3ISCA

Binary complex of human dna polymerase beta with an abasic site (thf) in the gapped dna
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title DNA polymerase beta substrate specificity: side chain modulation of the "A-rule".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 110
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3iscA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 3iscA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 3iscA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3iscA03
4P4PA 3LDAA 3V7KA 4I27A 3UXPA 2M2VA 1TV9A 1CEZA 5KG0A 2F1JA 1S10A 4ECYA 2J6UA 5J2FA 2ZJAA 1XC9A 2ISPA 3PY8A 3AQKA 1MC8A 5KFYA 5J2BA 4YR3A 5HRFA 3EW9A 5KFPA 4X4RA 4RT2A 1RXWA 1ZQFA 7ICFA 5HRHA 4I2DA 4EYIB 1BPZA 4KLUA 5HR9A 4KN4A 1R8CA 1N56A 9ICSA 4F4XA 4I2FA 4FH5A 3MFHA 4M6WB 1ZQUA 2FMPA 1KNYA 5KFKA 1SKWA 3IM1A 2AQ4A 4M04A 2XGQA 3RH5A 4FO6A 4DQRA 2PFQA 8ICCA 3L9DA 4UB3A 4KN7A 4QZGA 2V4QA 2ASLA 9ICCA 1UT5A 5L1IA 2Y1IA 4DQPA 2IMWP 4Q43A 1V9PA 3AQMA 7ICLA 1DK3A 1L3TA 5D49A 1NK6A 1NK0A 4YMNA 3K75D 3OHBA 1T3NA 1S0OA 2ZH9A 3MR3A 3RBDA 5J0XA 4KITB 1VJ7A 1T4GA 4B9MA 2P6UA 4JWNA 2HW3A 1HJPA 3BQ1A 2ID1A 3NYBA 1U45A 2M2WA 2XC9A 1RXVA 3ZD8A 3GV8B 1ZQHA 4Q44A 3GDXA 4I2AA 4JWMA 2NRKA 3HIYA 1PX5A 4X0BA 4QW8A 1R89A 3H8WA 3OGUA 5F2VO 2IHNA 3BDPA 1SL0A 3C1ZA 1NKBA 5BOLA 5J2DA 3ZDCA 4J9SA 2AJQA 1K1QA 2PFOA 4F4WA 8ICYA 4ELTA 2KZ3A 5DBCA 3UQ0A 1ZQKA 4IR1A 3PW4A 3EPIA 3THVA 3GIMA 3PNCA 9ICRA 4RQ3A 3SV4A 4KLLA 2HHTA 4BWJA 4Z6DA 3N4MB 2JEJA 5KG4A 2FPMA 5DQIA 4DS4A 3QZ7A 3RBEA 4EBJA 4WC1A 5KT7A 3C2MA 3UXNA 1SL1A 2BPGA 5DDYA 2GWSA 2ISOA 2BCVA 8ICWA 1ZQSA 4FHXA 1B22A 2ZH1A 1HUOA 1X9WA 4RU9A 4UAWA 2R8KA 9ICTA 4RNMA 3MDCA 5D4BA 4F2RA 1A76A 1TK0A 2HVIA 4BXOB 4WC3A 1Z00B 1KFTA 4UD5A 2XGPA 8ICHA 5DLGA 3LWMA 5IIJA 3V6KA 1UT8A 3PR4A 1EXNA 4RUAA 4EBEA 2C22A 1NK7A 1HUZA 3T5KA 3QEBZ 4ED3A 4Q8EA 9ICOA 4AT7A 1ZQQA 4GXIA 2KZZA 3FYHA 4UAZA 1UA0A 1S0MA 2DR7A 1NK4A 2VA2A 1BPYA 2BCUA 9ICWA 4RWPA 3H38A 4DFJA 1XS9D 8ICSA 2J6SA 2I9GA 5KFSA 2HHVA 4ELUA 3T5JA 1K1SA 1XU4A 5IIKA 1X2IA 4K4GA 4WC6A 2P66A 3ZDDA 9ICJA 2FPLA 5KFVA 3GV5B 2C2RA 5KT6A 9ICMA 5DG9A 3GIKA 5KG2A 1JMSA 5J0SA 4KLEA 5F9LA 4RQ2A 4LZDA 1BPDA 5TZVA 8ICLA 5DBAA 4KLIA 3RJEA 3RH4A 3TAPA 3H3AA 4KTQA 3PW5A 3QEAZ 4I2GA 1RYSA 4F92B 2W9CB 3PO4A 1MIWA 4PHPA 2M2TA 2BCQA 5KG6A 4KLDA 1ZETA 1T7PA 3HP6A 7ICGA 3ORYA 1BGXT 2AGPA 3LK9A 5HP4A 8ICZA 4WC2A 2BKEA 3H8SA 4DL5A 2I1QA 1KEJA 4QWEA 1KFSA 3RJKA 3C18A 1IM4A 1SKRA 4X4TA 4TQRA 1BPBA 3KHLA 4ED6A 4DFPA 4MEXA 3RR8A 3OHAA 5J0OA 4GC7A 2C28A 4DWIA 9ICPA 1XSNA 3KHGA 2UVUA 4F8RA 5KFTA 5L1KA 1T8EA 5HREA 4P4OA 3SYZA 5J29A 4RPYA 4ECSA 4KLFA 1S76D 1ZQEA 4ATBA 5KFRA 1TFRA 3JPSA 4GXKA 9ICNA 4FH3A 2HVHA 5EWEA 4ED0A 1U48A 1NJZA 4JUZA 4PGYA 4YN4A 3MDAA 2F1IA 1ZQMA 1OU5A 5DB8A 1KFDA 4P2HA 2DVIA 3GIJA 4MFCA 3ZDAA 2Q66A 5KFQA 3ETLA 3H8JA 5L9XA 3PMLA 4FHVA 4WC7A 3RJFA 4YR2A 4E0DA 7ICQA 1L3UA 7ICIA 8ICEA 4PH5A 4YD1A 4O3PA 4TUPA 2ZJ5A 4FHYA 1QTMA 2KFZA 1DOQA 1ZQJA 4Z6CA 4ECZA 4WBYA 3JYYA 4RQ6A 3SV3A 3WFPA 4DL2A 4NXZA 2H5XA 5DB6A 9ICIA 9ICQA 2LYHA 4QWBA 8ICJA 2BPFA 5J2JA 4KMUA 5J2AA 4B9VA 1S77D 3SI8A 4WC4A 4C8NA 4J9KA 4FBUA 4C8MA 3Q8PB 3TFSA 3Q8MA 2HHQA 4NLZA 1S0VA 2JEFA 3SZ2A 4X4SA 2ASDA 4S3NA 3T5HA 1TVAA 3HX0A 4KLHA 4DL7A 3ZDBA 5HRKA 4ECWA 2ATLA 3RAXA 9ICGA 3C2LA 3RTVA 4O5EA 5KFMA 2W8KA 3RB6A 1ZQGA 5KFBA 1KRPA 4F5QA 4DL3A 2FMSA 4IG8A 4F3OA 2DPIA 5JUMA 4AT7B 1NK5A 3C1YA 3ISDA 3JZ0A 5KG5A 4XQ7A 4B9UA 4KLOA 1SKSA 4KLMA 1BPEA 1Y88A 3IHQB 5J0UA 5J2GA 3ISBA 4J9MA 4DS5A 1MQ2A 4KLSA 1MIVA 4E7XA 4JK1A 4YG2A 4UAYA 3C66A 2DR5A 4QZ9A 5KG3A 5KFAA 5KT2A 5BOMA 3RB0A 1NJWA 1MQ3A 1ZQOA 5EWFA 3V6JA 5HRGA 1SL2A 1Q78A 2O1PA 5J0RA 1TAQA 1NJXA 7ICTA 4NLKA 3RB3A 8ICBA 5J0WA 5DQHA 2XY7A 4RQ1A 1NK8A 4HYKA 3C21A 4IQVA 1C7YA 5EWGA 3OUYA 4R8UA 4DFKA 4F5PA 4C8KA 2KTQA 1ZQZA 2FLNA 5DB7A 4Q8FA 4AT8B 7ICRA 3B0XA 3OSNA 4M5DA 3C5GA 5KFEA 1MIYA 3JPNA 1D8LA 2PXIA 4IR9A 4GXJA 4Q45A 4RNNA 3EPGA 