3ISCA

Binary complex of human dna polymerase beta with an abasic site (thf) in the gapped dna
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA polymerase beta substrate specificity: side chain modulation of the "A-rule".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 110
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3iscA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 3iscA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 3iscA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3iscA03
1ZQWA 1S9FA 1TV9A 1X9WA 1UETA 1V9PA 4O0IA 5KT3A 2XY5A 1R89A 1XSNA 5IIOA 4QWBA 1X2IA 1BGXT 4IQVA 4R8UB 1MC8A 3M9MB 2R8HA 5L1LA 3EZ5A 3RJIA 2J6TA 3ZDBA 3OVSA 2P6UA 4TUQA 1IXRA 2KP7A 2W9CA 4RU9A 2AQ4A 3FYHA 3JPOA 4F4KA 3T5HA 1BNPA 1MIWA 4E80A 2KZMA 4J9RA 4DF4A 5KT6A 3C1YA 2JZBB 3LDAA 3OV7A 2DVIA 3HP6A 5KT7A 4I2GA 1WCLA 1XU4A 4PGQA 4YP3A 4RWQA 4Z6DA 3MFIA 3RR8A 4O3QA 3RJFA 4I27A 4KLOA 1H38A 3GV8B 3H8SA 1EXNA 1U4BA 1NK6A 4C8OA 2P6RA 1C7YA 4TUPA 1S0VA 8ICTA 4Z6CA 2ZH1A 2BQRA 4M5DA 2NRVA 2ZUCA 5HP4A 1BPYA 5KFYA 2FLNA 8ICHA 5DBCA 2NRTA 2J6UA 5HR9A 1NK7A 5DB8A 2XY7A 4DL2A 1ZQMA 1MSWD 2WTFA 2JZBA 2KN7A 4B9SA 4KLUA 2BCVA 4F8RA 1NK8A 7ICNA 4R63A 3THVA 2ASLA 4MEXA 4YQWA 4EBKA 1ZQKA 4B9TA 4WBZA 4LT6A 4KLSA 1ZQTA 4R8UA 2XCPA 1S76D 3HT3A 4EZ6A 1MIYA 4LZDA 5D46A 5BPCA 3AU2A 1DK2A 4EBCA 4I2EA 4FO6A 5CWRA 4PPXA 4C8KA 1KTQA 1S77D 5HREA 4QWDA 3PX0A 3L9DA 2NRZA 3LWLA 2ZH5A 2HHUA 1BPDA 4FHPA 3G6XA 4Q44A 2KTQA 3RB6A 4NM1A 2ZJ8A 1ZQEA 2MAXA 3RJKA 9ICVA 1S97A 1TKDA 4RT2A 3JPTA 5HRIA 1JXLA 4X4VA 2VA2A 1UT5A 4PH5A 5BOLA 2BPFA 4O5EA 1K1QA 4UBCA 2DPIA 4BWMA 3QE9Y 4NKUA 4X4QA 1XO1A 4PHEA 1XWLA 4UAZA 4UB2A 3V6JA 4DFKA 1XS9D 5KFBA 1ZQXA 3V7LA 4B9UA 4DOAA 5HRBA 3HJ1A 1NZPA 1ZQLA 4YCXA 4O3RA 5IINA 4I2DA 2ZJ5A 3ISBA 1L3UA 4IQWA 4X4OA 5DDYA 3KHLA 3ETLA 4KMUA 2UVWA 3RRGA 3TARA 4GXJA 1MQ2A 5HRLA 3PW7A 2IMWP 3LK9A 4ELUA 3K4GA 4TUSA 4F4WA 4UD4A 1TK8A 5EWEA 2FLLA 9ICEA 1TFYA 8ICKA 3K75D 4DF8A 3Q8MA 2W9CB 1A76A 4RQ7A 4IR9A 4ECVA 4GC7A 4DOCA 4C8NA 2OWOA 4RQ1A 2PFPA 2HHQA 4WC7A 4RT3A 2W8LA 3V6HA 3M9NB 4DLGA 3ISCA 1ZJMA 2R8JA 2Q0ZX 1D8YA 2BCQA 5J2EA 2MUTB 5KFEA 3RH5A 3RJGA 2ASJA 5CB1A 5IIJA 3RBEA 2W9MA 3SV3A 1TK5A 2PFQA 5J2KA 2R8KA 4LZGA 3M8SA 3IM1A 4X4TA 3EPIA 3Q8PB 3WFOA 4YD2A 4KLMA 4YN4A 8ICXA 8ICIA 1VJ7A 8ICWA 4WC3A 4XQ8A 4X4RA 5HC9A 2BCRA 3WFRE 2PFOA 1NO5A 2C2DA 2ZHBA 5HMMA 4F5OA 7ICEA 3QZ8A 3OHBA 2FPLA 4EYIB 3MGHA 3JPQA 4KTQA 5HNKA 1NJWA 3TFRA 3TQ1A 2KFNA 3H37A 3NYBA 5HHHA 5KFMA 5KT2A 7ICHA 1L3VA 3Q8SB 5J0SA 3EYZA 3H8WA 3IHQB 1Z00A 4DS5A 7ICMA 4YXMA 4J9OA 4J9LA 4JV0A 4BXOA 3GV7B 7ICFA 1MIVA 4F4ZA 8ICSA 4AT7B 5CJ7A 4F91B 3MGIA 2AGOA 4RNMA 1JMSA 4MF2A 4O3SA 1X9SA 4IRDA 4QZFA 4Q8FA 1WOTA 5KFIA 4RUCA 3MDCA 4YMMA 4DL4A 4IRKA 3LQCB 9ICSA 5DKWA 5KFPA 3ZDDA 1K1SA 1L3TA 2UVRA 7ICIA 4ATBB 4YR3A 4PGYA 5DQHA 3BQ2A 1KLNA 4MFAA 2RFFA 4QZAA 3AQLA 4O5CA 3SV4A 1ZJNA 1ZQSA 1JN3A 1SZPA 4F5RA 3PX4A 3ZDCA 5J2HA 3PY8A 2PI5A 4XA5A 4UQGA 4WC5A 2ZH2A 4M04A 2XY6A 4NM2A 8ICVA 2XGPA 4RQ5A 4FHVA 5KFHA 1PX5A 5KFRA 8ICZA 3PO4A 2FPMA 2DR9A 4UAYA 3GILA 3KHHA 4I28A 5DG7A 2PBEA 4UB5A 1ZQCA 4HYKA 4F93B 4M47A 1NK0A 3H40A 4FBUA 4UBBA 1ZQUA 4M9GA 2AJQA 5KG2A 1XSLA 8ICAA 1RPLA 4Q43A 4C8LA 3E2EA 2O1PA 4B9MA 4PHDA 5KTQA 2ZTDA 1ZQDA 5JUMA 1WCNA 7ICRA 3ZDAA 4RNOA 8ICMA 3ORYA 3TANA 4O9MA 1S10A 2FPKA 3PMLA 4RWPA 2HHSA 5CHGA 1ZQYA 4QZ8A 3GDXA 1RXWA 4TQRA 2W9BA 3C2LA 4CCHA 4QZBA 3H4BA 2BCUA 2V4RA 5HMLA 8ICNA 4X0BA 1TFWA 1DK3A 4O3OA 1KFTA 1NJXA 2ZH4A 1UT8A 4DQIA 4AT8B 5DDMA 4I2BA 1T4GA 4M9JA 4RWNA 5KG1A 2BDPA 9ICUA 1ZQHA 4NLNA 2KZZA 3HJ4A 4UB3A 4BGDA 3RH6A 2V9WA 9ICWA 1KNYA 4M9NA 4NXZA 3H38A 3V6KA 4DSJA 1U45A 3GIJA 1RXVA 5KFXA 3ZD9A 8ICQA 4I2AA 4DOBA 1R8AA 3BDPA 4ED6A 4QZEA 2JEJA 3EWAA 4UAWA 8ICRA 2I1QA 7ICKA 5D4BA 5J0UA 4DSFA 3ISDA 4E7XA 3UQ0A 4X5VA 5KT5A 1SL1A 1A77A 3JPRA 3M9OB 3MR3A 4DSIA 9ICRA 4FHWA 7ICJA 1DOQA 4EBEA 4AT9B 1UEUA 5CA7A 4KN7A 5DQIA 9ICFA 3AQMA 4EEYA 1D8LA 4B9NA 2Y1IA 3LWMA 4EYHB 3Q8LA 1KEJA 2IBKA 5HRKA 1U49A 5DBAA 1DGSA 4QZIA 1BPXA 4YVZA 4FBTA 4Z6EA 1R8BA 4FHYA 5KG7A 4XQ7A 4NLGA 3H7IA 5J0YA 2KFZA 5DLGA 9ICPA 3MABA 2DFLA 3GIMA 2LYHA 5DG9A 2DPJA 1KFSA 4DWIA 1XC9A 5DGBA 4R64A 2HVHA 1NK5A 1LB2B 5KG6A 5KFJA 3T3FA 9ICAA 3C23A 2M2TA 4ELTA 1OU5A 5KFZA 5J2GA 2ZH9A 2M2UA 4DO9A 4I2JA 1PZNA 2C28A 4P2HA 3N4MB 1QSLA 2C22A 9ICTA 5KFSA 4XRHA 5DB9A 3HWTA 2BHNA 3C5GA 4WBYA 3JPPA 1CEZA 8ICJA 3PV8A 1KSPA 4E0DA 5F2VO 5DLFA 4DFJA 1S0MA 1ZQZA 5L1KA 4QZHA 1BNOA 1T3NA 4FHXA 4B9VA 1NOMA 4M6WA 4ECYA 5HRFA 4R66A 3EW9A 1JIHA 4EBDA 1SL2A 3RJHA 4M9LA 5KFAA 2BQ3A 9ICBA 1CUKA 2R8GA 5EWGA 3C66A 2HHXA 4MFFA 1SKRA 4Q8EA 4ECXA 5J2JA 3BQ1A 4O3NA 2XC9A 4R65A 4I2HA 4KLTA 4DL7A 5HRDA 3RB4A 4ED8A 3H3AA 2I9GA 3V7JA 1ZQNA 4K4GA 4DQSA 1N48A 2Y1JA 1NKBA 1S0NA 9ICJA 3RH4A 5D49A 8ICEA 1JAJA 3Q8KA 3RTVA 5KFFA 1Y88A 2JEGA 4M2YA 4NLZA 5KFOA 2A1JB 4DQRA 2HVIA 5J2BA 2HHWA 3HX0A 4WC0A 3KHGA 4P4OA 2XO7A 4P4PA 2ZUDA 3SZ2A 2BKEA 4YR0A 3SYZA 5C5JA 4ED1A 3PW2A 3RR7A 4DQPA 1FA0A 3OUYB 4PHAA 4KLGA 3BJYA 2DR8A 3RBDA 4YFKA 3AQNA 2H5XA 1KDHA 4UB1A 4I2IA 4RPYA 1RZTA 4X4PA 4JUZA 3QZ7A 1AROP 3B0YA 2A1JA 5KFQA 1VFGA 4UB4A 4E8FA 2ZUBA 4ED3A 3KTQA 2Q66A 5KFGA 5CR0A 3UPQA 2AQ0A 3EPGA 4KLDA 1TAUA 8ICPA 2F1JA 3JZ0A 4KLQA 1B43A 1X9MA 1SL0A 2FMPA 9ICHA 4KLLA 3NGDA 2HW3A 1ZQOA 4DS4A 4JWMA 4J9KA 4IRCA 2XGQA 5DECA 2DR7A 1ZQQA 1F5AA 1ZETA 4YG2A 2BR0A 2FLPA 3MR6A 4YXJA 1ZQVA 1BPEA 5KG4A 4YD1A 3OJUA 1TK0A 5KFVA 2ZH3A 5HRHA 3OGUA 8ICCA 4F5NA 2ZHAA 4F2RA 9ICOA 3AU6A 4DFMA 1UA0A 5KFWA 5KFDA 2NRWA 5KFCA 3UXPA 5HRGA 1TAQA 4M6WB 5DQGA 4X4NA 4NLKA 4RZRA 1RYRA 4K4IA 8ICBA 3H4DA 4ED2A 3PW5A 1T7PA 1U48A 4YMNA 2UVVA 5KFKA 4ECQA 2UVUA 2FMSA 2W8KA 4PHPA 3G6YA 2IHMA 3RJJA 4O3PA 3SI8A 3OSPA 4EZ9A 4KLHA 4WCWA 4J9MA 5J0WA 3PR5B 3OUYA 4DL6A 5J2FA 4TURA 4GXIA 1R8CA 2AGPA 4ECTA 3PVXA 1JQRA 4BWJA 3PX6A 4F92B 2BGWA 1HUZA 1Q78A 1KRPA 9ICCA 4QZDA 4DLEA 4ECSA 4QZ9A 7ICLA 3V72A 5J0OA 5J2DA 1SKSA 1ZQRA 5J2AA 5KG3A 5TZVA 5DB7A 2ATLA 4ED7A 3C2MA 2P66A 9ICLA 2M2VA 2NRKA 5L1IA 5L1JA 4KITB 3MR2A 1KFDA 4O5KA 4AT9A 3WFQE 4P4MA 2B21A 3HPOA 5J2IA 4KLEA 2HHPA 2AGQA 2ZTEA 5IILA 5J0XA 4RQ3A 4TQSA 4QWCA 4ECWA 3RJEA 2KZ3A 4I2FA 4DSEA 5L9XA 4F2SA 2RDIA 4DFPA 4KLIA 4DL5A 9ICXA 3H39A 2BQUA 3GIIA 2JEFA 3OSNA 3PO5A 7ICTA 2ISOA 4JK1A 2R8IA 3PW0A 1COOA 4DEZA 4RNNA 1BPZA 1ZQBA 8ICOA 4XUSA 5J2CA 4IQUA 4K4HA 7ICPA 4RQ0A 4UD5A 2PI4A 4I29A 9ICQA 3C1ZA 5KG5A 3RB0A 1NJZA 2DRAA 2DRBA 3HW8A 2ISPA 4X0AA 4MEYA 4RPXA 4ECZA 4AT8A 1QTMA 2JEIA 4RWOA 2BPCA 2VANA 4ED0A 4ECRA 5KG0A 4Z6FA 1QLNA 5HHIA 4LVSA 1YLQA 4QZCA 3RB3A 3GIKA 3MBYA 2RDJA 2DR5A 2W9BB 3C18A 4DSKA 2ID1A 3QEAZ 2VA8A 2M9NA 2V4QA 2NRXA 4F5QA 4MFCA 3RAXA 4IQTA 4J9PA 2ALZA 1N56A 2M2WA 5DGAA 4JV2A 8ICYA 5IIKA 3HIYA 8ICFA 9ICNA 4QWEA 1NK9A 1ZQJA 5DG8A 9ICKA 4RQ4A 1Q79A 2C2EA 1SKWA 5KFLA 5EWFA 5KFUA 4QWAA 1NKEA 3WFPA 3ZD8A 3MFHA 8ICUA 9ICGA 1D9DA 3JYYA 3Q8QB 3UQ2A 4YMOA 4B9LA 3GV5B 4RQ8A 4J9QA 4F50A 3TAQA 3MDAA 4F5PA 3RRHA 4RQ6A 3TFSA 1TVAA 3OHAA 3OVAA 4QW8A 3AUOA 1ZQAA 5F9NA 4F4YA 4WC6A 2PXIA 4M9HA 3M8RA 4ATBA 1UA1A 4GC6A 3JPSA 4DSLA 3GQCA 7ICGA 4I2CA 4J9NA 4KLFA 1ZYQA 4ECUA 3Q8RB 1B22A 5DEDA 1ZQPA 4JWNA 4X4UA 5IIIA 2BCSA 5DB6A 4C8MA 5J0TA 4FH3A 2F1IA 4IG8A 4DQQA 5KFNA 4GXKA 4NY8A 2ZH7A 3OJSA 3BQTA 1MQ3A 3B0XA 1NKCA 3UXNA 4EP7A 3JPNA 5KFTA 1RYSA 5KT4A 4WC1A 5F9LA 4J9SA 3TI0A 2O5AA 3NTUA 5DBBA 3KHRA 1JXEA 4RPZA 1L3SA 2FMQA 3T5LA 8ICLA 4RQ2A 4NKTA 5J0RA 4M0AA 3FDSA 3PR4A 3BQ0A 1HUOA 5BOMA 7ICOA 2MUTA 3T5KA 1ZQIA 1BVSA 4F4XA 4YR2A 4FS2A 3H8JA 3OVBA 1U9LA 3PW4A 5CP2A 2HHVA 2PFNA 2ZH8A 1XSPA 2AU0A 4QZGA 2IHNA 3ZDEA 3RAQA 1NK4A 4KLJA 4EBJA 4WC2A 1L5UA 3QEBZ 3WFSC 4QW9A 2W9AA 4ZH4A 2XCAA 3GFKB 2ASDA 1V4AA 7ICQA 4ELVA 3MR5A 2HHTA 5J0PA 1T8EA 5J29A 1Z3EB 4FS1A 1NJYA 3TAPA 9ICMA 5EOZA 2J6SA 3G6VA 4G3IA 3UXOA 7ICUA 4BDPA 3PMNA 1QSSA 3C21A 2C2RA 2BE3A 1TFRA 1BPBA 2VA3A 4PGXA 4AT7A 4RUAA 1S0OA 1ZQGA 4BXOB 1Z00B 4WC4A 2ZH6A 3C2KA 2F1HA 3PNCA 1JX4A 3C5FA 3AQKA 4X4SA 5J0QA 4GLXA 4MF8A 1IM4A 4DL3A 1D9FA 2ZTCA 4KN4A 2BPGA 2ZJAA 3V7KA 7ICSA 5IIMA 4IR1A 2IA6A 9ICIA 3T5JA 2GWSA 1QSYA 3UPSA 1ZQFA 4F3OA 4FH5A 1LV5A 3N97B 8ICGA 1UEVA 4JV1A 4S3NA 4Q45A 7ICVA 1U47A 1HJPA
chains in the Genus database with same CATH superfamily
