 A;  3ICX A;  4GC7 A;  1NK7 A;  4JV1 A;  1RQL A;  2FPM A;  3JPP A;  5KFK A;  1ZQK A;  1Q8K A;  3WFR E;  3ETR A;  3C29 A;  3RFA A;  4FZN A;  5DLF A;  5KFG A;  4K8V A;  3PNC A;  1QLN A;  7ICF A;  5BOM A;  2OM6 A;  5JUM A;  2G09 A;  1Z19 A;  1NZP A;  4AT7 A;  4K9B A;  3RJK A;  4UBB A;  2I9G A;  2J6S A;  2ZIU A;  4F4W A;  4EBK A;  4AT9 A;  3OJU A;  5KFJ A;  1KDH A;  2ZH9 A;  3NWI A;  2KHQ A;  4EEN A;  2B21 A;  3ZDE A;  3SD7 A;  3OVB A;  4ECW A;  4M2Y A;  4O5C A;  4DQP A;  4QW8 A;  5CEH A;  2GH1 A;  1J2M A;  4NV0 A;  5HML A;  4USA A;  1N56 A;  1X6J A;  2ISP A;  5AI6 A;  1S0N A;  4QWB A;  3QX7 A;  5J2A A;  3GQC A;  3FAH A;  3V72 A;  2WF8 A;  4DQQ A;  2NRZ A;  4OO1 J;  1JQR A;  1KFS A;  2W7P A;  4I2J A;  4Q43 A;  4GIB A;  4RQ6 A;  1N2X A;  2DGZ A;  4X4P A;  4F5O A;  2F1J A;  5HRL A;  4M6W A;  4HYK A;  5KT7 A;  4KLD A;  4C8K A;  1HJP A;  3HP6 A;  1ZQI A;  1U48 A;  3RJG A;  3H3A A;  2W3S A;  2BQU A;  2GO7 A;  3L4P A;  3WKB A;  2W7O A;  1SV0 C;  8ICI A;  1NK6 A;  1SKW A;  3SEI A;  5KFD A;  3OWG A;  2PFP A;  3KD3 A;  4Y2T A;  4LVS A;  5J2D A;  1COO A;  2ZG6 A;  4LEW A;  5CP2 A;  1CRX A;  2HBL A;  8ICQ A;  4ATB A;  2AH5 A;  3EZ5 A;  3ZDB A;  2ZTD A;  5AK6 A;  3WKD A;  4RWP A;  3NAS A;  9ICJ A;  4ED6 A;  2BDP A;  2BQ3 A;  3SAH A;  4KLI A;  1ZQD A;  3KOO A;  1DRG A;  4C7Y A;  5L1I A;  3NUQ A;  1SL2 A;  5KFH A;  1WWU A;  1TAM A;  4PHD A;  2MUT B;  2NYV A;  3NYB A;  1B43 A;  2OWO A;  5D63 A;  2E1F A;  4QZC A;  4CNQ A;  4RQ2 A;  4QIW C;  4F93 B;  2HBM A;  4BX9 C;  4FBU A;  1B22 A;  1NNL A;  1M6Y A;  2J6U A;  8ICK A;  4UW9 A;  1S97 A;  8ICL A;  8ICW A;  1QH9 A;  2DKX A;  4ACO A;  2DRA A;  2I6X A;  2NRK A;  4EX7 A;  1ZQS A;  4YD1 A;  3IRU A;  3MFI A;  3TAP A;  3LVV A;  1JRP A;  8ICA A;  5J0R A;  3TFS A;  4FO6 A;  4HAI A;  2NRV A;  3QNM A;  2XI9 A;  5KL8 B;  2RRD A;  5KL1 B;  4RQ8 A;  1HUZ A;  4MKP A;  3I28 A;  4OAG A;  4I2H A;  1RYU A;  4Q8F A;  1Q78 A;  4RPZ A;  5ALO A; 
#chains in the Genus database with same CATH homology
