3ISCA

Binary complex of human dna polymerase beta with an abasic site (thf) in the gapped dna
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase/dna
source organism Homo sapiens
publication title DNA polymerase beta substrate specificity: side chain modulation of the "A-rule".
pubmed doi rcsb
total genus 110
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3iscA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 3iscA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 3iscA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3iscA03
4X5VA 4NXZA 5J2IA 5DLGA 1TK8A 1L3TA 7ICPA 2ZH4A 4C8LA 2BKEA 2ZJ5A 5IIIA 4EBEA 1AROP 3V6JA 8ICBA 3V72A 4YR2A 4NM1A 4ED8A 4F8RA 1LV5A 3QZ7A 4F2SA 3IHQB 4PH5A 2M2UA 3LWMA 2ZH9A 2FPKA 2J6UA 2BCQA 4M9GA 1ZQQA 1R8CA 2ASDA 3C66A 2P6UA 1UA1A 2GWSA 1X9MA 2BE3A 3QEBZ 2KTQA 4E8FA 5KT2A 3RAQA 3EZ5A 4AT9B 3HW8A 4XUSA 3PX0A 5D4BA 4WC2A 4BXOB 1U9LA 5HMMA 7ICGA 4QZCA 3HJ4A 2ZH1A 5KG1A 4ECWA 4YG2A 2W9AA 4F4ZA 3JYYA 3C18A 1X9SA 3JPRA 4UB4A 4DQRA 4YN4A 8ICVA 9ICEA 4RU9A 4KLOA 3OVAA 4QW8A 3RR7A 3E2EA 4TUSA 4R63A 3EPIA 4HYKA 4MFCA 4QZBA 9ICAA 2BQRA 2ZH5A 3H39A 4KN7A 3UPQA 4J9SA 3OVBA 3C5FA 5J0TA 3RJEA 9ICMA 3MFIA 2BPFA 1KLNA 5KG6A 2HHQA 4YP3A 4O3QA 4I2GA 3T5JA 2BCUA 1DK3A 4EYIB 1U45A 4RWNA 3AU2A 4KLJA 5IIJA 4F5QA 1TAQA 4R8UA 4ZH4A 1SKSA 1ZQZA 4X4SA 1BGXT 1TFRA 4NLNA 5BOMA 5KG0A 4X4TA 4DOAA 3PO5A 4IR1A 4FH3A 4PGQA 1RPLA 5HP4A 4KLDA 1WCLA 3B0XA 8ICQA 3PW5A 2JEJA 2O5AA 1TKDA 2I1QA 5HHIA 3H4BA 4DF4A 1XWLA 3RJKA 4BDPA 4QWEA 4R66A 4YFKA 3GQCA 3H38A 5CJ7A 2VA3A 1OU5A 4FHXA 2IHNA 4DSIA 3OUYA 4ECZA 4WC6A 3RJGA 4RT3A 4WC5A 2V9WA 1U4BA 3KHLA 4DQIA 4I2HA 8ICFA 3V6HA 1UETA 1VFGA 4IQUA 3EYZA 8ICCA 4EEYA 3EWAA 4JV2A 3PMLA 5DBCA 3T3FA 3ZDAA 4KLUA 4F50A 5DGAA 1KTQA 2BPGA 1QLNA 2JEGA 2IA6A 2P66A 4DL5A 4E80A 5DEDA 5J0YA 3C5GA 1ZQCA 2ZUDA 4QW9A 5J0WA 1NOMA 1MSWD 4I29A 3ETLA 9ICIA 1V4AA 4DLEA 4I2IA 2JZBB 4KITB 5HHHA 4UAWA 1NJXA 4P2HA 2HHSA 9ICFA 4QZ9A 1NK0A 4M2YA 5KFUA 2UVWA 3KHHA 4QWDA 9ICLA 4IR9A 2H5XA 4RT2A 4QZFA 4YVZA 3AQMA 4RWQA 3PW4A 1UT5A 4MF8A 3TFRA 4RWPA 1TK5A 9ICBA 4F5PA 3V7LA 4M9JA 4X4NA 2UVVA 4ECTA 4FO6A 4DS4A 2C2EA 1A77A 3H40A 4IRKA 1RXVA 4FBTA 5F9NA 4J9KA 1UA0A 2DPIA 5J29A 1S0NA 4RUAA 7ICVA 2ZHAA 4X0BA 3AU6A 4X4VA 1IXRA 1H38A 1ZQTA 1ZQAA 1U49A 4C8KA 4QZIA 4M9NA 4LZDA 5KFMA 1VJ7A 2LYHA 1ZQJA 4ED6A 2HHUA 2NRVA 5J2DA 4J9MA 4DFKA 2R8JA 3BJYA 4FHYA 1JXEA 1HUZA 5KFQA 4RPZA 2ASJA 2KP7A 4AT8A 4ECQA 2F1JA 2W9CB 4F2RA 5J2JA 5KFRA 4J9RA 1ZQDA 4AT7B 2BCSA 4GLXA 3H4DA 1NJYA 2IHMA 4GXKA 1N56A 4QZGA 4KLLA 2AGPA 3WFQE 3WFRE 4MFFA 5F9LA 3RB4A 3C23A 5J2BA 3UXNA 2FMPA 4F4XA 2C28A 5DB7A 5D49A 1ZQIA 4I2CA 1UT8A 1YLQA 3WFPA 4IG8A 7ICNA 5IILA 5EWGA 1S0MA 1N48A 2BCRA 3MDAA 4G3IA 4FHVA 3MGHA 4ECRA 3JPSA 2ZH3A 1WCNA 4Q44A 1NK5A 2PI4A 4KLIA 3PR4A 4YMOA 4K4GA 4UAYA 4C8OA 4KLEA 4QZEA 3AQNA 5D46A 5KFCA 2PI5A 2B21A 1B22A 3ISCA 5DB9A 1CEZA 4RQ3A 4F93B 4DL2A 3SV3A 2F1IA 4ECSA 1ZQHA 4RNOA 3M8SA 4UB5A 4GXJA 2J6TA 4F5NA 5KG7A 4B9UA 4FH5A 4DFMA 4I2JA 1ZQNA 1T7PA 2KZ3A 4ED1A 5J2CA 8ICNA 7ICSA 1D9FA 5KFKA 5HRFA 2HHWA 3MABA 2BPCA 3QZ8A 3GIKA 2R8GA 1Q78A 3M9MB 1T8EA 5KTQA 5BPCA 3G6XA 5DECA 1KNYA 4AT7A 4M6WA 4IQVA 4F4YA 2KN7A 3TFSA 2AGQA 4KLMA 9ICWA 1KDHA 3GFKB 2PFPA 5DQIA 5L1JA 4TURA 2W9BA 1S10A 4JK1A 4YMNA 3MR5A 3QEAZ 2OWOA 2RDIA 2BHNA 5J0OA 4F92B 3PR5B 2JEFA 3T5HA 4EZ6A 8ICLA 1U48A 4WBZA 2ZJAA 4R8UB 3RH4A 1D8YA 4QWCA 1QSSA 4FS2A 3Q8MA 8ICSA 5J0PA 2C2RA 4M0AA 2XO7A 5HRKA 4FS1A 2ID1A 7ICJA 4JWNA 4YR0A 2ASLA 2BR0A 8ICGA 2DR9A 1S97A 4XA5A 3PW2A 1NK8A 4E0DA 2VANA 1JIHA 2IMWP 1MQ3A 3ZDEA 1L3UA 5KFZA 3RRHA 5HR9A 4ELTA 2HHPA 2BQ3A 3Q8QB 9ICPA 4QZDA 2A1JA 2MUTA 3OSNA 4QZHA 3JPPA 1BPZA 4F5OA 2PFOA 4TQRA 3PVXA 3HJ1A 4O5EA 4ECYA 1ZQWA 5J2HA 3V7KA 3TARA 1BNPA 1NK4A 1SL2A 8ICUA 1JMSA 2DR8A 3RRGA 5IIKA 3H7IA 5CR0A 4P4MA 1D9DA 8ICMA 5KFXA 1BVSA 1NO5A 5KFWA 5J2KA 4UAZA 5DG9A 1LB2B 1BPYA 2A1JB 2MUTB 7ICFA 8ICTA 9ICSA 1NKCA 5KG2A 1JXLA 8ICZA 7ICLA 4C8MA 1R8AA 3HIYA 3ISDA 3RJIA 4R64A 4DO9A 2DFLA 1U47A 4EBKA 3B0YA 1ZQGA 4KLQA 1Q79A 4MFAA 4JUZA 5CWRA 2R8HA 4QWAA 1R89A 5EWEA 2V4RA 3Q8KA 1S0OA 5KFBA 9ICVA 4BWMA 5J0SA 2BQUA 2ZH7A 4X0AA 4JV0A 5KFJA 5IINA 4E7XA 4RQ7A 3OGUA 3RH5A 3RB0A 3ZDCA 5J2EA 1XS9D 4I2AA 8ICJA 4WC0A 2ALZA 4O0IA 1ZQMA 4C8NA 3BQTA 2ZJ8A 4RQ5A 4X4PA 4KMUA 4RQ4A 4ED7A 1JN3A 1ZQEA 4O5KA 8ICWA 3OJSA 2FPLA 3PX6A 4X4OA 5KFHA 5HC9A 2ISPA 1S77D 2M2TA 3RBEA 5DDYA 1V9PA 1Z00A 1MC8A 1FA0A 1D8LA 4DQQA 4PHAA 4PHPA 4YXMA 3RBDA 3BQ1A 3SI8A 7ICTA 1ZYQA 4M6WB 5J2AA 4RQ2A 5DG8A 4RQ1A 2V4QA 2R8IA 4DL6A 1ZQSA 1KRPA 2VA2A 3ZDBA 8ICEA 3V7JA 4X4QA 2DRAA 7ICMA 2BCVA 4AT8B 1XC9A 5L9XA 3TAPA 4DSLA 4DL7A 3UQ0A 1SZPA 2FMQA 1SKRA 4DL4A 2UVRA 1ZQYA 5DG7A 8ICRA 8ICHA 9ICGA 4I27A 9ICHA 1T4GA 4IQTA 1KFSA 4QZ8A 4UBCA 5C5JA 5DB6A 2AGOA 2ZHBA 4KLGA 1XSNA 4KLFA 5IIOA 3MBYA 4X4RA 5J0UA 4S3NA 1R8BA 1UEUA 1XO1A 3GV5B 5EWFA 4I28A 4DSFA 3MR2A 8ICIA 3OSPA 4BGDA 1BPDA 3GIJA 3JPQA 2FLLA 1TFYA 2JEIA 1ZQRA 3V6KA 4K4HA 2XY6A 3OJUA 4J9PA 1ZQVA 4NLZA 5KFVA 1KSPA 3SYZA 1RYRA 4MF2A 2W9BB 3SZ2A 5J0QA 4DOBA 1SKWA 1QTMA 4BXOA 4BWJA 5KFEA 2C22A 1TK0A 5KFAA 3JPTA 5DKWA 3PO4A 3T5LA 2W8KA 3THVA 4DQSA 1RYSA 1HUOA 3AQLA 4DSEA 4ECXA 1Z00B 3UXOA 5KT5A 2IBKA 4MEYA 3OV7A 4LVSA 9ICXA 7ICHA 2NRXA 3M9NB 3MGIA 1TVAA 1QSYA 2PFNA 3Q8PB 1L3SA 5KFDA 3C21A 1DOQA 5DBAA 2R8KA 2ZTCA 3HP6A 5HNKA 1ZQKA 2C2DA 1SL1A 2AU0A 3FDSA 5KFFA 3PMNA 4NM2A 1MQ2A 2M9NA 1MIVA 5HMLA 2ZH6A 2WTFA 4M04A 4YXJA 3RJJA 3TANA 4J9NA 5KFIA 5IIMA 2Y1JA 3PNCA 3OUYB 4YQWA 1BPBA 4WC7A 1XSLA 4GXIA 3OHAA 1RXWA 1KFTA 2AQ0A 1PX5A 5CP2A 9ICTA 5HRHA 1B43A 4F4KA 3JPNA 1T3NA 2NRZA 1XSPA 3C1YA 3SV4A 7ICRA 2DRBA 4QWBA 2NRWA 3G6VA 2JZBA 1Z3EB 5DQGA 5DDMA 1NJZA 4JWMA 2XGPA 2Q0ZX 3HPOA 3ZDDA 5KFNA 2ISOA 4RWOA 3RAXA 4O3OA 4ECUA 3OHBA 5CA7A 4ED0A 4M9LA 5DQHA 4ED2A 3RJFA 1RZTA 2UVUA 4B9LA 4DFJA 4UD4A 4EP7A 4B9MA 3LQCB 4K4IA 5L1KA 4PHDA 3IM1A 3WFSC 4RUCA 3GV8B 2HHVA 5DLFA 1DK2A 4Q8FA 2Q66A 3L9DA 4ATBA 1L5UA 2KFNA 4DLGA 3Q8LA 4O9MA 3H8JA 1NK6A 2HVIA 2I9GA 4B9SA 3H8WA 4Z6FA 1S76D 2MAXA 1ZETA 3GV7B 2DR5A 4NKUA 4P4OA 4CCHA 4PGYA 4ELUA 4R65A 1Y88A 2XY7A 5DB8A 1NJWA 5KT6A 3HWTA 3AUOA 1ZQOA 4O3SA 1IM4A 1X9WA 4M9HA 7ICOA 5DGBA 3GILA 5CB1A 3AQKA 3GIMA 8ICPA 5L1LA 4I2FA 4J9LA 1NKBA 3BDPA 4NY8A 1BPEA 1SL0A 2J6SA 1JX4A 3UPSA 1QSLA 2AQ4A 3PY8A 2M2WA 1UEVA 4F4WA 4Q8EA 2ZTDA 2M2VA 4QZAA 3RR8A 9ICKA 1K1SA 9ICQA 4ECVA 4IRCA 5KG4A 4XQ8A 3K75D 3EW9A 4TUQA 1JQRA 3RB6A 1ZQPA 2RDJA 4Q43A 1PZNA 2ZTEA 4Z6DA 3T5KA 4MEXA 5KFGA 4WCWA 4EBDA 5CHGA 3RJHA 2ZH2A 5KFSA 4JV1A 3JZ0A 3C1ZA 7ICIA 4O3RA 3FYHA 4IQWA 4LZGA 4ED3A 3K4GA 4GC7A 1KEJA 5L1IA 4Z6EA 9ICUA 5HRLA 5DBBA 1ZJMA 1ZQUA 3PV8A 3RH6A 4DWIA 3BQ0A 2KZZA 2FLNA 2BGWA 4RPYA 1K1QA 3JPOA 2KZMA 4ELVA 5EOZA 4DSKA 5KFLA 2XY5A 4XRHA 4B9NA 4KLSA 1COOA 1ZJNA 2FLPA 3LWLA 2VA8A 4DQPA 2HW3A 2HHTA 4FHWA 1BPXA 4XQ7A 4J9QA 3Q8RB 3ORYA 3TAQA 2BDPA 4F3OA 2AJQA 1HJPA 1ZQFA 1BNOA 4Q45A 4WBYA 3RTVA 1A76A 4RPXA 3KTQA 2ZUBA 2W9MA 1S9FA 3H8SA 2W8LA 1L3VA 3UXPA 2KFZA 7ICQA 2O1PA 4AT9A 2DPJA 4I2EA 1WOTA 4WC3A 7ICUA 4RQ0A 1NZPA 3GIIA 4B9VA 2ZH8A 4KLHA 4FBUA 5KFOA 3BQ2A 4RQ8A 4EZ9A 3ISBA 4DFPA 3PW0A 3NYBA 8ICKA 4UD5A 2DR7A 2FMSA 2PBEA 4RNMA 4KN4A 2XGQA 4X4UA 1CUKA 4UB2A 3WFOA 4WC4A 5KFPA 4EYHB 5TZVA 4UB1A 1MIYA 3RB3A 4M47A 7ICEA 5BOLA 3TQ1A 3TI0A 5JUMA 8ICAA 4PHEA 4RQ6A 4KTQA 1EXNA 1ZQXA 5KG3A 4UQGA 4PPXA 3H3AA 4IRDA 3QE9Y 5KFYA 2DVIA 8ICYA 4O3PA 2RFFA 1ZQLA 5KT4A 2PXIA 3N4MB 5KT7A 4YD2A 3LDAA 2P6RA 4NLGA 9ICNA 5HRGA 5J0XA 3EPGA 3NGDA 1ZQBA 4YD1A 2HHXA 4GC6A 9ICRA 3G6YA 4O5CA 4DOCA 4DEZA 5J2FA 3GDXA 9ICCA 2NRKA 3H37A 5F2VO 5HRBA 4PGXA 2FPMA 3KHGA 2F1HA 3M8RA 4NKTA 4DF8A 1TV9A 1TAUA 3C2LA 4ATBB 4I2BA 3MR6A 2Y1IA 1NKEA 5J2GA 4P4PA 3ZD8A 2XCPA 7ICKA 4WC1A 4RZRA 2HVHA 4F5RA 4YR3A 1KFDA 4DS5A 3LK9A 3MFHA 3HT3A 1NK9A 3NTUA 5KFTA 4J9OA 3MDCA 5HREA 3PW7A 2XC9A 1F5AA 4B9TA 1MIWA 3KHRA 4DSJA 4KLTA 3Q8SB 4RNNA 3ZD9A 5HRDA 3PX4A 3HX0A 2ATLA 9ICJA 2ZUCA 4YCXA 5HRIA 1TFWA 3N97B 2NRTA 4EBCA 1NK7A 1C7YA 1JAJA 4M5DA 4FHPA 1XU4A 4NLKA 4I2DA 5KT3A 2PFQA 8ICOA 3OVSA 1X2IA 1DGSA 5J0RA 2XCAA 2W9CA 4TQSA 8ICXA 5KG5A 1S0VA 4LT6A 4UB3A 4Z6CA 3M9OB 3MR3A 9ICOA 4O3NA 4UBBA 4DL3A 3C2MA 3C2KA 3UQ2A 4TUPA 4EBJA 4YMMA 4F91B
chains in the Genus database with same CATH superfamily