4O67A 2NO4A 1V9PA 5KT3A 3UMGA 3HRDD 5L1LA 1X2IA 2P6RA 3OVSA 2E3TA 2KP7A 4TUQA 2AQ4A 3JPOA 2KZMA 5KT6A 2JZBB 3LDAA 1Q3UA 2DVIA 3HP6A 1JUDA 3I1YA 5KT7A 5AKYA 4PGQA 3MFIA 4O3QA 2IOFK 4IS7A 3GV8B 3H8SA 4EX6A 8ICTA 2ZH1A 2BQRA 5HP4A 5KFYA 1RG6A 4DL2A 3NVZA 2JZBA 5ALGA 3THVA 4B9TA 5AKKA 1S76D 4Y2RA 3HT3A 2HCFA 3WK5A 2W7PA 4FO6A 1KTQA 5HREA 3VC8A 5H2FU 4QWDA 3LWLA 2ZH5A 2HHUA 1N5WA 4NM1A 2ZJ8A 1ZQEA 3RJKA 4X4VA 1JXLA 5BOLA 4UBCA 3QE9Y 4X4QA 1XO1A 3O0FA 1XWLA 1FFUA 4DFKA 4PHEA 3V7LA 5HRBA 4BJQA 1PVRA 2IMWP 3LK9A 4TUSA 4F4WA 4UD4A 5EWEA 8ICKA 1GPJA 3Q8MA 1L8OA 4DLGA 3ISCA 4OO1J 1D8YA 2MUTB 5CB1A 1YZ7A 5J2KA 4LZGA 4NXVA 3M6KA 5CHEA 2G5IB 5EE9A 4Y2PA 4ZOHC 8ICWA 4F71A 5HC9A 2BCRA 3WFRE 2ZHBA 3OHBA 4EYIB 3MGHA 3JPQA 5HNKA 1NJWA 2KFNA 2CN1A 5KFMA 3NVOA 3RF9A 2AH5A 3IHQB 4YXMA 4J9LA 4BXOA 4JV0A 3DDHA 3GV7B 1UPHA 4O3SA 4Q8FA 5KFIA 4IRKA 3LQCB 4YMMA 9ICSA 5KFPA 2DKXA 3GZFA 1L3TA 4PL2A 4K9BA 1LVHA 4ATBB 3BQ2A 3ZDCA 2ZH2A 1ZOLA 4WC5A 4XA5A 4UQGA 2WFAA 1ZD2P 1F44A 2KSOA 4FHVA 3NVWA 1L7NA 2DR9A 3WFOA 5DG7A 2Y0SC 1ZQCA 4M9GA 3H40A 4UBBA 5AI8A 5KG2A 5ALVA 1PK3A 1XSLA 4C8LA 3QUCA 2ZTDA 1N63A 3WK8A 3UM9A 4RNOA 3ORYA 3TANA 3PMLA 2HHSA 3H8MA 4AYBF 4QZ8A 4CCHA 4QZBA 5HMLA 8ICNA 4KX3A 1DK3A 2ZH4A 2PMZF 4DQIA 1URJA 4I2BA 4I0UA 2YX8A 2BDPA 1ZQHA 2V9WA 2YMQA 9ICWA 2XI9A 4DSJA 3GIJA 1OW5A 3IDWA 3EWAA 4UAWA 4O69A 1SXDA 2JV3A 3JPRA 3NASA 3ICXA 4AT9B 1UEUA 4KN7A 2ODGA 9ICFA 3AQMA 5CFTA 1D8LA 4GFJA 3Q8LA 2IBKA 1VLBA 1DGSA 4FBTA 4Z6EA 3H7IA 2KFZA 5DLGA 3C29A 3MABA 2LYHA 4DWIA 2GH1A 5ALXA 1LB2B 5KG6A 2ZIWB 3C23A 4PJ0U 5J2GA 5EE1A 4P2HA 1QSLA 9ICTA 5J8YC 5B66U 1CEZA 1HEKA 2K4EA 3PV8A 1S0MA 2K8CB 3WKCA 5L1KA 4B9VA 1NI3A 1ZD5A 1L7MA 1CUKA 5EWGA 2KHQA 1SKRA 4Q8EA 4GIBA 2XC9A 4O68A 3RB4A 2I9GA 1ZQNA 3BS5A 3RH4A 5D49A 1JAJA 3RTVA 3F2DA 2HVIA 4ACOA 5KFOA 1PVPA 3UMBA 9ICJA 3SYZA 3OUYB 2K4IA 3NS1A 3RBDA 3AQNA 1KDHA 5E79U 3UMCA 4RPYA 1RZTA 3F5AA 3AQEA 3U26A 1WYGA 4KLDA 8ICPA 2F1JA 1X9MA 1SL0A 4Y2XA 2HW3A 4DS4A 5DECA 1F5AA 4YG2A 2FLPA 3OJUA 5KFVA 1OUQA 2ZHAA 3AU6A 5HRGA 5KFDA 2G0AA 3KKAA 4M6WB 4X4NA 4US8A 4RZRA 4K4IA 8ICBA 4XJEA 2YB4A 5KFKA 4P0QB 4PHPA 2IHMA 2LPEA 4EZ9A 4O3PA 4KLHA 4WCWA 1HIWA 1QH9A 3OUYA 1R8CA 4GXIA 2KIVA 2R18A 3KKAC 1JQRA 3SAHA 5TISU 9ICCA 4ECSA 3N7RC 7ICLA 5J2DA 5TZVA 2ATLA 3C2MA 9ICLA 2NRKA 5L1IA 3S6JA 3MR2A 4JLXA 4OAFA 5IILA 2ZTEA 4QWCA 4Y2VA 5ALNA 2KZ3A 7ICTA 1ZQBA 4XUSA 2KKVA 5J2CA 2DKZA 9ICQA 1Z1VA 5KG5A 2DRAA 2DRBA 3HW8A 2ISPA 5EE3A 1QTMA 2ZIWA 4OAIZ 2JEIA 4ED0A 2HDOA 2YY6A 4WQLA 4ECRA 5KG0A 2EAMA 2E8PA 5HHIA 4LVSA 4DSKA 1KKXA 2VA8A 4PL1A 2V4QA 2NRXA 5ALIA 4MFCA 2M2WA 2HBMA 9ICNA 2WAQC 1NK9A 5DG8A 4RQ4A 3MFHA 4J9QA 1TVAA 4RQMA 2HOFA 2P35A 4M9HA 1JROA 4GC6A 4DSLA 3VCBA 3AMZA 5AIAA 1SXEA 1ZYQA 4ECUA 3Q8RB 5DEDA 1ZQPA 1FFVA 2G5HB 5IIIA 2BCSA 5DB6A 2A1AA 5KFNA 3OJSA 3BQTA 5AKLA 1MQ3A 5AM2A 5B3PA 1YT3A 3JPNA 3M7DA 3OWGA 3RFAA 4NL9C 3TI0A 5AK6A 2FMQA 2EH9A 1IIPA 3FDSA 5A0LA 7ICOA 3T5KA 3R9KA 2KSOB 1ED1A 3H8JA 1XSPA 4KLJA 1L5UA 3WFSC 2M0NA 2W9AA 4OJOA 4ELVA 3MR5A 5J29A 1Z3EB 4FS1A 5AM4A 2W54A 9ICMA 4G3IA 3G6VA 7ICUA 2C2RA 1BPBA 2RHFA 4PGXA 2VA3A 3LVWA 4BXOB 1S0OA 4AT7A 1Z00B 2KE7A 5ALEA 4CE6A 4GLXA 4N7RA 1Z4NA 5ALFA 2K89A 2ZJAA 5IIMA 3T5JA 1QSYA 2OH2A 2F77X 3LYSA 4NL9A 3NKUA 4F3OA 4FH5A 1LV5A 3N97B 5AK4A 2K8BB 2A19A 2LYBA 1ZQWA 2WF6A 1S9FA 1TV9A 1X9WA 1COKA 1XSNA 2HOQA 4R8UB 5B5EU 2KVSA 2B6GA 1BNPA 3IG5A 4KM5A 2JR5A 3F2CA 1WCLA 5ALMA 3L3FX 2W7OA 4YP3A 3RJFA 4QIWF 2OHFA 1EXNA 1F0MA 4G9BA 4C8OA 1S0VA 5ALHA 5K4LA 2ZUCA 2FLNA 8ICHA 2J6UA 2NRTA 3KZIU 2W03A 2YQEA 1ZQMA 4F8RA 1NK8A 2HN1A 2ASLA 5AHXA 4MEXA 1ZQTA 4LZDA 1DK2A 3AU2A 4I2EA 4QIWC 2KMDA 4PPXA 4NXWA 3NWIA 1Q3VA 5HR6A 4O5EA 1T3QA 3WKDA 4UAZA 1MSWD 4OJ6A 3V6JA 1SB3C 4DOAA 3H0MB 1ZQLA 4YCXA 2D6FC 4KMUA 1MQ2A 4FE3A 3EF2A 1X9XA 1TFYA 2KJ8A 3K75D 4DF8A 2W9CB 4ECVA 4GC7A 4DOCA 2OWOA 4RQ1A 2PFPA 2Y9TA 2FCLA 4RT3A 3V6HA 3JCFA 3RH5A 5KFEA 2ASJA 2R8KA 1TK5A 3EPIA 4MHVA 5ALSA 3SMVA 4YD2A 8ICIA 4WC3A 1ZD3A 2H3ZA 4KTQA 3TQ1A 3H37A 1L3VA 3KBBA 3Q8SB 7ICMA 7ICFA 4BUGA 2E8MA 4RNMA 1JMSA 4IRDA 1RM6C 4QZFA 1WOTA 4RUCA 3MDCA 3WK9A 5DKWA 3ZDDA 7ICIA 2ZXIA 4YR3A 4PGYA 5GTIU 1KLNA 2Y0SF 3HJEA 4QZAA 3AQLA 1ZJNA 4F5RA 5KAIU 4M04A 2XY6A 2XGPA 2DWQA 1PX5A 3PO4A 2FPMA 2WHEA 1SV0A 3KHHA 3WKAA 5AICA 2AJQA 1RPLA 2EANA 4Q43A 3E2EA 4JMUA 8ICMA 4RWPA 3NRZA 1ZQYA 5ALOA 4TQRA 3BQ7A 4X0BA 3K7DA 1X66A 2MRLA 4O3OA 2NO5A 1NJXA 2KZZA 3RH6A 1KNYA 1B0XA 4KB6A 5KFXA 4DOBA 2JEJA 1RYUA 8ICRA 2KEYA 4E7XA 1SL1A 1VDVA 1C20A 9ICRA 4Y2QA 3FM9A 3SENA 1V38A 3LWMA 4EYHB 1KEJA 2ZIUB 5DBAA 4QZIA 1BPXA 4YVZA 1R8BA 2EDUA 4FHYA 4XQ7A 4NLGA 9ICPA 2RRDA 3GIMA 5DG9A 2DPJA 3SAFA 5EE0A 5DGBA 3SAGA 4ELTA 4DO9A 2WF7A 1PZNA 3N4MB 4XRHA 3C5GA 4FZMA 8ICJA 1JRPA 2GOLA 4QZHA 4HX0A 4M6WA 4ECYA 5HRFA 1MA7A 4M9LA 5KFAA 2BQ3A 2R8GA 3C66A 4JLZA 5J2JA 4O3NA 1PK1B 5HRDA 4ED8A 3V7JA 3KZXA 4K4GA 2HHWA 4WC0A 3KHGA 3DV9A 4MKPA 3PW2A 1FA0A 2BKEA 4YR0A 2WB1C 5AKZA 4DQPA 2EWRA 1KL9A 4PHAA 4KLGA 2KVCA 2E5SA 2IHOA 1JALA 4X4PA 2H3VA 4JUZA 3QZ7A 1AROP 1VFGA 2FDRA 4E8FA 1S5LU 2E1FA 4ED3A 5KFGA 3KTQA 2QLTA 3EPGA 1TAUA 1XO0A 2LM1A 4KLLA 2K4HA 4PZOA 1ZQOA 4J9KA 5G5HA 2XGQA 1ZQVA 1BPEA 5KG4A 2ZH3A 3PSIA 5HRHA 3A0HU 4F5NA 2QARB 1UA0A 3UXPA 1TAQA 5DQGA 4NLCA 5D61A 3H4DA 4NLBA 3NVYA 4HAIA 2YMPA 2W8KA 3ETRA 3RJJA 5J0WA 2ZXHA 2FE9A 4TURA 1ZXIA 2KIWA 3L4PA 4BWJA 3PX6A 2MA1A 4F92B 2BGWA 1HUZA 2JGAA 1N5XA 4CF5A 4QZDA 3MCRA 3V72A 3FC4A 5DB7A 2A3VA 2ZIXA 3PZPA 5L1JA 2LKYA 2O6KA 2G07A 5GTHU 4KITB 4AT9A 5AKXA 2K8AA 4C80A 2LM4A 2HHPA 5AM0A 1M6YA 4RQ3A 4TQSA 3RJEA 4I2FA 2RP5A 2RDIA 4DFPA 4KLIA 4K9AA 2EAPA 2BQUA 3PO5A 3KD3A 4JK1A 1COOA 8ICOA 4UASA 4K99A 4K4HA 4UD5A 1TE2A 1NJZA 1X42A 4X0AA 4MEYA 4RWOA 3K1RB 4ICAA 3M1YA 1QLNA 4QZCA 3RB3A 1YZ6A 3MBYA 3GIKA 1O08A 4F5QA 2DL0A 2ZIUA 4IQTA 2ALZA 2JH7A 5ALDA 4QWAA 5EWFA 3WFPA 3ZD8A 8ICUA 1D9DA 3Q8QB 4RQ8A 3MGVA 2B51A 3OVAA 4QW8A 1O03A 1UA1A 3F53A 1B22A 4C8MA 2F1IA 2LBOA 4IG8A 4DQQA 4O3MA 1J2MA 4GXKA 4NY8A 1CRXA 1A0PA 2ZH7A 3HILA 1NKCA 4EP7A 4EELA 1S8OA 5AM3A 2O5AA 4CRXA 5HR7A 2K60A 3TACB 8ICLA 2YMLA 4C4RA 1MN8A 3QUQA 3WK7A 2MUTA 4FS2A 3HKZC 1ZD4A 2JH1A 3PW4A 5CP2A 2ZH8A 2PFNA 1J2NA 2HBKA 3RAQA 4WC2A 3QEBZ 3GFKB 5AI0A 7ICQA 2HBLA 2BE3A 5KL8B 3C2KA 3C5FA 2G06A 2HBJA 4DL3A 2GA9D 2ZTCA 1D8BA 1SWWA 2D3DA 4CF4A 7ICSA 1F5SA 2GWSA 2LHTA 3UPSA 2Y9UA 5ALZA 3NVVA 8ICGA 2JXJA 1NK6A 5AKEA 2XY5A 1R89A 5IIOA 3M9MB 1BGXT 3PSFA 3RJIA 1MC8A 4IC9A 3ZDBA 2P6UA 4DCCA 4EX7A 1RQNA 2W9CA 4RU9A 3FYHA 1MIWA 1WUDA 3WU2U 4E80A 1L6NA 4DF4A 3C1YA 3OV7A 2F8KA 2OYYA 4EEKA 4I2GA 1XU4A 4RWQA 2OCEA 4Z6DA 3RR8A 4I27A 4WH5A 4CGZA 4KLOA 1PVQA 1U4BA 1C7YA 4TUPA 4Z6CA 2DF4B 2NRVA 2Q4TA 5DBCA 4LEVA 1NK7A 2XY7A 3H0RB 4CDGA 2W43A 4IL6U 2WTFA 4B9SA 7ICNA 4R63A 2W3RA 2ESEA 5ALPA 1ZQKA 1IV8A 4EBKA 4OAGA 2XCPA 4EZ6A 1MIYA 5D46A 3I76A 4C8KA 1S77D 5AI5A 3L9DA 1L8LA 2NRZA 1Q8KA 4FHPA 4K8VA 1Z4OA 1S97A 3JPTA 5HRIA 2EAOA 2VA2A 2BPFA 4BWMA 4UB2A 1ZQXA 1NZPA 4O3RA 5IINA 4I2DA 2ZJ5A 1L3UA 4X4OA 5DDYA 3ETLA 2KG5A 4GXJA 5HRLA 3PW7A 1TK8A 2MSNA 2FLLA 1A76A 3NRWA 4QJFB 4IR9A 3WKEA 3IP4B 4BX9C 2R8JA 1ZJMA 2Q0ZX 4M9NA 5J2EA 8ICSA 3F2BA 4UAVA 3RBEA 2W9MA 4C7YA 3M8SA 3IM1A 4X4TA 1NZBA 8ICXA 4YN4A 4XQ8A 4OJ5A 3QU9A 1N2XA 2PMZC 5AKGA 3TFRA 7ICHA 3EYZA 5J0SA 3H8WA 1Z00A 3D6JA 4AT7B 1MIVA 4F4ZA 3ZI4A 4F91B 3MGIA 1L7OA 1X9SA 4DL4A 2N1RA 2UVRA 1T94A 2RFFA 4O5CA 1SZPA 3PX4A 3PY8A 2QKQA 1X6IA 2KD1A 1QQ5A 4NM2A 4RQ5A 5KFHA 8ICZA 4UAYA 3GILA 4UB5A 4HYKA 9ICGA 1NK0A 1LKYB 8ICAA 1ZQUA 2O1PA 4PHDA 5KTQA 7ICRA 3ZDAA 3BZKA 5AIBA 2KICA 2D8CA 1S10A 2W9BA 3C2LA 3H4BA 1KBUA 4Y2YA 3SQIA 3QU4A 1TFWA 4LJXA 4EEDA 1KFTA 1UT8A 1UQVA 4M9JA 1T4GA 4RWNA 1SV0C 5KG1A 9ICUA 2GAFD 1V97A 3H38A 2G08A 1U45A 3C28A 1RXVA 3ZD9A 4I2AA 4ED6A 4QZEA 5AM5A 7ICKA 2XVTA 3CW2C 5D4BA 5J0UA 3FAHA 4DSFA 1K5OA 3ISDA 5AKHA 5KT5A 1A77A 4C0ZA 2IOHA 3L5KA 5AK3A 1DOQA 1WWVA 4O6AA 2KJ9A 4B9NA 2RQ5A 2Y1IA 5HRKA 2EZYA 2JRZA 5KG7A 5J0YA 1PUZA 4R64A 2HVHA 2E1EA 3D2SA 9ICAA 3QUBA 3PSTA 5KFJA 4J03A 5KFZA 2ZH9A 4I2JA 2C28A 4AYBC 2C22A 3OPXA 4Y2JA 5KFSA 3HWTA 4NV0A 4WBYA 5D62A 1KSPA 4E0DA 5F2VO 1ZQZA 3B9JA 5ALJA 1T3NA 4FHXA 1NOMA 1ZRNA 4R66A 2QARA 1JIHA 3EW9A 3IG8A 4EBDA 1SL2A 4C4TA 2ZIVB 4DFDA 3NUQA 4MFFA 4ECXA 3BQ1A 4I2HA 4DQSA 1N48A 2Y1JA 1NKBA 1S0NA 1X40A 8ICEA 4CF3A 4P0PB 5KFFA 4DQRA 2A1JB 1Q46A 1V85A 4P4OA 3IV6A 4ED1A 5C5JA 2DBYA 2DR8A 3BJYA 4U7CA 4FO1A 4YFKA 5JRTA 2H5XA 4UB1A 4I2IA 2EZXA 4LEWA 3B0YA 4A8EA 3DEEA 2Q66A 3UPQA 2AQ0A 2W55A 2F76X 4NXTA 4NXXA 2FMPA 9ICHA 2Z7JA 4KX5A 4IRCA 1ZETA 2KKPA 2LMRA 4NWIA 4YXJA 3MR6A 1TK0A 3AL0B 1SZHA 2MU2A 8ICCA 4F2RA 2CPRA 4JB3A 5KFCA 2KJ5A 4NLKA 5AK5A 4ED2A 3PW5A 1T7PA 3G6YA 4J9MA 3PR5B 5J2FA 2AGPA 3PVXA 2WAQF 1Q78A 1KRPA 4P0PA 2H3FA 3I28A 2NV3A 4QZ9A 1N60A 3BS5B 2EQYA 3C18A 4ED7A 2P66A 3H0LB 4UB6U 3QUTA 1KFDA 4O5KA 2CXYA 3WFQE 4P4MA 3HPOA 5J2IA 2ZIVA 4OD0A 5J0XA 4DSEA 3WKBA 9ICXA 4DL5A 3H39A 3GIIA 2JEFA 3OSNA 2ISOA 2R8IA 4DEZA 4RNNA 1BPZA 4NJ8A 7ICPA 5D63A 2PI4A 4I29A 3C1ZA 3RB0A 4USAA 1WG8A 4RPXA 4ECZA 4AT8A 2VANA 3OTQA 4Z6FA 3PSPA 2DR5A 3QEAZ 4K96A 4J9PA 1N56A 5DGAA 2QB0A 4JV2A 8ICYA 5IIKA 8ICFA 4QWEA 9ICKA 5KFLA 5KFUA 1NKEA 2I5HA 1ZRMA 3N7SC 4YMOA 4B9LA 3GV5B 3E0FA 5AI6A 4K98A 5L1MA 3MDAA 4F5PA 3RRHA 3TFSA 1Z19A 1ZQAA 5F9NA 4F4YA 4WC6A 1VJ5A 2HI0A 2IUBA 3M8RA 3AQFA 4OAHA 2HMXA 4WQKA 3JPSA 1QCKA 7ICGA 2DQNB 4KLFA 4JWNA 4X4UA 4FH3A 2I6XA 5JTIA 1CI4A 2KOBA 2KNJA 1RYSA 5KFTA 5F9LA 1LKYA 4RPZA 1L3SA 3T5LA 4RQ2A 4NKTA 4NXUA 1RQLA 4K97A 5J0RA 3BQ0A 5BOMA 2QB1A 2HHVA 4C7ZA 2AU0A 4QZGA 2IHNA 1FIQA 4EBJA 2VJ5A 1SIJA 