 5KG2 A;  4QZB A;  4NLN A;  2P6U A;  3RB0 A;  3PV8 A;  2AGQ A;  1UA0 A;  5HRK A;  4FHW A;  1S0M A;  1XU4 A;  2JZB B;  4O0I A;  4KLQ A;  3UQ0 A;  2FPL A;  4DFP A;  3RB4 A;  4XRH A;  4I2A A;  3SV3 A;  4MFA A;  4ED0 A;  3UPQ A;  2HHT A;  2BPC A;  4AT7 B;  4RWN A;  3QZ7 A;  7ICT A;  3C1Y A;  2ASJ A;  1XSL A;  5KFR A;  2RDJ A;  9ICH A;  3RJE A;  4TUP A;  3H37 A;  2ZH3 A;  5KFP A;  1VFG A;  4JWN A;  9ICS A;  2DR5 A;  4O3R A;  4AT8 A;  2Q66 A;  3Q8P B;  5J2F A;  4RUC A;  4J9P A;  4DQR A;  9ICT A;  4RQ1 A;  4YMN A;  4RWO A;  9ICK A;  4KMU A;  4WC0 A;  1KSP A;  3QE9 Y;  4ECZ A;  3G6Y A;  4EBJ A;  4WC3 A;  5KFX A;  3T3F A;  1OU5 A;  1L3S A;  1A76 A;  1NK9 A;  5HRE A;  3QEA Z;  4YVZ A;  7ICR A;  2A1J B;  2BCR A;  2ISO A;  2UVV A;  3GDX A;  3RJH A;  4WCW A;  3KTQ A;  2Q0Z X;  4DL5 A;  4KLM A;  4GXI A;  3OGU A;  2XCA A;  1T7P A;  7ICJ A;  4YMO A;  4RPY A;  1XWL A;  2PI4 A;  4DS5 A;  4YD2 A;  4DFM A;  5F2V O;  4BXO A;  2ZH6 A;  4KIT B;  4DOB A;  5KT5 A;  4M47 A;  2VAN A;  1NJW A;  3RRG A;  1R89 A;  4I28 A;  2R8I A;  4C8M A;  4RQ5 A;  2XCP A;  5KG5 A;  2BQR A;  4UD4 A;  3JPS A;  1V9P A;  1JX4 A;  8ICS A;  1MIY A;  4QWC A;  5CR0 A;  9ICA A;  3PX6 A;  2KZZ A;  1TFY A;  4ECS A;  2P66 A;  8ICE A;  5KFI A;  4Z6E A;  4DFK A;  4BWM A;  2KN7 A;  4NY8 A;  9ICW A;  4Z6C A;  3NTU A;  2BCV A;  4KLU A;  4RWQ A;  3KHH A;  5KFO A;  1XS9 D;  3HWT A;  1MQ2 A;  3ISD A;  3PO5 A;  2UVU A;  5DB7 A;  1ZQM A;  1ZQW A;  7ICI A;  8ICF A;  7ICS A;  1ZQA A;  4DF4 A;  4NLZ A;  5J2J A;  1R8A A;  1EXN A;  2ATL A;  3HJ1 A;  1TAU A;  7ICK A;  2C2D A;  4PPX A;  2W9B A;  5KFE A;  2BR0 A;  1JAJ A;  4EP7 A;  4UB2 A;  2R8J A;  3RR8 A;  2NRW A;  2UVR A;  4ZH4 A;  5C5J A;  1DGS A;  3TI0 A;  1ZQP A;  5J0Y A;  1KFD A;  5DB8 A;  5L1L A;  4O3Q A;  5HHH A;  2BCS A;  2J6T A;  1UA1 A;  4EYI B;  4M04 A;  1UET A;  3EWA A;  5DG7 A;  4IG8 A;  4KLE A;  3PY8 A;  4RQ3 A;  4DSE A;  3AUO A;  1JXL A;  7ICV A;  5HRI A;  4O3S A;  1JIH A;  1K1S A;  2DVI A;  3BQ1 A;  3LWL A;  5KG7 A;  4JK1 A;  3RBE A;  3T5J A;  2M2W A;  5HR9 A;  4X4R A;  4F92 B;  3GII A;  5J2H A;  4EYH B;  3Q8Q B;  2HW3 A;  5CA7 A;  1D9D A;  4X4Q A;  2JEF A;  4F5N A;  2FLL A;  4FHY A;  4E80 A;  3TAN A;  4Z6D A;  4UB4 A;  1ZQL A;  1ZQB A;  4I2I A;  4I2G A;  1XSP A;  2DPI A;  2XGQ A;  1NKB A;  4AT9 B;  2ZH7 A;  4QZH A;  4DL6 A;  3RH6 A;  1XC9 A;  1NJX A;  4I2E A;  4AT8 B;  3JPR A;  2RDI A;  3NGD A;  4DSL