4X4NA 4YP3A 2M2UA 4NY8A 4AT9B 5CA7A 5D46A 1U9LA 4BGDA 4QWAA 2DPJA 1U4BA 1ZQLA 4R66A 4BDPA 4M0AA 2HHXA 1S97A 5KG1A 5L1JA 5KFNA 8ICXA 7ICVA 4DEZA 3OSPA 7ICOA 3RRHA 3AUOA 2AGQA 2MUTA 3ZD9A 1SZPA 1L3VA 1LB2B 3OV7A 3QZ8A 3RJIA 8ICPA 1TAUA 3AU6A 4IQTA 4ECXA 4MFAA 2R8HA 2PFNA 3K4GA 2R8JA 2AQ0A 1WCNA 4PPXA 3Q8LA 4ED8A 5HRIA 2ZH8A 5CB1A 3PX6A 1S9FA 2M9NA 4ECRA 1RZTA 3AQLA 7ICUA 3HW8A 4RQ0A 3GV7B 1ZQTA 1QSYA 4UQGA 2V4RA 4DL6A 5DKWA 5J2EA 4EYHB 2OWOA 1DGSA 4K4HA 8ICUA 3LQCB 1R8BA 2NRZA 3PX0A 3MGHA 3RH6A 3H7IA 8ICKA 5KFXA 2VANA 3EZ5A 4B9LA 5BPCA 4M6WA 4O3RA 1BNPA 2MAXA 4E8FA 1XSLA 2W9MA 3JPRA 3V6HA 5IIMA 4DL4A 3TANA 4QZBA 2FMQA 1NOMA 4ECVA 2AU0A 4PHEA 4NKUA 4O3SA 3WFRE 4QZCA 4DLGA 4YR0A 5J0TA 2IA6A 3E2EA 2NRVA 4QW9A 5J2IA 2HHPA 1RYRA 3OVSA 4QZIA 2WTFA 9ICUA 1UEUA 2KFNA 4J9QA 1R8AA 4RWOA 9ICAA 4BWMA 5C5JA 2HHUA 4RNOA 2ZH7A 4DSKA 4DOBA 3Q8QB 3MFIA 5J2CA 4O5KA 2ZUCA 2BGWA 1TKDA 1L3SA 5IILA 2C2DA 4MF8A 4DLEA 2RDJA 5CJ7A 7ICNA 1UEVA 5DEDA 3WFOA 5KFLA 4O3OA 4EBKA 3TARA 1ZQAA 2UVVA 2VA8A 5CHGA 4I28A 2ZTEA 2BCSA 5HMMA 3GILA 4I2JA 3H37A 2KZMA 3LWLA 4QZDA 4GLXA 1ZQYA 4RPXA 5HHHA 2PI5A 4I2BA 2AGOA 7ICEA 8ICMA 2FPKA 1KTQA 3RB4A 3N97B 5KFHA 5KT4A 4F4ZA 9ICHA 4F50A 4KLTA 4M9LA 2HHWA 5HRBA 2BE3A 2RFFA 4X4OA 4MFFA 4DFMA 1UA1A 4M2YA 4E80A 2XCPA 4LVSA 3TQ1A 3MR6A 3V72A 3MR2A 2W9BA 3V7LA 3PMNA 4ELVA 1U47A 1BPXA 3GFKB 1Z3EB 3G6VA 4J9LA 3UQ2A 4EEYA 9ICBA 1ZQBA 3H40A 4NLGA 4O9MA 1NZPA 4FHWA 2RDIA 4EBCA 5HHIA 1Z00A 4B9TA 4RUCA 1ZJMA 4ED2A 4JV0A 3JPQA 4M9NA 5DGAA 4IRKA 1NKEA 8ICNA 4RWQA 7ICMA 1L5UA 3RJJA 4QZAA 4XQ8A 3MR5A 1F5AA 2ASJA 3PR5B 5J0QA 4XA5A 2BQUA 4B9NA 4PHDA 4ZH4A 1KLNA 1AROP 4ECUA 4ECQA 3AQNA 4FHPA 4F5RA 4RT3A 4DOCA 4C8OA 4I29A 2P6RA 4X4PA 1TFWA 5IINA 8ICTA 3BQTA 5IIIA 2BHNA 4UD4A 4YMMA 4QZHA 2XY5A 3HPOA 4QZFA 2XO7A 4YXJA 2J6TA 1QLNA 4YVZA 7ICPA 3UPSA 3MBYA 2IBKA 4M9HA 1FA0A 3B0YA 1UETA 5KG7A 1JXLA 3BQ0A 4WBZA 4UB4A 1X9SA 4J9OA 2ALZA 3OVAA 4RQ7A 3M8RA 4QZEA 3Q8RB 1TK5A 4LT6A 5DG8A 2ZJ8A 1DK2A 4EP7A 2ZHBA 4RQ4A 1NK9A 9ICXA 1YLQA 5F9NA 1Q79A 3M9NB 3ISCA 3OJUA 2W9CA 3UPQA 5DBBA 2Y1JA 1N48A 2ZH2A 3T3FA 2ZH4A 4O0IA 4M9GA 4RPZA 2NRXA 5KFUA 2W8LA 4QZ8A 2FLPA 4WCWA 2DFLA 1JIHA 4JV2A 5DG7A 4DSEA 5CWRA 1WCLA 4O5CA 3ZDEA 3H4DA 4DSIA 2A1JA 2ZUDA 4KLJA 2ZH6A 3KHRA 5DGBA 4DQIA 4F4KA 3OVBA 1TFYA 2BR0A 1JN3A 3C2KA 5HNKA 4PGXA 1D9DA 8ICQA 5DDMA 1CUKA 9ICLA 4YXMA 1LV5A 1ZQRA 4J9PA 4DSJA 4O3QA 2JZBA 3EWAA 4O3NA 5KFFA 3M9OB 4X5VA 1QSSA 2UVRA 2ZHAA 5DQGA 3JPTA 1KSPA 4UB2A 4F91B 4WC5A 2NRWA 4DSLA 4F5OA 4NLNA 3H39A 3C23A 4Z6FA 2JEGA 2ZTDA 4I2IA 3GQCA 5KTQA 4EZ6A 4YCXA 4JV1A 3G6XA 3PO5A 3BJYA 4X4QA 4XRHA 5KFCA 3HWTA 4G3IA 4ATBB 5IIOA 4MEYA 5J0YA 4I2EA 1ZQNA 3RRGA 3PVXA 4IRDA 3Q8SB 5J2KA 4RZRA 4ED7A 1QSLA 3NTUA 1ZYQA 2BCRA 4R64A 4M47A 3PW7A 3TI0A 5J0PA 1XO1A 3JPOA 2W9BB 4J9NA 4Z6EA 3Q8KA 4FBTA 4UBBA 3MABA 3PW0A 4NM1A 5KFDA 4ECTA 3FDSA 4IRCA 9ICKA 3WFSC 4NM2A 2NRTA 3AU2A 1KDHA 4KLGA 5DECA 5DB9A 5KFIA 4DOAA 4P4MA 4F4YA 2HHSA 1WOTA 4C8LA 3HJ4A 1XSPA 4QWDA 4B9SA 4ED1A 2ZTCA 4YD2A 1ZQPA 4J9RA 1ZQIA 2FLLA 3BQ2A 5HMLA 3UXOA 4YFKA 3M9MB 3RAQA 1BNOA 4RQ8A 5KT3A 2PBEA 4CCHA 1PZNA 8ICGA 1ZQWA 3T5LA 2ZH3A 4XUSA 1D9FA 1H38A 5CR0A 5KFWA 1X9MA 3C5FA 1JQRA 4QWCA 1NO5A 2BQRA 4TUSA 3M8SA 4EBDA 3PV8A 4LZGA 9ICVA 2R8GA 4YQWA 2BQ3A 1JAJA 2F1HA 3NGDA 4DQSA 5HRDA 5HC9A 1VFGA 2ZH5A 2PI4A 3V7JA 1ZJNA 5DLFA 2O5AA 4I2HA 2UVWA 8ICAA 1ZQVA 4PGQA 3OJSA 4K4IA 4F2SA 1IXRA 2XY6A 2ZUBA 4TUQA 1XWLA 2XCAA 1RPLA 8ICRA 4GC6A 2KP7A 4RWNA 5J2HA 4DF4A 2DRBA 1COOA 4TURA 1JX4A 4R65A 5KFZA 5KFJA 4DSFA 4AT8A 4MF2A 3RR7A 4M9JA 5EOZA 4RQ5A 2B21A 2IHMA 4UBCA 4UB5A 1ZQCA 3KTQA 1JXEA 2C2EA 4AT9A 3H4BA 2V9WA 3WFQE 3OUYB 8ICVA 4R63A 2A1JB 5KFGA 4R8UB 3PX4A 3TAQA 1D8YA 2PFPA 3RJGA 8ICFA 9ICFA 2DRAA 4X4UA 1ZQDA 4NKTA 4X4VA 1ZQXA 4YMOA 4FS1A 3MGIA 4X0AA 4BXOA 4F93B 3RJHA 7ICKA 2Q0ZX 1V4AA 1TK8A 2W9AA 4UB1A 5CP2A 2DR9A 2JZBB 1U49A 2VA3A 1A77A 1NKCA 4DQQA 2JEIA 3JPPA 2R8IA 3HT3A 2BDPA 4IQWA 9ICEA 4TQSA 8ICOA 5HRLA 5KT5A 4I2CA 3KHHA 1MSWD 3TFRA 3HJ1A 5KFOA 4EZ9A 4FS2A 3QE9Y 5L1LA 7ICHA 1BVSA 8ICIA 4WC0A 2MUTB 4IQUA 1NJYA 4DF8A 3EYZA 1B43A 3GIIA 4PHAA 3PW2A 1S0NA 7ICJA 4KLQA 7ICSA 4F5NA 2DR8A 4DO9A 3G6YA 2BPCA 2KN7A