4QW9A 4ZH4A 1V4AA 5C0YA 1N62A 3TAPA 5EOZA 3UXOA 3SEIA 1QSSA 2BDUA 3WK4A 2HOIA 3PNCA 2H3QA 1JX4A 4X4SA 2F3NA 1IM4A 1D9FA 3T79A 3IN5A 3V7KA 2YB1A 2YMMA 4IR1A 9ICIA 3CNHA 2DUYA 1UHUA 3ED5A 4JV1A 4Q45A 1IG6A 1KN5A 1HJPA 1UETA 3D2NA 4O0IA 5CEHA 4QWBA 1Z1BA 4EGWA 4IQVA 3TADC 2R8HA 2J6TA 3EZ5A 1IXRA 2LYAA 4F4KA 3T5HA 4J9RA 1ZQ1C 4CNQA 1H38A 1DRGA 2B0CA 3N28A 4UB8U 5ALLA 2H3IA 4M5DA 5ALQA 1BPYA 3N7PD 5HR9A 4RQNA 5DB8A 2E8NA 4KLUA 2KN7A 2AHOB 4PZNA 2BCVA 3K1ZA 4YQWA 1JI7A 5B3QA 4LT6A 4KLSA 4Y2UA 3M6ZA 5CFUA 4R8UA 2JMGA 2LI6A 5BPCA 4EBCA 2AXTU 5T14A 5CWRA 2JHDA 3PX0A 3HKZF 3WK6A 2CRXA 1BPDA 3G6XA 4Q44A 2KTQA 3RB6A 2MAXA 4Y2TA 9ICVA 1TKDA 3QU7A 4RT2A 1UT5A 4PH5A 1K1QA 2VIXA 2DPIA 4EEBA 4QNLA 1XS9D 5KFBA 4B9UA 3HJ1A 4NKUA 2K4PA 3ISBA 4IQWA 3KHLA 2UVWA 3RRGA 1N61A 3TARA 2NYVA 3ERCC 4ELUA 3K4GA 9ICEA 3KFUF 2F8LA 4RQ7A 3LVVA 4C8NA 5JU5A 2HHQA 4B6JA 4WC7A 2W8LA 1ECWA 3M9NB 3RJGA 2BCQA 3OVBA 5IIJA 2L5YA 5F3XB 3SV3A 2PFQA 2F2AB 3TADA 5AI4A 3Q8PB 4OJLA 4KLMA 1VJ7A 4X4RA 2EZZA 3QU5A 2PFOA 5KNIA 2C2DA 5HMMA 4F5OA 7ICEA 3QZ8A 1NO5A 2FPLA 2DGZA 3NYBA 5HHHA 5KT2A 4DS5A 1AQ6A 4J9OA 5CJ7A 2AGOA 4MF2A 4EV6A 1L7PA 4UW9A 2WF5A 1K1SA 5DQHA 5AKIA 4MFAA 2W11A 5AI9A 2B56A 3ONNA 3SV4A 1ZQSA 1JN3A 5J2HA 2PI5A 2HSZA 5AM1A 8ICVA 3AM9A 5KFRA 4F72A 4I28A 2PBEA 4M47A 3GU3A 3QYPA 4FZLA 4F93B 4FBUA 4WBZA 4B9MA 1ZQDA 5JUMA 1WCNA 2QB0B 4O9MA 3MC1A 2FPKA 2OM6A 5CHGA 3GDXA 1RXWA 2BCUA 2V4RA 2BBHA 2VJ4A 2F44A 4AT8B 5DDMA 3HJ4A 4NLNA 4FFDA 4UB3A 4BGDA 4NXZA 1OXJA 3V6KA 8ICQA 1R8AA 3BDPA 2VKQA 2I1QA 3QX7A 3UQ0A 4X5VA 2KK0A 3M9OB 3MR3A 4DSIA 4FHWA 4WOYA 7ICJA 1GO3F 4EBEA 2W3SA 1KQQA 5CA7A 5DQIA 1SV4A 4EEYA 2WB1F 1U49A 4U6PA 3CRXA 3PHZA 5ALUA 2DFLA 1KFSA 4UAUA 1XC9A 1NK5A 2M2TA 3T3FA 1OU5A 3IRUA 2M2UA 2GO7A 5DB9A 2BHNA 4P0QA 3JPPA 1RDFA 5DLFA 4DFJA 1B4FA 1BNOA 3BS7A 3BZCA 4LEYA 3SD7A 3RJHA 9ICBA 4UATA 2HHXA 4KLTA 4R65A 1WWUA 4DL7A 2ZIXB 3H3AA 4FZNA 2ES6A 3SR6A 2GLEA 2W04A 3Q8KA 4NLZA 1Y88A 3QU2A 2JEGA 4M2YA 3TKAA 2B4VA 5J2BA 3HX0A 3KOOA 2XO7A 2IOFA 4P4PA 2ZUDA 3SZ2A 3RR7A 2E8OA 5JTGA 5J8YA 2OXOA 5KFQA 2A1JA 1SWVA 4UB4A 2ZUBA 2BBJA 5CR0A 3JZ0A 4KLQA 2YN4A 2BZFA 1B43A 1SGGA 4LEZA 3NGDA 4JWMA 5KL1B 2DR7A 1ZQQA 2BR0A 4YD1A 3OGUA 9ICOA 4DFMA 5KFWA 2NRWA 3ALRA 4WJ3B 1RYRA 1U48A 4YMNA 2UVVA 4ECQA 3ER9B 2UVUA 2FMSA 3SI8A 3OSPA 4DL6A 1A6SA 3D2QA 4ECTA 5G5GA 1P7DA 4DLEA 4Y2SA 5J0OA 2HN2A 4AP9A 2WF8A 1SKSA 1ZQRA 5J2AA 5KG3A 2XICA 3QNMA 2M2VA 1PK1A 4UARA 2B21A 4KLEA 2AGQA 4ECWA 5ALTA 5L9XA 4F2SA 3AEVA 1FO4A 1KW4A 3PW0A 3CYMA 4IQUA 3EUB2 4RQ0A 2BPCA 5ALYA 4KMOB 4EENA 1YLQA 3CK6A 5AKJA 2YTUA 2W9BB 2RDJA 1QQ6A 2ID1A 2M9NA 3RAXA 2FJ6A 3ER8C 5ALRA 3HIYA 1Q79A 1ZQJA 2C2EA 1SKWA 3F5EA 1X6JA 2PKEA 3JYYA 3UQ2A 2OEHA 5ALKA 4F50A 3TAQA 4RQ6A 3OHAA 3AUOA 1NNLA 2RLTA 2PXIA 2ZG6A 1XNSA 4ATBA 1FEZA 3GQCA 4I2CA 4J9NA 3AN1A 2KHVA 5J0TA 4OJPA 2G09A 5FP0A 1J97A 3B0XA 2WF9A 3UXNA 1TAMA 1DGJA 5CFSA 2FI1A 1UCVA 5KT4A 4WC1A 4J9SA 3A0BU 3NTUA 5DBBA 1JXEA 3KHRA 4M0AA 3PR4A 1HUOA 3CP8A 1ZQIA 5CRXA 1BVSA 4F4XA 4YR2A 1U9LA 3ZDEA 1NK4A 2ASDA 2XCAA 4US9A 2HHTA 5J0PA 1T8EA 1NJYA 2J6SA 5ALWA 4BDPA 3PMNA 3C21A 1TFRA 4RUAA 4C4SA 1ZQGA 2KV2A 4WC4A 2ZH6A 1DXSA 2F1HA 3J81j 3AQKA 5KAFU 5J0QA 4MF8A 3QXGA 4KN4A 2BPGA 3E58A 2IA6A 1QQ7A 1ZQFA 1UEVA 2XIDA 4S3NA 4OCZA 7ICVA 1U47A
chains in the Genus database with same CATH topology
1ZQWA 1S9FA 1TV9A 1X9WA 1UETA 1V9PA 4O0IA 5KT3A 2XY5A 1R89A 1XSNA 5IIOA 4QWBA 1X2IA 1BGXT 4IQVA 4R8UB 1MC8A 3M9MB 2R8HA 5L1LA 3EZ5A 3RJIA 2J6TA 3ZDBA 3OVSA 2P6UA 4TUQA 1IXRA 2KP7A 2W9CA 4RU9A 2AQ4A 3FYHA 3JPOA 4F4KA 3T5HA 1BNPA 1MIWA 4E80A 2KZMA 4J9RA 4DF4A 5KT6A 3C1YA 2JZBB 3LDAA 3OV7A 2DVIA 3HP6A 5KT7A 4I2GA 1WCLA 1XU4A 4PGQA 4YP3A 4RWQA 4Z6DA 3MFIA 3RR8A 4O3QA 3RJFA 4I27A 4KLOA 1H38A 3GV8B 3H8SA 1EXNA 1U4BA 1NK6A 4C8OA 2P6RA 1C7YA 4TUPA 1S0VA 8ICTA 4Z6CA 2ZH1A 2BQRA 4M5DA 2NRVA 2ZUCA 5HP4A 1BPYA 5KFYA 2FLNA 8ICHA 5DBCA 2NRTA 2J6UA 5HR9A 1NK7A 5DB8A 2XY7A 4DL2A 1ZQMA 1MSWD 2WTFA 2JZBA 2KN7A 4B9SA 4KLUA 2BCVA 4F8RA 1NK8A 7ICNA 4R63A 3THVA 2ASLA 4MEXA 4YQWA 4EBKA 1ZQKA 4B9TA 4WBZA 4LT6A 4KLSA 1ZQTA 4R8UA 2XCPA 1S76D 3HT3A 4EZ6A 1MIYA 4LZDA 5D46A 5BPCA 3AU2A 1DK2A 4EBCA 4I2EA 4FO6A 5CWRA 4PPXA 4C8KA 1KTQA 1S77D 5HREA 4QWDA 3PX0A 3L9DA 2NRZA 3LWLA 2ZH5A 2HHUA 1BPDA 4FHPA 3G6XA 4Q44A 2KTQA 3RB6A 4NM1A 2ZJ8A 1ZQEA 2MAXA 3RJKA 9ICVA 1S97A 1TKDA 4RT2A 3JPTA 5HRIA 1JXLA 4X4VA 2VA2A 1UT5A 4PH5A 5BOLA 2BPFA 4O5EA 1K1QA 4UBCA 2DPIA 4BWMA 3QE9Y 4NKUA 4X4QA 1XO1A 4PHEA 1XWLA 4UAZA 4UB2A 3V6JA 4DFKA 1XS9D 5KFBA 1ZQXA 3V7LA 4B9UA 4DOAA 5HRBA 3HJ1A 1NZPA 1ZQLA 4YCXA 4O3RA 5IINA 4I2DA 2ZJ5A 3ISBA 1L3UA 4IQWA 4X4OA 5DDYA 3KHLA 3ETLA 4KMUA 2UVWA 3RRGA 3TARA 4GXJA 1MQ2A 5HRLA 3PW7A 2IMWP 3LK9A 4ELUA 3K4GA 4TUSA 4F4WA 4UD4A 1TK8A 5EWEA 2FLLA 9ICEA 1TFYA 8ICKA 3K75D 4DF8A 3Q8MA 2W9CB 1A76A 4RQ7A 4IR9A 4ECVA 4GC7A 4DOCA 4C8NA 2OWOA 4RQ1A 2PFPA 2HHQA 4WC7A 4RT3A 2W8LA 3V6HA 3M9NB 4DLGA 3ISCA 1ZJMA 2R8JA 2Q0ZX 1D8YA 2BCQA 5J2EA 2MUTB 5KFEA 3RH5A 3RJGA 2ASJA 5CB1A 5IIJA 3RBEA 2W9MA 3SV3A 1TK5A 2PFQA 5J2KA 2R8KA 4LZGA 3M8SA 3IM1A 4X4TA 3EPIA 3Q8PB 3WFOA 4YD2A 4KLMA 4YN4A 8ICXA 8ICIA 1VJ7A 8ICWA 4WC3A 4XQ8A 4X4RA 5HC9A 2BCRA 3WFRE 2PFOA 1NO5A 2C2DA 2ZHBA 5HMMA 4F5OA 7ICEA 3QZ8A 3OHBA 2FPLA 4EYIB 3MGHA 3JPQA 4KTQA 5HNKA 1NJWA 3TFRA 3TQ1A 2KFNA 3H37A 3NYBA 5HHHA 5KFMA 5KT2A 7ICHA 1L3VA 3Q8SB 5J0SA 3EYZA 3H8WA 3IHQB 1Z00A 4DS5A 7ICMA 4YXMA 4J9OA 4J9LA 4JV0A 4BXOA 3GV7B 7ICFA 1MIVA 4F4ZA 8ICSA 4AT7B 5CJ7A 4F91B 3MGIA 2AGOA 4RNMA 1JMSA 4MF2A 4O3SA 1X9SA 4IRDA 4QZFA 4Q8FA 1WOTA 5KFIA 4RUCA 3MDCA 4YMMA 4DL4A 4IRKA 3LQCB 9ICSA 5DKWA 5KFPA 3ZDDA 1K1SA 1L3TA 2UVRA 7ICIA 4ATBB 4YR3A 4PGYA 5DQHA 3BQ2A 1KLNA 4MFAA 2RFFA 4QZAA 3AQLA 4O5CA 3SV4A 1ZJNA 1ZQSA 1JN3A 1SZPA 4F5RA 3PX4A 3ZDCA 5J2HA 3PY8A 2PI5A 4XA5A 4UQGA 4WC5A 2ZH2A 4M04A 2XY6A 4NM2A 8ICVA 2XGPA 4RQ5A 4FHVA 5KFHA 1PX5A 5KFRA 8ICZA 3PO4A 2FPMA 2DR9A 4UAYA 3GILA 3KHHA 4I28A 5DG7A 2PBEA 4UB5A 1ZQCA 4HYKA 4F93B 4M47A 1NK0A 3H40A 4FBUA 4UBBA 1ZQUA 4M9GA 2AJQA 5KG2A 1XSLA 8ICAA 1RPLA 4Q43A 4C8LA 3E2EA 2O1PA 4B9MA 4PHDA 5KTQA 2ZTDA 1ZQDA 5JUMA 1WCNA 7ICRA 3ZDAA 4RNOA 8ICMA 3ORYA 3TANA 4O9MA 1S10A 2FPKA 3PMLA 4RWPA 2HHSA 5CHGA 1ZQYA 4QZ8A 3GDXA 1RXWA 4TQRA 2W9BA 3C2LA 4CCHA 4QZBA 3H4BA 2BCUA 2V4RA 5HMLA 8ICNA 4X0BA 1TFWA 1DK3A 4O3OA 1KFTA 1NJXA 2ZH4A 1UT8A 4DQIA 4AT8B 5DDMA 4I2BA 1T4GA 4M9JA 4RWNA 5KG1A 2BDPA 9ICUA 1ZQHA 4NLNA 2KZZA 3HJ4A 4UB3A 4BGDA 3RH6A 2V9WA 9ICWA 1KNYA 4M9NA 4NXZA 3H38A 3V6KA 4DSJA 1U45A 3GIJA 1RXVA 5KFXA 3ZD9A 8ICQA 4I2AA 4DOBA 1R8AA 3BDPA 4ED6A 4QZEA 2JEJA 3EWAA 4UAWA 8ICRA 2I1QA 7ICKA 5D4BA 5J0UA 4DSFA 3ISDA 4E7XA 3UQ0A 4X5VA 5KT5A 1SL1A 1A77A 3JPRA 3M9OB 3MR3A 4DSIA 9ICRA 4FHWA 7ICJA 1DOQA 4EBEA 4AT9B 1UEUA 5CA7A 4KN7A 5DQIA 9ICFA 3AQMA 4EEYA 1D8LA 4B9NA 2Y1IA 3LWMA 4EYHB 3Q8LA 1KEJA 2IBKA 5HRKA 1U49A 5DBAA 1DGSA 4QZIA 1BPXA 4YVZA 4FBTA 4Z6EA 1R8BA 4FHYA 5KG7A 4XQ7A 4NLGA 3H7IA 5J0YA 2KFZA 5DLGA 9ICPA 3MABA 2DFLA 3GIMA 2LYHA 5DG9A 2DPJA 1KFSA 4DWIA 1XC9A 5DGBA 4R64A 2HVHA 1NK5A 1LB2B 5KG6A 5KFJA 3T3FA 9ICAA 3C23A 2M2TA 4ELTA 1OU5A 5KFZA 5J2GA 2ZH9A 2M2UA 4DO9A 4I2JA 1PZNA 2C28A 4P2HA 3N4MB 1QSLA 2C22A 9ICTA 5KFSA 4XRHA 5DB9A 3HWTA 2BHNA 3C5GA 4WBYA 3JPPA 1CEZA 8ICJA 3PV8A 1KSPA 4E0DA 5F2VO 5DLFA 4DFJA 1S0MA 1ZQZA 5L1KA 4QZHA 1BNOA 1T3NA 4FHXA 4B9VA 1NOMA 4M6WA 4ECYA 5HRFA 4R66A 3EW9A 1JIHA 4EBDA 1SL2A 3RJHA 4M9LA 5KFAA 2BQ3A 9ICBA 1CUKA 2R8GA 5EWGA 3C66A 2HHXA 4MFFA 1SKRA 4Q8EA 4ECXA 5J2JA 3BQ1A 4O3NA 2XC9A 4R65A 4I2HA 4KLTA 4DL7A 5HRDA 3RB4A 4ED8A 3H3AA 2I9GA 3V7JA 1ZQNA 4K4GA 4DQSA 1N48A 2Y1JA 1NKBA 1S0NA 9ICJA 3RH4A 5D49A 8ICEA 1JAJA 3Q8KA 3RTVA 5KFFA 1Y88A 2JEGA 4M2YA 4NLZA 5KFOA 2A1JB 4DQRA 2HVIA 5J2BA 2HHWA 3HX0A 4WC0A 3KHGA 4P4OA 2XO7A 4P4PA 2ZUDA 3SZ2A 2BKEA 4YR0A 3SYZA 5C5JA 4ED1A 3PW2A 3RR7A 4DQPA 1FA0A 3OUYB 4PHAA 4KLGA 3BJYA 2DR8A 3RBDA 4YFKA 3AQNA 2H5XA 1KDHA 4UB1A 4I2IA 4RPYA 1RZTA 4X4PA 4JUZA 3QZ7A 1AROP 3B0YA 2A1JA 5KFQA 1VFGA 4UB4A 4E8FA 2ZUBA 4ED3A 3KTQA 2Q66A 5KFGA 5CR0A 3UPQA 2AQ0A 3EPGA 4KLDA 1TAUA 8ICPA 2F1JA 3JZ0A 4KLQA 1B43A 1X9MA 1SL0A 2FMPA 9ICHA 4KLLA 3NGDA 2HW3A 1ZQOA 4DS4A 4JWMA 4J9KA 4IRCA 2XGQA 5DECA 2DR7A 1ZQQA 1F5AA 1ZETA 4YG2A 2BR0A 2FLPA 3MR6A 4YXJA 1ZQVA 1BPEA 5KG4A 4YD1A 3OJUA 1TK0A 5KFVA 2ZH3A 5HRHA 3OGUA 8ICCA 4F5NA 2ZHAA 4F2RA 9ICOA 3AU6A 4DFMA 1UA0A 5KFWA 5KFDA 2NRWA 5KFCA 3UXPA 5HRGA 1TAQA 4M6WB 5DQGA 4X4NA 4NLKA 4RZRA 1RYRA 4K4IA 8ICBA 3H4DA 4ED2A 3PW5A 1T7PA 1U48A 4YMNA 2UVVA 5KFKA 4ECQA 2UVUA 2FMSA 2W8KA 4PHPA 3G6YA 2IHMA 3RJJA 4O3PA 3SI8A 3OSPA 4EZ9A 4KLHA 4WCWA 4J9MA 5J0WA 3PR5B 3OUYA 4DL6A 5J2FA 4TURA 4GXIA 1R8CA 2AGPA 4ECTA 3PVXA 1JQRA 4BWJA 3PX6A 4F92B 2BGWA 1HUZA 1Q78A 1KRPA 9ICCA 4QZDA 4DLEA 4ECSA 4QZ9A 7ICLA 3V72A 5J0OA 5J2DA 1SKSA 1ZQRA 5J2AA 5KG3A 5TZVA 5DB7A 2ATLA 4ED7A 3C2MA 2P66A 9ICLA 2M2VA 2NRKA 5L1IA 5L1JA 4KITB 3MR2A 1KFDA 4O5KA 4AT9A 3WFQE 4P4MA 2B21A 