4NXZA 1TK8A 1B4FA 2ZH4A 5IIIA 4YR2A 4NM1A 1LV5A 3IHQB 2O6KA 1SXEA 3LWMA 3C28A 2J6UA 2BCQA 4M9GA 1R8CA 2ASDA 3C66A 2BE3A 1UA1A 5KT2A 3EZ5A 4AT9B 2G06A 4WC2A 3I28A 5HMMA 3HJ4A 2ZH1A 3M6ZA 4UB4A 4UW9A 4KLOA 3RR7A 3E2EA 2E8OA 4R63A 3EPIA 4HYKA 4CNQA 3QUBA 9ICAA 5CFSA 4KN7A 3RJEA 3E0FA 5J0TA 2BPFA 5KG6A 4O3QA 2BCUA 2RP5A 2LM4A 3AU2A 4F5QA 4R8UA 4ZH4A 4NLNA 4P0QA 2B51A 1RPLA 2R18A 2E8MA 2DUYA 4KLDA 8ICQA 3PW5A 3NVZA 1WWUA 2I1QA 5HHIA 4R66A 1SV0C 3OUYA 1U4BA 1KN5A 8ICFA 1VFGA 4US8A 4IQUA 4JLZA 3EWAA 4JV2A 5DBCA 4F50A 3HJEA 2IA6A 5ALUA 4DL5A 5J0YA 1YT3A 2NYVA 1S5LU 2ZIXB 4I2IA 4KITB 2KSOB 4HX0A 1NK0A 2WF7A 4NV0A 1WWVA 5KFUA 4YVZA 4HAIA 4RWQA 1UT5A 4MF8A 3TFRA 9ICBA 4F5PA 4X4NA 2UVVA 4ECTA 3H40A 1RXVA 2JXJA 4FBTA 1UA0A 2F77X 4ICAA 1S0NA 1PVPA 4X0BA 1ZQAA 1U49A 4QZIA 2LYHA 2DKXA 1ZQJA 2HHUA 4J9MA 1JXEA 3S6JA 4RPZA 2QARA 2LKYA 2G5HB 1ZQ1C 4AT7B 3WKAA 1QQ5A 4GLXA 3H4DA 4GXKA 2LPEA 2AGPA 4MFFA 5F9LA 5J2BA 4QJFB 2GH1A 3WFPA 1YLQA 3I76A 5IILA 2BCRA 3MDAA 2QB0A 4UB6U 1WCNA 4Q44A 1NK5A 4YMOA 4K4GA 4C8OA 4KLEA 1PK3A 5D46A 5KFCA 2B21A 4RQ3A 5KG7A 4B9UA 4EELA 2F44A 5KFKA 3MABA 4USAA 3QZ8A 4LJXA 1Q78A 2KK0A 2EAPA 5KTQA 5BPCA 3G6XA 1KNYA 4Y2VA 2Y0SC 2AGQA 5L1JA 1S10A 4JK1A 3N7RC 3QEAZ 2OH2A 5J0OA 2WF6A 1LKYA 2CRXA 2JEFA 8ICLA 4EX7A 1QQ7A 4Y2PA 3ERCC 8ICSA 2DKZA 5AHXA 2XO7A 7ICJA 2DL0A 1RDFA 2IMWP 2HBMA 1MQ3A 4AYBC 3RRHA 4ELTA 4IL6U 3Q8QB 9ICPA 2IHOA 1Z4NA 3OSNA 4QZHA 4F5OA 2YQEA 4TQRA 2EQYA 1J97A 2XI9A 4ECYA 5ALGA 1BNPA 5JRTA 3V7KA 3RRGA 8ICMA 4P4MA 5ALJA 1JI7A 3QYPA 5KFXA 1BVSA 1NO5A 7ICFA 3CNHA 5J2KA 7ICLA 5KG2A 8ICZA 4C8MA 3ISDA 2Y9UA 2DFLA 2G09A 4KX3A 1Q79A 2HOIA 4JUZA 5CWRA 2R8HA 1R89A 1S0OA 2WAQC 5KFBA 2BQUA 5KFJA 3OGUA 3RB0A 3ZDCA 5J2EA 2E8NA 3KD3A 4DCCA 4RQ5A 3ALRA 3HILA 4KMUA 4RQ4A 4X4OA 3OJSA 5DDYA 1FA0A 1D8LA 2EANA 4PHPA 4DL6A 5G5GA 5KAFU 1ZQSA 3CRXA 3ZDBA 4X4QA 4JMUA 2BCVA 1SWWA 3TAPA 4DSLA 4DL7A 1SZPA 2UVRA 1SKRA 4I27A 1KFSA 4UBCA 5DB6A 5B3QA 3U26A 3MCRA 4KLFA 2W04A 3MBYA 1NZBA 4KX5A 3GV5B 2KD1A 2QKQA 1BPDA 3GIJA 3JPQA 1HIWA 3V6KA 2XY6A 3OJUA 2JH1A 5KFVA 1KSPA 4MF2A 1SKWA 3PSTA 5J0QA 3SZ2A 4BXOA 4DQSA 4RQMA 4ECXA 2KKPA 4C0ZA 4LVSA 2ES6A 7ICHA 1TVAA 2WF5A 3WKDA 5AM4A 5HNKA 2AU0A 1GO3F 4NM2A 2M9NA 4J9NA 3KZIU 4CRXA 4YQWA 2AQ0A 1PX5A 3JPNA 1T3NA 3SQIA 2LBOA 4LEVA 2NRWA 4FZMA 1Z3EB 4JWMA 2XGPA 4C4RA 2AXTU 4RWOA 3RAXA 4O3OA 3F2DA 2K8AA 4B6JA 5CA7A 4ED0A 5DQHA 2UVUA 1QQ6A 4B9MA 2VJ4A 4K4IA 4PHDA 2W3SA 3IM1A 3KFUF 4ATBA 1L5UA 3J81j 2E8PA 5FP0A 2I9GA 1X66A 2QB0B 3QU4A 2DR5A 4BJQA 4CCHA 1Y88A 2JH7A 1NJWA 3HWTA 3AUOA 1X9WA 1KL9A 3GILA 3AQKA 3GIMA 3MC1A 2KIWA 2J6SA 1XO0A 2B0CA 4QZAA 2M2VA 4MHVA 1K1SA 4ECVA 4XQ8A 3K75D 2LM1A 3BZCA 3KKAC 2RDJA 2YMPA 4P0PA 2ZTEA 4F72A 3SD7A 1M6YA 4JV1A 7ICIA 1Q8KA 1ZD3A 4GC7A 5L1IA 1KEJA 1MIVA 5DBBA 4ELVA 2WB1F 5KFLA 2EDUA 3AN1A 4XRHA 1ZJNA 2HHTA 3LWLA 1BPXA 3NRZA 3QU7A 2BDPA 2K4EA 4RPXA 2W9MA 3H8SA 2Z7JA 3FAHA 3QNMA 2O1PA 1X6IA 1D8BA 1NZPA 4B9VA 5AKHA 5AKZA 4DFPA 2G5IB 3NYBA 4UD5A 4K98A 1L8LA 2FMSA 3IDWA 3BZKA 3WFOA 2K8BB 1WG8A 1N2XA 1MIYA 4WQKA 2HMXA 4M47A 3WU2U 4RQ6A 3E58A 1EXNA 2DGZA 4IRDA 3QE9Y 1SB3C 2KNJA 2DVIA 4OAGA 9ICNA 1RM6C 4YD2A 5HRGA 4UATA 3NGDA 1ZQBA 4DOCA 2NO5A 4DEZA 2NRKA 5F2VO 2XIDA 2KHQA 2KEYA 4P4PA 7ICKA 3ONNA 4YR3A 1KFDA 3HT3A 3NTUA 4J9OA 5HREA 2ZIWA 2BZFA 1JALA 4DSJA 3MGVA 1CI4A 3BS5A 4RNNA 3ZD9A 1IV8A 1OW5A 3HX0A 9ICJA 2G0AA 2ZUCA 4I2DA 5KT3A 1OUQA 1QCKA 5KL8B 8ICXA 3ER9B 3SEIA 4UB3A 4KM5A 1SV0A 4QIWF 3M9OB 3PSPA 4WJ3B 3C2KA 1NK8A 4QNLA 4P0PB 3C29A 2E1EA 4EBEA 1AROP 8ICBA 4F8RA 4XJEA 4F2SA 2M2UA 2FPKA 3B9JA 3QU5A 2GWSA 1Z1BA 3QEBZ 3ZI4A 2KTQA 1J2NA 4E8FA 3RAQA 3NUQA 4XUSA 7ICGA 4ECWA 5CRXA 1SV4A 1X9SA 4I0UA 1SIJA 2KJ5A 4QZBA 2BQRA 4Y2JA 2ZXIA 4DFDA 3C5FA 9ICMA 4YP3A 2W55A 1U45A 5ALWA 1FFVA 2CXYA 2MRLA 4N7RA 1TFRA 2YN4A 5KG0A 4X4TA 2HDOA 4IR1A 4PGQA 2IOFK 5HP4A 2JEJA 4EENA 2HSZA 1XWLA 3RF9A 2I6XA 4DSIA 4WC6A 4RT3A 1RQLA 4NXVA 3NVYA 1QLNA 3TADC 3NS1A 3C5GA 1TAMA 5J0WA 4DLEA 2Q4TA 4EX6A 4UAWA 3TKAA 5AM0A 9ICLA 2WF9A 3AQMA 3PW4A 1TK5A 2PMZF 3V7LA 2C2EA 1VLBA 1A77A 1Z19A 2JR5A 4J9KA 4WOYA 4OJPA 7ICVA 2ZHAA 1IXRA 3AL0B 4C8KA 2OCEA 5F3XB 4ED6A 5J2DA 5AICA 3BJYA 2KP7A 2K89A 4CF5A 4AT8A 2F1JA 1V38A 5H2FU 1NJYA 3UXNA 3WK5A 4F4XA 1UT8A 2KE7A 7ICNA 5EWGA 1S0MA 2OYYA 4ECRA 2JRZA 2ZH3A 4KLIA 3PR4A 4GIBA 5AKGA 1MA7A 2PI5A 4J03A 5DB9A 4NXTA 5ALHA 4F93B 4DL2A 1ZQHA 4ECSA 4UB5A 3KOOA 8ICNA 5HRFA 1QH9A 2EZYA 3M9MB 1T8EA 5DECA 4AT7A 4F4YA 3TFSA 9ICWA 1ZD2P 2F3NA 3GFKB 2W9BA 2ZIVB 2OWOA 4WBZA 4O68A 4R8UB 1D8YA 1QSSA 4FS2A 1FEZA 4M0AA 5HRKA 4JWNA 4YR0A 8ICGA 4K96A 4E0DA 4Y2UA 2YY6A 5KFZA 2BQ3A 2WAQF 3JCFA 5AIAA 2A1AA 2PFOA 3PVXA 1RQNA 1UHUA 1FIQA 4O5EA 4PZOA 1ZQWA 3L5KA 2NO4A 8ICUA 1JMSA 3NASA 2DR8A 2KOBA 5KFWA 1LB2B 4UAZA 3AQFA 8ICTA 9ICSA 1JXLA 3RJIA 4C7YA 5EWEA 2V4RA 3Q8KA 5J0SA 4X0AA 4JV0A 8ICJA 3SENA 4O0IA 4C8NA 2RLTA 2WHEA 1JN3A 3PX6A 2ISPA 2M2TA 1MC8A 7ICTA 4M6WB 4RQ1A 2R8IA 1V85A 1KRPA 4C8LA 1UQVA 4EGWA 3H39A 1Q46A 2H3ZA 2N1RA 2F8LA 3RFAA 4F71A 8ICHA 4IQTA 4QZ8A 5TISU 2AGOA 2LYBA 4KLGA 2BBHA 1JRPA 5J0UA 1R8BA 2W11A 2NV3A 4J9PA 2KIVA 3WK6A 3H0MB 3SYZA 1F5AA 4BWJA 3PO4A 5KFAA 3JPTA 1VDVA 4NLCA 4O67A 2ZG6A 4Y2QA 3AQLA 5ALVA 2JHDA 4CF3A 1SZHA 1DOQA 5DBAA 3HP6A 1ZQKA 2RHFA 3FDSA 5AK5A 4OJ5A 2G08A 2ZH6A 2YMLA 5KFIA 3BS7A 1XSLA 1ZD5A 1KFTA 4EEDA 5HRHA 1B43A 2NRZA 3C1YA 3SV4A 1S8OA 2G07A 5DDMA 1NJZA 2Q0ZX 3ZDDA 3QU2A 4ECUA 4K9AA 1ED1A 4M9LA 4ED2A 2HBJA 3OPXA 4EP7A 5EE9A 4O3MA 3D2QA 5DLFA 2Q66A 4JLXA 2MSNA 4DLGA 3Q8LA 3H8JA 1NK6A 2HVIA 2DF4B 4Z6FA 1S76D 2MAXA 3H0RB 1ZETA 5AKXA 4P4OA 1L8OA 4PGYA 4ELUA 1N63A 5DB8A 1ZQOA 7ICOA 5DGBA 5CB1A 5AI9A 5GTHU 4Y2RA 4I2FA 1NKBA 4NY8A 1BPEA 4NLBA 2E5SA 2W43A 4F4WA 4Q8EA 3CK6A 9ICKA 9ICQA 2KVCA 4IRCA 3LYSA 3RB6A 2ZIWB 3L4PA 4Z6DA 3T5KA 4EBDA 2ZH2A 2H3QA 3JZ0A 3PSFA 4O3RA 1X9XA 5JU5A 9ICUA 1ZJMA 5ALOA 3PV8A 2KZZA 4OJ6A 2K4HA 2KZMA 4NL9C 4OJLA 3AMZA 5EOZA 2XY5A 4KLSA 4K99A 4DQPA 4XQ7A 4J9QA 3ORYA 5AK4A 2AJQA 1HJPA 1ZQFA 1A76A 2LMRA 2ZUBA 2W8LA 3UXPA 4CE6A 2DPJA 3TADA 1WOTA 4RQ0A 4FBUA 4EZ9A 4UB8U 2PBEA 4RNMA 4KN4A 5ALIA 5KFPA 2ODGA 3TI0A 5JUMA 4KTQA 1P7DA 5KG3A 1PK1A 4UQGA 3H3AA 5AKYA 1L6NA 1ZQLA 4NLGA 4O69A 3LDAA 1O03A 5J0XA 5B66U 2HHXA 3QUTA 5HRBA 2FPMA 1Q3UA 2F1HA 4DF8A 4I2BA 3MR6A 1NKEA 4WC1A 2JV3A 1Z1VA 4F5RA 5AI8A 1NK9A 2XC9A 3K1ZA 3QUCA 5HRDA 3AM9A 1TFWA 4EBCA 4M5DA 5CFTA 2PFQA 3OVSA 2M0NA 1DGSA 5J0RA 2XCAA 1URJA 5ALYA 4TQSA 3F53A 4MKPA 5KG5A 3MR3A 4UBBA 4DL3A 2P66A 2YMMA 4YMMA 1RZTA 8ICIA 1ZOLA 5J2IA 1FO4A 1L3TA 3V72A 4O6AA 4ED8A 3QZ7A 1LKYB 3PSIA 3R9KA 4PH5A 3FC4A 4LEZA 4K97A 2MA1A 2PMZC 3PX0A 5KL1B 3K1RB 4BXOB 3CYMA 3PZPA 4QZCA 5KG1A 4YG2A 3JYYA 3C18A 3JPRA 4DQRA 4YN4A 8ICVA 5ALKA 9ICEA 4RU9A 4QW8A 5G5HA 4TUSA 1YZ7A 1N61A 2ZH5A 3UPQA 4NWIA 2K4PA 4C4SA 3MFIA 1KLNA 2HHQA 1DK3A 3T5JA 1AQ6A 4RWNA 3DV9A 3GZFA 1ZQZA 2A3VA 4X4SA 4A8EA 2AHOB 4DOAA 4FH3A 1L7PA 1B0XA 3UMCA 2KHVA 2YTUA 4IC9A 3B0XA 1TKDA 3N28A 2LHTA 2KMDA 3H4BA 1HEKA 4BDPA 4BX9C 3RJKA 2GAFD 5CJ7A 2VA3A 3GU3A 4FHXA 2IHNA 4ECZA 2D8CA 2YB4A 2OEHA 3RJGA 3KHLA 2ESEA 4WQLA 1VJ5A 2H3FA 3V6HA 4I2HA 1UETA 5ALFA 8ICCA 5AI4A 4EEYA 4KLUA 2BPGA 2JEGA 2OHFA 5ALQA 2BDUA 9ICIA 1V4AA 5HHHA 2JZBB 2HHSA 4P2HA 4BUGA 4M2YA 2H5XA 4RT2A 2W03A 4QZFA 4RWPA 2HN1A 3HKZF 4UARA 4M9JA 4AP9A 4FO6A 4DS4A 3UMBA 4IRKA 2IOFA 5F9NA 2DPIA 5J29A 2KV2A 4LZDA 5KFMA 1VJ7A 3M1YA 2NRVA 4JB3A 2B56A 3FM9A 5KFQA 2ASJA 3AEVA 1SXDA 4F2RA 1L7NA 4J9RA 1ZQDA 2IHMA 1N56A 4KLLA 4QZGA 3WFQE 2DWQA 3RB4A 1DXSA 2C28A 2W7PA 5D49A 3M6KA 2PI4A 5AK3A 5AKEA 4UAVA 4QZEA 2AH5A 1B22A 3F2CA 3QU9A 2F1IA 2J6TA 4F5NA 4I2JA 1T7PA 1SGGA 2KZ3A 4ED1A 5D62A 5J2CA 1D9FA 3DEEA 4IQVA 2KN7A 1KDHA 2PFPA 4TURA 2E1FA 4NXUA 2RDIA 2BHNA 5CEHA 3WKCA 2ZJAA 4Y2YA 4PL1A 5J0PA 4FS1A 2ID1A 2BR0A 4XA5A 2K8CB 2VANA 1JIHA 3OTQA 1L3UA 5HR9A 2HHPA 4OAHA 2MUTA 1BPZA 3JPPA 3HJ1A 2KJ9A 4FZNA 5AK6A 3TARA 1SL2A 2LI6A 5ALTA 4KB6A 5CR0A 2ZXHA 2H3VA 2MUTB 1NKCA 1V97A 3HIYA 3L3FX 4R64A 1U47A 1ZQGA 4KLQA 4NL9A 4MFAA 1ZXIA 4OAFA 2ZH7A 9ICVA 4BWMA 4PL2A 3ICXA 3KZXA 4FFDA 2FE9A 1XS9D 4I2AA 2HI0A 2ALZA 1ZQMA 2LYAA 1F5SA 4ED7A 8ICWA 4O5KA 2FPLA 5KFHA 1S77D 5AI5A 3RBEA 1Z00A 4PHAA 2CPRA 5ALPA 1ZYQA 2V4QA 4RQ2A 5DG8A 5ALRA 2DRAA 4AT8B 1XC9A 2HOQA 5L9XA 2FDRA 2OM6A 4X4PA 4DL4A 1ZQYA 2L5YA 2FI1A 2YB1A 2KICA 3I1YA 2ZHBA 4WH5A 2WFAA 4I28A 3MR2A 5E79U 3OSPA 4BGDA 2FLLA 4IS7A 2JEIA 1ZQRA 3SAGA 1ZQVA 1RYRA 4DOBA 1QTMA 1A0PA 5DKWA 3T5LA 1RYSA 4DSEA 5KT5A 3UXOA 2IBKA 3DDHA 3EF2A 5EE3A 2RRDA 3M9NB 3MGIA 1QSYA 2PFNA 1L3SA 5KFDA 3C21A 2R8KA 2C2DA 3BS5B 1SL1A 5KFFA 3PMNA 1MQ2A 2EAOA 3QXGA 5HMLA 4M04A 4YXJA 3TANA 2EWRA 2Y1JA 2B4VA 3WKEA 4WC7A 3OHAA 4US9A 1OXJA 5CP2A 4F4KA 7ICRA 1XSPA 3G6VA 7ICPA 3M7DA 5KFNA 1F44A 4C4TA 2RQ5A 2DQNB 2HCFA 2VJ5A 4B9LA 3ER8C 4DFJA 3F5EA 3KBBA 3LQCB 3OWGA 5L1KA 3WFSC 4Q8FA 3L9DA 1SWVA 3N7SC 2YX8A 1JROA 3KKAA 1L7OA 4B9SA 3H8WA 1T3QA 4R65A 3NVVA 2XY7A 3F5AA 1IM4A 4M9HA 4J9LA 1N5XA 3BDPA 2GA9D 3PY8A 2M2WA 2ZTDA 3RR8A 1T94A 5KG4A 4OJOA 3BQ7A 4K9BA 1JQRA 1WYGA 4Q43A 1PZNA 4MEXA 3WK8A 5CHGA 3RJHA 3ETRA 3NVOA 3FYHA 2D6FC 2YMQA 3K4GA 3SR6A 4DWIA 2GLEA 2FLNA 2BGWA 2IUBA 4RPYA 1K1QA 3JPOA 2HN2A 4DSKA 4LEWA 4B9NA 2HW3A 2VA8A 4F3OA 3IP4B 4P0QB 1S9FA 4AT9A 1FFUA 4AYBF 3GIIA 2ZH8A 4C7ZA 3ISBA 5ALZA 2DR7A 5AI0A 2XGQA 4X4UA 1CUKA 4UB2A 4WC4A 4EYHB 5AKLA 5TZVA 5A0LA 4UB1A 3RB3A 5AM3A 3TQ1A 8ICAA 1ZQXA 5KFYA 4O3PA 5KT4A 2PXIA 3N4MB 5KT7A 1LVHA 2P6RA 3OVAA 1RYUA 4U6PA 3EPGA 4YD1A 9ICRA 3G6YA 4O5CA 3GDXA 3H37A 3KHGA 3HRDD 4ATBB 2Y1IA 5AKIA 5J2GA 3ZD8A 4RZRA 4EEBA 2KVSA 