A;  1BNO A;  3M8R A;  1MIW A;  4TUR A;  1ZQT A;  4YXM A;  4M0A A;  2BPG A;  2F1I A;  3PX0 A;  3Q8K A;  4IR1 A;  2ZHB A;  4F5Q A;  3LDA A;  3RB6 A;  2XC9 A;  4IQU A;  1UEU A;  4QZA A;  4KTQ A;  1U4B A;  5CHG A;  5KG3 A;  4J9M A;  1Z00 A;  9ICU A;  4TUS A;  4XUS A;  4EEY A;  4ED8 A;  4O5E A;  4F5R A;  2PXI A;  4MFC A;  4KLO A;  4DEZ A;  2PFQ A;  3UXN A;  3ORY A;  1NKE A;  4RU9 A;  1NK0 A;  4PHA A;  5D49 A;  4QWE A;  2IHM A;  2V4Q A;  4F8R A;  4O5K A;  3MBY A;  3AQL A;  2ID1 A;  2HHW A;  2ZH8 A;  5KFY A;  3G6X A;  1JN3 A;  3THV A;  8ICH A;  4IRK A;  4WC5 A;  1CUK A;  8ICT A;  1ZJM A;  2O5A A;  3PW0 A;  5KFU A;  4DLG A;  3OUY A;  4F4X A;  1ZQZ A;  1D9F A;  4KLS A;  4MF8 A;  4WBY A;  5KFN A;  5KG0 A;  3G6V A;  3HW8 A;  5DBA A;  1T4G A;  4DSF A;  3N4M B;  4J9O A;  3K4G A;  1ZQE A;  5DQG A;  5EWG A;  1NKC A;  4I29 A;  3UXO A;  3RBD A;  1QTM A;  1ZQJ A;  3MR6 A;  1RZT A;  1DK3 A;  1TK0 A;  1RYS A;  4NLG A;  4DL7 A;  3V7J A;  4GXJ A;  3FDS A;  4F4Z A;  2AQ4 A;  4B9N A;  2W8K A;  4F4Y A;  2KFZ A;  3WFP A;  4Q45 A;  2VA8 A;  2ZHA A;  4QZE A;  1H38 A;  4O9M A;  2C22 A;  5KT4 A;  4NM1 A;  2BCQ A;  3AQM A;  5DED A;  1ZQH A;  3Q8M A;  4ED7 A;  5F9N A;  3V6H A;  2ZUC A;  4FBT A;  4M5D A;  4IQW A;  1ARO P;  4ECT A;  4JV2 A;  2MAX A;  2DR9 A;  4TQS A;  4DF8 A;  4XQ8 A;  2FLP A;  2C28 A;  5DB9 A;  7ICO A;  1PZN A;  5HHI A;  4YR0 A;  4PHP A;  1QSY A;  3GFK B;  3Q8L A;  3MR3 A;  1NK8 A;  4WC4 A;  5HC9 A;  2VA3 A;  1PX5 A;  5DQH A;  2BPF A;  3BQT A;  3ISC A;  5KFM A;  2AGO A;  4QZD A;  4KN7 A;  4RPX A;  4ECR A;  4NXZ A;  4DLE A;  4P4M A;  5J29 A;  1NJY A;  5DEC A;  4UAZ A;  1ZET A;  4YG2 A;  4XA5 A;  3RR7 A;  3C5F A;  2HVH A;  4Z6F A;  4R63 A;  8ICX A;  4UD5 A;  3PX4 A;  4X4V A;  2LYH A;  3H39 A;  4YXJ A;  3C2L A;  9ICN A;  4C8O A;  1WOT A;  5KFV A;  1WCL A;  2H5X A;  2ZH4 A;  3B0Y A;  2XY7 A;  5L1J A;  3HPO A;  3AU6 A;  4X5V A;  1D8Y A;  2HHP A;  4X0A A;  3MGI A;  3OJS A;  3H4B A;  1TK8 A;  3PW5 A;  4YR3 A;  5DQI A;  4C8L A;  3JZ0 A;  1KFT A;  9ICF A;  4KLJ A;  1MQ3 A;  5IIM A;  3GIK A;  3UPS A;  8ICM A;  2JEJ A;  1ZQU A;  3OUY B;  8ICB A;  4UB3 A;  3PMN A;  3MGH A;  5KFT A;  3MDC A;  2KZM A;  1KNY A;  4X0B A;  5J0S A;  8ICV