3HPOA 5J2IA 4KLEA 2HHPA 2AGQA 2ZTEA 5IILA 5J0XA 4RQ3A 4TQSA 4QWCA 4ECWA 3RJEA 2KZ3A 4I2FA 4DSEA 5L9XA 4F2SA 2RDIA 4DFPA 4KLIA 4DL5A 9ICXA 3H39A 2BQUA 3GIIA 2JEFA 3OSNA 3PO5A 7ICTA 2ISOA 4JK1A 2R8IA 3PW0A 1COOA 4DEZA 4RNNA 1BPZA 1ZQBA 8ICOA 4XUSA 5J2CA 4IQUA 4K4HA 7ICPA 4RQ0A 4UD5A 2PI4A 4I29A 9ICQA 3C1ZA 5KG5A 3RB0A 1NJZA 2DRAA 2DRBA 3HW8A 2ISPA 4X0AA 4MEYA 4RPXA 4ECZA 4AT8A 1QTMA 2JEIA 4RWOA 2BPCA 2VANA 4ED0A 4ECRA 5KG0A 4Z6FA 1QLNA 5HHIA 4LVSA 1YLQA 4QZCA 3RB3A 3GIKA 3MBYA 2RDJA 2DR5A 2W9BB 3C18A 4DSKA 2ID1A 3QEAZ 2VA8A 2M9NA 2V4QA 2NRXA 4F5QA 4MFCA 3RAXA 4IQTA 4J9PA 2ALZA 1N56A 2M2WA 5DGAA 4JV2A 8ICYA 5IIKA 3HIYA 8ICFA 9ICNA 4QWEA 1NK9A 1ZQJA 5DG8A 9ICKA 4RQ4A 1Q79A 2C2EA 1SKWA 5KFLA 5EWFA 5KFUA 4QWAA 1NKEA 3WFPA 3ZD8A 3MFHA 8ICUA 9ICGA 1D9DA 3JYYA 3Q8QB 3UQ2A 4YMOA 4B9LA 3GV5B 4RQ8A 4J9QA 4F50A 3TAQA 3MDAA 4F5PA 3RRHA 4RQ6A 3TFSA 1TVAA 3OHAA 3OVAA 4QW8A 3AUOA 1ZQAA 5F9NA 4F4YA 4WC6A 2PXIA 4M9HA 3M8RA 4ATBA 1UA1A 4GC6A 3JPSA 4DSLA 3GQCA 7ICGA 4I2CA 4J9NA 4KLFA 1ZYQA 4ECUA 3Q8RB 1B22A 5DEDA 1ZQPA 4JWNA 4X4UA 5IIIA 2BCSA 5DB6A 4C8MA 5J0TA 4FH3A 2F1IA 4IG8A 4DQQA 5KFNA 4GXKA 4NY8A 2ZH7A 3OJSA 3BQTA 1MQ3A 3B0XA 1NKCA 3UXNA 4EP7A 3JPNA 5KFTA 1RYSA 5KT4A 4WC1A 5F9LA 4J9SA 3TI0A 2O5AA 3NTUA 5DBBA 3KHRA 1JXEA 4RPZA 1L3SA 2FMQA 3T5LA 8ICLA 4RQ2A 4NKTA 5J0RA 4M0AA 3FDSA 3PR4A 3BQ0A 1HUOA 5BOMA 7ICOA 2MUTA 3T5KA 1ZQIA 1BVSA 4F4XA 4YR2A 4FS2A 3H8JA 3OVBA 1U9LA 3PW4A 5CP2A 2HHVA 2PFNA 2ZH8A 1XSPA 2AU0A 4QZGA 2IHNA 3ZDEA 3RAQA 1NK4A 4KLJA 4EBJA 4WC2A 1L5UA 3QEBZ 3WFSC 4QW9A 2W9AA 4ZH4A 2XCAA 3GFKB 2ASDA 1V4AA 7ICQA 4ELVA 3MR5A 2HHTA 5J0PA 1T8EA 5J29A 1Z3EB 4FS1A 1NJYA 3TAPA 9ICMA 5EOZA 2J6SA 3G6VA 4G3IA 3UXOA 7ICUA 4BDPA 3PMNA 1QSSA 3C21A 2C2RA 2BE3A 1TFRA 1BPBA 2VA3A 4PGXA 4AT7A 4RUAA 1S0OA 1ZQGA 4BXOB 1Z00B 4WC4A 2ZH6A 3C2KA 2F1HA 3PNCA 1JX4A 3C5FA 3AQKA 4X4SA 5J0QA 4GLXA 4MF8A 1IM4A 4DL3A 1D9FA 2ZTCA 4KN4A 2BPGA 2ZJAA 3V7KA 7ICSA 5IIMA 4IR1A 2IA6A 9ICIA 3T5JA 2GWSA 1QSYA 3UPSA 1ZQFA 4F3OA 4FH5A 1LV5A 3N97B 8ICGA 1UEVA 4JV1A 4S3NA 4Q45A 7ICVA 1U47A 1HJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQW A;  1S9F A;  1TV9 A;  1X9W A;  1UET A;  1V9P A;  4O0I A;  5KT3 A;  2XY5 A;  1R89 A;  1XSN A;  5IIO A;  4QWB A;  1X2I A;  1BGX T;  4IQV A;  4R8U B;  1MC8 A;  3M9M B;  2R8H A;  5L1L A;  3EZ5 A;  3RJI A;  2J6T A;  3ZDB A;  3OVS A;  2P6U A;  4TUQ A;  1IXR A;  2KP7 A;  2W9C A;  4RU9 A;  2AQ4 A;  3FYH A;  3JPO A;  4F4K A;  3T5H A;  1BNP A;  1MIW A;  4E80 A;  2KZM A;  4J9R A;  4DF4 A;  5KT6 A;  3C1Y A;  2JZB B;  3LDA A;  3OV7 A;  2DVI A;  3HP6 A;  5KT7 A;  4I2G A;  1WCL A;  1XU4 A;  4PGQ A;  4YP3 A;  4RWQ A;  4Z6D A;  3MFI A;  3RR8 A;  4O3Q A;  3RJF A;  4I27 A;  4KLO A;  1H38 A;  3GV8 B;  3H8S A;  1EXN A;  1U4B A;  1NK6 A;  4C8O A;  2P6R A;  1C7Y A;  4TUP A;  1S0V A;  8ICT A;  4Z6C A;  2ZH1 A;  2BQR A;  4M5D A;  2NRV A;  2ZUC A;  5HP4 A;  1BPY A;  5KFY A;  2FLN A;  8ICH A;  5DBC A;  2NRT A;  2J6U A;  5HR9 A;  1NK7 A;  5DB8 A;  2XY7 A;  4DL2 A;  1ZQM A;  1MSW D;  2WTF A;  2JZB A;  2KN7 A;  4B9S A;  4KLU A;  2BCV A;  4F8R A;  1NK8 A;  7ICN A;  4R63 A;  3THV A;  2ASL A;  4MEX A;  4YQW A;  4EBK A;  1ZQK A;  4B9T A;  4WBZ A;  4LT6 A;  4KLS A;  1ZQT A;  4R8U A;  2XCP A;  1S76 D;  3HT3 A;  4EZ6 A;  1MIY A;  4LZD A;  5D46 A;  5BPC A;  3AU2 A;  1DK2 A;  4EBC A;  4I2E A;  4FO6 A;  5CWR A;  4PPX A;  4C8K A;  1KTQ A;  1S77 D;  5HRE A;  4QWD A;  3PX0 A;  3L9D A;  2NRZ A;  3LWL A;  2ZH5 A;  2HHU A;  1BPD A;  4FHP A;  3G6X A;  4Q44 A;  2KTQ A;  3RB6 A;  4NM1 A;  2ZJ8 A;  1ZQE A;  2MAX A;  3RJK A;  9ICV A;  1S97 A;  1TKD A;  4RT2 A;  3JPT A;  5HRI A;  1JXL A;  4X4V A;  2VA2 A;  1UT5 A;  4PH5 A;  5BOL A;  2BPF A;  4O5E A;  1K1Q A;  4UBC A;  2DPI A;  4BWM A;  3QE9 Y;  4NKU A;  4X4Q A;  1XO1 A;  4PHE A;  1XWL A;  4UAZ A;  4UB2 A;  3V6J A;  4DFK A;  1XS9 D;  5KFB A;  1ZQX A;  3V7L A;  4B9U A;  4DOA A;  5HRB A;  3HJ1 A;  1NZP A;  1ZQL A;  4YCX A;  4O3R A;  5IIN A;  4I2D A;  2ZJ5 A;  3ISB A;  1L3U A;  4IQW A;  4X4O A;  5DDY A;  3KHL A;  3ETL A;  4KMU A;  2UVW A;  3RRG A;  3TAR A;  4GXJ A;  1MQ2 A;  5HRL A;  3PW7 A;  2IMW P;  3LK9 A;  4ELU A;  3K4G A;  4TUS A;  4F4W A;  4UD4 A;  1TK8 A;  5EWE A;  2FLL A;  9ICE A;  1TFY A;  8ICK A;  3K75 D;  4DF8 A;  3Q8M A;  2W9C B;  1A76 A;  4RQ7 A;  4IR9 A;  4ECV A;  4GC7 A;  4DOC A;  4C8N A;  2OWO A;  4RQ1 A;  2PFP A;  2HHQ A;  4WC7 A;  4RT3 A;  2W8L A;  3V6H A;  3M9N B;  4DLG A;  3ISC A;  1ZJM A;  2R8J A;  2Q0Z X;  1D8Y A;  2BCQ A;  5J2E A;  2MUT B;  5KFE A;  3RH5 A;  3RJG A;  2ASJ A;  5CB1 A;  5IIJ A;  3RBE A;  2W9M A;  3SV3 A;  1TK5 A;  2PFQ A;  5J2K A;  2R8K A;  4LZG A;  3M8S A;  3IM1 A;  4X4T A;  3EPI A;  3Q8P B;  3WFO A;  4YD2 A;  4KLM A;  4YN4 A;  8ICX A;  8ICI A;  1VJ7 A;  8ICW A;  4WC3 A;  4XQ8 A;  4X4R A;  5HC9 A;  2BCR A;  3WFR E;  2PFO A;  1NO5 A;  2C2D A;  2ZHB A;  5HMM A;  4F5O A;  7ICE A;  3QZ8 A;  3OHB A;  2FPL A;  4EYI B;  3MGH A;  3JPQ A;  4KTQ A;  5HNK A;  1NJW A;  3TFR A;  3TQ1 A;  2KFN A;  3H37 A;  3NYB A;  5HHH A;  5KFM A;  5KT2 A;  7ICH A;  1L3V A;  3Q8S B;  5J0S A;  3EYZ A;  3H8W A;  3IHQ B;  1Z00 A;  4DS5 A;  7ICM A;  4YXM A;  4J9O A;  4J9L A;  4JV0 A;  4BXO A;  3GV7 B;  7ICF A;  1MIV A;  4F4Z A;  8ICS A;  4AT7 B;  5CJ7 A;  4F91 B;  3MGI A;  2AGO A;  4RNM A;  1JMS A;  4MF2 A;  4O3S A;  1X9S A;  4IRD A;  4QZF A;  4Q8F A;  1WOT A;  5KFI A;  4RUC A;  3MDC A;  4YMM A;  4DL4 A;  4IRK A;  3LQC B;  9ICS A;  5DKW A;  5KFP A;  3ZDD A;  1K1S A;  1L3T A;  2UVR A;  7ICI A;  4ATB B;  4YR3 A;  4PGY A;  5DQH A;  3BQ2 A;  1KLN A;  4MFA A;  2RFF A;  4QZA A;  3AQL A;  4O5C A;  3SV4 A;  1ZJN A;  1ZQS A;  1JN3 A;  1SZP A;  4F5R A;  3PX4 A;  3ZDC A;  5J2H A;  3PY8 A;  2PI5 A;  4XA5 A;  4UQG A;  4WC5 A;  2ZH2 A;  4M04 A;  2XY6 A;  4NM2 A;  8ICV A;  2XGP A;  4RQ5 A;  4FHV A;  5KFH A;  1PX5 A;  5KFR A;  8ICZ A;  3PO4 A;  2FPM A;  2DR9 A;  4UAY A;  3GIL A;  3KHH A;  4I28 A;  5DG7 A;  2PBE A;  4UB5 A;  1ZQC A;  4HYK A;  4F93 B;  4M47 A;  1NK0 A;  3H40 A;  4FBU A;  4UBB A;  1ZQU A;  4M9G A;  2AJQ A;  5KG2 A;  1XSL A;  8ICA A;  1RPL A;  4Q43 A;  4C8L A;  3E2E A;  2O1P A;  4B9M A;  4PHD A;  5KTQ A;  2ZTD A;  1ZQD A;  5JUM A;  1WCN A;  7ICR A;  3ZDA A;  4RNO A;  8ICM A;  3ORY A;  3TAN A;  4O9M A;  1S10 A;  2FPK A;  3PML A;  4RWP A;  2HHS A;  5CHG A;  1ZQY A;  4QZ8 A;  3GDX A;  1RXW A;  4TQR A;  2W9B A;  3C2L A;  4CCH A;  4QZB A;  3H4B A;  2BCU A;  2V4R A;  5HML A;  8ICN A;  4X0B A;  1TFW A;  1DK3 A;  4O3O A;  1KFT A;  1NJX A;  2ZH4 A;  1UT8 A;  4DQI A;  4AT8 B;  5DDM A;  4I2B A;  1T4G A;  4M9J A;  4RWN A;  5KG1 A;  2BDP A;  9ICU A;  1ZQH A;  4NLN A;  2KZZ A;  3HJ4 A;  4UB3 A;  4BGD A;  3RH6 A;  2V9W A;  9ICW A;  1KNY A;  4M9N A;  4NXZ A;  3H38 A;  3V6K A;  4DSJ A;  1U45 A;  3GIJ A;  1RXV A;  5KFX A;  3ZD9 A;  8ICQ A;  4I2A A;  4DOB A;  1R8A A;  3BDP A;  4ED6 A;  4QZE A;  2JEJ A;  3EWA A;  4UAW A;  8ICR A;  2I1Q A;  7ICK A;  5D4B A;  5J0U A;  4DSF A;  3ISD A;  4E7X A;  3UQ0 A;  4X5V A;  5KT5 A;  1SL1 A;  1A77 A;  3JPR A;  3M9O B;  3MR3 A;  4DSI A;  9ICR A;  4FHW A;  7ICJ A;  1DOQ A;  4EBE A;  4AT9 B;  1UEU A;  5CA7 A;  4KN7 A;  5DQI A;  9ICF A;  3AQM A;  4EEY A;  1D8L A;  4B9N A;  2Y1I A;  3LWM A;  4EYH B;  3Q8L A;  1KEJ A;  2IBK A;  5HRK A;  1U49 A;  5DBA A;  1DGS A;  4QZI A;  1BPX A;  4YVZ A;  4FBT A;  4Z6E A;  1R8B A;  4FHY A;  5KG7 A;  4XQ7 A;  4NLG A;  3H7I A;  5J0Y A;  2KFZ A;  5DLG A;  9ICP A;  3MAB A;  2DFL A;  3GIM A;  2LYH A;  5DG9 A;  2DPJ A;  1KFS A;  4DWI A;  1XC9 A;  5DGB A;  4R64 A;  2HVH A;  1NK5 A;  1LB2 B;  5KG6 A;  5KFJ A;  3T3F A;  9ICA A;  3C23 A;  2M2T A;  4ELT A;  1OU5 A;  5KFZ A;  5J2G A;  2ZH9 A;  2M2U A;  4DO9 A;  4I2J A;  1PZN A;  2C28 A;  4P2H A;  3N4M B;  1QSL A;  2C22 A;  9ICT A;  5KFS A;  4XRH A;  5DB9 A;  3HWT A;  2BHN A;  3C5G A;  4WBY A;  3JPP A;  1CEZ A;  8ICJ A;  3PV8 A;  1KSP A;  4E0D A;  5F2V O;  5DLF A;  4DFJ A;  1S0M A;  1ZQZ A;  5L1K A;  4QZH A;  1BNO A;  1T3N A;  4FHX A;  4B9V A;  1NOM A;  4M6W A;  4ECY A;  5HRF A;  4R66 A;  3EW9 A;  1JIH A;  4EBD A;  1SL2 A;  3RJH A;  4M9L A;  5KFA A;  2BQ3 A;  9ICB A;  1CUK A;  2R8G A;  5EWG A;  3C66 A;  2HHX A;  4MFF A;  1SKR A;  4Q8E A;  4ECX A;  5J2J A;  3BQ1 A;  4O3N A;  2XC9 A;  4R65 A;  4I2H A;  4KLT A;  4DL7 A;  5HRD A;  3RB4 A;  4ED8 A;  3H3A A;  2I9G A;  3V7J A;  1ZQN A;  4K4G A;  4DQS A;  1N48 A;  2Y1J A;  1NKB A;  1S0N A;  9ICJ A;  3RH4 A;  5D49 A;  8ICE A;  1JAJ A;  3Q8K A;  3RTV A;  5KFF A;  1Y88 A;  2JEG A;  4M2Y A;  4NLZ A;  5KFO A;  2A1J B;  4DQR A;  2HVI A;  5J2B A;  2HHW A;  3HX0 A;  4WC0 A;  3KHG A;  4P4O A;  2XO7 A;  4P4P A;  2ZUD A;  3SZ2 A;  2BKE A;  4YR0 A;  3SYZ A;  5C5J A;  4ED1 A;  3PW2 A;  3RR7 A;  4DQP A;  1FA0 A;  3OUY B;  4PHA A;  4KLG A;  3BJY A;  2DR8 A;  3RBD A;  4YFK