3LK9A 3PW7A 3H0LB 4Y2TA 3Q8SB 4OO1J 4FZLA 2ATLA 3F2BA 5HRIA 3N97B 2NRTA 1N60A 1C7YA 4FHPA 1XU4A 3H8MA 3T79A 1X2IA 5EE1A 2D3DA 1WUDA 1S0VA 4O3NA 4EBKA 4F91B 4X5VA 5JTIA 5DLGA 2BKEA 2ZJ5A 5L1MA 3V6JA 5ALSA 2ZH9A 2HBLA 1PVQA 2JMGA 3IV6A 1ZQQA 1UPHA 2P6UA 1X9MA 4CGZA 3HW8A 3VCBA 5D4BA 1U9LA 2ZIXA 2W9AA 4F4ZA 3A0HU 5D61A 2EZXA 5EE0A 2MU2A 4MFCA 2I5HA 5ALEA 2F2AB 2Y0SF 4J9SA 3OVBA 4IG8A 4QIWC 4I2GA 3WKBA 4EYIB 4KLJA 1ECWA 5IIJA 1TAQA 2JGAA 4U7CA 2KJ8A 1SKSA 3NWIA 1BGXT 5BOMA 1X42A 4Y2XA 4RQNA 3PO5A 3QX7A 4CF4A 1MN8A 1WCLA 2WB1C 2O5AA 1KQQA 4DF4A 3H38A 4QWEA 4YFKA 3GQCA 1OU5A 1KBUA 2E3TA 4WC5A 2V9WA 4DQIA 1PUZA 2IOHA 3EYZA 3PMLA 3T3FA 3ZDAA 5DGAA 1KTQA 5AIBA 4E80A 5DEDA 1ZQCA 2ZUDA 4QW9A 1NOMA 5AI6A 1MSWD 3ETLA 9ICFA 1NJXA 3UMGA 4QZ9A 2UVWA 3KHHA 4QWDA 1J2MA 4IR9A 2GO7A 2ZIUB 2F8KA 2W3RA 4RUAA 4X4VA 3AU6A 1H38A 1ZQTA 4M9NA 4FHYA 4DFKA 2R8JA 2XICA 3LVVA 5B3PA 5HR7A 1HUZA 1JUDA 3WK4A 4ECQA 2W9CB 4K8VA 5J2JA 4CDGA 3NVWA 5KFRA 1IIPA 2BCSA 4EV6A 3WFRE 2K4IA 4GFJA 3C23A 3SAFA 4OD0A 1KW4A 2FMPA 5DB7A 1ZQIA 4I2CA 3ED5A 5KAIU 3NRWA 1N48A 2WF8A 4G3IA 5ALXA 3MGHA 4FHVA 3JPSA 1ZRMA 4UAYA 3UM9A 3AQNA 4NJ8A 1GPJA 3ISCA 4UAUA 1CEZA 3SV3A 4RNOA 3M8SA 4GXJA 1Z4OA 5ALNA 3NKUA 4FH5A 2HOFA 1YZ6A 4DFMA 1ZQNA 7ICSA 1NNLA 1DRGA 2EZZA 2HHWA 3TACB 2BPCA 3WK9A 3GIKA 2R8GA 4M6WA 4KLMA 1UCVA 5DQIA 4YMNA 3MR5A 4EZ6A 4F92B 3PR5B 3T5HA 1U48A 3RH4A 4QWCA 3Q8MA 2C2RA 2A19A 2ASLA 1S97A 3PW2A 1DGJA 3ZDEA 2FCLA 1NI3A 5D63A 5J8YC 4QZDA 2A1JA 2VKQA 4NXXA 2K60A 5J2HA 4ZOHC 1NK4A 4G9BA 5IIKA 3H7IA 1D9DA 5AM1A 3AQEA 1BPYA 5DG9A 2A1JB 3IRUA 3IG5A 1R8AA 4DO9A 3B0YA 3N7PD 2QB1A 4QWAA 3IG8A 4NXWA 5IINA 4E7XA 4RQ7A 3RH5A 3PHZA 1ZRNA 4WC0A 3BQTA 4OCZA 2ZJ8A 4EEKA 2ZIUA 1ZQEA 5HC9A 5T14A 1V9PA 1CRXA 4FE3A 3SMVA 4DQQA 4YXMA 3RBDA 3SI8A 3BQ1A 2GOLA 4I29A 5J2AA 8ICEA 2VA2A 3D2SA 3V7JA 7ICMA 3UQ0A 2FMQA 9ICGA 5DG7A 8ICRA 9ICHA 5ALLA 1T4GA 3LVWA 3K7DA 5C5JA 1N62A 1XSNA 5IIOA 2H3IA 4S3NA 4X4RA 1UEUA 1XO1A 5EWFA 4DSFA 2BBJA 1TFYA 3HKZC 4K4HA 1A6SA 4NLZA 2ZIVA 2W9BB 4C80A 5KFEA 1TK0A 2C22A 2HBKA 2W8KA 3THVA 1HUOA 4Y2SA 1Z00B 1PVRA 4MEYA 3OV7A 2OXOA 9ICXA 2NRXA 1TE2A 3Q8PB 2ZTCA 2VIXA 2CN1A 2WTFA 3RJJA 5HR6A 1C20A 5IIMA 3OUYB 3PNCA 3QUQA 5AKJA 1BPBA 5AKKA 2EH9A 5JTGA 4GXIA 1RXWA 9ICTA 2DRBA 4QWBA 2DR9A 2JZBA 5DQGA 5ALDA 3HPOA 2ISOA 3D6JA 2Y9TA 5B5EU 2QLTA 3WK7A 5C0YA 2KG5A 2KKVA 3OHBA 3RJFA 4UD4A 2P35A 1IG6A 4RUCA 3GV8B 2HHVA 1DK2A 1KKXA 2EAMA 3O0FA 2KFNA 1X40A 4O9MA 1Q3VA 4NKUA 3GV7B 5ALMA 3CW2C 5KT6A 4O3SA 4PJ0U 8ICPA 5L1LA 2F76X 1SL0A 3UPSA 1JX4A 3CP8A 2AQ4A 1QSLA 1UEVA 1K5OA 5KNIA 3EW9A 4TUQA 1ZQPA 5KFGA 4WCWA 1L7MA 5KFSA 3C1ZA 5AM5A 4IQWA 4LZGA 4ED3A 4KMOB 4Z6EA 4PZNA 5HRLA 1X6JA 1ZQUA 2XVTA 3RH6A 3BQ0A 1N5WA 1COOA 5GTIU 2FLPA 4FHWA 3Q8RB 3EUB2 3TAQA 1BNOA 4Q45A 4WBYA 3RTVA 3KTQA 2KFZA 7ICQA 1L3VA 3D2NA 3VC8A 4I2EA 4WC3A 7ICUA 1F0MA 4UASA 5AM2A 4KLHA 2QARB 5KFOA 3BQ2A 4RQ8A 3A0BU 3PW0A 8ICKA 2DBYA 3SAHA 1ZD4A 5CFUA 7ICEA 5BOLA 4PHEA 4PPXA 2PKEA 8ICYA 2RFFA 1O08A 4GC6A 2KSOA 5J2FA 9ICCA 4PGXA 3IN5A 4NKTA 3M8RA 1TV9A 1TAUA 3C2LA 2XCPA 2W7OA 2HVHA 4DS5A 3MFHA 5KFTA 4ACOA 5J8YA 3MDCA 4B9TA 1MIWA 3KHRA 4KLTA 1COKA 2B6GA 3PX4A 4YCXA 1NK7A 1JAJA 1RG6A 2FJ6A 4NLKA 1PK1B 8ICOA 5CHEA 1XNSA 2W9CA 4LEYA 2W54A 4LT6A 4Z6CA 4FO1A 5K4LA 9ICOA 4OAIZ 3C2MA 3UQ2A 4TUPA 4EBJA
chains in the Genus database with same CATH topology
4X5VA 4NXZA 5J2IA 5DLGA 1TK8A 1L3TA 7ICPA 2ZH4A 4C8LA 2BKEA 2ZJ5A 5IIIA 4EBEA 1AROP 3V6JA 8ICBA 3V72A 4YR2A 4NM1A 4ED8A 4F8RA 1LV5A 3QZ7A 4F2SA 3IHQB 4PH5A 2M2UA 3LWMA 2ZH9A 2FPKA 2J6UA 2BCQA 4M9GA 1ZQQA 1R8CA 2ASDA 3C66A 2P6UA 1UA1A 2GWSA 1X9MA 2BE3A 3QEBZ 2KTQA 4E8FA 5KT2A 3RAQA 3EZ5A 4AT9B 3HW8A 4XUSA 3PX0A 5D4BA 4WC2A 4BXOB 1U9LA 5HMMA 7ICGA 4QZCA 3HJ4A 2ZH1A 5KG1A 4ECWA 4YG2A 2W9AA 4F4ZA 3JYYA 3C18A 1X9SA 3JPRA 4UB4A 4DQRA 4YN4A 8ICVA 9ICEA 4RU9A 4KLOA 3OVAA 4QW8A 3RR7A 3E2EA 4TUSA 4R63A 3EPIA 4HYKA 4MFCA 4QZBA 9ICAA 2BQRA 2ZH5A 3H39A 4KN7A 3UPQA 4J9SA 3OVBA 3C5FA 5J0TA 3RJEA 9ICMA 3MFIA 2BPFA 1KLNA 5KG6A 2HHQA 4YP3A 4O3QA 4I2GA 3T5JA 2BCUA 1DK3A 4EYIB 1U45A 4RWNA 3AU2A 4KLJA 5IIJA 4F5QA 1TAQA 4R8UA 4ZH4A 1SKSA 1ZQZA 4X4SA 1BGXT 1TFRA 4NLNA 5BOMA 5KG0A 4X4TA 4DOAA 3PO5A 4IR1A 4FH3A 4PGQA 1RPLA 5HP4A 4KLDA 1WCLA 3B0XA 8ICQA 3PW5A 2JEJA 2O5AA 1TKDA 2I1QA 5HHIA 3H4BA 4DF4A 1XWLA 3RJKA 4BDPA 4QWEA 4R66A 4YFKA 3GQCA 3H38A 5CJ7A 2VA3A 1OU5A 4FHXA 2IHNA 4DSIA 3OUYA 4ECZA 4WC6A 3RJGA 4RT3A 4WC5A 2V9WA 1U4BA 3KHLA 4DQIA 4I2HA 8ICFA 3V6HA 1UETA 1VFGA 4IQUA 3EYZA 8ICCA 4EEYA 3EWAA 4JV2A 3PMLA 5DBCA 3T3FA 3ZDAA 4KLUA 4F50A 5DGAA 1KTQA 2BPGA 1QLNA 2JEGA 2IA6A 2P66A 4DL5A 4E80A 5DEDA 5J0YA 3C5GA 1ZQCA 2ZUDA 4QW9A 5J0WA 1NOMA 1MSWD 4I29A 3ETLA 9ICIA 1V4AA 4DLEA 4I2IA 2JZBB 4KITB 5HHHA 4UAWA 1NJXA 4P2HA 2HHSA 9ICFA 4QZ9A 1NK0A 4M2YA 5KFUA 2UVWA 3KHHA 4QWDA 9ICLA 4IR9A 2H5XA 4RT2A 4QZFA 4YVZA 3AQMA 4RWQA 3PW4A 1UT5A 4MF8A 3TFRA 4RWPA 1TK5A 9ICBA 4F5PA 3V7LA 4M9JA 4X4NA 2UVVA 4ECTA 4FO6A 4DS4A 2C2EA 1A77A 3H40A 4IRKA 1RXVA 4FBTA 5F9NA 4J9KA 1UA0A 2DPIA 5J29A 1S0NA 4RUAA 7ICVA 2ZHAA 4X0BA 3AU6A 4X4VA 1IXRA 1H38A 1ZQTA 1ZQAA 1U49A 4C8KA 4QZIA 4M9NA 4LZDA 5KFMA 1VJ7A 2LYHA 1ZQJA 4ED6A 2HHUA 2NRVA 5J2DA 4J9MA 4DFKA 2R8JA 3BJYA 4FHYA 1JXEA 1HUZA 5KFQA 4RPZA 2ASJA 2KP7A 4AT8A 4ECQA 2F1JA 2W9CB 4F2RA 5J2JA 5KFRA 4J9RA 1ZQDA 4AT7B 2BCSA 4GLXA 3H4DA 1NJYA 2IHMA 4GXKA 1N56A 4QZGA 4KLLA 2AGPA 3WFQE 3WFRE 4MFFA 5F9LA 3RB4A 3C23A 5J2BA 3UXNA 2FMPA 4F4XA 2C28A 5DB7A 5D49A 1ZQIA 4I2CA 1UT8A 1YLQA 3WFPA 4IG8A 7ICNA 5IILA 5EWGA 1S0MA 1N48A 2BCRA 3MDAA 4G3IA 4FHVA 3MGHA 4ECRA 3JPSA 2ZH3A 1WCNA 4Q44A 1NK5A 2PI4A 4KLIA 3PR4A 4YMOA 4K4GA 4UAYA 4C8OA 4KLEA 4QZEA 3AQNA 5D46A 5KFCA 2PI5A 2B21A 1B22A 3ISCA 5DB9A 1CEZA 4RQ3A 4F93B 4DL2A 3SV3A 2F1IA 4ECSA 1ZQHA 4RNOA 3M8SA 4UB5A 4GXJA 2J6TA 4F5NA 5KG7A 4B9UA 4FH5A 4DFMA 4I2JA 1ZQNA 1T7PA 2KZ3A 4ED1A 5J2CA 8ICNA 7ICSA 1D9FA 5KFKA 5HRFA 2HHWA 3MABA 2BPCA 3QZ8A 3GIKA 2R8GA 1Q78A 3M9MB 1T8EA 5KTQA 5BPCA 3G6XA 5DECA 1KNYA 4AT7A 4M6WA 4IQVA 4F4YA 2KN7A 3TFSA 2AGQA 4KLMA 9ICWA 1KDHA 3GFKB 2PFPA 5DQIA 5L1JA 4TURA 2W9BA 1S10A 4JK1A 4YMNA 3MR5A 3QEAZ 2OWOA 2RDIA 2BHNA 5J0OA 4F92B 3PR5B 2JEFA 3T5HA 4EZ6A 8ICLA 1U48A 4WBZA 2ZJAA 4R8UB 3RH4A 1D8YA 4QWCA 1QSSA 4FS2A 3Q8MA 8ICSA 5J0PA 2C2RA 4M0AA 2XO7A 5HRKA 4FS1A 2ID1A 7ICJA 4JWNA 4YR0A 2ASLA 2BR0A 8ICGA 2DR9A 1S97A 4XA5A 3PW2A 1NK8A 4E0DA 2VANA 1JIHA 2IMWP 1MQ3A 3ZDEA 1L3UA 5KFZA 3RRHA 5HR9A 4ELTA 2HHPA 2BQ3A 3Q8QB 9ICPA 4QZDA 2A1JA 2MUTA 3OSNA 4QZHA 3JPPA 1BPZA 4F5OA 2PFOA 4TQRA 3PVXA 3HJ1A 4O5EA 4ECYA 1ZQWA 5J2HA 3V7KA 3TARA 1BNPA 1NK4A 1SL2A 8ICUA 1JMSA 2DR8A 3RRGA 5IIKA 3H7IA 5CR0A 4P4MA 1D9DA 8ICMA 5KFXA 1BVSA 1NO5A 5KFWA 5J2KA 4UAZA 5DG9A 1LB2B 1BPYA 2A1JB 2MUTB 7ICFA 8ICTA 9ICSA 1NKCA 5KG2A 1JXLA 8ICZA 7ICLA 4C8MA 1R8AA 3HIYA 3ISDA 3RJIA 4R64A 4DO9A 2DFLA 1U47A 4EBKA 3B0YA 1ZQGA 4KLQA 1Q79A 4MFAA 4JUZA 5CWRA 2R8HA 4QWAA 1R89A 5EWEA 2V4RA 3Q8KA 1S0OA 5KFBA 9ICVA 4BWMA 5J0SA 2BQUA 2ZH7A 4X0AA 4JV0A 5KFJA 5IINA 4E7XA 4RQ7A 3OGUA 3RH5A 3RB0A 3ZDCA 5J2EA 1XS9D 4I2AA 8ICJA 4WC0A 2ALZA 4O0IA 1ZQMA 4C8NA 3BQTA 2ZJ8A 4RQ5A 4X4PA 4KMUA 4RQ4A 4ED7A 1JN3A 1ZQEA 4O5KA 8ICWA 3OJSA 2FPLA 3PX6A 4X4OA 5KFHA 5HC9A 2ISPA 1S77D 2M2TA 3RBEA 5DDYA 1V9PA 1Z00A 1MC8A 1FA0A 1D8LA 4DQQA 4PHAA 4PHPA 4YXMA 3RBDA 3BQ1A 3SI8A 7ICTA 1ZYQA 4M6WB 5J2AA 4RQ2A 5DG8A 4RQ1A 2V4QA 2R8IA 4DL6A 1ZQSA 1KRPA 2VA2A 3ZDBA 8ICEA 3V7JA 4X4QA 2DRAA 7ICMA 2BCVA 4AT8B 1XC9A 5L9XA 3TAPA 4DSLA 4DL7A 3UQ0A 1SZPA 2FMQA 1SKRA 4DL4A 2UVRA 1ZQYA 5DG7A 8ICRA 8ICHA 9ICGA 4I27A 9ICHA 1T4GA 4IQTA 1KFSA 4QZ8A 4UBCA 5C5JA 5DB6A 2AGOA 2ZHBA 4KLGA 1XSNA 4KLFA 5IIOA 3MBYA 4X4RA 5J0UA 4S3NA 1R8BA 1UEUA 1XO1A 3GV5B 5EWFA 4I28A 4DSFA 3MR2A 8ICIA 3OSPA 4BGDA 1BPDA 3GIJA 3JPQA 2FLLA 1TFYA 2JEIA 1ZQRA 3V6KA 4K4HA 2XY6A 3OJUA 4J9PA 1ZQVA 4NLZA 5KFVA 1KSPA 3SYZA 1RYRA 4MF2A 2W9BB 3SZ2A 5J0QA 4DOBA 1SKWA 1QTMA 4BXOA 4BWJA 5KFEA 2C22A 1TK0A 5KFAA 3JPTA 5DKWA 3PO4A 3T5LA 2W8KA 3THVA 4DQSA 1RYSA 1HUOA 3AQLA 4DSEA 4ECXA 1Z00B 3UXOA 5KT5A 2IBKA 4MEYA 3OV7A 4LVSA 9ICXA 7ICHA 2NRXA 3M9NB 3MGIA 1TVAA 1QSYA 2PFNA 3Q8PB 1L3SA 5KFDA 3C21A 1DOQA 5DBAA 2R8KA 2ZTCA 3HP6A 5HNKA 1ZQKA 2C2DA 1SL1A 2AU0A 3FDSA 5KFFA 3PMNA 4NM2A 1MQ2A 2M9NA 1MIVA 5HMLA 2ZH6A 2WTFA 4M04A 4YXJA 3RJJA 3TANA 4J9NA 5KFIA 5IIMA 2Y1JA 3PNCA 3OUYB 4YQWA 1BPBA 4WC7A 1XSLA 4GXIA 3OHAA 1RXWA 1KFTA 2AQ0A 1PX5A 5CP2A 9ICTA 5HRHA 1B43A 4F4KA 3JPNA 1T3NA 2NRZA 1XSPA 3C1YA 3SV4A 7ICRA 2DRBA 4QWBA 2NRWA 3G6VA 2JZBA 1Z3EB 5DQGA 5DDMA 1NJZA 4JWMA 2XGPA 2Q0ZX 3HPOA 3ZDDA 5KFNA 2ISOA 4RWOA 3RAXA 4O3OA 4ECUA 3OHBA 5CA7A 4ED0A 4M9LA 5DQHA 4ED2A 3RJFA 1RZTA 2UVUA 4B9LA 4DFJA 4UD4A 4EP7A 4B9MA 3LQCB 4K4IA 5L1KA 4PHDA 3IM1A 3WFSC 4RUCA 3GV8B 2HHVA 5DLFA 1DK2A 4Q8FA 2Q66A 3L9DA 4ATBA 1L5UA 2KFNA 4DLGA 3Q8LA 4O9MA 3H8JA 1NK6A 2HVIA 2I9GA 4B9SA 3H8WA 4Z6FA 1S76D 2MAXA 1ZETA 3GV7B 2DR5A 4NKUA 4P4OA 4CCHA 4PGYA 4ELUA 