chains in the Genus database with same CATH superfamily
4P4PA 2JRZA 3AMZA 3UXPA 2NO5A 3DV9A 5J2FA 1XC9A 1MC8A 5J2BA 4YR3A 4I2DA 3CK6A 4KN4A 1R8CA 3BS5A 4M6WB 1ZQUA 2HDOA 2B0CA 3RH5A 4FO6A 4QZGA 3H0RB 2V4QA 3ERCC 5L1IA 2DGZA 2IMWP 1N5XA 2EANA 2E8OA 5AI4A 1L3TA 5D49A 4P0QB 4YMNA 3K75D 5AI6A 5AK5A 3OHBA 3MR3A 3IG8A 4B9MA 3NYBA 3ZD8A 4Q44A 3GDXA 5B3QA 4QW8A 4NXXA 2GH1A 2JR5A 1FFVA 3H8WA 1JROA 3BDPA 5GTHU 4USAA 2AJQA 2OXOA 5GTIU 2HOIA 2KZ3A 5DBCA 3UQ0A 1ZQKA 3EPIA 3THVA 5AK3A 9ICRA 5B66U 1DXSA 2HHTA 2RLTA 2LMRA 2FPMA 5DQIA 3QZ7A 4WC1A 3C2MA 2ISOA 5CFUA 2XIDA 1Z00B 5G5HA 5ALMA 5IIJA 1FFUA 9ICOA 1UCVA 2E1FA 4UAZA 1S0MA 1NK4A 1BPYA 1WG8A 2LKYA 2K60A 1ECWA 9ICWA 3KOOA 3M6ZA 1CI4A 5KFSA 3M1YA 2E8NA 3F2BA 9ICJA 2FPLA 3GV5B 3NWIA 3SD7A 4KLEA 5F9LA 4Y2RA 1L7OA 3H3AA 4KTQA 3PW5A 4I2GA 3PO4A 2BCQA 5ALSA 7ICGA 3LK9A 5HP4A 8ICZA 1IM4A 4LEVA 5HR7A 2ODGA 4OD0A 3KHLA 4ED6A 3OHAA 3KHGA 4F8RA 2G5HB 4P4OA 4NL9A 5L1MA 4KLFA 1S76D 4GXKA 5AM4A 9ICNA 4OJ5A 4N7RA 3ER9B 4ED0A 1U48A 1OU5A 4PL1A 1L8LA 2F1IA 1QCKA 1ZQMA 3ZDAA 1JRPA 5KFQA 5L9XA 4E0DA 4O3PA 4NJ8A 1ZQJA 4WBYA 4Z6CA 4DL2A 4NXZA 5C0YA 8ICJA 2AH5A 4JLZA 5J2JA 3L5KA 4EEBA 3NS1A 2P35A 3TFSA 4NLZA 2JEFA 4X4SA 2ASDA 5CEHA 3C2LA 4P0PB 5ALIA 2W8KA 3RB6A 4NL9C 4F5QA 2FMSA 4XQ7A 1RDFA 3ISBA 1Y88A 4J9MA 5J2GA 5AKJA 2H3VA 4JK1A 5KT2A 1MQ3A 1ZQOA 5EWFA 2O1PA 5JTGA 3QXGA 7ICTA 4NLKA 4F71A 2F2AB 4RQ1A 2OYYA 1S8OA 1DGJA 4R8UA 4DFKA 2HN1A 1F44A 2FLNA 4AT8B 5AM1A 3N28A 1NNLA 2OH2A 3C5GA 1MIYA 4FO1A 3JPNA 2PXIA 4YP3A 3PHZA 2DBYA 4AT9B 1OXJA 1U9LA 4BGDA 1S97A 1D8BA 4US8A 3OSPA 3AUOA 2AGQA 1LB2B 4UATA 3AN1A 2R8JA 5H2FU 1WCNA 4NLBA 1S9FA 2H3QA 1QSYA 5AI9A 5HRFA 1R8BA 1DGSA 3H7IA 4UAUA 5KFXA 4AP9A 4LEZA 3KZIU 4M6WA 5IIMA 2KK0A 5AK4A 3KD3A 4O3SA 3UMCA 1NZBA 2OCEA 4QZCA 4DLGA 4YR0A 2HHPA 4RQMA 9ICUA 4UAVA 4J9QA 1R8AA 2KNJA 9ICAA 4BWMA 3E0FA 2ZH7A 4G9BA 4DOBA 4P0QA 1VDVA 4MF8A 4DLEA 3WFOA 5D61A 2ZTEA 3F53A 4I2JA 2KICA 2KZMA 3CRXA 4QZDA 1ZQYA 4I2BA 8ICMA 9ICHA 2FPKA 5HRBA 2RFFA 4M9LA 5AI5A 5KAIU 1UA1A 2YMLA 3TQ1A 1L7NA 4UB6U 2JMGA 1U47A 1N5WA 1BPXA 2W11A 3G6VA 3UQ2A 9ICBA 1ZQBA 3H40A 4O9MA 5AHXA 1Z00A 1ZJMA 4EEKA 4RWQA 1NKEA 5ALYA 2N1RA 5AM2A 3HJEA 2ASJA 4ZH4A 4O68A 1AROP 3AQNA 4F5RA 2HBMA 5IINA 3BQTA 4UD4A 1PUZA 2BDUA 4YMMA 2XY5A 4CF3A 4YXJA 4PZNA 2J6TA 2RP5A 4UB4A 2W7OA 1X9SA 3Q8RB 1N2XA 1DK2A 2ESEA 1N48A 2Y1JA 5DBBA 1VJ5A 2ZH4A 4M9GA 4RPZA 5KFUA 1V38A 2W8LA 2DFLA 4RQNA 2A1JA 1ZRNA 5DGBA 3OVBA 2BR0A 5HNKA 4PGXA 4EX7A 3VC8A 5KFFA 3M9OB 4O3NA 1QSSA 1KSPA 4WC5A 2NRWA 2F77X 4F5OA 3H39A 4I2IA 3GQCA 5KTQA 4C0ZA 4JV1A 3PO5A 2E8PA 2W7PA 4I0UA 4G3IA 4ATBB 3QUTA 5J0YA 4I2EA 2NV3A 4IRDA 4ED7A 4RZRA 4JLXA 5ALHA 2BCRA 2KSOB 4M47A 4LEWA 1F5SA 2ZIVA 3TI0A 2G09A 1XO1A 5J0PA 5JTIA 3Q8KA 4FBTA 1X9XA 5KFDA 2E8MA 2I6XA 1T3QA 3AU2A 5JU5A 5AICA 5DB9A 2W3RA 4F4YA 2EWRA 3HJ4A 4HX0A 4QWDA 2ZTCA 4A8EA 4YD2A 3K7DA 3TADA 1ZQIA 3UXOA 3RAQA 3K1ZA 4BJQA 1ZQWA 5CR0A 5KFWA 1X9MA 3C5FA 4QWCA 3LYSA 3M8SA 2R8GA 5HC9A 3MC1A 2Y0SC 2ZIUA 2OEHA 1K5OA 4I2HA 4PGQA 2ZUBA 1XWLA 2YB1A 1RPLA 2XCAA 4GC6A 4DF4A 4WOYA 1JX4A 4DSFA 4AT8A 2KHQA 3ED5A 1O03A 5EOZA 1Q3VA 4AT9A 3H4BA 3OUYB 4LEYA 5AM0A 2HMXA 4CE6A 2BZFA 2BBJA 3TADC 1V4AA 2JZBB 1A77A 4DQQA 2JEIA 1L6NA 3HT3A 1VLBA 4K99A 4TQSA 4I2CA 5E79U 4FS2A 3QE9Y 3GZFA 4IQUA 4AYBF 3PW2A 7ICJA 4KLQA 7ICSA 2D6FC 4DO9A 2KN7A 5DGAA 1X9WA 2R8KA 3IG5A 3LDAA 5KL1B 3V7KA 1KL9A 2M0NA 1CEZA 5KG0A 4ECYA 5CHEA 3EW9A 1SXEA 5KFPA 4RT2A 7ICFA 5HR9A 4WJ3B 4O69A 2B56A 1RYUA 2YQEA 1SKWA 2MRLA 4OAGA 3IM1A 2AQ4A 2FI1A 4KN7A 3N7RC 2EAPA 1UT5A 4DQPA 2Y1IA 3BQ7A 1FO4A 1UQVA 3NRZA 1T3NA 1S0OA 1DRGA 3RBDA 1VJ7A 4KITB 4C4TA 4F72A 2P6UA 3WK7A 1ZQHA 3NASA 2NRKA 2KEYA 2JV3A 1R89A 2WF9A 3OGUA 4CF5A 2KV2A 5AKGA 5J2DA 4ELTA 4IR1A 