A;  4ECX A;  4S3N A;  1BPZ A;  3SV4 A;  3BDP A;  4Q44 A;  4BGD A;  3QZ8 A;  4DL2 A;  1XSN A;  1S0V A;  4RQ4 A;  2HHX A;  4WC6 A;  5L9X A;  4QW9 A;  2IMW P;  2M2T A;  4IQT A;  2IBK A;  4J9S A;  3M8S A;  4M9N A;  2V9W A;  4FH3 A;  7ICU A;  5IIJ A;  1Y88 A;  5KG1 A;  1K1Q A;  2HHU A;  1X9W A;  1Q79 A;  2ZUB A;  4WC1 A;  8ICZ A;  1QSS A;  4R8U B;  5HRF A;  2KZ3 A;  1SL0 A;  4UQG A;  2RFF A;  1SZP A;  3H8W A;  3MFH A;  4EZ9 A;  3H8S A;  3H38 A;  5J0P A;  5KFF A;  4BWJ A;  1SL1 A;  1X9S A;  5L1K A;  2ZTE A;  3BJY A;  3B0X A;  9ICX A;  3KHG A;  3PW4 A;  1MIV A;  3KHL A;  1BPE A;  3C2K A;  5DG8 A;  5J0T A;  4FHV A;  5KFW A;  4BDP A;  5DGB A;  9ICQ A;  4K4G A;  4F2R A;  2C2E A;  4WC7 A;  2JEG A;  2BCU A;  3ZD8 A;  4BXO B;  2XO7 A;  5BPC A;  3GV5 B;  3H4D A;  1RYR A;  4KLF A;  1SKS A;  2ALZ A;  7ICP A;  1ZQV A;  9ICE A;  1VJ7 A;  4X4N A;  5D4B A;  3PVX A;  4I2F A;  3EPI A;  9ICG A;  3PML A;  1TKD A;  1L3V A;  3V6J A;  4E0D A;  3HJ4 A;  2P6R A;  3BQ2 A;  4YCX A;  4R64 A;  5CWR A;  4R66 A;  3RJI A;  5KG4 A;  2KFN A;  4PHE A;  2ASD A;  4J9Q A;  1TV9 A;  4DQI A;  4WC2 A;  4PH5 A;  3H40 A;  5J0X A;  3TQ1 A;  1TFW A;  4R65 A;  1CEZ A;  5KFS A;  3OHB A;  1T3N A;  4B9L A;  1BNP A;  3IHQ B;  2BGW A;  1UT8 A;  3OVS A;  2GWS A;  2IHN A;  1JXE A;  3GIM A;  4P4O A;  2M2U A;  1ZYQ A;  3C2M A;  1MC8 A;  1DOQ A;  5KG6 A;  4GLX A;  3HX0 A;  3JPO A;  8ICY A;  1V4A A;  2ZH1 A;  2W9C A;  3EYZ A;  1S0O A;  4YMM A;  4RUA A;  2I1Q A;  3N97 B;  1ZQN A;  4NLK A;  4F3O A;  4J9K A;  1ZQR A;  1TK5 A;  1X9M A;  4KLG A;  2AJQ A;  8ICR A;  3ZDC A;  2JZB A;  3M9M B;  3GIL A;  5J2K A;  1ZQY A;  2FMP A;  4IRD A;  3L9D A;  2PFN A;  4P2H A;  1TAQ A;  1LB2 B;  1R8C A;  3C66 A;  4MEX A;  4DSK A;  5J2I A;  3QEB Z;  4MFF A;  5J0O A;  5TZV A;  3TAQ A;  4X4T A;  4ELV A;  4PGQ A;  3JPT A;  4M9L A;  3RH4 A;  4X4S A;  1ZQQ A;  3LWM A;  1NK4 A;  9ICI A;  1KEJ A;  3RTV A;  2XY5 A;  3KHR A;  4DOC A;  3PO4 A;  4EBD A;  1MSW D;  2Y1I A;  3OSN A;  1ZQC A;  2ZJ5 A;  5HRB A;  8ICN A;  3ISB A;  5DDM A;  5DBC A;  4QZG A;  4FHP A;  3WFO A;  4F4K A;  4KN4 A;  4F50 A;  4ECY A;  4R8U A;  2FMS A;  2KP7 A;  4GC7 A;  4M9G A;  1NK7 A;  1S10 A;  4JV1 A;  4M9H A;  2O1P A;  