4R65A 1Y88A 2XY7A 5DB8A 1NJWA 5KT6A 3HWTA 3AUOA 1ZQOA 4O3SA 1IM4A 1X9WA 4M9HA 7ICOA 5DGBA 3GILA 5CB1A 3AQKA 3GIMA 8ICPA 5L1LA 4I2FA 4J9LA 1NKBA 3BDPA 4NY8A 1BPEA 1SL0A 2J6SA 1JX4A 3UPSA 1QSLA 2AQ4A 3PY8A 2M2WA 1UEVA 4F4WA 4Q8EA 2ZTDA 2M2VA 4QZAA 3RR8A 9ICKA 1K1SA 9ICQA 4ECVA 4IRCA 5KG4A 4XQ8A 3K75D 3EW9A 4TUQA 1JQRA 3RB6A 1ZQPA 2RDJA 4Q43A 1PZNA 2ZTEA 4Z6DA 3T5KA 4MEXA 5KFGA 4WCWA 4EBDA 5CHGA 3RJHA 2ZH2A 5KFSA 4JV1A 3JZ0A 3C1ZA 7ICIA 4O3RA 3FYHA 4IQWA 4LZGA 4ED3A 3K4GA 4GC7A 1KEJA 5L1IA 4Z6EA 9ICUA 5HRLA 5DBBA 1ZJMA 1ZQUA 3PV8A 3RH6A 4DWIA 3BQ0A 2KZZA 2FLNA 2BGWA 4RPYA 1K1QA 3JPOA 2KZMA 4ELVA 5EOZA 4DSKA 5KFLA 2XY5A 4XRHA 4B9NA 4KLSA 1COOA 1ZJNA 2FLPA 3LWLA 2VA8A 4DQPA 2HW3A 2HHTA 4FHWA 1BPXA 4XQ7A 4J9QA 3Q8RB 3ORYA 3TAQA 2BDPA 4F3OA 2AJQA 1HJPA 1ZQFA 1BNOA 4Q45A 4WBYA 3RTVA 1A76A 4RPXA 3KTQA 2ZUBA 2W9MA 1S9FA 3H8SA 2W8LA 1L3VA 3UXPA 2KFZA 7ICQA 2O1PA 4AT9A 2DPJA 4I2EA 1WOTA 4WC3A 7ICUA 4RQ0A 1NZPA 3GIIA 4B9VA 2ZH8A 4KLHA 4FBUA 5KFOA 3BQ2A 4RQ8A 4EZ9A 3ISBA 4DFPA 3PW0A 3NYBA 8ICKA 4UD5A 2DR7A 2FMSA 2PBEA 4RNMA 4KN4A 2XGQA 4X4UA 1CUKA 4UB2A 3WFOA 4WC4A 5KFPA 4EYHB 5TZVA 4UB1A 1MIYA 3RB3A 4M47A 7ICEA 5BOLA 3TQ1A 3TI0A 5JUMA 8ICAA 4PHEA 4RQ6A 4KTQA 1EXNA 1ZQXA 5KG3A 4UQGA 4PPXA 3H3AA 4IRDA 3QE9Y 5KFYA 2DVIA 8ICYA 4O3PA 2RFFA 1ZQLA 5KT4A 2PXIA 3N4MB 5KT7A 4YD2A 3LDAA 2P6RA 4NLGA 9ICNA 5HRGA 5J0XA 3EPGA 3NGDA 1ZQBA 4YD1A 2HHXA 4GC6A 9ICRA 3G6YA 4O5CA 4DOCA 4DEZA 5J2FA 3GDXA 9ICCA 2NRKA 3H37A 5F2VO 5HRBA 4PGXA 2FPMA 3KHGA 2F1HA 3M8RA 4NKTA 4DF8A 1TV9A 1TAUA 3C2LA 4ATBB 4I2BA 3MR6A 2Y1IA 1NKEA 5J2GA 4P4PA 3ZD8A 2XCPA 7ICKA 4WC1A 4RZRA 2HVHA 4F5RA 4YR3A 1KFDA 4DS5A 3LK9A 3MFHA 3HT3A 1NK9A 3NTUA 5KFTA 4J9OA 3MDCA 5HREA 3PW7A 2XC9A 1F5AA 4B9TA 1MIWA 3KHRA 4DSJA 4KLTA 3Q8SB 4RNNA 3ZD9A 5HRDA 3PX4A 3HX0A 2ATLA 9ICJA 2ZUCA 4YCXA 5HRIA 1TFWA 3N97B 2NRTA 4EBCA 1NK7A 1C7YA 1JAJA 4M5DA 4FHPA 1XU4A 4NLKA 4I2DA 5KT3A 2PFQA 8ICOA 3OVSA 1X2IA 1DGSA 5J0RA 2XCAA 2W9CA 4TQSA 8ICXA 5KG5A 1S0VA 4LT6A 4UB3A 4Z6CA 3M9OB 3MR3A 9ICOA 4O3NA 4UBBA 4DL3A 3C2MA 3C2KA 3UQ2A 4TUPA 4EBJA 4YMMA 4F91B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5V A;  4NXZ A;  5J2I A;  5DLG A;  1TK8 A;  1L3T A;  7ICP A;  2ZH4 A;  4C8L A;  2BKE A;  2ZJ5 A;  5III A;  4EBE A;  1ARO P;  3V6J A;  8ICB A;  3V72 A;  4YR2 A;  4NM1 A;  4ED8 A;  4F8R A;  1LV5 A;  3QZ7 A;  4F2S A;  3IHQ B;  4PH5 A;  2M2U A;  3LWM A;  2ZH9 A;  2FPK A;  2J6U A;  2BCQ A;  4M9G A;  1ZQQ A;  1R8C A;  2ASD A;  3C66 A;  2P6U A;  1UA1 A;  2GWS A;  1X9M A;  2BE3 A;  3QEB Z;  2KTQ A;  4E8F A;  5KT2 A;  3RAQ A;  3EZ5 A;  4AT9 B;  3HW8 A;  4XUS A;  3PX0 A;  5D4B A;  4WC2 A;  4BXO B;  1U9L A;  5HMM A;  7ICG A;  4QZC A;  3HJ4 A;  2ZH1 A;  5KG1 A;  4ECW A;  4YG2 A;  2W9A A;  4F4Z A;  3JYY A;  3C18 A;  1X9S A;  3JPR A;  4UB4 A;  4DQR A;  4YN4 A;  8ICV A;  9ICE A;  4RU9 A;  4KLO A;  3OVA A;  4QW8 A;  3RR7 A;  3E2E A;  4TUS A;  4R63 A;  3EPI A;  4HYK A;  4MFC A;  4QZB A;  9ICA A;  2BQR A;  2ZH5 A;  3H39 A;  4KN7 A;  3UPQ A;  4J9S A;  3OVB A;  3C5F A;  5J0T A;  3RJE A;  9ICM A;  3MFI A;  2BPF A;  1KLN A;  5KG6 A;  2HHQ A;  4YP3 A;  4O3Q A;  4I2G A;  3T5J A;  2BCU A;  1DK3 A;  4EYI B;  1U45 A;  4RWN A;  3AU2 A;  4KLJ A;  5IIJ A;  4F5Q A;  1TAQ A;  4R8U A;  4ZH4 A;  1SKS A;  1ZQZ A;  4X4S A;  1BGX T;  1TFR A;  4NLN A;  5BOM A;  5KG0 A;  4X4T A;  4DOA A;  3PO5 A;  4IR1 A;  4FH3 A;  4PGQ A;  1RPL A;  5HP4 A;  4KLD A;  1WCL A;  3B0X A;  8ICQ A;  3PW5 A;  2JEJ A;  2O5A A;  1TKD A;  2I1Q A;  5HHI A;  3H4B A;  4DF4 A;  1XWL A;  3RJK A;  4BDP A;  4QWE A;  4R66 A;  4YFK A;  3GQC A;  3H38 A;  5CJ7 A;  2VA3 A;  1OU5 A;  4FHX A;  2IHN A;  4DSI A;  3OUY A;  4ECZ A;  4WC6 A;  3RJG A;  4RT3 A;  4WC5 A;  2V9W A;  1U4B A;  3KHL A;  4DQI A;  4I2H A;  8ICF A;  3V6H A;  1UET A;  1VFG A;  4IQU A;  3EYZ A;  8ICC A;  4EEY A;  3EWA A;  4JV2 A;  3PML A;  5DBC A;  3T3F A;  3ZDA A;  4KLU A;  4F50 A;  5DGA A;  1KTQ A;  2BPG A;  1QLN A;  2JEG A;  2IA6 A;  2P66 A;  4DL5 A;  4E80 A;  5DED A;  5J0Y A;  3C5G A;  1ZQC A;  2ZUD A;  4QW9 A;  5J0W A;  1NOM A;  1MSW D;  4I29 A;  3ETL A;  9ICI A;  1V4A A;  4DLE A;  4I2I A;  2JZB B;  4KIT B;  5HHH A;  4UAW A;  1NJX A;  4P2H A;  2HHS A;  9ICF A;  4QZ9 A;  1NK0 A;  4M2Y A;  5KFU A;  2UVW A;  3KHH A;  4QWD A;  9ICL A;  4IR9 A;  2H5X A;  4RT2 A;  4QZF A;  4YVZ A;  3AQM A;  4RWQ A;  3PW4 A;  1UT5 A;  4MF8 A;  3TFR A;  4RWP A;  1TK5 A;  9ICB A;  4F5P A;  3V7L A;  4M9J A;  4X4N A;  2UVV A;  4ECT A;  4FO6 A;  4DS4 A;  2C2E A;  1A77 A;  3H40 A;  4IRK A;  1RXV A;  4FBT A;  5F9N A;  4J9K A;  1UA0 A;  2DPI A;  5J29 A;  1S0N A;  4RUA A;  7ICV A;  2ZHA A;  4X0B A;  3AU6 A;  4X4V A;  1IXR A;  1H38 A;  1ZQT A;  1ZQA A;  1U49 A;  4C8K A;  4QZI A;  4M9N A;  4LZD A;  5KFM A;  1VJ7 A;  2LYH A;  1ZQJ A;  4ED6 A;  2HHU A;  2NRV A;  5J2D A;  4J9M A;  4DFK A;  2R8J A;  3BJY A;  4FHY A;  1JXE A;  1HUZ A;  5KFQ A;  4RPZ A;  2ASJ A;  2KP7 A;  4AT8 A;  4ECQ A;  2F1J A;  2W9C B;  4F2R A;  5J2J A;  5KFR A;  4J9R A;  1ZQD A;  4AT7 B;  2BCS A;  4GLX A;  3H4D A;  1NJY A;  2IHM A;  4GXK A;  1N56 A;  4QZG A;  4KLL A;  2AGP A;  3WFQ E;  3WFR E;  4MFF A;  5F9L A;  3RB4 A;  3C23 A;  5J2B A;  3UXN A;  2FMP A;  4F4X A;  2C28 A;  5DB7 A;  5D49 A;  1ZQI A;  4I2C A;  1UT8 A;  1YLQ A;  3WFP A;  4IG8 A;  7ICN A;  5IIL A;  5EWG A;  1S0M A;  1N48 A;  2BCR A;  3MDA A;  4G3I A;  4FHV A;  3MGH A;  4ECR A;  3JPS A;  2ZH3 A;  1WCN A;  4Q44 A;  1NK5 A;  2PI4 A;  4KLI A;  3PR4 A;  4YMO A;  4K4G A;  4UAY A;  4C8O A;  4KLE A;  4QZE A;  3AQN A;  5D46 A;  5KFC A;  2PI5 A;  2B21 A;  1B22 A;  3ISC A;  5DB9 A;  1CEZ A;  4RQ3 A;  4F93 B;  4DL2 A;  3SV3 A;  2F1I A;  4ECS A;  1ZQH A;  4RNO A;  3M8S A;  4UB5 A;  4GXJ A;  2J6T A;  4F5N A;  5KG7 A;  4B9U A;  4FH5 A;  4DFM A;  4I2J A;  1ZQN A;  1T7P A;  2KZ3 A;  4ED1 A;  5J2C A;  8ICN A;  7ICS A;  1D9F A;  5KFK A;  5HRF A;  2HHW A;  3MAB A;  2BPC A;  3QZ8 A;  3GIK A;  2R8G A;  1Q78 A;  3M9M B;  1T8E A;  5KTQ A;  5BPC A;  3G6X A;  5DEC A;  1KNY A;  4AT7 A;  4M6W A;  4IQV A;  4F4Y A;  2KN7 A;  3TFS A;  2AGQ A;  4KLM A;  9ICW A;  1KDH A;  3GFK B;  2PFP A;  5DQI A;  5L1J A;  4TUR A;  2W9B A;  1S10 A;  4JK1 A;  4YMN A;  3MR5 A;  3QEA Z;  2OWO A;  2RDI A;  2BHN A;  5J0O A;  4F92 B;  3PR5 B;  2JEF A;  3T5H A;  4EZ6 A;  8ICL A;  1U48 A;  4WBZ A;  2ZJA A;  4R8U B;  3RH4 A;  1D8Y A;  4QWC A;  1QSS A;  4FS2 A;  3Q8M A;  8ICS A;  5J0P A;  2C2R A;  4M0A A;  2XO7 A;  5HRK A;  4FS1 A;  2ID1 A;  7ICJ A;  4JWN A;  4YR0 A;  2ASL A;  2BR0 A;  8ICG A;  2DR9 A;  1S97 A;  4XA5 A;  3PW2 A;  1NK8 A;  4E0D A;  2VAN A;  1JIH A;  2IMW P;  1MQ3 A;  3ZDE A;  1L3U A;  5KFZ A;  3RRH A;  5HR9 A;  4ELT A;  2HHP A;  2BQ3 A;  3Q8Q B;  9ICP A;  4QZD A;  2A1J A;  2MUT A;  3OSN A;  4QZH A;  3JPP A;  1BPZ A;  4F5O A;  2PFO A;  4TQR A;  3PVX A;  3HJ1 A;  4O5E A;  4ECY A;  1ZQW A;  5J2H A;  3V7K A;  3TAR A;  1BNP A;  1NK4 A;  1SL2 A;  8ICU A;  1JMS A;  2DR8 A;  3RRG A;  5IIK A;  3H7I A;  5CR0 A;  4P4M A;  1D9D A;  8ICM A;  5KFX A;  1BVS A;  1NO5 A;  5KFW A;  5J2K A;  4UAZ A;  5DG9 A;  1LB2 B;  1BPY A;  2A1J B;  2MUT B;  7ICF A;  8ICT A;  9ICS A;  1NKC A;  5KG2 A;  1JXL A;  8ICZ A;  7ICL A;  4C8M A;  1R8A A;  3HIY A;  3ISD A;  3RJI A;  4R64 A;  4DO9 A;  2DFL A;  1U47 A;  4EBK A;  3B0Y A;  1ZQG A;  4KLQ A;  1Q79 A;  4MFA A;  4JUZ A;  5CWR A;  2R8H A;  4QWA A;  1R89 A;  5EWE A;  2V4R A;  3Q8K A;  1S0O A;  5KFB A;  9ICV A;  4BWM A;  5J0S A;  2BQU A;  2ZH7 A;  4X0A A;  4JV0 A;  5KFJ A;  5IIN A;  4E7X A;  4RQ7 A;  3OGU A;  3RH5 A;  3RB0 A;  3ZDC A;  5J2E A;  1XS9 D;  4I2A A;  8ICJ A;  4WC0 A;  2ALZ A;  4O0I A;  1ZQM A;  4C8N A;  3BQT A;  2ZJ8 A;  4RQ5 A;  4X4P A;  4KMU A;  4RQ4 A;  4ED7 A;  1JN3 A;  1ZQE A;  4O5K A;  8ICW A;  3OJS A;  2FPL A;  3PX6 A;  4X4O A;  5KFH A;  5HC9 A;  2ISP A;  1S77 D;  2M2T A;  3RBE A;  5DDY A;  1V9P A;  1Z00 A;  1MC8 A;  1FA0 A;  1D8L A;  4DQQ A;  4PHA A;  4PHP A;  4YXM A;  3RBD A;  3BQ1 A;  3SI8 A;  7ICT A;  1ZYQ A;  4M6W B;  5J2A A;  4RQ2 A;  5DG8 A;  4RQ1 A;  2V4Q A;  2R8I A;  4DL6 A;  1ZQS A;  1KRP A;  2VA2 A;  3ZDB A;  8ICE A;  3V7J A;  4X4Q A;  2DRA A;  7ICM A;  2BCV A;  4AT8 B;  1XC9 A;  5L9X A;  3TAP A;  4DSL A;  4DL7 A;  3UQ0 A;  1SZP A;  2FMQ A;  1SKR A;  4DL4 A;  2UVR A;  1ZQY A;  5DG7 A;  8ICR A;  8ICH A;  9ICG A;  4I27 A;  9ICH A;  1T4G A;  4IQT A;  1KFS A;  4QZ8 A;  4UBC A;  5C5J A;  5DB6 A;  2AGO A;  2ZHB A;  4KLG A;  1XSN A;  4KLF A;  5IIO A;  3MBY A;  4X4R A;  5J0U A;  4S3N A;  1R8B A;  1UEU A;  1XO1 A;  3GV5 B;  5EWF A;  4I28 A;  4DSF A;  3MR2 A;  8ICI A;  3OSP A;  4BGD A;  1BPD A;  3GIJ A;  3JPQ A;  2FLL A;  1TFY A;  2JEI A;  1ZQR A;  3V6K A;  4K4H A;  2XY6 A;  3OJU A;  4J9P A;  1ZQV A;  4NLZ A;  5KFV A;  1KSP A;  3SYZ A;  1RYR A;  4MF2 A;  2W9B B;  3SZ2 A;  5J0Q A;  4DOB