A;  3AQN A;  2H5X A;  1KDH A;  4UB1 A;  4I2I A;  4RPY A;  1RZT A;  4X4P A;  4JUZ A;  3QZ7 A;  1ARO P;  3B0Y A;  2A1J A;  5KFQ A;  1VFG A;  4UB4 A;  4E8F A;  2ZUB A;  4ED3 A;  3KTQ A;  2Q66 A;  5KFG A;  5CR0 A;  3UPQ A;  2AQ0 A;  3EPG A;  4KLD A;  1TAU A;  8ICP A;  2F1J A;  3JZ0 A;  4KLQ A;  1B43 A;  1X9M A;  1SL0 A;  2FMP A;  9ICH A;  4KLL A;  3NGD A;  2HW3 A;  1ZQO A;  4DS4 A;  4JWM A;  4J9K A;  4IRC A;  2XGQ A;  5DEC A;  2DR7 A;  1ZQQ A;  1F5A A;  1ZET A;  4YG2 A;  2BR0 A;  2FLP A;  3MR6 A;  4YXJ A;  1ZQV A;  1BPE A;  5KG4 A;  4YD1 A;  3OJU A;  1TK0 A;  5KFV A;  2ZH3 A;  5HRH A;  3OGU A;  8ICC A;  4F5N A;  2ZHA A;  4F2R A;  9ICO A;  3AU6 A;  4DFM A;  1UA0 A;  5KFW A;  5KFD A;  2NRW A;  5KFC A;  3UXP A;  5HRG A;  1TAQ A;  4M6W B;  5DQG A;  4X4N A;  4NLK A;  4RZR A;  1RYR A;  4K4I A;  8ICB A;  3H4D A;  4ED2 A;  3PW5 A;  1T7P A;  1U48 A;  4YMN A;  2UVV A;  5KFK A;  4ECQ A;  2UVU A;  2FMS A;  2W8K A;  4PHP A;  3G6Y A;  2IHM A;  3RJJ A;  4O3P A;  3SI8 A;  3OSP A;  4EZ9 A;  4KLH A;  4WCW A;  4J9M A;  5J0W A;  3PR5 B;  3OUY A;  4DL6 A;  5J2F A;  4TUR A;  4GXI A;  1R8C A;  2AGP A;  4ECT A;  3PVX A;  1JQR A;  4BWJ A;  3PX6 A;  4F92 B;  2BGW A;  1HUZ A;  1Q78 A;  1KRP A;  9ICC A;  4QZD A;  4DLE A;  4ECS A;  4QZ9 A;  7ICL A;  3V72 A;  5J0O A;  5J2D A;  1SKS A;  1ZQR A;  5J2A A;  5KG3 A;  5TZV A;  5DB7 A;  2ATL A;  4ED7 A;  3C2M A;  2P66 A;  9ICL A;  2M2V A;  2NRK A;  5L1I A;  5L1J A;  4KIT B;  3MR2 A;  1KFD A;  4O5K A;  4AT9 A;  3WFQ E;  4P4M A;  2B21 A;  3HPO A;  5J2I A;  4KLE A;  2HHP A;  2AGQ A;  2ZTE A;  5IIL A;  5J0X A;  4RQ3 A;  4TQS A;  4QWC A;  4ECW A;  3RJE A;  2KZ3 A;  4I2F A;  4DSE A;  5L9X A;  4F2S A;  2RDI A;  4DFP A;  4KLI A;  4DL5 A;  9ICX A;  3H39 A;  2BQU A;  3GII A;  2JEF A;  3OSN A;  3PO5 A;  7ICT A;  2ISO A;  4JK1 A;  2R8I A;  3PW0 A;  1COO A;  4DEZ A;  4RNN A;  1BPZ A;  1ZQB A;  8ICO A;  4XUS A;  5J2C A;  4IQU A;  4K4H A;  7ICP A;  4RQ0 A;  4UD5 A;  2PI4 A;  4I29 A;  9ICQ A;  3C1Z A;  5KG5 A;  3RB0 A;  1NJZ A;  2DRA A;  2DRB A;  3HW8 A;  2ISP A;  4X0A A;  4MEY A;  4RPX A;  4ECZ A;  4AT8 A;  1QTM A;  2JEI A;  4RWO A;  2BPC A;  2VAN A;  4ED0 A;  4ECR A;  5KG0 A;  4Z6F A;  1QLN A;  5HHI A;  4LVS A;  1YLQ A;  4QZC A;  3RB3 A;  3GIK A;  3MBY A;  2RDJ A;  2DR5 A;  2W9B B;  3C18 A;  4DSK A;  2ID1 A;  3QEA Z;  2VA8 A;  2M9N A;  2V4Q A;  2NRX A;  4F5Q A;  4MFC A;  3RAX A;  4IQT A;  4J9P A;  2ALZ A;  1N56 A;  2M2W A;  5DGA A;  4JV2 A;  8ICY A;  5IIK A;  3HIY A;  8ICF A;  9ICN A;  4QWE A;  1NK9 A;  1ZQJ A;  5DG8 A;  9ICK A;  4RQ4 A;  1Q79 A;  2C2E A;  1SKW A;  5KFL A;  5EWF A;  5KFU A;  4QWA A;  1NKE A;  3WFP A;  3ZD8 A;  3MFH A;  8ICU A;  9ICG A;  1D9D A;  3JYY A;  3Q8Q B;  3UQ2 A;  4YMO A;  4B9L A;  3GV5 B;  4RQ8 A;  4J9Q A;  4F50 A;  3TAQ A;  3MDA A;  4F5P A;  3RRH A;  4RQ6 A;  3TFS A;  1TVA A;  3OHA A;  3OVA A;  4QW8 A;  3AUO A;  1ZQA A;  5F9N A;  4F4Y A;  4WC6 A;  2PXI A;  4M9H A;  3M8R A;  4ATB A;  1UA1 A;  4GC6 A;  3JPS A;  4DSL A;  3GQC A;  7ICG A;  4I2C A;  4J9N A;  4KLF A;  1ZYQ A;  4ECU A;  3Q8R B;  1B22 A;  5DED A;  1ZQP A;  4JWN A;  4X4U A;  5III A;  2BCS A;  5DB6 A;  4C8M A;  5J0T A;  4FH3 A;  2F1I A;  4IG8 A;  4DQQ A;  5KFN A;  4GXK A;  4NY8 A;  2ZH7 A;  3OJS A;  3BQT A;  1MQ3 A;  3B0X A;  1NKC A;  3UXN A;  4EP7 A;  3JPN A;  5KFT A;  1RYS A;  5KT4 A;  4WC1 A;  5F9L A;  4J9S A;  3TI0 A;  2O5A A;  3NTU A;  5DBB A;  3KHR A;  1JXE A;  4RPZ A;  1L3S A;  2FMQ A;  3T5L A;  8ICL A;  4RQ2 A;  4NKT A;  5J0R A;  4M0A A;  3FDS A;  3PR4 A;  3BQ0 A;  1HUO A;  5BOM A;  7ICO A;  2MUT A;  3T5K A;  1ZQI A;  1BVS A;  4F4X A;  4YR2 A;  4FS2 A;  3H8J A;  3OVB A;  1U9L A;  3PW4 A;  5CP2 A;  2HHV A;  2PFN A;  2ZH8 A;  1XSP A;  2AU0 A;  4QZG A;  2IHN A;  3ZDE A;  3RAQ A;  1NK4 A;  4KLJ A;  4EBJ A;  4WC2 A;  1L5U A;  3QEB Z;  3WFS C;  4QW9 A;  2W9A A;  4ZH4 A;  2XCA A;  3GFK B;  2ASD A;  1V4A A;  7ICQ A;  4ELV A;  3MR5 A;  2HHT A;  5J0P A;  1T8E A;  5J29 A;  1Z3E B;  4FS1 A;  1NJY A;  3TAP A;  9ICM A;  5EOZ A;  2J6S A;  3G6V A;  4G3I A;  3UXO A;  7ICU A;  4BDP A;  3PMN A;  1QSS A;  3C21 A;  2C2R A;  2BE3 A;  1TFR A;  1BPB A;  2VA3 A;  4PGX A;  4AT7 A;  4RUA A;  1S0O A;  1ZQG A;  4BXO B;  1Z00 B;  4WC4 A;  2ZH6 A;  3C2K A;  2F1H A;  3PNC A;  1JX4 A;  3C5F A;  3AQK A;  4X4S A;  5J0Q A;  4GLX A;  4MF8 A;  1IM4 A;  4DL3 A;  1D9F A;  2ZTC A;  4KN4 A;  2BPG A;  2ZJA A;  3V7K A;  7ICS A;  5IIM A;  4IR1 A;  2IA6 A;  9ICI A;  3T5J A;  2GWS A;  1QSY A;  3UPS A;  1ZQF A;  4F3O A;  4FH5 A;  1LV5 A;  3N97 B;  8ICG A;  1UEV A;  4JV1 A;  4S3N A;  4Q45 A;  7ICV A;  1U47 A;  1HJP A; 
#chains in the Genus database with same CATH topology
 4O67 A;  2NO4 A;  1V9P A;  5KT3 A;  3UMG A;  3HRD D;  5L1L A;  1X2I A;  2P6R A;  3OVS A;  2E3T A;  2KP7 A;  4TUQ A;  2AQ4 A;  3JPO A;  2KZM A;  5KT6 A;  2JZB B;  3LDA A;  1Q3U A;  2DVI A;  3HP6 A;  1JUD A;  3I1Y A;  5KT7 A;  5AKY A;  4PGQ A;  3MFI A;  4O3Q A;  2IOF K;  4IS7 A;  3GV8 B;  3H8S A;  4EX6 A;  8ICT A;  2ZH1 A;  2BQR A;  5HP4 A;  5KFY A;  1RG6 A;  4DL2 A;  3NVZ A;  2JZB A;  5ALG A;  3THV A;  4B9T A;  5AKK A;  1S76 D;  4Y2R A;  3HT3 A;  2HCF A;  3WK5 A;  2W7P A;  4FO6 A;  1KTQ A;  5HRE A;  3VC8 A;  5H2F U;  4QWD A;  3LWL A;  2ZH5 A;  2HHU A;  1N5W A;  4NM1 A;  2ZJ8 A;  1ZQE A;  3RJK A;  4X4V A;  1JXL A;  5BOL A;  4UBC A;  3QE9 Y;  4X4Q A;  1XO1 A;  3O0F A;  1XWL A;  1FFU A;  4DFK A;  4PHE A;  3V7L A;  5HRB A;  4BJQ A;  1PVR A;  2IMW P;  3LK9 A;  4TUS A;  4F4W A;  4UD4 A;  5EWE A;  8ICK A;  1GPJ A;  3Q8M A;  1L8O A;  4DLG A;  3ISC A;  4OO1 J;  1D8Y A;  2MUT B;  5CB1 A;  1YZ7 A;  5J2K A;  4LZG A;  4NXV A;  3M6K A;  5CHE A;  2G5I B;  5EE9 A;  4Y2P A;  4ZOH C;  8ICW A;  4F71 A;  5HC9 A;  2BCR A;  3WFR E;  2ZHB A;  3OHB A;  4EYI B;  3MGH A;  3JPQ A;  5HNK A;  1NJW A;  2KFN A;  2CN1 A;  5KFM A;  3NVO A;  3RF9 A;  2AH5 A;  3IHQ B;  4YXM A;  4J9L A;  4BXO A;  4JV0 A;  3DDH A;  3GV7 B;  1UPH A;  4O3S A;  4Q8F A;  5KFI A;  4IRK A;  3LQC B;  4YMM A;  9ICS A;  5KFP A;  2DKX A;  3GZF A;  1L3T A;  4PL2 A;  4K9B A;  1LVH A;  4ATB B;  3BQ2 A;  3ZDC A;  2ZH2 A;  1ZOL A;  4WC5 A;  4XA5 A;  4UQG A;  2WFA A;  1ZD2 P;  1F44 A;  2KSO A;  4FHV A;  3NVW A;  1L7N A;  2DR9 A;  3WFO A;  5DG7 A;  2Y0S C;  1ZQC A;  4M9G A;  3H40 A;  4UBB A;  5AI8 A;  5KG2 A;  5ALV A;  1PK3 A;  1XSL A;  4C8L A;  3QUC A;  2ZTD A;  1N63 A;  3WK8 A;  3UM9 A;  4RNO A;  3ORY A;  3TAN A;  3PML A;  2HHS A;  3H8M A;  4AYB F;  4QZ8 A;  4CCH A;  4QZB A;  5HML A;  8ICN A;  4KX3 A;  1DK3 A;  2ZH4 A;  2PMZ F;  4DQI A;  1URJ A;  4I2B A;  4I0U A;  2YX8 A;  2BDP A;  1ZQH A;  2V9W A;  2YMQ A;  9ICW A;  2XI9 A;  4DSJ A;  3GIJ A;  1OW5 A;  3IDW A;  3EWA A;  4UAW A;  4O69 A;  1SXD A;  2JV3 A;  3JPR A;  3NAS A;  3ICX A;  4AT9 B;  1UEU A;  4KN7 A;  2ODG A;  9ICF A;  3AQM A;  5CFT A;  1D8L A;  4GFJ A;  3Q8L A;  2IBK A;  1VLB A;  1DGS A;  4FBT A;  4Z6E A;  3H7I A;  2KFZ A;  5DLG A;  3C29 A;  3MAB A;  2LYH A;  4DWI A;  2GH1 A;  5ALX A;  1LB2 B;  5KG6 A;  2ZIW B;  3C23 A;  4PJ0 U;  5J2G A;  5EE1 A;  4P2H A;  1QSL A;  9ICT A;  5J8Y C;  5B66 U;  1CEZ A;  1HEK A;  2K4E A;  3PV8 A;  1S0M A;  2K8C B;  3WKC A;  5L1K A;  4B9V A;  1NI3 A;  1ZD5 A;  1L7M A;  1CUK A;  5EWG A;  2KHQ A;  1SKR A;  4Q8E A;  4GIB A;  2XC9 A;  4O68 A;  3RB4 A;  2I9G A;  1ZQN A;  3BS5 A;  3RH4 A;  5D49 A;  1JAJ A;  3RTV A;  3F2D A;  2HVI A;  4ACO A;  5KFO A;  1PVP A;  3UMB A;  9ICJ A;  3SYZ A;  3OUY B;  2K4I A;  3NS1 A;  3RBD A;  3AQN A;  1KDH A;  5E79 U;  3UMC A;  4RPY A;  1RZT A;  3F5A A;  3AQE A;  3U26 A;  1WYG A;  4KLD A;  8ICP A;  2F1J A;  1X9M A;  1SL0 A;  4Y2X A;  2HW3 A;  4DS4 A;  5DEC A;  1F5A A;  4YG2 A;  2FLP A;  3OJU A;  5KFV A;  1OUQ A;  2ZHA A;  3AU6 A;  5HRG A;  5KFD A;  2G0A A;  3KKA A;  4M6W B;  4X4N A;  4US8 A;  4RZR A;  4K4I A;  8ICB A;  4XJE A;  2YB4 A;  5KFK A;  4P0Q B;  4PHP A;  2IHM A;  2LPE A;  4EZ9 A;  4O3P A;  4KLH A;  4WCW A;  1HIW A;  1QH9 A;  3OUY A;  1R8C A;  4GXI A;  2KIV A;  2R18 A;  3KKA C;  1JQR A;  3SAH A;  5TIS U;  9ICC A;  4ECS A;  3N7R C;  7ICL A;  5J2D A;  5TZV A;  2ATL A;  3C2M A;  9ICL A;  2NRK A;  5L1I A;  3S6J A;  3MR2 A;  4JLX A;  4OAF A;  5IIL A;  2ZTE A;  4QWC A;  4Y2V A;  5ALN A;  2KZ3 A;  7ICT A;  1ZQB A;  4XUS A;  2KKV A;  5J2C A;  2DKZ A;  9ICQ A;  1Z1V A;  5KG5 A;  2DRA A;  2DRB A;  3HW8 A;  2ISP A;  5EE3 A;  1QTM A;  2ZIW A;  4OAI Z;  2JEI A;  4ED0 A;  2HDO A;  2YY6 A;  4WQL A;  4ECR A;  5KG0 A;  2EAM A;  2E8P A;  5HHI A;  4LVS A;  4DSK A;  1KKX A;  2VA8 A;  4PL1 A;  2V4Q A;  2NRX A;  5ALI A;  4MFC A;  2M2W A;  2HBM A;  9ICN A;  2WAQ C;  1NK9 A;  5DG8 A;  4RQ4 A;  3MFH A;  4J9Q A;  1TVA A;  4RQM A;  2HOF A;  2P35 A;  4M9H A;  1JRO A;  4GC6 A;  4DSL A;  3VCB A;  3AMZ A;  5AIA A;  1SXE A;  1ZYQ A;  4ECU A;  3Q8R