3E58A 3PW4A 4XJEA 3PNCA 4RQ3A 4DS4A 1SL1A 2GWSA 9ICTA 5ALZA 3MDCA 4F2RA 2HVIA 1TK0A 4BXOB 2XGPA 3U26A 2ZXIA 1JUDA 1UT8A 4EBEA 1NK7A 4Q8EA 2C22A 4AT7A 4ED3A 2YN4A 4GXIA 1UA0A 4EELA 2VA2A 2DKXA 2DUYA 2BCUA 1X6JA 4RWPA 2G08A 1XS9D 8ICSA 3IRUA 2I9GA 1QQ5A 3QNMA 3B9JA 4K4GA 2P66A 3TKAA 3ZDDA 2C2RA 9ICMA 5KG2A 1JMSA 5J0SA 5TZVA 3TAPA 1RYSA 1MIWA 5KG6A 1ZETA 3HP6A 4DCCA 2W54A 1SKRA 4X4TA 1BPBA 3RR8A 4MEXA 5J0OA 4GC7A 2C28A 4DWIA 9ICPA 2UVUA 3SYZA 5J29A 2RQ5A 5B5EU 4ECSA 1C20A 4CRXA 5KAFU 4ATBA 2YMMA 4FH3A 3RFAA 4JUZA 4PGYA 4YN4A 1B0XA 3MDAA 2KSOA 5DB8A 1KFDA 3GIJA 4MFCA 2Q66A 4FHVA 2CXYA 1IV8A 3RJFA 4NXTA 4YR2A 4PH5A 4YD1A 1L7MA 2KFZA 1DOQA 3N7SC 3JYYA 3WFPA 2GAFD 2H5XA 9ICIA 2LYHA 1Q3UA 5AM3A 2QB0A 3WKAA 4LJXA 5ALDA 4C8MA 3Q8MA 5EE1A 4KLHA 4S3NA 3HX0A 4DL7A 5HRKA 4ECWA 3RAXA 1SWWA 2W04A 5A0LA 1LKYB 1KRPA 1YZ7A 5JUMA 4C7ZA 1MQ2A 1MIVA 4DS5A 1Z4NA 4E7XA 1SGGA 1PK1B 4QZ9A 5KG3A 5BOMA 3RB0A 5HRGA 5AM5A 1NK8A 4IQVA 3OUYA 3QU2A 3MCRA 3NVVA 7ICRA 3B0XA 3OSNA 2ES6A 4X4NA 5D46A 4M0AA 1U4BA 4R66A 3KKAA 5KFNA 8ICXA 3OPXA 4DEZA 7ICVA 3OV7A 5HR6A 4BX9C 2HCFA 1TAUA 3AU6A 4IQTA 4MFAA 2R8HA 3K4GA 2AQ0A 3S6JA 3PX6A 4ECRA 1COKA 1KKXA 3GV7B 5DKWA 5J2EA 3PSFA 3PX0A 2WF7A 3RH6A 2LPEA 3CYMA 3SQIA 5ALTA 4UASA 4K8VA 2R18A 3NVOA 1BNPA 4DL4A 3TANA 4QZBA 2OM6A 4PHEA 3WFRE 2DL0A 3AQEA 3IN5A 2IA6A 3E2EA 5J2IA 1RYRA 2KFNA 4RWOA 2LBOA 2KJ8A 2HHUA 4RNOA 2FDRA 3KKAC 2KVSA 3MFIA 2ZUCA 1TKDA 1SWVA 5IILA 5J8YA 2MU2A 2RDJA 5CJ7A 3SMVA 1UEVA 1ZD3A 4AYBC 4O3OA 2UVVA 2VA8A 2BCSA 3GILA 3H37A 1OW5A 4IS7A 4GLXA 4RPXA 2AGOA 5ALNA 5KT4A 5JRTA 4X4OA 4MFFA 4M2YA 4LVSA 3A0HU 3MR6A 4KMOB 2W9BA 3V7LA 2Y0SF 4ELVA 4IL6U 1Z3EB 2NYVA 3VCBA 3SR6A 1YZ6A 3K1RB 4B9TA 3WKEA 3JPQA 4OJLA 8ICNA 7ICMA 2WB1C 3ETRA 4IC9A 2BBHA 4QZAA 1F5AA 1RQNA 4US9A 5J0QA 5J8YC 4XA5A 2H3ZA 4B9NA 1V97A 2G5IB 4ECUA 4CNQA 4U6PA 1TFWA 3JCFA 2BHNA 4QZHA 5EE3A 2XO7A 4YVZA 2IBKA 3B0YA 1UETA 1JXLA 2ALZA 4RQ7A 3M8RA 3AQFA 4PJ0U 1TK5A 5DG8A 2ZJ8A 4EP7A 2K4EA 4C7YA 1NK9A 1KBUA 3I76A 2LM4A 1JIHA 3FAHA 4JV2A 4O5CA 4Y2XA 3H4DA 2ZH6A 1P7DA 1TFYA 4JMUA 1D9DA 8ICQA 5DDMA 1CUKA 4O3QA 4X5VA 5DQGA 3JPTA 4F91B 1RQLA 3C23A 4Z6FA 2ZTDA 2KG5A 3QYPA 1JI7A 5KFCA 1KN5A 3PVXA 3Q8SB 5J2KA 3NTUA 2CN1A 3BZKA 4GIBA 2KD1A 3WK6A 4J9NA 4O3MA 2WAQC 3MABA 3PW0A 4NM1A 2K89A 4C4RA 2NRTA 5DECA 1J97A 4DOAA 3EF2A 4O6AA 1WOTA 4C8LA 2F3NA 4Y2UA 4J9RA 1O08A 3BQ2A 4YFKA 3M9MB 2KMDA 3QU4A 1PZNA 2FJ6A 8ICGA 1D9FA 1H38A 2GLEA 2O6KA 2BQRA 3PV8A 2BQ3A 2ZIWB 4DQSA 2WHEA 5HRDA 2OHFA 2UVWA 4K4IA 5AKXA 3OJSA 4F2SA 1YT3A 2XY6A 1ZD4A 1AQ6A 1Z1VA 2KP7A 5J2HA 1COOA 4TURA 3WK9A 4R65A 5KFZA 4M9JA 4RQ5A 5AKHA 3KTQA 4WQLA 3WFQE 2V9WA 2KJ5A 5KFGA 3TAQA 1D8YA 4X4VA 1ZQXA 1SV0C 5CFTA 2HBKA 4FS1A 4F93B 5AKLA 2BDPA 9ICEA 2IHOA 8ICOA 5KT5A 5KFOA 4EZ9A 1M6YA 7ICHA 4WC0A 8ICIA 4WH5A 1NJYA 3EYZA 4PHAA 3IDWA 3G6YA 2BPCA 2EZXA 4C80A 4I27A 1TV9A 1S10A 2J6UA 2ZJAA 5KFYA 4X4RA 5HRHA 4KLUA 4MHVA 9ICSA 3UM9A 4FH5A 2FMPA 5CFSA 2JGAA 4M04A 2XGQA 2PFQA 3L9DA 4UB3A 2ASLA 9ICCA 4ACOA 1ZQ1C 1HIWA 1V9PA 4Q43A 3QUQA 1J2NA 1SIJA 4NWIA 1NK6A 2ZH9A 1L8OA 1T4GA 2HW3A 1HJPA 3BQ1A 1U45A 1Q8KA 1RXVA 4I2AA 2YTUA 3WKCA 1PX5A 3HIYA 1WUDA 4X0BA 5F2VO 2IHNA 2QB1A 3C1ZA 1NKBA 3ZDCA 3IP4B 4J9SA 2PFOA 5EE0A 5KNIA 3I28A 3GIMA 1OUQA 3SV4A 4BWJA 2JEJA 5KG4A 5KT7A 2BPGA 5DDYA 8ICWA 1ZQSA 4FHXA 2ZH1A 4RU9A 4OJPA 4RNMA 3FM9A 4WC3A 1KFTA 4UD5A 4P0PA 2RRDA 3WK5A 8ICHA 5DLGA 3LWMA 3V6KA 3PR4A 7ICQA 2IOFK 3T5KA 3QEBZ 2IUBA 2E3TA 3FYHA 4KB6A 3QU9A 2LYAA 5ALGA 2J6SA 2HHVA 4ELUA 3T5JA 1XU4A 4BUGA 2KOBA 5KFVA 3GIKA 4Y2QA 1BPDA 5AKZA 1KW4A 5DBAA 3RJEA 4KLIA 2A3VA 4F92B 2W9CB 2M2TA 4KLDA 1T7PA 3ORYA 1BGXT 2AGPA 2BKEA 3H8SA 4QWEA 1KFSA 2WF8A 3C18A 4TQRA 1B4FA 2EZZA 1XSNA 5KFTA 5L1KA 5HREA 2HBLA 1TFRA 1NJZA 2FCLA 4GFJA 5AI0A 2QARB 1N61A 3FC4A 3ETLA 3H8JA 3PMLA 4WC7A 2HOFA 1L3UA 4WQKA 3C28A 4TUPA 4EEDA 2ZJ5A 2QLTA 4FHYA 1QTMA 2ZG6A 2ZIXB 4NV0A 9ICQA 4QWBA 2BPFA 4OAFA 4KMUA 3RF9A 5J2AA 1PVQA 1S77D 3SI8A 5D63A 