A;  1SKW A;  1QTM A;  4BXO A;  4BWJ A;  5KFE A;  2C22 A;  1TK0 A;  5KFA A;  3JPT A;  5DKW A;  3PO4 A;  3T5L A;  2W8K A;  3THV A;  4DQS A;  1RYS A;  1HUO A;  3AQL A;  4DSE A;  4ECX A;  1Z00 B;  3UXO A;  5KT5 A;  2IBK A;  4MEY A;  3OV7 A;  4LVS A;  9ICX A;  7ICH A;  2NRX A;  3M9N B;  3MGI A;  1TVA A;  1QSY A;  2PFN A;  3Q8P B;  1L3S A;  5KFD A;  3C21 A;  1DOQ A;  5DBA A;  2R8K A;  2ZTC A;  3HP6 A;  5HNK A;  1ZQK A;  2C2D A;  1SL1 A;  2AU0 A;  3FDS A;  5KFF A;  3PMN A;  4NM2 A;  1MQ2 A;  2M9N A;  1MIV A;  5HML A;  2ZH6 A;  2WTF A;  4M04 A;  4YXJ A;  3RJJ A;  3TAN A;  4J9N A;  5KFI A;  5IIM A;  2Y1J A;  3PNC A;  3OUY B;  4YQW A;  1BPB A;  4WC7 A;  1XSL A;  4GXI A;  3OHA A;  1RXW A;  1KFT A;  2AQ0 A;  1PX5 A;  5CP2 A;  9ICT A;  5HRH A;  1B43 A;  4F4K A;  3JPN A;  1T3N A;  2NRZ A;  1XSP A;  3C1Y A;  3SV4 A;  7ICR A;  2DRB A;  4QWB A;  2NRW A;  3G6V A;  2JZB A;  1Z3E B;  5DQG A;  5DDM A;  1NJZ A;  4JWM A;  2XGP A;  2Q0Z X;  3HPO A;  3ZDD A;  5KFN A;  2ISO A;  4RWO A;  3RAX A;  4O3O A;  4ECU A;  3OHB A;  5CA7 A;  4ED0 A;  4M9L A;  5DQH A;  4ED2 A;  3RJF A;  1RZT A;  2UVU A;  4B9L A;  4DFJ A;  4UD4 A;  4EP7 A;  4B9M A;  3LQC B;  4K4I A;  5L1K A;  4PHD A;  3IM1 A;  3WFS C;  4RUC A;  3GV8 B;  2HHV A;  5DLF A;  1DK2 A;  4Q8F A;  2Q66 A;  3L9D A;  4ATB A;  1L5U A;  2KFN A;  4DLG A;  3Q8L A;  4O9M A;  3H8J A;  1NK6 A;  2HVI A;  2I9G A;  4B9S A;  3H8W A;  4Z6F A;  1S76 D;  2MAX A;  1ZET A;  3GV7 B;  2DR5 A;  4NKU A;  4P4O A;  4CCH A;  4PGY A;  4ELU A;  4R65 A;  1Y88 A;  2XY7 A;  5DB8 A;  1NJW A;  5KT6 A;  3HWT A;  3AUO A;  1ZQO A;  4O3S A;  1IM4 A;  1X9W A;  4M9H A;  7ICO A;  5DGB A;  3GIL A;  5CB1 A;  3AQK A;  3GIM A;  8ICP A;  5L1L A;  4I2F A;  4J9L A;  1NKB A;  3BDP A;  4NY8 A;  1BPE A;  1SL0 A;  2J6S A;  1JX4 A;  3UPS A;  1QSL A;  2AQ4 A;  3PY8 A;  2M2W A;  1UEV A;  4F4W A;  4Q8E A;  2ZTD A;  2M2V A;  4QZA A;  3RR8 A;  9ICK A;  1K1S A;  9ICQ A;  4ECV A;  4IRC A;  5KG4 A;  4XQ8 A;  3K75 D;  3EW9 A;  4TUQ A;  1JQR A;  3RB6 A;  1ZQP A;  2RDJ A;  4Q43 A;  1PZN A;  2ZTE A;  4Z6D A;  3T5K A;  4MEX A;  5KFG A;  4WCW A;  4EBD A;  5CHG A;  3RJH A;  2ZH2 A;  5KFS A;  4JV1 A;  3JZ0 A;  3C1Z A;  7ICI A;  4O3R A;  3FYH A;  4IQW A;  4LZG A;  4ED3 A;  3K4G A;  4GC7 A;  1KEJ A;  5L1I A;  4Z6E A;  9ICU A;  5HRL A;  5DBB A;  1ZJM A;  1ZQU A;  3PV8 A;  3RH6 A;  4DWI A;  3BQ0 A;  2KZZ A;  2FLN A;  2BGW A;  4RPY A;  1K1Q A;  3JPO A;  2KZM A;  4ELV A;  5EOZ A;  4DSK A;  5KFL A;  2XY5 A;  4XRH A;  4B9N A;  4KLS A;  1COO A;  1ZJN A;  2FLP A;  3LWL A;  2VA8 A;  4DQP A;  2HW3 A;  2HHT A;  4FHW A;  1BPX A;  4XQ7 A;  4J9Q A;  3Q8R B;  3ORY A;  3TAQ A;  2BDP A;  4F3O A;  2AJQ A;  1HJP A;  1ZQF A;  1BNO A;  4Q45 A;  4WBY A;  3RTV A;  1A76 A;  4RPX A;  3KTQ A;  2ZUB A;  2W9M A;  1S9F A;  3H8S A;  2W8L A;  1L3V A;  3UXP A;  2KFZ A;  7ICQ A;  2O1P A;  4AT9 A;  2DPJ A;  4I2E A;  1WOT A;  4WC3 A;  7ICU A;  4RQ0 A;  1NZP A;  3GII A;  4B9V A;  2ZH8 A;  4KLH A;  4FBU A;  5KFO A;  3BQ2 A;  4RQ8 A;  4EZ9 A;  3ISB A;  4DFP A;  3PW0 A;  3NYB A;  8ICK A;  4UD5 A;  2DR7 A;  2FMS A;  2PBE A;  4RNM A;  4KN4 A;  2XGQ A;  4X4U A;  1CUK A;  4UB2 A;  3WFO A;  4WC4 A;  5KFP A;  4EYH B;  5TZV A;  4UB1 A;  1MIY A;  3RB3 A;  4M47 A;  7ICE A;  5BOL A;  3TQ1 A;  3TI0 A;  5JUM A;  8ICA A;  4PHE A;  4RQ6 A;  4KTQ A;  1EXN A;  1ZQX A;  5KG3 A;  4UQG A;  4PPX A;  3H3A A;  4IRD A;  3QE9 Y;  5KFY A;  2DVI A;  8ICY A;  4O3P A;  2RFF A;  1ZQL A;  5KT4 A;  2PXI A;  3N4M B;  5KT7 A;  4YD2 A;  3LDA A;  2P6R A;  4NLG A;  9ICN A;  5HRG A;  5J0X A;  3EPG A;  3NGD A;  1ZQB A;  4YD1 A;  2HHX A;  4GC6 A;  9ICR A;  3G6Y A;  4O5C A;  4DOC A;  4DEZ A;  5J2F A;  3GDX A;  9ICC A;  2NRK A;  3H37 A;  5F2V O;  5HRB A;  4PGX A;  2FPM A;  3KHG A;  2F1H A;  3M8R A;  4NKT A;  4DF8 A;  1TV9 A;  1TAU A;  3C2L A;  4ATB B;  4I2B A;  3MR6 A;  2Y1I A;  1NKE A;  5J2G A;  4P4P A;  3ZD8 A;  2XCP A;  7ICK A;  4WC1 A;  4RZR A;  2HVH A;  4F5R A;  4YR3 A;  1KFD A;  4DS5 A;  3LK9 A;  3MFH A;  3HT3 A;  1NK9 A;  3NTU A;  5KFT A;  4J9O A;  3MDC A;  5HRE A;  3PW7 A;  2XC9 A;  1F5A A;  4B9T A;  1MIW A;  3KHR A;  4DSJ A;  4KLT A;  3Q8S B;  4RNN A;  3ZD9 A;  5HRD A;  3PX4 A;  3HX0 A;  2ATL A;  9ICJ A;  2ZUC A;  4YCX A;  5HRI A;  1TFW A;  3N97 B;  2NRT A;  4EBC A;  1NK7 A;  1C7Y A;  1JAJ A;  4M5D A;  4FHP A;  1XU4 A;  4NLK A;  4I2D A;  5KT3 A;  2PFQ A;  8ICO A;  3OVS A;  1X2I A;  1DGS A;  5J0R A;  2XCA A;  2W9C A;  4TQS A;  8ICX A;  5KG5 A;  1S0V A;  4LT6 A;  4UB3 A;  4Z6C A;  3M9O B;  3MR3 A;  9ICO A;  4O3N A;  4UBB A;  4DL3 A;  3C2M A;  3C2K A;  3UQ2 A;  4TUP A;  4EBJ A;  4YMM A;  4F91 B; 
#chains in the Genus database with same CATH topology
 4NXZ A;  1TK8 A;  1B4F A;  2ZH4 A;  5III A;  4YR2 A;  4NM1 A;  1LV5 A;  3IHQ B;  2O6K A;  1SXE A;  3LWM A;  3C28 A;  2J6U A;  2BCQ A;  4M9G A;  1R8C A;  2ASD A;  3C66 A;  2BE3 A;  1UA1 A;  5KT2 A;  3EZ5 A;  4AT9 B;  2G06 A;  4WC2 A;  3I28 A;  5HMM A;  3HJ4 A;  2ZH1 A;  3M6Z A;  4UB4 A;  4UW9 A;  4KLO A;  3RR7 A;  3E2E A;  2E8O A;  4R63 A;  3EPI A;  4HYK A;  4CNQ A;  3QUB A;  9ICA A;  5CFS A;  4KN7 A;  3RJE A;  3E0F A;  5J0T A;  2BPF A;  5KG6 A;  4O3Q A;  2BCU A;  2RP5 A;  2LM4 A;  3AU2 A;  4F5Q A;  4R8U A;  4ZH4 A;  4NLN A;  4P0Q A;  2B51 A;  1RPL A;  2R18 A;  2E8M A;  2DUY A;  4KLD A;  8ICQ A;  3PW5 A;  3NVZ A;  1WWU A;  2I1Q A;  5HHI A;  4R66 A;  1SV0 C;  3OUY A;  1U4B A;  1KN5 A;  8ICF A;  1VFG A;  4US8 A;  4IQU A;  4JLZ A;  3EWA A;  4JV2 A;  5DBC A;  4F50 A;  3HJE A;  2IA6 A;  5ALU A;  4DL5 A;  5J0Y A;  1YT3 A;  2NYV A;  1S5L U;  2ZIX B;  4I2I A;  4KIT B;  2KSO B;  4HX0 A;  1NK0 A;  2WF7 A;  4NV0 A;  1WWV A;  5KFU A;  4YVZ A;  4HAI A;  4RWQ A;  1UT5 A;  4MF8 A;  3TFR A;  9ICB A;  4F5P A;  4X4N A;  2UVV A;  4ECT A;  3H40 A;  1RXV A;  2JXJ A;  4FBT A;  1UA0 A;  2F77 X;  4ICA A;  1S0N A;  1PVP A;  4X0B A;  1ZQA A;  1U49 A;  4QZI A;  2LYH A;  2DKX A;  1ZQJ A;  2HHU A;  4J9M A;  1JXE A;  3S6J A;  4RPZ A;  2QAR A;  2LKY A;  2G5H B;  1ZQ1 C;  4AT7 B;  3WKA A;  1QQ5 A;  4GLX A;  3H4D A;  4GXK A;  2LPE A;  2AGP A;  4MFF A;  5F9L A;  5J2B A;  4QJF B;  2GH1 A;  3WFP A;  1YLQ A;  3I76 A;  5IIL A;  2BCR A;  3MDA A;  2QB0 A;  4UB6 U;  1WCN A;  4Q44 A;  1NK5 A;  4YMO A;  4K4G A;  4C8O A;  4KLE A;  1PK3 A;  5D46 A;  5KFC A;  2B21 A;  4RQ3 A;  5KG7 A;  4B9U A;  4EEL A;  2F44 A;  5KFK A;  3MAB A;  4USA A;  3QZ8 A;  4LJX A;  1Q78 A;  2KK0 A;  2EAP A;  5KTQ A;  5BPC A;  3G6X A;  1KNY A;  4Y2V A;  2Y0S C;  2AGQ A;  5L1J A;  1S10 A;  4JK1 A;  3N7R C;  3QEA Z;  2OH2 A;  5J0O A;  2WF6 A;  1LKY A;  2CRX A;  2JEF A;  8ICL A;  4EX7 A;  1QQ7 A;  4Y2P A;  3ERC C;  8ICS A;  2DKZ A;  5AHX A;  2XO7 A;  7ICJ A;  2DL0 A;  1RDF A;  2IMW P;  2HBM A;  1MQ3 A;  4AYB C;  3RRH A;  4ELT A;  4IL6 U;  3Q8Q B;  9ICP A;  2IHO A;  1Z4N A;  3OSN A;  4QZH A;  4F5O A;  2YQE A;  4TQR A;  2EQY A;  1J97 A;  2XI9 A;  4ECY A;  5ALG A;  1BNP A;  5JRT A;  3V7K A;  3RRG A;  8ICM A;  4P4M A;  5ALJ A;  1JI7 A;  3QYP A;  5KFX A;  1BVS A;  1NO5 A;  7ICF A;  3CNH A;  5J2K A;  7ICL A;  5KG2 A;  8ICZ A;  4C8M A;  3ISD A;  2Y9U A;  2DFL A;  2G09 A;  4KX3 A;  1Q79 A;  2HOI A;  4JUZ A;  5CWR A;  2R8H A;  1R89 A;  1S0O A;  2WAQ C;  5KFB A;  2BQU A;  5KFJ A;  3OGU A;  3RB0 A;  3ZDC A;  5J2E A;  2E8N A;  3KD3 A;  4DCC A;  4RQ5 A;  3ALR A;  3HIL A;  4KMU A;  4RQ4 A;  4X4O A;  3OJS A;  5DDY A;  1FA0 A;  1D8L A;  2EAN A;  4PHP A;  4DL6 A;  5G5G A;  5KAF U;  1ZQS A;  3CRX A;  3ZDB A;  4X4Q A;  4JMU A;  2BCV A;  1SWW A;  3TAP A;  4DSL A;  4DL7 A;  1SZP A;  2UVR A;  1SKR A;  4I27 A;  1KFS A;  4UBC A;  5DB6 A;  5B3Q A;  3U26 A;  3MCR A;  4KLF A;  2W04 A;  3MBY A;  1NZB A;  4KX5 A;  3GV5 B;  2KD1 A;  2QKQ A;  1BPD A;  3GIJ A;  3JPQ A;  1HIW A;  3V6K A;  2XY6 A;  3OJU A;  2JH1 A;  5KFV A;  1KSP A;  4MF2 A;  1SKW A;  3PST A;  5J0Q A;  3SZ2 A;  4BXO A;  4DQS A;  4RQM A;  4ECX A;  2KKP A;  4C0Z A;  4LVS A;  2ES6 A;  7ICH A;  1TVA A;  2WF5 A;  3WKD A;  5AM4 A;  5HNK A;  2AU0 A;  1GO3 F;  4NM2 A;  2M9N A;  4J9N A;  3KZI U;  4CRX A;  4YQW A;  2AQ0 A;  1PX5 A;  3JPN A;  1T3N A;  3SQI A;  2LBO A;  4LEV A;  2NRW A;  4FZM A;  1Z3E B;  4JWM A;  2XGP A;  4C4R A;  2AXT U;  4RWO A;  3RAX A;  4O3O A;  3F2D A;  2K8A A;  4B6J A;  5CA7 A;  4ED0 A;  5DQH A;  2UVU A;  1QQ6 A;  4B9M A;  2VJ4 A;  4K4I A;  4PHD A;  2W3S A;  3IM1 A;  3KFU F;  4ATB A;  1L5U A;  3J81 j;  2E8P A;  5FP0 A;  2I9G A;  1X66 A;  2QB0 B;  3QU4 A;  2DR5 A;  4BJQ A;  4CCH A;  1Y88 A;  2JH7 A;  1NJW A;  3HWT A;  3AUO A;  1X9W A;  1KL9 A;  3GIL A;  3AQK A;  3GIM A;  3MC1 A;  2KIW A;  2J6S A;  1XO0 A;  2B0C A;  4QZA A;  2M2V A;  4MHV A;  1K1S A;  4ECV A;  4XQ8 A;  3K75 D;  2LM1 A;  3BZC A;  3KKA C;  2RDJ A;  2YMP A;  4P0P A;  2ZTE A;  4F72 A;  3SD7 A;  1M6Y A;  4JV1 A;  7ICI A;  