B;  5DED A;  1ZQP A;  1FFV A;  2G5H B;  5III A;  2BCS A;  5DB6 A;  2A1A A;  5KFN A;  3OJS A;  3BQT A;  5AKL A;  1MQ3 A;  5AM2 A;  5B3P A;  1YT3 A;  3JPN A;  3M7D A;  3OWG A;  3RFA A;  4NL9 C;  3TI0 A;  5AK6 A;  2FMQ A;  2EH9 A;  1IIP A;  3FDS A;  5A0L A;  7ICO A;  3T5K A;  3R9K A;  2KSO B;  1ED1 A;  3H8J A;  1XSP A;  4KLJ A;  1L5U A;  3WFS C;  2M0N A;  2W9A A;  4OJO A;  4ELV A;  3MR5 A;  5J29 A;  1Z3E B;  4FS1 A;  5AM4 A;  2W54 A;  9ICM A;  4G3I A;  3G6V A;  7ICU A;  2C2R A;  1BPB A;  2RHF A;  4PGX A;  2VA3 A;  3LVW A;  4BXO B;  1S0O A;  4AT7 A;  1Z00 B;  2KE7 A;  5ALE A;  4CE6 A;  4GLX A;  4N7R A;  1Z4N A;  5ALF A;  2K89 A;  2ZJA A;  5IIM A;  3T5J A;  1QSY A;  2OH2 A;  2F77 X;  3LYS A;  4NL9 A;  3NKU A;  4F3O A;  4FH5 A;  1LV5 A;  3N97 B;  5AK4 A;  2K8B B;  2A19 A;  2LYB A;  1ZQW A;  2WF6 A;  1S9F A;  1TV9 A;  1X9W A;  1COK A;  1XSN A;  2HOQ A;  4R8U B;  5B5E U;  2KVS A;  2B6G A;  1BNP A;  3IG5 A;  4KM5 A;  2JR5 A;  3F2C A;  1WCL A;  5ALM A;  3L3F X;  2W7O A;  4YP3 A;  3RJF A;  4QIW F;  2OHF A;  1EXN A;  1F0M A;  4G9B A;  4C8O A;  1S0V A;  5ALH A;  5K4L A;  2ZUC A;  2FLN A;  8ICH A;  2J6U A;  2NRT A;  3KZI U;  2W03 A;  2YQE A;  1ZQM A;  4F8R A;  1NK8 A;  2HN1 A;  2ASL A;  5AHX A;  4MEX A;  1ZQT A;  4LZD A;  1DK2 A;  3AU2 A;  4I2E A;  4QIW C;  2KMD A;  4PPX A;  4NXW A;  3NWI A;  1Q3V A;  5HR6 A;  4O5E A;  1T3Q A;  3WKD A;  4UAZ A;  1MSW D;  4OJ6 A;  3V6J A;  1SB3 C;  4DOA A;  3H0M B;  1ZQL A;  4YCX A;  2D6F C;  4KMU A;  1MQ2 A;  4FE3 A;  3EF2 A;  1X9X A;  1TFY A;  2KJ8 A;  3K75 D;  4DF8 A;  2W9C B;  4ECV A;  4GC7 A;  4DOC A;  2OWO A;  4RQ1 A;  2PFP A;  2Y9T A;  2FCL A;  4RT3 A;  3V6H A;  3JCF A;  3RH5 A;  5KFE A;  2ASJ A;  2R8K A;  1TK5 A;  3EPI A;  4MHV A;  5ALS A;  3SMV A;  4YD2 A;  8ICI A;  4WC3 A;  1ZD3 A;  2H3Z A;  4KTQ A;  3TQ1 A;  3H37 A;  1L3V A;  3KBB A;  3Q8S B;  7ICM A;  7ICF A;  4BUG A;  2E8M A;  4RNM A;  1JMS A;  4IRD A;  1RM6 C;  4QZF A;  1WOT A;  4RUC A;  3MDC A;  3WK9 A;  5DKW A;  3ZDD A;  7ICI A;  2ZXI A;  4YR3 A;  4PGY A;  5GTI U;  1KLN A;  2Y0S F;  3HJE A;  4QZA A;  3AQL A;  1ZJN A;  4F5R A;  5KAI U;  4M04 A;  2XY6 A;  2XGP A;  2DWQ A;  1PX5 A;  3PO4 A;  2FPM A;  2WHE A;  1SV0 A;  3KHH A;  3WKA A;  5AIC A;  2AJQ A;  1RPL A;  2EAN A;  4Q43 A;  3E2E A;  4JMU A;  8ICM A;  4RWP A;  3NRZ A;  1ZQY A;  5ALO A;  4TQR A;  3BQ7 A;  4X0B A;  3K7D A;  1X66 A;  2MRL A;  4O3O A;  2NO5 A;  1NJX A;  2KZZ A;  3RH6 A;  1KNY A;  1B0X A;  4KB6 A;  5KFX A;  4DOB A;  2JEJ A;  1RYU A;  8ICR A;  2KEY A;  4E7X A;  1SL1 A;  1VDV A;  1C20 A;  9ICR A;  4Y2Q A;  3FM9 A;  3SEN A;  1V38 A;  3LWM A;  4EYH B;  1KEJ A;  2ZIU B;  5DBA A;  4QZI A;  1BPX A;  4YVZ A;  1R8B A;  2EDU A;  4FHY A;  4XQ7 A;  4NLG A;  9ICP A;  2RRD A;  3GIM A;  5DG9 A;  2DPJ A;  3SAF A;  5EE0 A;  5DGB A;  3SAG A;  4ELT A;  4DO9 A;  2WF7 A;  1PZN A;  3N4M B;  4XRH A;  3C5G A;  4FZM A;  8ICJ A;  1JRP A;  2GOL A;  4QZH A;  4HX0 A;  4M6W A;  4ECY A;  5HRF A;  1MA7 A;  4M9L A;  5KFA A;  2BQ3 A;  2R8G A;  3C66 A;  4JLZ A;  5J2J A;  4O3N A;  1PK1 B;  5HRD A;  4ED8 A;  3V7J A;  3KZX A;  4K4G A;  2HHW A;  4WC0 A;  3KHG A;  3DV9 A;  4MKP A;  3PW2 A;  1FA0 A;  2BKE A;  4YR0 A;  2WB1 C;  5AKZ A;  4DQP A;  2EWR A;  1KL9 A;  4PHA A;  4KLG A;  2KVC A;  2E5S A;  2IHO A;  1JAL A;  4X4P A;  2H3V A;  4JUZ A;  3QZ7 A;  1ARO P;  1VFG A;  2FDR A;  4E8F A;  1S5L U;  2E1F A;  4ED3 A;  5KFG A;  3KTQ A;  2QLT A;  3EPG A;  1TAU A;  1XO0 A;  2LM1 A;  4KLL A;  2K4H A;  4PZO A;  1ZQO A;  4J9K A;  5G5H A;  2XGQ A;  1ZQV A;  1BPE A;  5KG4 A;  2ZH3 A;  3PSI A;  5HRH A;  3A0H U;  4F5N A;  2QAR B;  1UA0 A;  3UXP A;  1TAQ A;  5DQG A;  4NLC A;  5D61 A;  3H4D A;  4NLB A;  3NVY A;  4HAI A;  2YMP A;  2W8K A;  3ETR A;  3RJJ A;  5J0W A;  2ZXH A;  2FE9 A;  4TUR A;  1ZXI A;  2KIW A;  3L4P A;  4BWJ A;  3PX6 A;  2MA1 A;  4F92 B;  2BGW A;  1HUZ A;  2JGA A;  1N5X A;  4CF5 A;  4QZD A;  3MCR A;  3V72 A;  3FC4 A;  5DB7 A;  2A3V A;  2ZIX A;  3PZP A;  5L1J A;  2LKY A;  2O6K A;  2G07 A;  5GTH U;  4KIT B;  4AT9 A;  5AKX A;  2K8A A;  4C80 A;  2LM4 A;  2HHP A;  5AM0 A;  1M6Y A;  4RQ3 A;  4TQS A;  3RJE A;  4I2F A;  2RP5 A;  2RDI A;  4DFP A;  4KLI A;  4K9A A;  2EAP A;  2BQU A;  3PO5 A;  3KD3 A;  4JK1 A;  1COO A;  8ICO A;  4UAS A;  4K99 A;  4K4H A;  4UD5 A;  1TE2 A;  1NJZ A;  1X42 A;  4X0A A;  4MEY A;  4RWO A;  3K1R B;  4ICA A;  3M1Y A;  1QLN A;  4QZC A;  3RB3 A;  1YZ6 A;  3MBY A;  3GIK A;  1O08 A;  4F5Q A;  2DL0 A;  2ZIU A;  4IQT A;  2ALZ A;  2JH7 A;  5ALD A;  4QWA A;  5EWF A;  3WFP A;  3ZD8 A;  8ICU A;  1D9D A;  3Q8Q B;  4RQ8 A;  3MGV A;  2B51 A;  3OVA A;  4QW8 A;  1O03 A;  1UA1 A;  3F53 A;  1B22 A;  4C8M A;  2F1I A;  2LBO A;  4IG8 A;  4DQQ A;  4O3M A;  1J2M A;  4GXK A;  4NY8 A;  1CRX A;  1A0P A;  2ZH7 A;  3HIL A;  1NKC A;  4EP7 A;  4EEL A;  1S8O A;  5AM3 A;  2O5A A;  4CRX A;  5HR7 A;  2K60 A;  3TAC B;  8ICL A;  2YML A;  4C4R A;  1MN8 A;  3QUQ A;  3WK7 A;  2MUT A;  4FS2 A;  3HKZ C;  1ZD4 A;  2JH1 A;  3PW4 A;  5CP2 A;  2ZH8 A;  2PFN A;  1J2N A;  2HBK A;  3RAQ A;  4WC2 A;  3QEB Z;  3GFK B;  5AI0 A;  7ICQ A;  2HBL A;  2BE3 A;  5KL8 B;  3C2K A;  3C5F A;  2G06 A;  2HBJ A;  4DL3 A;  2GA9 D;  2ZTC A;  1D8B A;  1SWW A;  2D3D A;  4CF4 A;  7ICS A;  1F5S A;  2GWS A;  2LHT A;  3UPS A;  2Y9U A;  5ALZ A;  3NVV A;  8ICG A;  2JXJ A;  1NK6 A;  5AKE A;  2XY5 A;  1R89 A;  5IIO A;  3M9M B;  1BGX T;  3PSF A;  3RJI A;  1MC8 A;  4IC9 A;  3ZDB A;  2P6U A;  4DCC A;  4EX7 A;  1RQN A;  2W9C A;  4RU9 A;  3FYH A;  1MIW A;  1WUD A;  3WU2 U;  4E80 A;  1L6N A;  4DF4 A;  3C1Y A;  3OV7 A;  2F8K A;  2OYY A;  4EEK A;  4I2G A;  1XU4 A;  4RWQ A;  2OCE A;  4Z6D A;  3RR8 A;  4I27 A;  4WH5 A;  4CGZ A;  4KLO A;  1PVQ A;  1U4B A;  1C7Y A;  4TUP A;  4Z6C A;  2DF4 B;  2NRV A;  2Q4T A;  5DBC A;  4LEV A;  1NK7 A;  2XY7 A;  3H0R B;  4CDG A;  2W43 A;  4IL6 U;  2WTF A;  4B9S A;  7ICN A;  4R63 A;  2W3R A;  2ESE A;  5ALP A;  1ZQK A;  1IV8 A;  4EBK A;  4OAG A;  2XCP A;  4EZ6 A;  1MIY A;  5D46 A;  3I76 A;  4C8K A;  1S77 D;  5AI5 A;  3L9D A;  1L8L A;  2NRZ A;  1Q8K A;  4FHP A;  4K8V A;  1Z4O A;  1S97 A;  3JPT A;  5HRI A;  2EAO A;  2VA2 A;  2BPF A;  4BWM A;  4UB2 A;  1ZQX A;  1NZP A;  4O3R A;  5IIN A;  4I2D A;  2ZJ5 A;  1L3U A;  4X4O A;  5DDY A;  3ETL A;  2KG5 A;  4GXJ A;  5HRL A;  3PW7 A;  1TK8 A;  2MSN A;  2FLL A;  1A76 A;  3NRW A;  4QJF B;  4IR9 A;  3WKE A;  3IP4 B;  4BX9 C;  2R8J A;  1ZJM A;  2Q0Z X;  4M9N A;  5J2E A;  8ICS A;  3F2B A;  4UAV A;  3RBE A;  2W9M A;  4C7Y A;  3M8S A;  3IM1 A;  4X4T A;  1NZB A;  8ICX A;  4YN4 A;  4XQ8 A;  4OJ5 A;  3QU9 A;  1N2X A;  2PMZ C;  5AKG A;  3TFR A;  7ICH A;  3EYZ A;  5J0S A;  3H8W A;  1Z00 A;  3D6J A;  4AT7 B;  1MIV A;  4F4Z A;  3ZI4 A;  4F91 B;  3MGI A;  1L7O A;  1X9S A;  4DL4 A;  2N1R A;  2UVR A;  1T94 A;  2RFF A;  4O5C A;  1SZP A;  3PX4 A;  3PY8 A;  2QKQ A;  1X6I A;  2KD1 A;  1QQ5 A;  4NM2 A;  4RQ5 A;  5KFH A;  8ICZ A;  4UAY A;  3GIL A;  4UB5 A;  4HYK A;  9ICG A;  1NK0 A;  1LKY B;  8ICA A;  1ZQU A;  2O1P A;  4PHD A;  5KTQ A;  7ICR A;  3ZDA A;  3BZK A;  5AIB A;  2KIC A;  2D8C A;  1S10 A;  2W9B A;  3C2L A;  3H4B A;  1KBU A;  4Y2Y A;  3SQI A;  3QU4 A;  1TFW A;  4LJX A;  4EED A;  1KFT A;  1UT8 A;  1UQV A;  4M9J A;  1T4G A;  4RWN A;  1SV0 C;  5KG1 A;  9ICU A;  2GAF D;  1V97 A;  3H38 A;  2G08 A;  1U45 A;  3C28 A;  1RXV A;  3ZD9 A;  4I2A A;  4ED6 A;  4QZE A;  5AM5 A;  7ICK A;  2XVT A;  3CW2 C;  5D4B A;  5J0U A;  3FAH A;  4DSF A;  1K5O A;  3ISD A;  5AKH A;  5KT5 A;  1A77 A;  4C0Z A;  2IOH A;  3L5K A;  5AK3 A;  1DOQ A;  1WWV A;  4O6A A;  2KJ9 A;  4B9N A;  2RQ5 A;  2Y1I A;  5HRK A;  2EZY A;  2JRZ A;  5KG7 A;  5J0Y A;  1PUZ A;  4R64 A;  2HVH A;  2E1E A;  3D2S A;  9ICA A;  3QUB A;  3PST A;  5KFJ A;  4J03 A;  5KFZ A;  2ZH9 A;  4I2J A;  2C28 A;  4AYB C;  2C22 A;  3OPX A;  4Y2J A;  5KFS A;  3HWT A;  4NV0 A;  4WBY A;  5D62 A;  1KSP A;  4E0D A;  5F2V O;  1ZQZ A;  3B9J A;  5ALJ A;  1T3N A;  4FHX A;  1NOM A;  1ZRN A;  4R66 A;  2QAR A;  1JIH A;  3EW9 A;  3IG8 A;  4EBD A;  1SL2 A;  4C4T A;  2ZIV B;  4DFD A;  3NUQ A;  4MFF A;  4ECX A;  3BQ1 A;  4I2H A;  4DQS A;  1N48 A;  2Y1J A;  1NKB A;  1S0N A;  1X40 A;  8ICE A;  4CF3 A;  4P0P B;  5KFF A;  4DQR A;  2A1J B;  1Q46 A;  1V85 A;  4P4O A;  3IV6 A;  4ED1 A;  5C5J A;  2DBY A;  2DR8 A;  3BJY A;  4U7C A;  4FO1 A;  4YFK A;  5JRT A;  2H5X A;  4UB1 A;  4I2I A;  2EZX A;  4LEW A;  3B0Y A;  4A8E A;  3DEE A;  2Q66 A;  3UPQ A;  2AQ0 A;  2W55 A;  2F76 X;  4NXT A;  4NXX A;  2FMP A;  9ICH A;  2Z7J A;  4KX5 A;  4IRC A;  1ZET A;  2KKP A;  2LMR A;  4NWI A;  4YXJ A;  3MR6 A;  1TK0 A;  3AL0 B;  1SZH A;  2MU2 A;  8ICC A;  4F2R A;  2CPR A;  4JB3 A;  5KFC A;  2KJ5 A;  4NLK A;  5AK5 A;  4ED2 A;  3PW5 A;  1T7P A;  3G6Y A;  4J9M A;  3PR5 B;  5J2F A;  2AGP A;  3PVX A;  2WAQ F;  1Q78 