4J9KA 3LVVA 4Y2PA 3Q8PB 2HHQA 1Z4OA 1S0VA 3T5HA 3ZDBA 2A1AA 2ATLA 3HKZC 9ICGA 3NVWA 3RTVA 1CRXA 4O5EA 1JALA 1A6SA 1ZQGA 5KFBA 4IG8A 2E5SA 2ZIWA 1NK5A 3ISDA 1QQ7A 2WB1F 3LVWA 1UPHA 1SKSA 1BPEA 3IHQB 5J0UA 4YG2A 4UAYA 3C66A 4Y2JA 1NJWA 3CP8A 1ED1A 4CDGA 1SL2A 5J0RA 1NJXA 8ICBA 3RB3A 5J0WA 1J2MA 1MN8A 5DQHA 4HYKA 3C21A 5EWGA 3WKDA 4F5PA 5DB7A 3R9KA 2GOLA 1GPJA 4Q8FA 4M5DA 1D8LA 4IR9A 4RNNA 2M2UA 4NY8A 5CA7A 2DPJA 2AXTU 4BDPA 2HHXA 5L1JA 4FE3A 3RRHA 1L3VA 3ZD9A 5FP0A 1SZPA 3RJIA 8ICPA 1TE2A 1XNSA 2YMQA 4PPXA 2LI6A 4ED8A 5HRIA 1RZTA 2M9NA 3AQLA 3HW8A 4RQ0A 2EAOA 2V4RA 4DL6A 2OWOA 4KM5A 8ICUA 2NRZA 4C4SA 5ALEA 4KX3A 4B9LA 4Y2SA 3JPRA 3V6HA 3H0MB 1RG6A 2FMQA 1N63A 4ECVA 2E1EA 4NKUA 4NXUA 5J0TA 3WU2U 3OVSA 4QZIA 2WAQF 2IOFA 2EH9A 7ICNA 4EBKA 5DEDA 5KFLA 4KX5A 3TARA 1ZQAA 4I28A 5HMMA 1SZHA 3LWLA 3OVAA 2PI5A 5HHHA 5KFHA 2BE3A 2D8CA 2HHWA 1V85A 2IOHA 4DFMA 1PVRA 2GA9D 1URJA 2W03A 3KZXA 3GFKB 4EEYA 3SAHA 4NLGA 1NZPA 4FHWA 5HHIA 2XICA 5F3XB 4RUCA 4JV0A 1SB3C 4M9NA 4IRKA 3L4PA 2YB4A 3PR5B 2BQUA 4PHDA 3O0FA 1KLNA 5AKEA 3PSIA 1A0PA 4C8OA 4HAIA 5IIIA 3HPOA 1QLNA 7ICPA 3UPSA 5ALQA 2XI9A 3MBYA 4M9HA 2K8CB 4LT6A 2F44A 4RQ4A 1YLQA 9ICXA 5F9NA 3M9NB 2W9CA 3OJUA 2ZH2A 3UPQA 2DWQA 3T3FA 2NRXA 2FLPA 2VIXA 5ALFA 1WCLA 2ZUDA 4KLJA 4NXWA 3H0LB 3KHRA 4Y2YA 4DQIA 3N7PD 1JN3A 3C2KA 2KHVA 5KL8B 1ZQRA 2KJ9A 4J9PA 4DSJA 2JZBA 2UVRA 2H3IA 4PL2A 4NLNA 2QARA 5ALRA 2WF6A 3D2QA 3PSTA 2Q4TA 2K8BB 3BJYA 4XRHA 3J81j 5IIOA 2GO7A 4MEYA 2KIWA 5T14A 3RRGA 3MGVA 1UHUA 2ZIXA 3SAGA 3H8MA 4UB8U 3JPOA 5ALLA 4UBBA 4ECTA 4IRCA 1KDHA 5ALUA 5KFIA 4P4MA 2HHSA 1XSPA 4B9SA 1ZQPA 3NVYA 5HMLA 3QU7A 1BNOA 5KT3A 4CCHA 1N62A 2PMZC 3OWGA 2DKZA 4UW9A 5ALJA 1JQRA 4EX6A 2YMPA 2D3DA 4LZGA 9ICVA 5AKIA 4YQWA 1JAJA 5ALPA 2F1HA 2PI4A 1ZJNA 2O5AA 5DLFA 1ZQVA 3D2SA 3ZI4A 2A19A 3WK4A 8ICRA 2DRBA 5KFJA 4MF2A 3RR7A 2B21A 2IHMA 4UBCA 8ICVA 2A1JB 8ICFA 2PFPA 9ICFA 2YX8A 3RJGA 2DRAA 4X4UA 1ZQDA 4NKTA 4YMOA 4QNLA 3MGIA 1GO3F 4BXOA 3RJHA 7ICKA 2Q0ZX 4UB1A 5CP2A 3SENA 2R8IA 4IQWA 4OAHA 2Z7JA 2HBJA 3HJ1A 3KHHA 1MSWD 3TFRA 3QX7A 4O67A 2W43A 3M7DA 1BVSA 2MUTB 1SXDA 2DR8A 1S0NA 3D6JA 2M2VA 3IV6A 2F1JA 2ISPA 3PY8A 3AQKA 2ZIVB 1WWUA 1FEZA 1RXWA 1ZQFA 4EYIB 1BPZA 1LVHA 1N56A 2B51A 4F4XA 4I2FA 4U7CA 3MFHA 1KNYA 5KFKA 1XO0A 2KE7A 4DQRA 8ICCA 3WK8A 3AQMA 7ICLA 1DK3A 1NK0A 5ALOA 5J0XA 3HKZF 2H3FA 4JWNA 2ID1A 5ALXA 2M2WA 2HSZA 2XC9A 3GV8B 4JWMA 2ZIUB 3UMBA 4PZOA 4EENA 5G5GA 1SL0A 5BOLA 8ICYA 1K1QA 2G07A 5AIAA 4F4WA 4K98A 5AIBA 2VJ5A 3NKUA 3F2DA 5AK6A 2K4IA 4KLLA 3M6KA 4Z6DA 3N4MB 3RBEA 4EBJA 3BS7A 3UXNA 2BCVA 1QH9A 1B22A 1HUOA 4UAWA 5D4BA 1WYGA 1A76A 2W55A 1LKYA 2HI0A 4MKPA 1SV0A 4ZOHC 2K4PA 1EXNA 4RUAA 1HUZA 5TISU 1ZQQA 2KZZA 2DR7A 3T79A 2PKEA 3H38A 4DFJA 1PK1A 1K1SA 5IIKA 4WC6A 1X2IA 4NXVA 1Q46A 5KT6A 1PVPA 5DG9A 4RQ2A 4LZDA 8ICLA 3TACB 3RH4A 3QEAZ 2MSNA 4PHPA 1HEKA 4FZLA 4WC2A 2CRXA 4DL5A 2I1QA 1KEJA 3RJKA 4DFPA 4OJOA 1NI3A 4Y2VA 2LHTA 1T8EA 4RPYA 1ZQEA 5KFRA 3JPSA 2HVHA 5EWEA 2LM1A 3OTQA 2DVIA 4P2HA 7ICIA 8ICEA 2WFAA 1SV4A 2EZYA 5K4LA 3BZCA 4ECZA 4RQ6A 3SV3A 2KIVA 4QJFB 5DB6A 3WKBA 3NVZA 1X42A 3F5AA 4CGZA 4B9VA 2B4VA 4WC4A 4C8NA 4FBUA 2EAMA 3SZ2A 2F8KA 1TVAA 4FZMA 3AM9A 4QIWF 5KFMA 4J03A 2MA1A 4OAIZ 4DL3A 4F3OA 2DPIA 4AT7B 3C1YA 3JZ0A 4FZNA 5KG5A 4B9UA 4KLOA 1X40A 4KLMA 3HRDD 4KLSA 2DR5A 1F0MA 5KFAA 3QU5A 3F5EA 1ZOLA 3V6JA 1Q78A 1TAQA 5EE9A 4K96A 2XY7A 4OJ6A 1C7YA 4C8KA 2KTQA 3D2NA 1ZQZA 2FE9A 1FIQA 5KFEA 1X66A 4GXJA 4Q45A 3EPGA 2G0AA 3KFUF 1IG6A 4QWAA 1ZQLA 5KG1A 7ICOA 2CPRA 2MUTA 3QZ8A 1ZD2P 4ECXA 2PFNA 1T94A 1MA7A 2Y9UA 3Q8LA 2ZH8A 5CB1A 7ICUA 1QQ6A 1ZQTA 4UQGA 4EYHB 4K4HA 3LQCB 3UMGA 4UARA 3MGHA 8ICKA 2L5YA 4B6JA 2VANA 3ALRA 3EZ5A 4FFDA 5BPCA 4O3RA 4E8FA 5B3PA 2MAXA 1XSLA 2W9MA 1NOMA 2JHDA 1ZRMA 3ER8C 2QB0B 2AU0A 3GU3A 2NRVA 2G06A 4QW9A 3BS5B 5ALKA 2WTFA 1UEUA 1RM6C 5C5JA 4DSKA 3Q8QB 2I5HA 5J2CA 1L3SA 2BGWA 4O5KA 2RHFA 2F76X 2C2DA 3ONNA 1PK3A 4JB3A 5CHGA 1IIPA 5D62A 7ICEA 1KTQA 2PMZF 3EUB2 