1Q8K A;  1ZD3 A;  4GC7 A;  5L1I A;  1KEJ A;  1MIV A;  5DBB A;  4ELV A;  2WB1 F;  5KFL A;  2EDU A;  3AN1 A;  4XRH A;  1ZJN A;  2HHT A;  3LWL A;  1BPX A;  3NRZ A;  3QU7 A;  2BDP A;  2K4E A;  4RPX A;  2W9M A;  3H8S A;  2Z7J A;  3FAH A;  3QNM A;  2O1P A;  1X6I A;  1D8B A;  1NZP A;  4B9V A;  5AKH A;  5AKZ A;  4DFP A;  2G5I B;  3NYB A;  4UD5 A;  4K98 A;  1L8L A;  2FMS A;  3IDW A;  3BZK A;  3WFO A;  2K8B B;  1WG8 A;  1N2X A;  1MIY A;  4WQK A;  2HMX A;  4M47 A;  3WU2 U;  4RQ6 A;  3E58 A;  1EXN A;  2DGZ A;  4IRD A;  3QE9 Y;  1SB3 C;  2KNJ A;  2DVI A;  4OAG A;  9ICN A;  1RM6 C;  4YD2 A;  5HRG A;  4UAT A;  3NGD A;  1ZQB A;  4DOC A;  2NO5 A;  4DEZ A;  2NRK A;  5F2V O;  2XID A;  2KHQ A;  2KEY A;  4P4P A;  7ICK A;  3ONN A;  4YR3 A;  1KFD A;  3HT3 A;  3NTU A;  4J9O A;  5HRE A;  2ZIW A;  2BZF A;  1JAL A;  4DSJ A;  3MGV A;  1CI4 A;  3BS5 A;  4RNN A;  3ZD9 A;  1IV8 A;  1OW5 A;  3HX0 A;  9ICJ A;  2G0A A;  2ZUC A;  4I2D A;  5KT3 A;  1OUQ A;  1QCK A;  5KL8 B;  8ICX A;  3ER9 B;  3SEI A;  4UB3 A;  4KM5 A;  1SV0 A;  4QIW F;  3M9O B;  3PSP A;  4WJ3 B;  3C2K A;  1NK8 A;  4QNL A;  4P0P B;  3C29 A;  2E1E A;  4EBE A;  1ARO P;  8ICB A;  4F8R A;  4XJE A;  4F2S A;  2M2U A;  2FPK A;  3B9J A;  3QU5 A;  2GWS A;  1Z1B A;  3QEB Z;  3ZI4 A;  2KTQ A;  1J2N A;  4E8F A;  3RAQ A;  3NUQ A;  4XUS A;  7ICG A;  4ECW A;  5CRX A;  1SV4 A;  1X9S A;  4I0U A;  1SIJ A;  2KJ5 A;  4QZB A;  2BQR A;  4Y2J A;  2ZXI A;  4DFD A;  3C5F A;  9ICM A;  4YP3 A;  2W55 A;  1U45 A;  5ALW A;  1FFV A;  2CXY A;  2MRL A;  4N7R A;  1TFR A;  2YN4 A;  5KG0 A;  4X4T A;  2HDO A;  4IR1 A;  4PGQ A;  2IOF K;  5HP4 A;  2JEJ A;  4EEN A;  2HSZ A;  1XWL A;  3RF9 A;  2I6X A;  4DSI A;  4WC6 A;  4RT3 A;  1RQL A;  4NXV A;  3NVY A;  1QLN A;  3TAD C;  3NS1 A;  3C5G A;  1TAM A;  5J0W A;  4DLE A;  2Q4T A;  4EX6 A;  4UAW A;  3TKA A;  5AM0 A;  9ICL A;  2WF9 A;  3AQM A;  3PW4 A;  1TK5 A;  2PMZ F;  3V7L A;  2C2E A;  1VLB A;  1A77 A;  1Z19 A;  2JR5 A;  4J9K A;  4WOY A;  4OJP A;  7ICV A;  2ZHA A;  1IXR A;  3AL0 B;  4C8K A;  2OCE A;  5F3X B;  4ED6 A;  5J2D A;  5AIC A;  3BJY A;  2KP7 A;  2K89 A;  4CF5 A;  4AT8 A;  2F1J A;  1V38 A;  5H2F U;  1NJY A;  3UXN A;  3WK5 A;  4F4X A;  1UT8 A;  2KE7 A;  7ICN A;  5EWG A;  1S0M A;  2OYY A;  4ECR A;  2JRZ A;  2ZH3 A;  4KLI A;  3PR4 A;  4GIB A;  5AKG A;  1MA7 A;  2PI5 A;  4J03 A;  5DB9 A;  4NXT A;  5ALH A;  4F93 B;  4DL2 A;  1ZQH A;  4ECS A;  4UB5 A;  3KOO A;  8ICN A;  5HRF A;  1QH9 A;  2EZY A;  3M9M B;  1T8E A;  5DEC A;  4AT7 A;  4F4Y A;  3TFS A;  9ICW A;  1ZD2 P;  2F3N A;  3GFK B;  2W9B A;  2ZIV B;  2OWO A;  4WBZ A;  4O68 A;  4R8U B;  1D8Y A;  1QSS A;  4FS2 A;  1FEZ A;  4M0A A;  5HRK A;  4JWN A;  4YR0 A;  8ICG A;  4K96 A;  4E0D A;  4Y2U A;  2YY6 A;  5KFZ A;  2BQ3 A;  2WAQ F;  3JCF A;  5AIA A;  2A1A A;  2PFO A;  3PVX A;  1RQN A;  1UHU A;  1FIQ A;  4O5E A;  4PZO A;  1ZQW A;  3L5K A;  2NO4 A;  8ICU A;  1JMS A;  3NAS A;  2DR8 A;  2KOB A;  5KFW A;  1LB2 B;  4UAZ A;  3AQF A;  8ICT A;  9ICS A;  1JXL A;  3RJI A;  4C7Y A;  5EWE A;  2V4R A;  3Q8K A;  5J0S A;  4X0A A;  4JV0 A;  8ICJ A;  3SEN A;  4O0I A;  4C8N A;  2RLT A;  2WHE A;  1JN3 A;  3PX6 A;  2ISP A;  2M2T A;  1MC8 A;  7ICT A;  4M6W B;  4RQ1 A;  2R8I A;  1V85 A;  1KRP A;  4C8L A;  1UQV A;  4EGW A;  3H39 A;  1Q46 A;  2H3Z A;  2N1R A;  2F8L A;  3RFA A;  4F71 A;  8ICH A;  4IQT A;  4QZ8 A;  5TIS U;  2AGO A;  2LYB A;  4KLG A;  2BBH A;  1JRP A;  5J0U A;  1R8B A;  2W11 A;  2NV3 A;  4J9P A;  2KIV A;  3WK6 A;  3H0M B;  3SYZ A;  1F5A A;  4BWJ A;  3PO4 A;  5KFA A;  3JPT A;  1VDV A;  4NLC A;  4O67 A;  2ZG6 A;  4Y2Q A;  3AQL A;  5ALV A;  2JHD A;  4CF3 A;  1SZH A;  1DOQ A;  5DBA A;  3HP6 A;  1ZQK A;  2RHF A;  3FDS A;  5AK5 A;  4OJ5 A;  2G08 A;  2ZH6 A;  2YML A;  5KFI A;  3BS7 A;  1XSL A;  1ZD5 A;  1KFT A;  4EED A;  5HRH A;  1B43 A;  2NRZ A;  3C1Y A;  3SV4 A;  1S8O A;  2G07 A;  5DDM A;  1NJZ A;  2Q0Z X;  3ZDD A;  3QU2 A;  4ECU A;  4K9A A;  1ED1 A;  4M9L A;  4ED2 A;  2HBJ A;  3OPX A;  4EP7 A;  5EE9 A;  4O3M A;  3D2Q A;  5DLF A;  2Q66 A;  4JLX A;  2MSN A;  4DLG A;  3Q8L A;  3H8J A;  1NK6 A;  2HVI A;  2DF4 B;  4Z6F A;  1S76 D;  2MAX A;  3H0R B;  1ZET A;  5AKX A;  4P4O A;  1L8O A;  4PGY A;  4ELU A;  1N63 A;  5DB8 A;  1ZQO A;  7ICO A;  5DGB A;  5CB1 A;  5AI9 A;  5GTH U;  4Y2R A;  4I2F A;  1NKB A;  4NY8 A;  1BPE A;  4NLB A;  2E5S A;  2W43 A;  4F4W A;  4Q8E A;  3CK6 A;  9ICK A;  9ICQ A;  2KVC A;  4IRC A;  3LYS A;  3RB6 A;  2ZIW B;  3L4P A;  4Z6D A;  3T5K A;  4EBD A;  2ZH2 A;  2H3Q A;  3JZ0 A;  3PSF A;  4O3R A;  1X9X A;  5JU5 A;  9ICU A;  1ZJM A;  5ALO A;  3PV8 A;  2KZZ A;  4OJ6 A;  2K4H A;  2KZM A;  4NL9 C;  4OJL A;  3AMZ A;  5EOZ A;  2XY5 A;  4KLS A;  4K99 A;  4DQP A;  4XQ7 A;  4J9Q A;  3ORY A;  5AK4 A;  2AJQ A;  1HJP A;  1ZQF A;  1A76 A;  2LMR A;  2ZUB A;  2W8L A;  3UXP A;  4CE6 A;  2DPJ A;  3TAD A;  1WOT A;  4RQ0 A;  4FBU A;  4EZ9 A;  4UB8 U;  2PBE A;  4RNM A;  4KN4 A;  5ALI A;  5KFP A;  2ODG A;  3TI0 A;  5JUM A;  4KTQ A;  1P7D A;  5KG3 A;  1PK1 A;  4UQG A;  3H3A A;  5AKY A;  1L6N A;  1ZQL A;  4NLG A;  4O69 A;  3LDA A;  1O03 A;  5J0X A;  5B66 U;  2HHX A;  3QUT A;  5HRB A;  2FPM A;  1Q3U A;  2F1H A;  4DF8 A;  4I2B A;  3MR6 A;  1NKE A;  4WC1 A;  2JV3 A;  1Z1V A;  4F5R A;  5AI8 A;  1NK9 A;  2XC9 A;  3K1Z A;  3QUC A;  5HRD A;  3AM9 A;  1TFW A;  4EBC A;  4M5D A;  5CFT A;  2PFQ A;  3OVS A;  2M0N A;  1DGS A;  5J0R A;  2XCA A;  1URJ A;  5ALY A;  4TQS A;  3F53 A;  4MKP A;  5KG5 A;  3MR3 A;  4UBB A;  4DL3 A;  2P66 A;  2YMM A;  4YMM A;  1RZT A;  8ICI A;  1ZOL A;  5J2I A;  1FO4 A;  1L3T A;  3V72 A;  4O6A A;  4ED8 A;  3QZ7 A;  1LKY B;  3PSI A;  3R9K A;  4PH5 A;  3FC4 A;  4LEZ A;  4K97 A;  2MA1 A;  2PMZ C;  3PX0 A;  5KL1 B;  3K1R B;  4BXO B;  3CYM A;  3PZP A;  4QZC A;  5KG1 A;  4YG2 A;  3JYY A;  3C18 A;  3JPR A;  4DQR A;  4YN4 A;  8ICV A;  5ALK A;  9ICE A;  4RU9 A;  4QW8 A;  5G5H A;  4TUS A;  1YZ7 A;  1N61 A;  2ZH5 A;  3UPQ A;  4NWI A;  2K4P A;  4C4S A;  3MFI A;  1KLN A;  2HHQ A;  1DK3 A;  3T5J A;  1AQ6 A;  4RWN A;  3DV9 A;  3GZF A;  1ZQZ A;  2A3V A;  4X4S A;  4A8E A;  2AHO B;  4DOA A;  4FH3 A;  1L7P A;  1B0X A;  3UMC A;  2KHV A;  2YTU A;  4IC9 A;  3B0X A;  1TKD A;  3N28 A;  2LHT A;  2KMD A;  3H4B A;  1HEK A;  4BDP A;  4BX9 C;  3RJK A;  2GAF D;  5CJ7 A;  2VA3 A;  3GU3 A;  4FHX A;  2IHN A;  4ECZ A;  2D8C A;  2YB4 A;  2OEH A;  3RJG A;  3KHL A;  2ESE A;  4WQL A;  1VJ5 A;  2H3F A;  3V6H A;  4I2H A;  1UET A;  5ALF A;  8ICC A;  5AI4 A;  4EEY A;  4KLU A;  2BPG A;  2JEG A;  2OHF A;  5ALQ A;  2BDU A;  9ICI A;  1V4A A;  5HHH A;  2JZB B;  2HHS A;  4P2H A;  4BUG A;  4M2Y A;  2H5X A;  4RT2 A;  2W03 A;  4QZF A;  4RWP A;  2HN1 A;  3HKZ F;  4UAR A;  4M9J A;  4AP9 A;  4FO6 A;  4DS4 A;  3UMB A;  4IRK A;  2IOF A;  5F9N A;  2DPI A;  5J29 A;  2KV2 A;  4LZD A;  5KFM A;  1VJ7 A;  3M1Y A;  2NRV A;  4JB3 A;  2B56 A;  3FM9 A;  5KFQ A;  2ASJ A;  3AEV A;  1SXD A;  4F2R A;  1L7N A;  4J9R A;  1ZQD A;  2IHM A;  1N56 A;  4KLL A;  4QZG A;  3WFQ E;  2DWQ A;  3RB4 A;  1DXS A;  2C28 A;  2W7P A;  5D49 A;  3M6K A;  2PI4 A;  5AK3 A;  5AKE A;  4UAV A;  4QZE A;  2AH5 A;  1B22 A;  3F2C A;  3QU9 A;  2F1I A;  2J6T A;  4F5N A;  4I2J A;  1T7P A;  1SGG A;  2KZ3 A;  4ED1 A;  5D62 A;  5J2C A;  1D9F A;  3DEE A;  4IQV A;  2KN7 A;  1KDH A;  2PFP A;  4TUR A;  2E1F A;  4NXU A;  2RDI A;  2BHN A;  5CEH A;  3WKC A;  2ZJA A;  4Y2Y A;  4PL1 A;  5J0P A;  4FS1 A;  2ID1 A;  2BR0 A;  4XA5 A;  2K8C B;  2VAN A;  1JIH A;  3OTQ A;  1L3U A;  5HR9 A;  2HHP A;  4OAH A;  2MUT A;  1BPZ A;  3JPP A;  3HJ1 A;  2KJ9 A;  4FZN A;  5AK6 A;  3TAR A;  1SL2 A;  2LI6 A;  5ALT A;  4KB6 A;  5CR0 A;  2ZXH A;  2H3V A;  2MUT B;  1NKC A;  1V97 A;  3HIY A;  3L3F X;  4R64 A;  1U47 A;  1ZQG A;  4KLQ A;  4NL9 A;  4MFA A;  1ZXI A;  4OAF A;  2ZH7 A;  9ICV A;  4BWM A;  4PL2 A;  3ICX A;  3KZX A;  4FFD A;  2FE9 A;  1XS9 D;  4I2A A;  2HI0 A;  2ALZ A;  1ZQM A;  2LYA A;  1F5S A;  4ED7 A;  8ICW A;  4O5K A;  2FPL A;  5KFH A;  1S77 D;  5AI5 A;  3RBE A;  1Z00 A;  4PHA A;  2CPR A;  5ALP A;  1ZYQ A;  2V4Q A;  4RQ2 A;  5DG8 A;  5ALR A;  2DRA A;  4AT8 B;  1XC9 A;  2HOQ A;  5L9X A;  2FDR A;  2OM6 A;  4X4P A;  4DL4 A;  1ZQY A;  2L5Y A;  2FI1 A;  2YB1 A;  2KIC A;  3I1Y A;  2ZHB A;  4WH5 A;  2WFA A;  4I28 A;  3MR2 A;  5E79 U;  3OSP A;  4BGD A;  2FLL A;  4IS7 A;  2JEI A;  1ZQR A;  3SAG A;  1ZQV A;  1RYR A;  4DOB A;  1QTM A;  1A0P A;  5DKW A;  3T5L A;  1RYS A;  4DSE A;  5KT5 A;  3UXO A;  2IBK A;  3DDH A;  3EF2 A;  5EE3 A;  2RRD A;  3M9N B;  3MGI A;  1QSY A;  2PFN A;  1L3S A;  5KFD A;  3C21 A;  2R8K A;  2C2D A;  3BS5 B;  1SL1 A;  5KFF A;  3PMN A;  1MQ2 A;  2EAO A;  3QXG A;  5HML A;  4M04 A;  4YXJ A;  3TAN A;  2EWR A;  2Y1J A;  2B4V A;  3WKE A;  4WC7 A;  3OHA A;  4US9 A;  1OXJ A;  5CP2 A;  4F4K A;  7ICR A;  1XSP A;  3G6V A;  7ICP A;  3M7D