A;  1KRP A;  4P0P A;  2H3F A;  3I28 A;  2NV3 A;  4QZ9 A;  1N60 A;  3BS5 B;  2EQY A;  3C18 A;  4ED7 A;  2P66 A;  3H0L B;  4UB6 U;  3QUT A;  1KFD A;  4O5K A;  2CXY A;  3WFQ E;  4P4M A;  3HPO A;  5J2I A;  2ZIV A;  4OD0 A;  5J0X A;  4DSE A;  3WKB A;  9ICX A;  4DL5 A;  3H39 A;  3GII A;  2JEF A;  3OSN A;  2ISO A;  2R8I A;  4DEZ A;  4RNN A;  1BPZ A;  4NJ8 A;  7ICP A;  5D63 A;  2PI4 A;  4I29 A;  3C1Z A;  3RB0 A;  4USA A;  1WG8 A;  4RPX A;  4ECZ A;  4AT8 A;  2VAN A;  3OTQ A;  4Z6F A;  3PSP A;  2DR5 A;  3QEA Z;  4K96 A;  4J9P A;  1N56 A;  5DGA A;  2QB0 A;  4JV2 A;  8ICY A;  5IIK A;  8ICF A;  4QWE A;  9ICK A;  5KFL A;  5KFU A;  1NKE A;  2I5H A;  1ZRM A;  3N7S C;  4YMO A;  4B9L A;  3GV5 B;  3E0F A;  5AI6 A;  4K98 A;  5L1M A;  3MDA A;  4F5P A;  3RRH A;  3TFS A;  1Z19 A;  1ZQA A;  5F9N A;  4F4Y A;  4WC6 A;  1VJ5 A;  2HI0 A;  2IUB A;  3M8R A;  3AQF A;  4OAH A;  2HMX A;  4WQK A;  3JPS A;  1QCK A;  7ICG A;  2DQN B;  4KLF A;  4JWN A;  4X4U A;  4FH3 A;  2I6X A;  5JTI A;  1CI4 A;  2KOB A;  2KNJ A;  1RYS A;  5KFT A;  5F9L A;  1LKY A;  4RPZ A;  1L3S A;  3T5L A;  4RQ2 A;  4NKT A;  4NXU A;  1RQL A;  4K97 A;  5J0R A;  3BQ0 A;  5BOM A;  2QB1 A;  2HHV A;  4C7Z A;  2AU0 A;  4QZG A;  2IHN A;  1FIQ A;  4EBJ A;  2VJ5 A;  1SIJ A;  4QW9 A;  4ZH4 A;  1V4A A;  5C0Y A;  1N62 A;  3TAP A;  5EOZ A;  3UXO A;  3SEI A;  1QSS A;  2BDU A;  3WK4 A;  2HOI A;  3PNC A;  2H3Q A;  1JX4 A;  4X4S A;  2F3N A;  1IM4 A;  1D9F A;  3T79 A;  3IN5 A;  3V7K A;  2YB1 A;  2YMM A;  4IR1 A;  9ICI A;  3CNH A;  2DUY A;  1UHU A;  3ED5 A;  4JV1 A;  4Q45 A;  1IG6 A;  1KN5 A;  1HJP A;  1UET A;  3D2N A;  4O0I A;  5CEH A;  4QWB A;  1Z1B A;  4EGW A;  4IQV A;  3TAD C;  2R8H A;  2J6T A;  3EZ5 A;  1IXR A;  2LYA A;  4F4K A;  3T5H A;  4J9R A;  1ZQ1 C;  4CNQ A;  1H38 A;  1DRG A;  2B0C A;  3N28 A;  4UB8 U;  5ALL A;  2H3I A;  4M5D A;  5ALQ A;  1BPY A;  3N7P D;  5HR9 A;  4RQN A;  5DB8 A;  2E8N A;  4KLU A;  2KN7 A;  2AHO B;  4PZN A;  2BCV A;  3K1Z A;  4YQW A;  1JI7 A;  5B3Q A;  4LT6 A;  4KLS A;  4Y2U A;  3M6Z A;  5CFU A;  4R8U A;  2JMG A;  2LI6 A;  5BPC A;  4EBC A;  2AXT U;  5T14 A;  5CWR A;  2JHD A;  3PX0 A;  3HKZ F;  3WK6 A;  2CRX A;  1BPD A;  3G6X A;  4Q44 A;  2KTQ A;  3RB6 A;  2MAX A;  4Y2T A;  9ICV A;  1TKD A;  3QU7 A;  4RT2 A;  1UT5 A;  4PH5 A;  1K1Q A;  2VIX A;  2DPI A;  4EEB A;  4QNL A;  1XS9 D;  5KFB A;  4B9U A;  3HJ1 A;  4NKU A;  2K4P A;  3ISB A;  4IQW A;  3KHL A;  2UVW A;  3RRG A;  1N61 A;  3TAR A;  2NYV A;  3ERC C;  4ELU A;  3K4G A;  9ICE A;  3KFU F;  2F8L A;  4RQ7 A;  3LVV A;  4C8N A;  5JU5 A;  2HHQ A;  4B6J A;  4WC7 A;  2W8L A;  1ECW A;  3M9N B;  3RJG A;  2BCQ A;  3OVB A;  5IIJ A;  2L5Y A;  5F3X B;  3SV3 A;  2PFQ A;  2F2A B;  3TAD A;  5AI4 A;  3Q8P B;  4OJL A;  4KLM A;  1VJ7 A;  4X4R A;  2EZZ A;  3QU5 A;  2PFO A;  5KNI A;  2C2D A;  5HMM A;  4F5O A;  7ICE A;  3QZ8 A;  1NO5 A;  2FPL A;  2DGZ A;  3NYB A;  5HHH A;  5KT2 A;  4DS5 A;  1AQ6 A;  4J9O A;  5CJ7 A;  2AGO A;  4MF2 A;  4EV6 A;  1L7P A;  4UW9 A;  2WF5 A;  1K1S A;  5DQH A;  5AKI A;  4MFA A;  2W11 A;  5AI9 A;  2B56 A;  3ONN A;  3SV4 A;  1ZQS A;  1JN3 A;  5J2H A;  2PI5 A;  2HSZ A;  5AM1 A;  8ICV A;  3AM9 A;  5KFR A;  4F72 A;  4I28 A;  2PBE A;  4M47 A;  3GU3 A;  3QYP A;  4FZL A;  4F93 B;  4FBU A;  4WBZ A;  4B9M A;  1ZQD A;  5JUM A;  1WCN A;  2QB0 B;  4O9M A;  3MC1 A;  2FPK A;  2OM6 A;  5CHG A;  3GDX A;  1RXW A;  2BCU A;  2V4R A;  2BBH A;  2VJ4 A;  2F44 A;  4AT8 B;  5DDM A;  3HJ4 A;  4NLN A;  4FFD A;  4UB3 A;  4BGD A;  4NXZ A;  1OXJ A;  3V6K A;  8ICQ A;  1R8A A;  3BDP A;  2VKQ A;  2I1Q A;  3QX7 A;  3UQ0 A;  4X5V A;  2KK0 A;  3M9O B;  3MR3 A;  4DSI A;  4FHW A;  4WOY A;  7ICJ A;  1GO3 F;  4EBE A;  2W3S A;  1KQQ A;  5CA7 A;  5DQI A;  1SV4 A;  4EEY A;  2WB1 F;  1U49 A;  4U6P A;  3CRX A;  3PHZ A;  5ALU A;  2DFL A;  1KFS A;  4UAU A;  1XC9 A;  1NK5 A;  2M2T A;  3T3F A;  1OU5 A;  3IRU A;  2M2U A;  2GO7 A;  5DB9 A;  2BHN A;  4P0Q A;  3JPP A;  1RDF A;  5DLF A;  4DFJ A;  1B4F A;  1BNO A;  3BS7 A;  3BZC A;  4LEY A;  3SD7 A;  3RJH A;  9ICB A;  4UAT A;  2HHX A;  4KLT A;  4R65 A;  1WWU A;  4DL7 A;  2ZIX B;  3H3A A;  4FZN A;  2ES6 A;  3SR6 A;  2GLE A;  2W04 A;  3Q8K A;  4NLZ A;  1Y88 A;  3QU2 A;  2JEG A;  4M2Y A;  3TKA A;  2B4V A;  5J2B A;  3HX0 A;  3KOO A;  2XO7 A;  2IOF A;  4P4P A;  2ZUD A;  3SZ2 A;  3RR7 A;  2E8O A;  5JTG A;  5J8Y A;  2OXO A;  5KFQ A;  2A1J A;  1SWV A;  4UB4 A;  2ZUB A;  2BBJ A;  5CR0 A;  3JZ0 A;  4KLQ A;  2YN4 A;  2BZF A;  1B43 A;  1SGG A;  4LEZ A;  3NGD A;  4JWM A;  5KL1 B;  2DR7 A;  1ZQQ A;  2BR0 A;  4YD1 A;  3OGU A;  9ICO A;  4DFM A;  5KFW A;  2NRW A;  3ALR A;  4WJ3 B;  1RYR A;  1U48 A;  4YMN A;  2UVV A;  4ECQ A;  3ER9 B;  2UVU A;  2FMS A;  3SI8 A;  3OSP A;  4DL6 A;  1A6S A;  3D2Q A;  4ECT A;  5G5G A;  1P7D A;  4DLE A;  4Y2S A;  5J0O A;  2HN2 A;  4AP9 A;  2WF8 A;  1SKS A;  1ZQR A;  5J2A A;  5KG3 A;  2XIC A;  3QNM A;  2M2V A;  1PK1 A;  4UAR A;  2B21 A;  4KLE A;  2AGQ A;  4ECW A;  5ALT A;  5L9X A;  4F2S A;  3AEV A;  1FO4 A;  1KW4 A;  3PW0 A;  3CYM A;  4IQU A;  3EUB 2;  4RQ0 A;  2BPC A;  5ALY A;  4KMO B;  4EEN A;  1YLQ A;  3CK6 A;  5AKJ A;  2YTU A;  2W9B B;  2RDJ A;  1QQ6 A;  2ID1 A;  2M9N A;  3RAX A;  2FJ6 A;  3ER8 C;  5ALR A;  3HIY A;  1Q79 A;  1ZQJ A;  2C2E A;  1SKW A;  3F5E A;  1X6J A;  2PKE A;  3JYY A;  3UQ2 A;  2OEH A;  5ALK A;  4F50 A;  3TAQ A;  4RQ6 A;  3OHA A;  3AUO A;  1NNL A;  2RLT A;  2PXI A;  2ZG6 A;  1XNS A;  4ATB A;  1FEZ A;  3GQC A;  4I2C A;  4J9N A;  3AN1 A;  2KHV A;  5J0T A;  4OJP A;  2G09 A;  5FP0 A;  1J97 A;  3B0X A;  2WF9 A;  3UXN A;  1TAM A;  1DGJ A;  5CFS A;  2FI1 A;  1UCV A;  5KT4 A;  4WC1 A;  4J9S A;  3A0B U;  3NTU A;  5DBB A;  1JXE A;  3KHR A;  4M0A A;  3PR4 A;  1HUO A;  3CP8 A;  1ZQI A;  5CRX A;  1BVS A;  4F4X A;  4YR2 A;  1U9L A;  3ZDE A;  1NK4 A;  2ASD A;  2XCA A;  4US9 A;  2HHT A;  5J0P A;  1T8E A;  1NJY A;  2J6S A;  5ALW A;  4BDP A;  3PMN A;  3C21 A;  1TFR A;  4RUA A;  4C4S A;  1ZQG A;  2KV2 A;  4WC4 A;  2ZH6 A;  1DXS A;  2F1H A;  3J81 j;  3AQK A;  5KAF U;  5J0Q A;  4MF8 A;  3QXG A;  4KN4 A;  2BPG A;  3E58 A;  2IA6 A;  1QQ7 A;  1ZQF A;  1UEV A;  2XID A;  4S3N A;  4OCZ A;  7ICV A;  1U47 A; 
#chains in the Genus database with same CATH homology
 1ZQW A;  1S9F A;  1TV9 A;  1X9W A;  1UET A;  1V9P A;  4O0I A;  5KT3 A;  2XY5 A;  1R89 A;  1XSN A;  5IIO A;  4QWB A;  1X2I A;  1BGX T;  4IQV A;  4R8U B;  1MC8 A;  3M9M B;  2R8H A;  5L1L A;  3EZ5 A;  3RJI A;  2J6T A;  3ZDB A;  3OVS A;  2P6U A;  4TUQ A;  1IXR A;  2KP7 A;  2W9C A;  4RU9 A;  2AQ4 A;  3FYH A;  3JPO A;  4F4K A;  3T5H A;  1BNP A;  1MIW A;  4E80 A;  2KZM A;  4J9R A;  4DF4 A;  5KT6 A;  3C1Y A;  2JZB B;  3LDA A;  3OV7 A;  2DVI A;  3HP6 A;  5KT7 A;  4I2G A;  1WCL A;  1XU4 A;  4PGQ A;  4YP3 A;  4RWQ A;  4Z6D A;  3MFI A;  3RR8 A;  4O3Q A;  3RJF A;  4I27 A;  4KLO A;  1H38 A;  3GV8 B;  3H8S A;  1EXN A;  1U4B A;  1NK6 A;  4C8O A;  2P6R A;  1C7Y A;  4TUP A;  1S0V A;  8ICT A;  4Z6C A;  2ZH1 A;  2BQR A;  4M5D A;  2NRV A;  2ZUC A;  5HP4 A;  1BPY A;  5KFY A;  2FLN A;  8ICH A;  5DBC A;  2NRT A;  2J6U A;  5HR9 A;  1NK7 A;  5DB8 A;  2XY7 A;  4DL2 A;  1ZQM A;  1MSW D;  2WTF A;  2JZB A;  2KN7 A;  4B9S A;  4KLU A;  2BCV A;  4F8R A;  1NK8 A;  7ICN A;  4R63 A;  3THV A;  2ASL A;  4MEX A;  4YQW A;  4EBK A;  1ZQK A;  4B9T A;  4WBZ A;  4LT6 A;  4KLS A;  1ZQT A;  4R8U A;  2XCP A;  1S76 D;  3HT3 A;  4EZ6 A;  1MIY A;  4LZD A;  5D46 A;  5BPC A;  3AU2 A;  1DK2 A;  4EBC A;  4I2E A;  4FO6 A;  5CWR A;  4PPX A;  4C8K A;  1KTQ A;  1S77 D;  5HRE A;  4QWD A;  3PX0 A;  3L9D A;  2NRZ A;  3LWL A;  2ZH5 A;  2HHU A;  1BPD A;  4FHP A;  3G6X A;  4Q44 A;  2KTQ A;  3RB6 A;  4NM1 A;  2ZJ8 A;  1ZQE A;  2MAX A;  3RJK A;  9ICV A;  1S97 A;  1TKD A;  4RT2 A;  3JPT A;  5HRI A;  1JXL A;  4X4V A;  2VA2 A;  1UT5 A;  4PH5 A;  5BOL A;  2BPF A;  4O5E A;  1K1Q A;  4UBC A;  2DPI A;  4BWM A;  3QE9 Y;  4NKU A;  4X4Q A;  1XO1 A;  4PHE A;  1XWL A;  4UAZ A;  4UB2 A;  3V6J A;  4DFK A;  1XS9 D;  5KFB A;  1ZQX A;  3V7L A;  4B9U A;  4DOA A;  5HRB A;  3HJ1 A;  1NZP A;  1ZQL A;  4YCX A;  4O3R A;  5IIN A;  4I2D A;  2ZJ5 A;  3ISB A;  1L3U A;  4IQW A;  4X4O A;  5DDY A;  3KHL A;  3ETL A;  4KMU A;  2UVW A;  3RRG A;  3TAR A;  4GXJ A;  1MQ2 A;  5HRL A;  3PW7 A;  2IMW P;  3LK9 A;  4ELU A;  3K4G A;  4TUS A;  4F4W A;  4UD4 A;  1TK8 A;  5EWE A;  2FLL A;  9ICE A;  1TFY A;  8ICK A;  3K75 D;  4DF8 A;  3Q8M A;  2W9C B;  1A76 A;  4RQ7 A;  4IR9 A;  4ECV A;  4GC7 A;  4DOC A;  4C8N A;  2OWO A;  4RQ1 A;  2PFP A;  2HHQ A;  4WC7 A;  4RT3 A;  2W8L A;  3V6H A;  3M9N B;  4DLG A;  3ISC A;  1ZJM A;  2R8J A;  2Q0Z X;  1D8Y A;  2BCQ A;  5J2E A;  2MUT B;  5KFE A;  3RH5 A;  3RJG A;  2ASJ A;  5CB1 A;  5IIJ A;  3RBE A;  2W9M A;  3SV3 A;  1TK5 A;  2PFQ A;  5J2K A;  2R8K A;  4LZG A;  3M8S A;  3IM1 A;  4X4T A;  3EPI