3N97B 3RB4A 4F4ZA 4F50A 3ICXA 4KLTA 3CW2C 2HN2A 4E80A 2XCPA 3V72A 2JH7A 3MR2A 5CRXA 3PMNA 2KVCA 4J9LA 4EGWA 2RDIA 4EBCA 1N60A 5AI8A 2K8AA 4ED2A 3PSPA 4ICAA 2DF4B 1L5UA 3RJJA 3SEIA 4XQ8A 3MR5A 4FHPA 2XVTA 4ECQA 4RT3A 3F2CA 4DOCA 4I29A 2P6RA 4X4PA 8ICTA 4CF4A 4QZFA 2WF5A 1FA0A 2K4HA 4OCZA 1ZXIA 5KG7A 3BQ0A 4WBZA 4K9BA 4J9OA 4QZEA 2ZHBA 1Q79A 3ISCA 4K9AA 2EDUA 4O0IA 2VKQA 4QZ8A 4WCWA 3SAFA 3CNHA 4DSEA 5CWRA 5DG7A 3ZDEA 4DSIA 1TAMA 2JXJA 4F4KA 3DEEA 3HILA 2W3SA 9ICLA 4YXMA 1LV5A 3EWAA 3L3FX 2ZHAA 3KBBA 3C29A 4UB2A 4DSLA 2JEGA 4EZ6A 1S5LU 3AL0B 4YCXA 3G6XA 3A0BU 2NO4A 4X4QA 3HWTA 1ZQNA 3PZPA 2B6GA 1QSLA 1ZYQA 4R64A 5AKYA 2KKVA 1X6IA 1Z1BA 3PW7A 2W9BB 4Z6EA 3WFSC 3FDSA 9ICKA 4NM2A 1L7PA 1WWVA 4KLGA 5ALVA 3NUQA 2LYBA 3NRWA 2HOQA 5AKKA 5ALWA 4ED1A 2FLLA 2VJ4A 2F8LA 1KQQA 4Y2TA 4OO1J 3I1YA 2YY6A 4RQ8A 2PBEA 3T5LA 2ZH3A 4XUSA 2AHOB 1NO5A 2JH1A 2ZXHA 4TUSA 4EBDA 3NGDA 1VFGA 2Y9TA 2DQNB 2ZH5A 3DDHA 3V7JA 4NLCA 8ICAA 1IXRA 4TUQA 2EQYA 4RWNA 3QUCA 4K97A 1ZQCA 4UB5A 1JXEA 2QKQA 2C2EA 4R63A 4R8UB 3PX4A 4QIWC 4X0AA 1TK8A 2W9AA 2DR9A 3QUBA 1U49A 4DFDA 2VA3A 1NKCA 3AEVA 4EV6A 3JPPA 1ZD5A 5HRLA 5L1LA 4DF8A 1Z19A 1B43A 3GIIA 4F5NA 2KKPA
chains in the Genus database with same CATH topology
4P4PA 3LDAA 3V7KA 4I27A 3UXPA 2M2VA 1TV9A 1CEZA 5KG0A 2F1JA 1S10A 4ECYA 2J6UA 5J2FA 2ZJAA 1XC9A 2ISPA 3PY8A 3AQKA 1MC8A 5KFYA 5J2BA 4YR3A 5HRFA 3EW9A 5KFPA 4X4RA 4RT2A 1RXWA 1ZQFA 7ICFA 5HRHA 4I2DA 4EYIB 1BPZA 4KLUA 5HR9A 4KN4A 1R8CA 1N56A 9ICSA 4F4XA 4I2FA 4FH5A 3MFHA 4M6WB 1ZQUA 2FMPA 1KNYA 5KFKA 1SKWA 3IM1A 2AQ4A 4M04A 2XGQA 3RH5A 4FO6A 4DQRA 2PFQA 8ICCA 3L9DA 4UB3A 4KN7A 4QZGA 2V4QA 2ASLA 9ICCA 1UT5A 5L1IA 2Y1IA 4DQPA 2IMWP 4Q43A 1V9PA 3AQMA 7ICLA 1DK3A 1L3TA 5D49A 1NK6A 1NK0A 4YMNA 3K75D 3OHBA 1T3NA 1S0OA 2ZH9A 3MR3A 3RBDA 5J0XA 4KITB 1VJ7A 1T4GA 4B9MA 2P6UA 4JWNA 2HW3A 1HJPA 3BQ1A 2ID1A 3NYBA 1U45A 2M2WA 2XC9A 1RXVA 3ZD8A 3GV8B 1ZQHA 4Q44A 3GDXA 4I2AA 4JWMA 2NRKA 3HIYA 1PX5A 4X0BA 4QW8A 1R89A 3H8WA 3OGUA 5F2VO 2IHNA 3BDPA 1SL0A 3C1ZA 1NKBA 5BOLA 5J2DA 3ZDCA 4J9SA 2AJQA 1K1QA 2PFOA 4F4WA 8ICYA 4ELTA 2KZ3A 5DBCA 3UQ0A 1ZQKA 4IR1A 3PW4A 3EPIA 3THVA 3GIMA 3PNCA 9ICRA 4RQ3A 3SV4A 4KLLA 2HHTA 4BWJA 4Z6DA 3N4MB 2JEJA 5KG4A 2FPMA 5DQIA 4DS4A 3QZ7A 3RBEA 4EBJA 4WC1A 5KT7A 3C2MA 3UXNA 1SL1A 2BPGA 5DDYA 2GWSA 2ISOA 2BCVA 8ICWA 1ZQSA 4FHXA 1B22A 2ZH1A 1HUOA 1X9WA 4RU9A 4UAWA 2R8KA 9ICTA 4RNMA 3MDCA 5D4BA 4F2RA 1A76A 1TK0A 2HVIA 4BXOB 4WC3A 1Z00B 1KFTA 4UD5A 2XGPA 8ICHA 5DLGA 3LWMA 5IIJA 3V6KA 1UT8A 3PR4A 1EXNA 4RUAA 4EBEA 2C22A 1NK7A 1HUZA 3T5KA 3QEBZ 4ED3A 4Q8EA 9ICOA 4AT7A 1ZQQA 4GXIA 2KZZA 3FYHA 4UAZA 1UA0A 1S0MA 2DR7A 1NK4A 2VA2A 1BPYA 2BCUA 9ICWA 4RWPA 3H38A 4DFJA 1XS9D 8ICSA 2J6SA 2I9GA 5KFSA 2HHVA 4ELUA 3T5JA 1K1SA 1XU4A 5IIKA 1X2IA 4K4GA 4WC6A 2P66A 3ZDDA 9ICJA 2FPLA 5KFVA 3GV5B 2C2RA 5KT6A 9ICMA 5DG9A 3GIKA 5KG2A 1JMSA 5J0SA 4KLEA 5F9LA 4RQ2A 4LZDA 1BPDA 5TZVA 8ICLA 5DBAA 4KLIA 3RJEA 3RH4A 3TAPA 3H3AA 4KTQA 3PW5A 3QEAZ 4I2GA 1RYSA 4F92B 2W9CB 3PO4A 1MIWA 4PHPA 2M2TA 2BCQA 5KG6A 4KLDA 1ZETA 1T7PA 3HP6A 7ICGA 3ORYA 1BGXT 2AGPA 3LK9A 5HP4A 8ICZA 4WC2A 2BKEA 3H8SA 4DL5A 2I1QA 1KEJA 4QWEA 1KFSA 3RJKA 3C18A 1IM4A 1SKRA 4X4TA 4TQRA 1BPBA 3KHLA 4ED6A 4DFPA 4MEXA 3RR8A 3OHAA 5J0OA 4GC7A 2C28A 4DWIA 9ICPA 1XSNA 3KHGA 2UVUA 4F8RA 5KFTA 5L1KA 1T8EA 5HREA 4P4OA 3SYZA 5J29A 4RPYA 4ECSA 4KLFA 1S76D 1ZQEA 4ATBA 5KFRA 1TFRA 3JPSA 4GXKA 9ICNA 4FH3A 2HVHA 5EWEA 4ED0A 1U48A 1NJZA 4JUZA 4PGYA 4YN4A 3MDAA 2F1IA 1ZQMA 1OU5A 5DB8A 1KFDA 4P2HA 2DVIA 3GIJA 4MFCA 3ZDAA 2Q66A 5KFQA 3ETLA 3H8JA 5L9XA 3PMLA 4FHVA 4WC7A 3RJFA 4YR2A 4E0DA 7ICQA 1L3UA 7ICIA 8ICEA 4PH5A 4YD1A 4O3PA 4TUPA 2ZJ5A 4FHYA 1QTMA 2KFZA 1DOQA 1ZQJA 4Z6CA 4ECZA 4WBYA 3JYYA 4RQ6A 3SV3A 3WFPA 4DL2A 4NXZA 2H5XA 5DB6A 9ICIA 9ICQA 2LYHA 4QWBA 8ICJA 2BPFA 5J2JA 4KMUA 5J2AA 4B9VA 1S77D 3SI8A 4WC4A 4C8NA 4J9KA 4FBUA 4C8MA 3Q8PB 3TFSA 3Q8MA 2HHQA 4NLZA 1S0VA 2JEFA 3SZ2A 4X4SA 2ASDA 4S3NA 3T5HA 1TVAA 3HX0A 4KLHA 