A;  5KFN A;  1F44 A;  4C4T A;  2RQ5 A;  2DQN B;  2HCF A;  2VJ5 A;  4B9L A;  3ER8 C;  4DFJ A;  3F5E A;  3KBB A;  3LQC B;  3OWG A;  5L1K A;  3WFS C;  4Q8F A;  3L9D A;  1SWV A;  3N7S C;  2YX8 A;  1JRO A;  3KKA A;  1L7O A;  4B9S A;  3H8W A;  1T3Q A;  4R65 A;  3NVV A;  2XY7 A;  3F5A A;  1IM4 A;  4M9H A;  4J9L A;  1N5X A;  3BDP A;  2GA9 D;  3PY8 A;  2M2W A;  2ZTD A;  3RR8 A;  1T94 A;  5KG4 A;  4OJO A;  3BQ7 A;  4K9B A;  1JQR A;  1WYG A;  4Q43 A;  1PZN A;  4MEX A;  3WK8 A;  5CHG A;  3RJH A;  3ETR A;  3NVO A;  3FYH A;  2D6F C;  2YMQ A;  3K4G A;  3SR6 A;  4DWI A;  2GLE A;  2FLN A;  2BGW A;  2IUB A;  4RPY A;  1K1Q A;  3JPO A;  2HN2 A;  4DSK A;  4LEW A;  4B9N A;  2HW3 A;  2VA8 A;  4F3O A;  3IP4 B;  4P0Q B;  1S9F A;  4AT9 A;  1FFU A;  4AYB F;  3GII A;  2ZH8 A;  4C7Z A;  3ISB A;  5ALZ A;  2DR7 A;  5AI0 A;  2XGQ A;  4X4U A;  1CUK A;  4UB2 A;  4WC4 A;  4EYH B;  5AKL A;  5TZV A;  5A0L A;  4UB1 A;  3RB3 A;  5AM3 A;  3TQ1 A;  8ICA A;  1ZQX A;  5KFY A;  4O3P A;  5KT4 A;  2PXI A;  3N4M B;  5KT7 A;  1LVH A;  2P6R A;  3OVA A;  1RYU A;  4U6P A;  3EPG A;  4YD1 A;  9ICR A;  3G6Y A;  4O5C A;  3GDX A;  3H37 A;  3KHG A;  3HRD D;  4ATB B;  2Y1I A;  5AKI A;  5J2G A;  3ZD8 A;  4RZR A;  4EEB A;  2KVS A;  3LK9 A;  3PW7 A;  3H0L B;  4Y2T A;  3Q8S B;  4OO1 J;  4FZL A;  2ATL A;  3F2B A;  5HRI A;  3N97 B;  2NRT A;  1N60 A;  1C7Y A;  4FHP A;  1XU4 A;  3H8M A;  3T79 A;  1X2I A;  5EE1 A;  2D3D A;  1WUD A;  1S0V A;  4O3N A;  4EBK A;  4F91 B;  4X5V A;  5JTI A;  5DLG A;  2BKE A;  2ZJ5 A;  5L1M A;  3V6J A;  5ALS A;  2ZH9 A;  2HBL A;  1PVQ A;  2JMG A;  3IV6 A;  1ZQQ A;  1UPH A;  2P6U A;  1X9M A;  4CGZ A;  3HW8 A;  3VCB A;  5D4B A;  1U9L A;  2ZIX A;  2W9A A;  4F4Z A;  3A0H U;  5D61 A;  2EZX A;  5EE0 A;  2MU2 A;  4MFC A;  2I5H A;  5ALE A;  2F2A B;  2Y0S F;  4J9S A;  3OVB A;  4IG8 A;  4QIW C;  4I2G A;  3WKB A;  4EYI B;  4KLJ A;  1ECW A;  5IIJ A;  1TAQ A;  2JGA A;  4U7C A;  2KJ8 A;  1SKS A;  3NWI A;  1BGX T;  5BOM A;  1X42 A;  4Y2X A;  4RQN A;  3PO5 A;  3QX7 A;  4CF4 A;  1MN8 A;  1WCL A;  2WB1 C;  2O5A A;  1KQQ A;  4DF4 A;  3H38 A;  4QWE A;  4YFK A;  3GQC A;  1OU5 A;  1KBU A;  2E3T A;  4WC5 A;  2V9W A;  4DQI A;  1PUZ A;  2IOH A;  3EYZ A;  3PML A;  3T3F A;  3ZDA A;  5DGA A;  1KTQ A;  5AIB A;  4E80 A;  5DED A;  1ZQC A;  2ZUD A;  4QW9 A;  1NOM A;  5AI6 A;  1MSW D;  3ETL A;  9ICF A;  1NJX A;  3UMG A;  4QZ9 A;  2UVW A;  3KHH A;  4QWD A;  1J2M A;  4IR9 A;  2GO7 A;  2ZIU B;  2F8K A;  2W3R A;  4RUA A;  4X4V A;  3AU6 A;  1H38 A;  1ZQT A;  4M9N A;  4FHY A;  4DFK A;  2R8J A;  2XIC A;  3LVV A;  5B3P A;  5HR7 A;  1HUZ A;  1JUD A;  3WK4 A;  4ECQ A;  2W9C B;  4K8V A;  5J2J A;  4CDG A;  3NVW A;  5KFR A;  1IIP A;  2BCS A;  4EV6 A;  3WFR E;  2K4I A;  4GFJ A;  3C23 A;  3SAF A;  4OD0 A;  1KW4 A;  2FMP A;  5DB7 A;  1ZQI A;  4I2C A;  3ED5 A;  5KAI U;  3NRW A;  1N48 A;  2WF8 A;  4G3I A;  5ALX A;  3MGH A;  4FHV A;  3JPS A;  1ZRM A;  4UAY A;  3UM9 A;  3AQN A;  4NJ8 A;  1GPJ A;  3ISC A;  4UAU A;  1CEZ A;  3SV3 A;  4RNO A;  3M8S A;  4GXJ A;  1Z4O A;  5ALN A;  3NKU A;  4FH5 A;  2HOF A;  1YZ6 A;  4DFM A;  1ZQN A;  7ICS A;  1NNL A;  1DRG A;  2EZZ A;  2HHW A;  3TAC B;  2BPC A;  3WK9 A;  3GIK A;  2R8G A;  4M6W A;  4KLM A;  1UCV A;  5DQI A;  4YMN A;  3MR5 A;  4EZ6 A;  4F92 B;  3PR5 B;  3T5H A;  1U48 A;  3RH4 A;  4QWC A;  3Q8M A;  2C2R A;  2A19 A;  2ASL A;  1S97 A;  3PW2 A;  1DGJ A;  3ZDE A;  2FCL A;  1NI3 A;  5D63 A;  5J8Y C;  4QZD A;  2A1J A;  2VKQ A;  4NXX A;  2K60 A;  5J2H A;  4ZOH C;  1NK4 A;  4G9B A;  5IIK A;  3H7I A;  1D9D A;  5AM1 A;  3AQE A;  1BPY A;  5DG9 A;  2A1J B;  3IRU A;  3IG5 A;  1R8A A;  4DO9 A;  3B0Y A;  3N7P D;  2QB1 A;  4QWA A;  3IG8 A;  4NXW A;  5IIN A;  4E7X A;  4RQ7 A;  3RH5 A;  3PHZ A;  1ZRN A;  4WC0 A;  3BQT A;  4OCZ A;  2ZJ8 A;  4EEK A;  2ZIU A;  1ZQE A;  5HC9 A;  5T14 A;  1V9P A;  1CRX A;  4FE3 A;  3SMV A;  4DQQ A;  4YXM A;  3RBD A;  3SI8 A;  3BQ1 A;  2GOL A;  4I29 A;  5J2A A;  8ICE A;  2VA2 A;  3D2S A;  3V7J A;  7ICM A;  3UQ0 A;  2FMQ A;  9ICG A;  5DG7 A;  8ICR A;  9ICH A;  5ALL A;  1T4G A;  3LVW A;  3K7D A;  5C5J A;  1N62 A;  1XSN A;  5IIO A;  2H3I A;  4S3N A;  4X4R A;  1UEU A;  1XO1 A;  5EWF A;  4DSF A;  2BBJ A;  1TFY A;  3HKZ C;  4K4H A;  1A6S A;  4NLZ A;  2ZIV A;  2W9B B;  4C80 A;  5KFE A;  1TK0 A;  2C22 A;  2HBK A;  2W8K A;  3THV A;  1HUO A;  4Y2S A;  1Z00 B;  1PVR A;  4MEY A;  3OV7 A;  2OXO A;  9ICX A;  2NRX A;  1TE2 A;  3Q8P B;  2ZTC A;  2VIX A;  2CN1 A;  2WTF A;  3RJJ A;  5HR6 A;  1C20 A;  5IIM A;  3OUY B;  3PNC A;  3QUQ A;  5AKJ A;  1BPB A;  5AKK A;  2EH9 A;  5JTG A;  4GXI A;  1RXW A;  9ICT A;  2DRB A;  4QWB A;  2DR9 A;  2JZB A;  5DQG A;  5ALD A;  3HPO A;  2ISO A;  3D6J A;  2Y9T A;  5B5E U;  2QLT A;  3WK7 A;  5C0Y A;  2KG5 A;  2KKV A;  3OHB A;  3RJF A;  4UD4 A;  2P35 A;  1IG6 A;  4RUC A;  3GV8 B;  2HHV A;  1DK2 A;  1KKX A;  2EAM A;  3O0F A;  2KFN A;  1X40 A;  4O9M A;  1Q3V A;  4NKU A;  3GV7 B;  5ALM A;  3CW2 C;  5KT6 A;  4O3S A;  4PJ0 U;  8ICP A;  5L1L A;  2F76 X;  1SL0 A;  3UPS A;  1JX4 A;  3CP8 A;  2AQ4 A;  1QSL A;  1UEV A;  1K5O A;  5KNI A;  3EW9 A;  4TUQ A;  1ZQP A;  5KFG A;  4WCW A;  1L7M A;  5KFS A;  3C1Z A;  5AM5 A;  4IQW A;  4LZG A;  4ED3 A;  4KMO B;  4Z6E A;  4PZN A;  5HRL A;  1X6J A;  1ZQU A;  2XVT A;  3RH6 A;  3BQ0 A;  1N5W A;  1COO A;  5GTI U;  2FLP A;  4FHW A;  3Q8R B;  3EUB 2;  3TAQ A;  1BNO A;  4Q45 A;  4WBY A;  3RTV A;  3KTQ A;  2KFZ A;  7ICQ A;  1L3V A;  3D2N A;  3VC8 A;  4I2E A;  4WC3 A;  7ICU A;  1F0M A;  4UAS A;  5AM2 A;  4KLH A;  2QAR B;  5KFO A;  3BQ2 A;  4RQ8 A;  3A0B U;  3PW0 A;  8ICK A;  2DBY A;  3SAH A;  1ZD4 A;  5CFU A;  7ICE A;  5BOL A;  4PHE A;  4PPX A;  2PKE A;  8ICY A;  2RFF A;  1O08 A;  4GC6 A;  2KSO A;  5J2F A;  9ICC A;  4PGX A;  3IN5 A;  4NKT A;  3M8R A;  1TV9 A;  1TAU A;  3C2L A;  2XCP A;  2W7O A;  2HVH A;  4DS5 A;  3MFH A;  5KFT A;  4ACO A;  5J8Y A;  3MDC A;  4B9T A;  1MIW A;  3KHR A;  4KLT A;  1COK A;  2B6G A;  3PX4 A;  4YCX A;  1NK7 A;  1JAJ A;  1RG6 A;  2FJ6 A;  4NLK A;  1PK1 B;  8ICO A;  5CHE A;  1XNS A;  2W9C A;  4LEY A;  2W54 A;  4LT6 A;  4Z6C A;  4FO1 A;  5K4L A;  9ICO A;  4OAI Z;  3C2M A;  3UQ2 A;  4TUP A;  4EBJ A; 
#chains in the Genus database with same CATH homology
 4X5V A;  4NXZ A;  5J2I A;  5DLG A;  1TK8 A;  1L3T A;  7ICP A;  2ZH4 A;  4C8L A;  2BKE A;  2ZJ5 A;  5III A;  4EBE A;  1ARO P;  3V6J A;  8ICB A;  3V72 A;  4YR2 A;  4NM1 A;  4ED8 A;  4F8R A;  1LV5 A;  3QZ7 A;  4F2S A;  3IHQ B;  4PH5 A;  2M2U A;  3LWM A;  2ZH9 A;  2FPK A;  2J6U A;  2BCQ A;  4M9G A;  1ZQQ A;  1R8C A;  2ASD A;  3C66 A;  2P6U A;  1UA1 A;  2GWS A;  1X9M A;  2BE3 A;  3QEB Z;  2KTQ A;  4E8F A;  5KT2 A;  3RAQ A;  3EZ5 A;  4AT9 B;  3HW8 A;  4XUS A;  3PX0 A;  5D4B A;  4WC2 A;  4BXO B;  1U9L A;  5HMM A;  7ICG A;  4QZC A;  3HJ4 A;  2ZH1 A;  5KG1 A;  4ECW A;  4YG2 A;  2W9A A;  4F4Z A;  3JYY A;  3C18 A;  1X9S A;  3JPR A;  4UB4 A;  4DQR A;  4YN4 A;  8ICV A;  9ICE A;  4RU9 A;  4KLO A;  3OVA A;  4QW8 A;  3RR7 A;  3E2E A;  4TUS A;  4R63 A;  3EPI A;  4HYK A;  4MFC A;  4QZB A;  9ICA A;  2BQR A;  2ZH5 A;  3H39 A;  4KN7 A;  3UPQ A;  4J9S A;  3OVB A;  3C5F A;  5J0T A;  3RJE A;  9ICM A;  3MFI A;  2BPF A;  1KLN A;  5KG6 A;  2HHQ A;  4YP3 A;  4O3Q A;  4I2G A;  3T5J A;  2BCU A;  1DK3 A;  4EYI B;  1U45 A;  4RWN A;  3AU2 A;  4KLJ A;  5IIJ A;  4F5Q A;  1TAQ A;  4R8U A;  4ZH4 A;  1SKS A;  1ZQZ A;  4X4S A;  1BGX T;  1TFR A;  4NLN A;  5BOM A;  5KG0 A;  4X4T A;  4DOA A;  3PO5 A;  4IR1 A;  4FH3 A;  4PGQ A;  1RPL A;  5HP4 A;  4KLD A;  1WCL A;  3B0X A;  8ICQ A;  3PW5 A;  2JEJ A;  2O5A A;  1TKD A;  2I1Q A;  5HHI A;  3H4B A;  4DF4 A;  1XWL A;  3RJK A;  4BDP A;  4QWE A;  4R66 A;  4YFK A;  3GQC A;  3H38 A;  5CJ7 A;  2VA3 A;  1OU5 A;  4FHX A;  2IHN A;  4DSI A;  3OUY A;  4ECZ A;  4WC6 A;  3RJG A;  4RT3 A;  4WC5 A;  2V9W A;  1U4B A;  3KHL A;  4DQI A;  4I2H A;  8ICF A;  3V6H A;  1UET A;  1VFG A;  4IQU A;  3EYZ A;  8ICC A;  4EEY A;  3EWA A;  4JV2 A;  3PML A;  5DBC A;  3T3F A;  3ZDA A;  4KLU A;  4F50 A;  5DGA A;  1KTQ A;  2BPG A;  1QLN A;  2JEG A;  2IA6 A;  2P66 A;  4DL5 A;  4E80 A;  5DED A;  5J0Y A;  3C5G A;  1ZQC A;  2ZUD A;  4QW9 A;  5J0W A;  1NOM A;  1MSW D;  4I29 A;  3ETL A;  9ICI A;  1V4A A;  4DLE A;  4I2I A;  2JZB B;  4KIT B;  5HHH A;  4UAW A;  1NJX A;  4P2H A;  2HHS A;  9ICF A;  4QZ9 A;  1NK0 A;  4M2Y A;  5KFU A;  2UVW A;  3KHH A;  4QWD A;  9ICL A;  4IR9 A;  2H5X A;  4RT2 A;  4QZF A;  4YVZ A;  3AQM A;  4RWQ A;  3PW4 A;  1UT5 A;  4MF8 A;  3TFR A;  4RWP A;  1TK5 A;  9ICB A;  4F5P A;  3V7L A;  4M9J A;  4X4N A;  2UVV A;  4ECT A;  4FO6 A;  4DS4 A;  2C2E A;  1A77 A;  3H40 A;  4IRK A;  1RXV A;  4FBT A;  5F9N A;  4J9K A;  1UA0 A;  2DPI A;  5J29 A;  1S0N A;  4RUA A;  7ICV A;  2ZHA A;  4X0B A;  3AU6 A;  4X4V A;  1IXR A;  1H38 A;  1ZQT A;  1ZQA A;  