1IXR A;  4PGY A;  3PW2 A;  4JV0 A;  2R8H A;  5DGA A;  3BQ0 A;  2HHV A;  5KFZ A;  4F5P A;  2FMQ A;  2ASL A;  4B9S A;  2FPM A;  3C23 A;  5KFK A;  3JPP A;  3TFR A;  2R8G A;  4B9V A;  4I2D A;  2V4R A;  1ZQK A;  2IA6 A;  4B9M A;  4X4O A;  3OSP A;  1S76 D;  2M9N A;  5III A;  4I2C A;  2MUT A;  3WFR E;  3V6K A;  4YP3 A;  5IIN A;  1U49 A;  2VA2 A;  4ELU A;  1BPB A;  4KLT A;  4TQR A;  5DLF A;  5KFG A;  4ECQ A;  1RXW A;  3PNC A;  3MR2 A;  4QWA A;  3C21 A;  1QLN A;  2Y1J A;  1BPY A;  4MF2 A;  7ICF A;  4LZG A;  5BOM A;  5HMM A;  5J2C A;  2A1J A;  4O3P A;  5JUM A;  3Q8S B;  4ECU A;  2DPJ A;  4ED2 A;  1DK2 A;  5KFB A;  4DOA A;  3IM1 A;  1NZP A;  4RT2 A;  2PFO A;  3HIY A;  2ZH2 A;  3RJJ A;  4AT7 A;  3OV7 A;  4QZ9 A;  1ZQO A;  1X2I A;  4K4I A;  3RJK A;  5J2E A;  4UBB A;  2I9G A;  5HRH A;  4X4U A;  3M9O B;  2J6S A;  1NJZ A;  4K4H A;  3SZ2 A;  4UAW A;  2WTF A;  4F4W A;  2AU0 A;  4EBC A;  4ATB B;  8ICO A;  4EBK A;  3WFQ E;  2BHN A;  4LZD A;  3RRH A;  3OJU A;  1NO5 A;  5KFJ A;  4AT9 A;  2R8K A;  3UQ2 A;  3JYY A;  1KDH A;  2HHS A;  4LT6 A;  2ZH9 A;  3SYZ A;  1N48 A;  1U9L A;  3GIJ A;  2KTQ A;  4QZF A;  1D8L A;  2B21 A;  3ZDE A;  4M9J A;  4O3N A;  3OVB A;  4G3I A;  2ZJ8 A;  2BKE A;  4ECW A;  4M2Y A;  5EWF A;  3EW9 A;  4GXK A;  4DQP A;  4QW8 A;  2W9C B;  4O5C A;  7ICG A;  5DLG A;  4QWD A;  7ICL A;  5HML A;  1N56 A;  4CCH A;  2ISP A;  1S0N A;  4E7X A;  1BVS A;  4QWB A;  3GQC A;  5J2A A;  4B9U A;  3C1Z A;  4YFK A;  1WCN A;  1Z00 B;  5KFA A;  3V72 A;  1KRP A;  4YQW A;  4NM2 A;  2M2V A;  4DQQ A;  3OVA A;  2UVW A;  2NRZ A;  8ICC A;  1RPL A;  2ZJA A;  3C18 A;  4UBC A;  4DL3 A;  1JQR A;  1KFS A;  3TAR A;  4I2J A;  4JUZ A;  5D46 A;  4Q43 A;  3JPN A;  3T5L A;  4RQ6 A;  4DWI A;  1S9F A;  4J9N A;  2C2R A;  4F5O A;  4X4P A;  4FS2 A;  4NKU A;  2F1J A;  4F91 B;  4B9T A;  5HRL A;  1S77 D;  4M6W A;  4HYK A;  5KT7 A;  1FA0 A;  5DG9 A;  5EOZ A;  4EBE A;  2XGP A;  4KLD A;  4KLH A;  1F5A A;  4J9L A;  7ICH A;  1UEV A;  4C8K A;  4ECV A;  1HJP A;  4IQV A;  1LV5 A;  3HP6 A;  1ZQI A;  1U48 A;  4IRC A;  4GC6 A;  1NK5 A;  3RJG A;  4Q8E A;  3H3A A;  2ZTC A;  9ICM A;  2FPK A;  3H8J A;  2BQU A;  3AU2 A;  5IIO A;  2XY6 A;  3M9N B;  4DFJ A;  4JWM A;  8ICI A;  