4DL7A 3ZDBA 5HRKA 4ECWA 2ATLA 3RAXA 9ICGA 3C2LA 3RTVA 4O5EA 5KFMA 2W8KA 3RB6A 1ZQGA 5KFBA 1KRPA 4F5QA 4DL3A 2FMSA 4IG8A 4F3OA 2DPIA 5JUMA 4AT7B 1NK5A 3C1YA 3ISDA 3JZ0A 5KG5A 4XQ7A 4B9UA 4KLOA 1SKSA 4KLMA 1BPEA 1Y88A 3IHQB 5J0UA 5J2GA 3ISBA 4J9MA 4DS5A 1MQ2A 4KLSA 1MIVA 4E7XA 4JK1A 4YG2A 4UAYA 3C66A 2DR5A 4QZ9A 5KG3A 5KFAA 5KT2A 5BOMA 3RB0A 1NJWA 1MQ3A 1ZQOA 5EWFA 3V6JA 5HRGA 1SL2A 1Q78A 2O1PA 5J0RA 1TAQA 1NJXA 7ICTA 4NLKA 3RB3A 8ICBA 5J0WA 5DQHA 2XY7A 4RQ1A 1NK8A 4HYKA 3C21A 4IQVA 1C7YA 5EWGA 3OUYA 4R8UA 4DFKA 4F5PA 4C8KA 2KTQA 1ZQZA 2FLNA 5DB7A 4Q8FA 4AT8B 7ICRA 3B0XA 3OSNA 4M5DA 3C5GA 5KFEA 1MIYA 3JPNA 1D8LA 2PXIA 4IR9A 4GXJA 4Q45A 4RNNA 3EPGA 4X4NA 4YP3A 2M2UA 4NY8A 4AT9B 5CA7A 5D46A 1U9LA 4BGDA 4QWAA 2DPJA 1U4BA 1ZQLA 4R66A 4BDPA 4M0AA 2HHXA 1S97A 5KG1A 5L1JA 5KFNA 8ICXA 7ICVA 4DEZA 3OSPA 7ICOA 3RRHA 3AUOA 2AGQA 2MUTA 3ZD9A 1SZPA 1L3VA 1LB2B 3OV7A 3QZ8A 3RJIA 8ICPA 1TAUA 3AU6A 4IQTA 4ECXA 4MFAA 2R8HA 2PFNA 3K4GA 2R8JA 2AQ0A 1WCNA 4PPXA 3Q8LA 4ED8A 5HRIA 2ZH8A 5CB1A 3PX6A 1S9FA 2M9NA 4ECRA 1RZTA 3AQLA 7ICUA 3HW8A 4RQ0A 3GV7B 1ZQTA 1QSYA 4UQGA 2V4RA 4DL6A 5DKWA 5J2EA 4EYHB 2OWOA 1DGSA 4K4HA 8ICUA 3LQCB 1R8BA 2NRZA 3PX0A 3MGHA 3RH6A 3H7IA 8ICKA 5KFXA 2VANA 3EZ5A 4B9LA 5BPCA 4M6WA 4O3RA 1BNPA 2MAXA 4E8FA 1XSLA 2W9MA 3JPRA 3V6HA 5IIMA 4DL4A 3TANA 4QZBA 2FMQA 1NOMA 4ECVA 2AU0A 4PHEA 4NKUA 4O3SA 3WFRE 4QZCA 4DLGA 4YR0A 5J0TA 2IA6A 3E2EA 2NRVA 4QW9A 5J2IA 2HHPA 1RYRA 3OVSA 4QZIA 2WTFA 9ICUA 1UEUA 2KFNA 4J9QA 1R8AA 4RWOA 9ICAA 4BWMA 5C5JA 2HHUA 4RNOA 2ZH7A 4DSKA 4DOBA 3Q8QB 3MFIA 5J2CA 4O5KA 2ZUCA 2BGWA 1TKDA 1L3SA 5IILA 2C2DA 4MF8A 4DLEA 2RDJA 5CJ7A 7ICNA 1UEVA 5DEDA 3WFOA 5KFLA 4O3OA 4EBKA 3TARA 1ZQAA 2UVVA 2VA8A 5CHGA 4I28A 2ZTEA 2BCSA 5HMMA 3GILA 4I2JA 3H37A 2KZMA 3LWLA 4QZDA 4GLXA 1ZQYA 4RPXA 5HHHA 2PI5A 4I2BA 2AGOA 7ICEA 8ICMA 2FPKA 1KTQA 3RB4A 3N97B 5KFHA 5KT4A 4F4ZA 9ICHA 4F50A 4KLTA 4M9LA 2HHWA 5HRBA 2BE3A 2RFFA 4X4OA 4MFFA 4DFMA 1UA1A 4M2YA 4E80A 2XCPA 4LVSA 3TQ1A 3MR6A 3V72A 3MR2A 2W9BA 3V7LA 3PMNA 4ELVA 1U47A 1BPXA 3GFKB 1Z3EB 3G6VA 4J9LA 3UQ2A 4EEYA 9ICBA 1ZQBA 3H40A 4NLGA 4O9MA 1NZPA 4FHWA 2RDIA 4EBCA 5HHIA 1Z00A 4B9TA 4RUCA 1ZJMA 4ED2A 4JV0A 3JPQA 4M9NA 5DGAA 4IRKA 1NKEA 8ICNA 4RWQA 7ICMA 1L5UA 3RJJA 4QZAA 4XQ8A 3MR5A 1F5AA 2ASJA 3PR5B 5J0QA 4XA5A 2BQUA 4B9NA 4PHDA 4ZH4A 1KLNA 1AROP 4ECUA 4ECQA 3AQNA 4FHPA 4F5RA 4RT3A 4DOCA 4C8OA 4I29A 2P6RA 4X4PA 1TFWA 5IINA 8ICTA 3BQTA 5IIIA 2BHNA 4UD4A 4YMMA 4QZHA 2XY5A 3HPOA 4QZFA 2XO7A 4YXJA 2J6TA 1QLNA 4YVZA 7ICPA 3UPSA 3MBYA 2IBKA 4M9HA 1FA0A 3B0YA 1UETA 5KG7A 1JXLA 3BQ0A 4WBZA 4UB4A 1X9SA 4J9OA 2ALZA 3OVAA 4RQ7A 3M8RA 4QZEA 3Q8RB 1TK5A 4LT6A 5DG8A 2ZJ8A 1DK2A 4EP7A 2ZHBA 4RQ4A 1NK9A 9ICXA 1YLQA 5F9NA 1Q79A 3M9NB 3ISCA 3OJUA 2W9CA 3UPQA 5DBBA 2Y1JA 1N48A 2ZH2A 3T3FA 2ZH4A 4O0IA 4M9GA 4RPZA 2NRXA 5KFUA 2W8LA 4QZ8A 2FLPA 4WCWA 2DFLA 1JIHA 4JV2A 5DG7A 4DSEA 5CWRA 1WCLA 4O5CA 3ZDEA 3H4DA 4DSIA 2A1JA 2ZUDA 4KLJA 2ZH6A 3KHRA 5DGBA 4DQIA 4F4KA 3OVBA 1TFYA 2BR0A 1JN3A 3C2KA 5HNKA 4PGXA 1D9DA 8ICQA 5DDMA 1CUKA 9ICLA 4YXMA 1LV5A 1ZQRA 4J9PA 4DSJA 4O3QA 2JZBA 3EWAA 4O3NA 5KFFA 3M9OB 4X5VA 1QSSA 2UVRA 2ZHAA 5DQGA 3JPTA 1KSPA 4UB2A 4F91B 4WC5A 2NRWA 4DSLA 4F5OA 4NLNA 3H39A 3C23A 4Z6FA 2JEGA 2ZTDA 4I2IA 3GQCA 5KTQA 4EZ6A 4YCXA 4JV1A 3G6XA 3PO5A 3BJYA 4X4QA 4XRHA 5KFCA 3HWTA 4G3IA 4ATBB 5IIOA 4MEYA 5J0YA 4I2EA 1ZQNA 3RRGA 3PVXA 4IRDA 3Q8SB 5J2KA 4RZRA 4ED7A 1QSLA 3NTUA 1ZYQA 2BCRA 4R64A 4M47A 3PW7A 3TI0A 5J0PA 1XO1A 3JPOA 2W9BB 4J9NA 4Z6EA 3Q8KA 4FBTA 4UBBA 3MABA 3PW0A 4NM1A 5KFDA 4ECTA 3FDSA 4IRCA 9ICKA 3WFSC 4NM2A 2NRTA 3AU2A 1KDHA 4KLGA 5DECA 5DB9A 5KFIA 4DOAA 4P4MA 4F4YA 2HHSA 1WOTA 4C8LA 3HJ4A 1XSPA 4QWDA 4B9SA 4ED1A 2ZTCA 4YD2A 1ZQPA 4J9RA 1ZQIA 2FLLA 3BQ2A 5HMLA 3UXOA 4YFKA 3M9MB 3RAQA 1BNOA 4RQ8A 5KT3A 2PBEA 4CCHA 1PZNA 8ICGA 1ZQWA 3T5LA 2ZH3A 4XUSA 1D9FA 1H38A 5CR0A 5KFWA 1X9MA 3C5FA 1JQRA 4QWCA 1NO5A 2BQRA 4TUSA 3M8SA 4EBDA 3PV8A 4LZGA 9ICVA 2R8GA 4YQWA 2BQ3A 