1U49 A;  4C8K A;  4QZI A;  4M9N A;  4LZD A;  5KFM A;  1VJ7 A;  2LYH A;  1ZQJ A;  4ED6 A;  2HHU A;  2NRV A;  5J2D A;  4J9M A;  4DFK A;  2R8J A;  3BJY A;  4FHY A;  1JXE A;  1HUZ A;  5KFQ A;  4RPZ A;  2ASJ A;  2KP7 A;  4AT8 A;  4ECQ A;  2F1J A;  2W9C B;  4F2R A;  5J2J A;  5KFR A;  4J9R A;  1ZQD A;  4AT7 B;  2BCS A;  4GLX A;  3H4D A;  1NJY A;  2IHM A;  4GXK A;  1N56 A;  4QZG A;  4KLL A;  2AGP A;  3WFQ E;  3WFR E;  4MFF A;  5F9L A;  3RB4 A;  3C23 A;  5J2B A;  3UXN A;  2FMP A;  4F4X A;  2C28 A;  5DB7 A;  5D49 A;  1ZQI A;  4I2C A;  1UT8 A;  1YLQ A;  3WFP A;  4IG8 A;  7ICN A;  5IIL A;  5EWG A;  1S0M A;  1N48 A;  2BCR A;  3MDA A;  4G3I A;  4FHV A;  3MGH A;  4ECR A;  3JPS A;  2ZH3 A;  1WCN A;  4Q44 A;  1NK5 A;  2PI4 A;  4KLI A;  3PR4 A;  4YMO A;  4K4G A;  4UAY A;  4C8O A;  4KLE A;  4QZE A;  3AQN A;  5D46 A;  5KFC A;  2PI5 A;  2B21 A;  1B22 A;  3ISC A;  5DB9 A;  1CEZ A;  4RQ3 A;  4F93 B;  4DL2 A;  3SV3 A;  2F1I A;  4ECS A;  1ZQH A;  4RNO A;  3M8S A;  4UB5 A;  4GXJ A;  2J6T A;  4F5N A;  5KG7 A;  4B9U A;  4FH5 A;  4DFM A;  4I2J A;  1ZQN A;  1T7P A;  2KZ3 A;  4ED1 A;  5J2C A;  8ICN A;  7ICS A;  1D9F A;  5KFK A;  5HRF A;  2HHW A;  3MAB A;  2BPC A;  3QZ8 A;  3GIK A;  2R8G A;  1Q78 A;  3M9M B;  1T8E A;  5KTQ A;  5BPC A;  3G6X A;  5DEC A;  1KNY A;  4AT7 A;  4M6W A;  4IQV A;  4F4Y A;  2KN7 A;  3TFS A;  2AGQ A;  4KLM A;  9ICW A;  1KDH A;  3GFK B;  2PFP A;  5DQI A;  5L1J A;  4TUR A;  2W9B A;  1S10 A;  4JK1 A;  4YMN A;  3MR5 A;  3QEA Z;  2OWO A;  2RDI A;  2BHN A;  5J0O A;  4F92 B;  3PR5 B;  2JEF A;  3T5H A;  4EZ6 A;  8ICL A;  1U48 A;  4WBZ A;  2ZJA A;  4R8U B;  3RH4 A;  1D8Y A;  4QWC A;  1QSS A;  4FS2 A;  3Q8M A;  8ICS A;  5J0P A;  2C2R A;  4M0A A;  2XO7 A;  5HRK A;  4FS1 A;  2ID1 A;  7ICJ A;  4JWN A;  4YR0 A;  2ASL A;  2BR0 A;  8ICG A;  2DR9 A;  1S97 A;  4XA5 A;  3PW2 A;  1NK8 A;  4E0D A;  2VAN A;  1JIH A;  2IMW P;  1MQ3 A;  3ZDE A;  1L3U A;  5KFZ A;  3RRH A;  5HR9 A;  4ELT A;  2HHP A;  2BQ3 A;  3Q8Q B;  9ICP A;  4QZD A;  2A1J A;  2MUT A;  3OSN A;  4QZH A;  3JPP A;  1BPZ A;  4F5O A;  2PFO A;  4TQR A;  3PVX A;  3HJ1 A;  4O5E A;  4ECY A;  1ZQW A;  5J2H A;  3V7K A;  3TAR A;  1BNP A;  1NK4 A;  1SL2 A;  8ICU A;  1JMS A;  2DR8 A;  3RRG A;  5IIK A;  3H7I A;  5CR0 A;  4P4M A;  1D9D A;  8ICM A;  5KFX A;  1BVS A;  1NO5 A;  5KFW A;  5J2K A;  4UAZ A;  5DG9 A;  1LB2 B;  1BPY A;  2A1J B;  2MUT B;  7ICF A;  8ICT A;  9ICS A;  1NKC A;  5KG2 A;  1JXL A;  8ICZ A;  7ICL A;  4C8M A;  1R8A A;  3HIY A;  3ISD A;  3RJI A;  4R64 A;  4DO9 A;  2DFL A;  1U47 A;  4EBK A;  3B0Y A;  1ZQG A;  4KLQ A;  1Q79 A;  4MFA A;  4JUZ A;  5CWR A;  2R8H A;  4QWA A;  1R89 A;  5EWE A;  2V4R A;  3Q8K A;  1S0O A;  5KFB A;  9ICV A;  4BWM A;  5J0S A;  2BQU A;  2ZH7 A;  4X0A A;  4JV0 A;  5KFJ A;  5IIN A;  4E7X A;  4RQ7 A;  3OGU A;  3RH5 A;  3RB0 A;  3ZDC A;  5J2E A;  1XS9 D;  4I2A A;  8ICJ A;  4WC0 A;  2ALZ A;  4O0I A;  1ZQM A;  4C8N A;  3BQT A;  2ZJ8 A;  4RQ5 A;  4X4P A;  4KMU A;  4RQ4 A;  4ED7 A;  1JN3 A;  1ZQE A;  4O5K A;  8ICW A;  3OJS A;  2FPL A;  3PX6 A;  4X4O A;  5KFH A;  5HC9 A;  2ISP A;  1S77 D;  2M2T A;  3RBE A;  5DDY A;  1V9P A;  1Z00 A;  1MC8 A;  1FA0 A;  1D8L A;  4DQQ A;  4PHA A;  4PHP A;  4YXM A;  3RBD A;  3BQ1 A;  3SI8 A;  7ICT A;  1ZYQ A;  4M6W B;  5J2A A;  4RQ2 A;  5DG8 A;  4RQ1 A;  2V4Q A;  2R8I A;  4DL6 A;  1ZQS A;  1KRP A;  2VA2 A;  3ZDB A;  8ICE A;  3V7J A;  4X4Q A;  2DRA A;  7ICM A;  2BCV A;  4AT8 B;  1XC9 A;  5L9X A;  3TAP A;  4DSL A;  4DL7 A;  3UQ0 A;  1SZP A;  2FMQ A;  1SKR A;  4DL4 A;  2UVR A;  1ZQY A;  5DG7 A;  8ICR A;  8ICH A;  9ICG A;  4I27 A;  9ICH A;  1T4G A;  4IQT A;  1KFS A;  4QZ8 A;  4UBC A;  5C5J A;  5DB6 A;  2AGO A;  2ZHB A;  4KLG A;  1XSN A;  4KLF A;  5IIO A;  3MBY A;  4X4R A;  5J0U A;  4S3N A;  1R8B A;  1UEU A;  1XO1 A;  3GV5 B;  5EWF A;  4I28 A;  4DSF A;  3MR2 A;  8ICI A;  3OSP A;  4BGD A;  1BPD A;  3GIJ A;  3JPQ A;  2FLL A;  1TFY A;  2JEI A;  1ZQR A;  3V6K A;  4K4H A;  2XY6 A;  3OJU A;  4J9P A;  1ZQV A;  4NLZ A;  5KFV A;  1KSP A;  3SYZ A;  1RYR A;  4MF2 A;  2W9B B;  3SZ2 A;  5J0Q A;  4DOB A;  1SKW A;  1QTM A;  4BXO A;  4BWJ A;  5KFE A;  2C22 A;  1TK0 A;  5KFA A;  3JPT A;  5DKW A;  3PO4 A;  3T5L A;  2W8K A;  3THV A;  4DQS A;  1RYS A;  1HUO A;  3AQL A;  4DSE A;  4ECX A;  1Z00 B;  3UXO A;  5KT5 A;  2IBK A;  4MEY A;  3OV7 A;  4LVS A;  9ICX A;  7ICH A;  2NRX A;  3M9N B;  3MGI A;  1TVA A;  1QSY A;  2PFN A;  3Q8P B;  1L3S A;  5KFD A;  3C21 A;  1DOQ A;  5DBA A;  2R8K A;  2ZTC A;  3HP6 A;  5HNK A;  1ZQK A;  2C2D A;  1SL1 A;  2AU0 A;  3FDS A;  5KFF A;  3PMN A;  4NM2 A;  1MQ2 A;  2M9N A;  1MIV A;  5HML A;  2ZH6 A;  2WTF A;  4M04 A;  4YXJ A;  3RJJ A;  3TAN A;  4J9N A;  5KFI A;  5IIM A;  2Y1J A;  3PNC A;  3OUY B;  4YQW A;  1BPB A;  4WC7 A;  1XSL A;  4GXI A;  3OHA A;  1RXW A;  1KFT A;  2AQ0 A;  1PX5 A;  5CP2 A;  9ICT A;  5HRH A;  1B43 A;  4F4K A;  3JPN A;  1T3N A;  2NRZ A;  1XSP A;  3C1Y A;  3SV4 A;  7ICR A;  2DRB A;  4QWB A;  2NRW A;  3G6V A;  2JZB A;  1Z3E B;  5DQG A;  5DDM A;  1NJZ A;  4JWM A;  2XGP A;  2Q0Z X;  3HPO A;  3ZDD A;  5KFN A;  2ISO A;  4RWO A;  3RAX A;  4O3O A;  4ECU A;  3OHB A;  5CA7 A;  4ED0 A;  4M9L A;  5DQH A;  4ED2 A;  3RJF A;  1RZT A;  2UVU A;  4B9L A;  4DFJ A;  4UD4 A;  4EP7 A;  4B9M A;  3LQC B;  4K4I A;  5L1K A;  4PHD A;  3IM1 A;  3WFS C;  4RUC A;  3GV8 B;  2HHV A;  5DLF A;  1DK2 A;  4Q8F A;  2Q66 A;  3L9D A;  4ATB A;  1L5U A;  2KFN A;  4DLG A;  3Q8L A;  4O9M A;  3H8J A;  1NK6 A;  2HVI A;  2I9G A;  4B9S A;  3H8W A;  4Z6F A;  1S76 D;  2MAX A;  1ZET A;  3GV7 B;  2DR5 A;  4NKU A;  4P4O A;  4CCH A;  4PGY A;  4ELU A;  4R65 A;  1Y88 A;  2XY7 A;  5DB8 A;  1NJW A;  5KT6 A;  3HWT A;  3AUO A;  1ZQO A;  4O3S A;  1IM4 A;  1X9W A;  4M9H A;  7ICO A;  5DGB A;  3GIL A;  5CB1 A;  3AQK A;  3GIM A;  8ICP A;  5L1L A;  4I2F A;  4J9L A;  1NKB A;  3BDP A;  4NY8 A;  1BPE A;  1SL0 A;  2J6S A;  1JX4 A;  3UPS A;  1QSL A;  2AQ4 A;  3PY8 A;  2M2W A;  1UEV A;  4F4W A;  4Q8E A;  2ZTD A;  2M2V A;  4QZA A;  3RR8 A;  9ICK A;  1K1S A;  9ICQ A;  4ECV A;  4IRC A;  5KG4 A;  4XQ8 A;  3K75 D;  3EW9 A;  4TUQ A;  1JQR A;  3RB6 A;  1ZQP A;  2RDJ A;  4Q43 A;  1PZN A;  2ZTE A;  4Z6D A;  3T5K A;  4MEX A;  5KFG A;  4WCW A;  4EBD A;  5CHG A;  3RJH A;  2ZH2 A;  5KFS A;  4JV1 A;  3JZ0 A;  3C1Z A;  7ICI A;  4O3R A;  3FYH A;  4IQW A;  4LZG A;  4ED3 A;  3K4G A;  4GC7 A;  1KEJ A;  5L1I A;  4Z6E A;  9ICU A;  5HRL A;  5DBB A;  1ZJM A;  1ZQU A;  3PV8 A;  3RH6 A;  4DWI A;  3BQ0 A;  2KZZ A;  2FLN A;  2BGW A;  4RPY A;  1K1Q A;  3JPO A;  2KZM A;  4ELV A;  5EOZ A;  4DSK A;  5KFL A;  2XY5 A;  4XRH A;  4B9N A;  4KLS A;  1COO A;  1ZJN A;  2FLP A;  3LWL A;  2VA8 A;  4DQP A;  2HW3 A;  2HHT A;  4FHW A;  1BPX A;  4XQ7 A;  4J9Q A;  3Q8R B;  3ORY A;  3TAQ A;  2BDP A;  4F3O A;  2AJQ A;  1HJP A;  1ZQF A;  1BNO A;  4Q45 A;  4WBY A;  3RTV A;  1A76 A;  4RPX A;  3KTQ A;  2ZUB A;  2W9M A;  1S9F A;  3H8S A;  2W8L A;  1L3V A;  3UXP A;  2KFZ A;  7ICQ A;  2O1P A;  4AT9 A;  2DPJ A;  4I2E A;  1WOT A;  4WC3 A;  7ICU A;  4RQ0 A;  1NZP A;  3GII A;  4B9V A;  2ZH8 A;  4KLH A;  4FBU A;  5KFO A;  3BQ2 A;  4RQ8 A;  4EZ9 A;  3ISB A;  4DFP A;  3PW0 A;  3NYB A;  8ICK A;  4UD5 A;  2DR7 A;  2FMS A;  2PBE A;  4RNM A;  4KN4 A;  2XGQ A;  4X4U A;  1CUK A;  4UB2 A;  3WFO A;  4WC4 A;  5KFP A;  4EYH B;  5TZV A;  4UB1 A;  1MIY A;  3RB3 A;  4M47 A;  7ICE A;  5BOL A;  3TQ1 A;  3TI0 A;  5JUM A;  8ICA A;  4PHE A;  4RQ6 A;  4KTQ A;  1EXN A;  1ZQX A;  5KG3 A;  4UQG A;  4PPX A;  3H3A A;  4IRD A;  3QE9 Y;  5KFY A;  2DVI A;  8ICY A;  4O3P A;  2RFF A;  1ZQL A;  5KT4 A;  2PXI A;  3N4M B;  5KT7 A;  4YD2 A;  3LDA A;  2P6R A;  4NLG A;  9ICN A;  5HRG A;  5J0X A;  3EPG A;  3NGD A;  1ZQB A;  4YD1 A;  2HHX A;  4GC6 A;  9ICR A;  3G6Y A;  4O5C A;  4DOC A;  4DEZ A;  5J2F A;  3GDX A;  9ICC A;  2NRK A;  3H37 A;  5F2V O;  5HRB A;  4PGX A;  2FPM A;  3KHG A;  2F1H A;  3M8R A;  4NKT A;  4DF8 A;  1TV9 A;  1TAU A;  3C2L A;  4ATB B;  4I2B A;  3MR6 A;  2Y1I A;  1NKE A;  5J2G A;  4P4P A;  3ZD8 A;  2XCP A;  7ICK A;  4WC1 A;  4RZR A;  2HVH A;  4F5R A;  4YR3 A;  1KFD A;  4DS5 A;  3LK9 A;  3MFH A;  3HT3 A;  1NK9 A;  3NTU A;  5KFT A;  4J9O A;  3MDC A;  5HRE A;  3PW7 A;  2XC9 A;  1F5A A;  4B9T A;  1MIW A;  3KHR A;  4DSJ A;  4KLT A;  3Q8S B;  4RNN A;  3ZD9 A;  5HRD A;  3PX4 A;  3HX0 A;  2ATL A;  9ICJ A;  2ZUC A;  4YCX A;  5HRI A;  1TFW A;  3N97 B;  2NRT A;  4EBC A;  1NK7 A;  1C7Y A;  1JAJ A;  4M5D A;  4FHP A;  1XU4 A;  4NLK A;  4I2D A;  5KT3 A;  2PFQ A;  8ICO A;  3OVS A;  1X2I A;  1DGS A;  5J0R A;  2XCA A;  2W9C A;  4TQS A;  8ICX A;  5KG5 A;  1S0V A;  4LT6 A;  4UB3 A;  4Z6C A;  3M9O B;  3MR3 A;  9ICO A;  4O3N A;  4UBB A;  4DL3 A;  3C2M A;  3C2K A;  3UQ2 A;  4TUP A;  4EBJ A;  4YMM A;  4F91 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...