4WBZ A;  4RNM A;  1NK6 A;  1ZQG A;  1ZJN A;  4EZ6 A;  1SKW A;  4RT3 A;  5KFD A;  2ZUD A;  3RH5 A;  4UB1 A;  2ZH5 A;  2AGP A;  2PFP A;  2DRB A;  5J0W A;  5DDY A;  1UT5 A;  2NRT A;  3WFS C;  5KT6 A;  5J2D A;  4LVS A;  5EWE A;  3RAX A;  1KLN A;  3FYH A;  3V7L A;  5HP4 A;  1L5U A;  2W9B B;  1COO A;  1R8B A;  4DQS A;  4FHX A;  5CP2 A;  1L3U A;  5CB1 A;  4UB5 A;  4RNO A;  5F9L A;  3SI8 A;  1BGX T;  5CJ7 A;  3K75 D;  8ICG A;  2PI5 A;  2DR7 A;  5KFL A;  8ICQ A;  4ATB A;  9ICL A;  3EZ5 A;  4ELT A;  3ZDB A;  2HHQ A;  2ZTD A;  1U45 A;  4E8F A;  3LQC B;  3H7I A;  4RZR A;  4RWP A;  4P4P A;  1NOM A;  1ZQX A;  9ICV A;  9ICJ A;  1C7Y A;  4RQ0 A;  9ICO A;  3ETL A;  4ED6 A;  2BDP A;  2BQ3 A;  5HRG A;  2FLN A;  4F2S A;  4ED3 A;  3PR5 B;  1ZQD A;  5J0U A;  4KLI A;  3RB3 A;  5L1I A;  3EPG A;  1SL2 A;  5HRD A;  3JPQ A;  5KFH A;  3UXP A;  4FH5 A;  8ICU A;  7ICE A;  3HT3 A;  5DBB A;  4I27 A;  4XQ7 A;  1T8E A;  2BE3 A;  4PHD A;  2DFL A;  4TUQ A;  2MUT B;  1TFR A;  1JMS A;  1BPD A;  2W9M A;  1HUO A;  1XO1 A;  4MEY A;  3ZDD A;  3MDA A;  4QZI A;  5HNK A;  1QSL A;  1KTQ A;  3NYB A;  3Q8R B;  1B43 A;  3PW7 A;  2OWO A;  1IM4 A;  3E2E A;  4J9R A;  5KT2 A;  5J0Q A;  1A77 A;  4QZC A;  4YN4 A;  4RQ2 A;  4F93 B;  5KFC A;  5IIL A;  4QZ8 A;  4M6W B;  9ICP A;  4YR2 A;  4DSJ A;  4FBU A;  4IR9 A;  3OHA A;  5BOL A;  7ICM A;  2J6U A;  8ICK A;  1B22 A;  1S97 A;  5J2B A;  4FS1 A;  8ICL A;  1ZQF A;  5KFQ A;  2F1H A;  8ICW A;  4RQ7 A;  5KT3 A;  5KTQ A;  2DR8 A;  2DRA A;  3ZDA A;  2NRK A;  4PGX A;  4UAY A;  4YD1 A;  1ZQS A;  3LK9 A;  3MFI A;  3PR4 A;  1U47 A;  1L3T A;  3TAP A;  9ICB A;  2PBE A;  3RAQ A;  5IIK A;  3GV8 B;  2W8L A;  8ICA A;  4O3O A;  4C8N A;  8ICJ A;  2JEI A;  4DL4 A;  4DSI A;  4ED1 A;  1YLQ A;  4RNN A;  5J0R A;  3MR5 A;  3T5H A;  3TFS A;  1RXV A;  8ICP A;  2NRX A;  3MAB A;  4FO6 A;  4DO9 A;  2AQ0 A;  2NRV A;  1BPX A;  3AQK A;  4I2B A;  3ZD9 A;  4NKT A;  1Z3E B;  3V7K A;  2HVI A;  5J2G A;  3C5G A;  1TVA A;  4RQ8 A;  3T5K A;  1HUZ A;  7ICN A;  5DKW A;  2W9A A;  9ICR A;  5DB6 A;  1SKR A;  4KLL A;  4I2H A;  3RJF A;  4Q8F A;  4DS4 A;  9ICC A;  1Q78 A;  7ICQ A;  3AQN A;  3GV7 B;  4RPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...