A;  3Q8P B;  3WFO A;  4YD2 A;  4KLM A;  4YN4 A;  8ICX A;  8ICI A;  1VJ7 A;  8ICW A;  4WC3 A;  4XQ8 A;  4X4R A;  5HC9 A;  2BCR A;  3WFR E;  2PFO A;  1NO5 A;  2C2D A;  2ZHB A;  5HMM A;  4F5O A;  7ICE A;  3QZ8 A;  3OHB A;  2FPL A;  4EYI B;  3MGH A;  3JPQ A;  4KTQ A;  5HNK A;  1NJW A;  3TFR A;  3TQ1 A;  2KFN A;  3H37 A;  3NYB A;  5HHH A;  5KFM A;  5KT2 A;  7ICH A;  1L3V A;  3Q8S B;  5J0S A;  3EYZ A;  3H8W A;  3IHQ B;  1Z00 A;  4DS5 A;  7ICM A;  4YXM A;  4J9O A;  4J9L A;  4JV0 A;  4BXO A;  3GV7 B;  7ICF A;  1MIV A;  4F4Z A;  8ICS A;  4AT7 B;  5CJ7 A;  4F91 B;  3MGI A;  2AGO A;  4RNM A;  1JMS A;  4MF2 A;  4O3S A;  1X9S A;  4IRD A;  4QZF A;  4Q8F A;  1WOT A;  5KFI A;  4RUC A;  3MDC A;  4YMM A;  4DL4 A;  4IRK A;  3LQC B;  9ICS A;  5DKW A;  5KFP A;  3ZDD A;  1K1S A;  1L3T A;  2UVR A;  7ICI A;  4ATB B;  4YR3 A;  4PGY A;  5DQH A;  3BQ2 A;  1KLN A;  4MFA A;  2RFF A;  4QZA A;  3AQL A;  4O5C A;  3SV4 A;  1ZJN A;  1ZQS A;  1JN3 A;  1SZP A;  4F5R A;  3PX4 A;  3ZDC A;  5J2H A;  3PY8 A;  2PI5 A;  4XA5 A;  4UQG A;  4WC5 A;  2ZH2 A;  4M04 A;  2XY6 A;  4NM2 A;  8ICV A;  2XGP A;  4RQ5 A;  4FHV A;  5KFH A;  1PX5 A;  5KFR A;  8ICZ A;  3PO4 A;  2FPM A;  2DR9 A;  4UAY A;  3GIL A;  3KHH A;  4I28 A;  5DG7 A;  2PBE A;  4UB5 A;  1ZQC A;  4HYK A;  4F93 B;  4M47 A;  1NK0 A;  3H40 A;  4FBU A;  4UBB A;  1ZQU A;  4M9G A;  2AJQ A;  5KG2 A;  1XSL A;  8ICA A;  1RPL A;  4Q43 A;  4C8L A;  3E2E A;  2O1P A;  4B9M A;  4PHD A;  5KTQ A;  2ZTD A;  1ZQD A;  5JUM A;  1WCN A;  7ICR A;  3ZDA A;  4RNO A;  8ICM A;  3ORY A;  3TAN A;  4O9M A;  1S10 A;  2FPK A;  3PML A;  4RWP A;  2HHS A;  5CHG A;  1ZQY A;  4QZ8 A;  3GDX A;  1RXW A;  4TQR A;  2W9B A;  3C2L A;  4CCH A;  4QZB A;  3H4B A;  2BCU A;  2V4R A;  5HML A;  8ICN A;  4X0B A;  1TFW A;  1DK3 A;  4O3O A;  1KFT A;  1NJX A;  2ZH4 A;  1UT8 A;  4DQI A;  4AT8 B;  5DDM A;  4I2B A;  1T4G A;  4M9J A;  4RWN A;  5KG1 A;  2BDP A;  9ICU A;  1ZQH A;  4NLN A;  2KZZ A;  3HJ4 A;  4UB3 A;  4BGD A;  3RH6 A;  2V9W A;  9ICW A;  1KNY A;  4M9N A;  4NXZ A;  3H38 A;  3V6K A;  4DSJ A;  1U45 A;  3GIJ A;  1RXV A;  5KFX A;  3ZD9 A;  8ICQ A;  4I2A A;  4DOB A;  1R8A A;  3BDP A;  4ED6 A;  4QZE A;  2JEJ A;  3EWA A;  4UAW A;  8ICR A;  2I1Q A;  7ICK A;  5D4B A;  5J0U A;  4DSF A;  3ISD A;  4E7X A;  3UQ0 A;  4X5V A;  5KT5 A;  1SL1 A;  1A77 A;  3JPR A;  3M9O B;  3MR3 A;  4DSI A;  9ICR A;  4FHW A;  7ICJ A;  1DOQ A;  4EBE A;  4AT9 B;  1UEU A;  5CA7 A;  4KN7 A;  5DQI A;  9ICF A;  3AQM A;  4EEY A;  1D8L A;  4B9N A;  2Y1I A;  3LWM A;  4EYH B;  3Q8L A;  1KEJ A;  2IBK A;  5HRK A;  1U49 A;  5DBA A;  1DGS A;  4QZI A;  1BPX A;  4YVZ A;  4FBT A;  4Z6E A;  1R8B A;  4FHY A;  5KG7 A;  4XQ7 A;  4NLG A;  3H7I A;  5J0Y A;  2KFZ A;  5DLG A;  9ICP A;  3MAB A;  2DFL A;  3GIM A;  2LYH A;  5DG9 A;  2DPJ A;  1KFS A;  4DWI A;  1XC9 A;  5DGB A;  4R64 A;  2HVH A;  1NK5 A;  1LB2 B;  5KG6 A;  5KFJ A;  3T3F A;  9ICA A;  3C23 A;  2M2T A;  4ELT A;  1OU5 A;  5KFZ A;  5J2G A;  2ZH9 A;  2M2U A;  4DO9 A;  4I2J A;  1PZN A;  2C28 A;  4P2H A;  3N4M B;  1QSL A;  2C22 A;  9ICT A;  5KFS A;  4XRH A;  5DB9 A;  3HWT A;  2BHN A;  3C5G A;  4WBY A;  3JPP A;  1CEZ A;  8ICJ A;  3PV8 A;  1KSP A;  4E0D A;  5F2V O;  5DLF A;  4DFJ A;  1S0M A;  1ZQZ A;  5L1K A;  4QZH A;  1BNO A;  1T3N A;  4FHX A;  4B9V A;  1NOM A;  4M6W A;  4ECY A;  5HRF A;  4R66 A;  3EW9 A;  1JIH A;  4EBD A;  1SL2 A;  3RJH A;  4M9L A;  5KFA A;  2BQ3 A;  9ICB A;  1CUK A;  2R8G A;  5EWG A;  3C66 A;  2HHX A;  4MFF A;  1SKR A;  4Q8E A;  4ECX A;  5J2J A;  3BQ1 A;  4O3N A;  2XC9 A;  4R65 A;  4I2H A;  4KLT A;  4DL7 A;  5HRD A;  3RB4 A;  4ED8 A;  3H3A A;  2I9G A;  3V7J A;  1ZQN A;  4K4G A;  4DQS A;  1N48 A;  2Y1J A;  1NKB A;  1S0N A;  9ICJ A;  3RH4 A;  5D49 A;  8ICE A;  1JAJ A;  3Q8K A;  3RTV A;  5KFF A;  1Y88 A;  2JEG A;  4M2Y A;  4NLZ A;  5KFO A;  2A1J B;  4DQR A;  2HVI A;  5J2B A;  2HHW A;  3HX0 A;  4WC0 A;  3KHG A;  4P4O A;  2XO7 A;  4P4P A;  2ZUD A;  3SZ2 A;  2BKE A;  4YR0 A;  3SYZ A;  5C5J A;  4ED1 A;  3PW2 A;  3RR7 A;  4DQP A;  1FA0 A;  3OUY B;  4PHA A;  4KLG A;  3BJY A;  2DR8 A;  3RBD A;  4YFK A;  3AQN A;  2H5X A;  1KDH A;  4UB1 A;  4I2I A;  4RPY A;  1RZT A;  4X4P A;  4JUZ A;  3QZ7 A;  1ARO P;  3B0Y A;  2A1J A;  5KFQ A;  1VFG A;  4UB4 A;  4E8F A;  2ZUB A;  4ED3 A;  3KTQ A;  2Q66 A;  5KFG A;  5CR0 A;  3UPQ A;  2AQ0 A;  3EPG A;  4KLD A;  1TAU A;  8ICP A;  2F1J A;  3JZ0 A;  4KLQ A;  1B43 A;  1X9M A;  1SL0 A;  2FMP A;  9ICH A;  4KLL A;  3NGD A;  2HW3 A;  1ZQO A;  4DS4 A;  4JWM A;  4J9K A;  4IRC A;  2XGQ A;  5DEC A;  2DR7 A;  1ZQQ A;  1F5A A;  1ZET A;  4YG2 A;  2BR0 A;  2FLP A;  3MR6 A;  4YXJ A;  1ZQV A;  1BPE A;  5KG4 A;  4YD1 A;  3OJU A;  1TK0 A;  5KFV A;  2ZH3 A;  5HRH A;  3OGU A;  8ICC A;  4F5N A;  2ZHA A;  4F2R A;  9ICO A;  3AU6 A;  4DFM A;  1UA0 A;  5KFW A;  5KFD A;  2NRW A;  5KFC A;  3UXP A;  5HRG A;  1TAQ A;  4M6W B;  5DQG A;  4X4N A;  4NLK A;  4RZR A;  1RYR A;  4K4I A;  8ICB A;  3H4D A;  4ED2 A;  3PW5 A;  1T7P A;  1U48 A;  4YMN A;  2UVV A;  5KFK A;  4ECQ A;  2UVU A;  2FMS A;  2W8K A;  4PHP A;  3G6Y A;  2IHM A;  3RJJ A;  4O3P A;  3SI8 A;  3OSP A;  4EZ9 A;  4KLH A;  4WCW A;  4J9M A;  5J0W A;  3PR5 B;  3OUY A;  4DL6 A;  5J2F A;  4TUR A;  4GXI A;  1R8C A;  2AGP A;  4ECT A;  3PVX A;  1JQR A;  4BWJ A;  3PX6 A;  4F92 B;  2BGW A;  1HUZ A;  1Q78 A;  1KRP A;  9ICC A;  4QZD A;  4DLE A;  4ECS A;  4QZ9 A;  7ICL A;  3V72 A;  5J0O A;  5J2D A;  1SKS A;  1ZQR A;  5J2A A;  5KG3 A;  5TZV A;  5DB7 A;  2ATL A;  4ED7 A;  3C2M A;  2P66 A;  9ICL A;  2M2V A;  2NRK A;  5L1I A;  5L1J A;  4KIT B;  3MR2 A;  1KFD A;  4O5K A;  4AT9 A;  3WFQ E;  4P4M A;  2B21 A;  3HPO A;  5J2I A;  4KLE A;  2HHP A;  2AGQ A;  2ZTE A;  5IIL A;  5J0X A;  4RQ3 A;  4TQS A;  4QWC A;  4ECW A;  3RJE A;  2KZ3 A;  4I2F A;  4DSE A;  5L9X A;  4F2S A;  2RDI A;  4DFP A;  4KLI A;  4DL5 A;  9ICX A;  3H39 A;  2BQU A;  3GII A;  2JEF A;  3OSN A;  3PO5 A;  7ICT A;  2ISO A;  4JK1 A;  2R8I A;  3PW0 A;  1COO A;  4DEZ A;  4RNN A;  1BPZ A;  1ZQB A;  8ICO A;  4XUS A;  5J2C A;  4IQU A;  4K4H A;  7ICP A;  4RQ0 A;  4UD5 A;  2PI4 A;  4I29 A;  9ICQ A;  3C1Z A;  5KG5 A;  3RB0 A;  1NJZ A;  2DRA A;  2DRB A;  3HW8 A;  2ISP A;  4X0A A;  4MEY A;  4RPX A;  4ECZ A;  4AT8 A;  1QTM A;  2JEI A;  4RWO A;  2BPC A;  2VAN A;  4ED0 A;  4ECR A;  5KG0 A;  4Z6F A;  1QLN A;  5HHI A;  4LVS A;  1YLQ A;  4QZC A;  3RB3 A;  3GIK A;  3MBY A;  2RDJ A;  2DR5 A;  2W9B B;  3C18 A;  4DSK A;  2ID1 A;  3QEA Z;  2VA8 A;  2M9N A;  2V4Q A;  2NRX A;  4F5Q A;  4MFC A;  3RAX A;  4IQT A;  4J9P A;  2ALZ A;  1N56 A;  2M2W A;  5DGA A;  4JV2 A;  8ICY A;  5IIK A;  3HIY A;  8ICF A;  9ICN A;  4QWE A;  1NK9 A;  1ZQJ A;  5DG8 A;  9ICK A;  4RQ4 A;  1Q79 A;  2C2E A;  1SKW A;  5KFL A;  5EWF A;  5KFU A;  4QWA A;  1NKE A;  3WFP A;  3ZD8 A;  3MFH A;  8ICU A;  9ICG A;  1D9D A;  3JYY A;  3Q8Q B;  3UQ2 A;  4YMO A;  4B9L A;  3GV5 B;  4RQ8 A;  4J9Q A;  4F50 A;  3TAQ A;  3MDA A;  4F5P A;  3RRH A;  4RQ6 A;  3TFS A;  1TVA A;  3OHA A;  3OVA A;  4QW8 A;  3AUO A;  1ZQA A;  5F9N A;  4F4Y A;  4WC6 A;  2PXI A;  4M9H A;  3M8R A;  4ATB A;  1UA1 A;  4GC6 A;  3JPS A;  4DSL A;  3GQC A;  7ICG A;  4I2C A;  4J9N A;  4KLF A;  1ZYQ A;  4ECU A;  3Q8R B;  1B22 A;  5DED A;  1ZQP A;  4JWN A;  4X4U A;  5III A;  2BCS A;  5DB6 A;  4C8M A;  5J0T A;  4FH3 A;  2F1I A;  4IG8 A;  4DQQ A;  5KFN A;  4GXK A;  4NY8 A;  2ZH7 A;  3OJS A;  3BQT A;  1MQ3 A;  3B0X A;  1NKC A;  3UXN A;  4EP7 A;  3JPN A;  5KFT A;  1RYS A;  5KT4 A;  4WC1 A;  5F9L A;  4J9S A;  3TI0 A;  2O5A A;  3NTU A;  5DBB A;  3KHR A;  1JXE A;  4RPZ A;  1L3S A;  2FMQ A;  3T5L A;  8ICL A;  4RQ2 A;  4NKT A;  5J0R A;  4M0A A;  3FDS A;  3PR4 A;  3BQ0 A;  1HUO A;  5BOM A;  7ICO A;  2MUT A;  3T5K A;  1ZQI A;  1BVS A;  4F4X A;  4YR2 A;  4FS2 A;  3H8J A;  3OVB A;  1U9L A;  3PW4 A;  5CP2 A;  2HHV A;  2PFN A;  2ZH8 A;  1XSP A;  2AU0 A;  4QZG A;  2IHN A;  3ZDE A;  3RAQ A;  1NK4 A;  4KLJ A;  4EBJ A;  4WC2 A;  1L5U A;  3QEB Z;  3WFS C;  4QW9 A;  2W9A A;  4ZH4 A;  2XCA A;  3GFK B;  2ASD A;  1V4A A;  7ICQ A;  4ELV A;  3MR5 A;  2HHT A;  5J0P A;  1T8E A;  5J29 A;  1Z3E B;  4FS1 A;  1NJY A;  3TAP A;  9ICM A;  5EOZ A;  2J6S A;  3G6V A;  4G3I A;  3UXO A;  7ICU A;  4BDP A;  3PMN A;  1QSS A;  3C21 A;  2C2R A;  2BE3 A;  1TFR A;  1BPB A;  2VA3 A;  4PGX A;  4AT7 A;  4RUA A;  1S0O A;  1ZQG A;  4BXO B;  1Z00 B;  4WC4 A;  2ZH6 A;  3C2K A;  2F1H A;  3PNC A;  1JX4 A;  3C5F A;  3AQK A;  4X4S A;  5J0Q A;  4GLX A;  4MF8 A;  1IM4 A;  4DL3 A;  1D9F A;  2ZTC A;  4KN4 A;  2BPG A;  2ZJA A;  3V7K A;  7ICS A;  5IIM A;  4IR1 A;  2IA6 A;  9ICI A;  3T5J A;  2GWS A;  1QSY A;  3UPS A;  1ZQF A;  4F3O A;  4FH5 A;  1LV5 A;  3N97 B;  8ICG A;  1UEV A;  4JV1 A;  4S3N A;  4Q45 A;  7ICV A;  1U47 A;  1HJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...