1JAJA 2F1HA 3NGDA 4DQSA 5HRDA 5HC9A 1VFGA 2ZH5A 2PI4A 3V7JA 1ZJNA 5DLFA 2O5AA 4I2HA 2UVWA 8ICAA 1ZQVA 4PGQA 3OJSA 4K4IA 4F2SA 1IXRA 2XY6A 2ZUBA 4TUQA 1XWLA 2XCAA 1RPLA 8ICRA 4GC6A 2KP7A 4RWNA 5J2HA 4DF4A 2DRBA 1COOA 4TURA 1JX4A 4R65A 5KFZA 5KFJA 4DSFA 4AT8A 4MF2A 3RR7A 4M9JA 5EOZA 4RQ5A 2B21A 2IHMA 4UBCA 4UB5A 1ZQCA 3KTQA 1JXEA 2C2EA 4AT9A 3H4BA 2V9WA 3WFQE 3OUYB 8ICVA 4R63A 2A1JB 5KFGA 4R8UB 3PX4A 3TAQA 1D8YA 2PFPA 3RJGA 8ICFA 9ICFA 2DRAA 4X4UA 1ZQDA 4NKTA 4X4VA 1ZQXA 4YMOA 4FS1A 3MGIA 4X0AA 4BXOA 4F93B 3RJHA 7ICKA 2Q0ZX 1V4AA 1TK8A 2W9AA 4UB1A 5CP2A 2DR9A 2JZBB 1U49A 2VA3A 1A77A 1NKCA 4DQQA 2JEIA 3JPPA 2R8IA 3HT3A 2BDPA 4IQWA 9ICEA 4TQSA 8ICOA 5HRLA 5KT5A 4I2CA 3KHHA 1MSWD 3TFRA 3HJ1A 5KFOA 4EZ9A 4FS2A 3QE9Y 5L1LA 7ICHA 1BVSA 8ICIA 4WC0A 2MUTB 4IQUA 1NJYA 4DF8A 3EYZA 1B43A 3GIIA 4PHAA 3PW2A 1S0NA 7ICJA 4KLQA 7ICSA 4F5NA 2DR8A 4DO9A 3G6YA 2BPCA 2KN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4P A;  3LDA A;  3V7K A;  4I27 A;  3UXP A;  2M2V A;  1TV9 A;  1CEZ A;  5KG0 A;  2F1J A;  1S10 A;  4ECY A;  2J6U A;  5J2F A;  2ZJA A;  1XC9 A;  2ISP A;  3PY8 A;  3AQK A;  1MC8 A;  5KFY A;  5J2B A;  4YR3 A;  5HRF A;  3EW9 A;  5KFP A;  4X4R A;  4RT2 A;  1RXW A;  1ZQF A;  7ICF A;  5HRH A;  4I2D A;  4EYI B;  1BPZ A;  4KLU A;  5HR9 A;  4KN4 A;  1R8C A;  1N56 A;  9ICS A;  4F4X A;  4I2F A;  4FH5 A;  3MFH A;  4M6W B;  1ZQU A;  2FMP A;  1KNY A;  5KFK A;  1SKW A;  3IM1 A;  2AQ4 A;  4M04 A;  2XGQ A;  3RH5 A;  4FO6 A;  4DQR A;  2PFQ A;  8ICC A;  3L9D A;  4UB3 A;  4KN7 A;  4QZG A;  2V4Q A;  2ASL A;  9ICC A;  1UT5 A;  5L1I A;  2Y1I A;  4DQP A;  2IMW P;  4Q43 A;  1V9P A;  3AQM A;  7ICL A;  1DK3 A;  1L3T A;  5D49 A;  1NK6 A;  1NK0 A;  4YMN A;  3K75 D;  3OHB A;  1T3N A;  1S0O A;  2ZH9 A;  3MR3 A;  3RBD A;  5J0X A;  4KIT B;  1VJ7 A;  1T4G A;  4B9M A;  2P6U A;  4JWN A;  2HW3 A;  1HJP A;  3BQ1 A;  2ID1 A;  3NYB A;  1U45 A;  2M2W A;  2XC9 A;  1RXV A;  3ZD8 A;  3GV8 B;  1ZQH A;  4Q44 A;  3GDX A;  4I2A A;  4JWM A;  2NRK A;  3HIY A;  1PX5 A;  4X0B A;  4QW8 A;  1R89 A;  3H8W A;  3OGU A;  5F2V O;  2IHN A;  3BDP A;  1SL0 A;  3C1Z A;  1NKB A;  5BOL A;  5J2D A;  3ZDC A;  4J9S A;  2AJQ A;  1K1Q A;  2PFO A;  4F4W A;  8ICY A;  4ELT A;  2KZ3 A;  5DBC A;  3UQ0 A;  1ZQK A;  4IR1 A;  3PW4 A;  3EPI A;  3THV A;  3GIM A;  3PNC A;  9ICR A;  4RQ3 A;  3SV4 A;  4KLL A;  2HHT A;  4BWJ A;  4Z6D A;  3N4M B;  2JEJ A;  5KG4 A;  2FPM A;  5DQI A;  4DS4 A;  3QZ7 A;  3RBE A;  4EBJ A;  4WC1 A;  5KT7 A;  3C2M A;  3UXN A;  1SL1 A;  2BPG A;  5DDY A;  2GWS A;  2ISO A;  2BCV A;  8ICW A;  1ZQS A;  4FHX A;  1B22 A;  2ZH1 A;  1HUO A;  1X9W A;  4RU9 A;  4UAW A;  2R8K A;  9ICT A;  4RNM A;  3MDC A;  5D4B A;  4F2R A;  1A76 A;  1TK0 A;  2HVI A;  4BXO B;  4WC3 A;  1Z00 B;  1KFT A;  4UD5 A;  2XGP A;  8ICH A;  5DLG A;  3LWM A;  5IIJ A;  3V6K A;  1UT8 A;  3PR4 A;  1EXN A;  4RUA A;  4EBE A;  2C22 A;  1NK7 A;  1HUZ A;  3T5K A;  3QEB Z;  4ED3 A;  4Q8E A;  9ICO A;  4AT7 A;  1ZQQ A;  4GXI A;  2KZZ A;  3FYH A;  4UAZ A;  1UA0 A;  1S0M A;  2DR7 A;  1NK4 A;  2VA2 A;  1BPY A;  2BCU A;  9ICW A;  4RWP A;  3H38 A;  4DFJ A;  1XS9 D;  8ICS A;  2J6S A;  2I9G A;  5KFS A;  2HHV A;  4ELU A;  3T5J A;  1K1S A;  1XU4 A;  5IIK A;  1X2I A;  4K4G A;  4WC6 A;  2P66 A;  3ZDD A;  9ICJ A;  2FPL A;  5KFV A;  3GV5 B;  2C2R A;  5KT6 A;  9ICM A;  5DG9 A;  3GIK A;  5KG2 A;  1JMS A;  5J0S A;  4KLE A;  5F9L A;  4RQ2 A;  4LZD A;  1BPD A;  5TZV A;  8ICL A;  5DBA A;  4KLI A;  3RJE A;  3RH4 A;  3TAP A;  3H3A A;  4KTQ A;  3PW5 A;  3QEA Z;  4I2G A;  1RYS A;  4F92 B;  2W9C B;  3PO4 A;  1MIW A;  4PHP A;  2M2T A;  2BCQ A;  5KG6 A;  4KLD A;  1ZET A;  1T7P A;  3HP6 A;  7ICG A;  3ORY A;  1BGX T;  2AGP A;  3LK9 A;  5HP4 A;  8ICZ A;  4WC2 A;  2BKE A;  3H8S A;  4DL5 A;  2I1Q A;  1KEJ A;  4QWE A;  1KFS A;  3RJK A;  3C18 A;  1IM4 A;  1SKR A;  4X4T A;  4TQR A;  1BPB A;  3KHL A;  4ED6 A;  4DFP A;  4MEX A;  3RR8 A;  3OHA A;  5J0O A;  4GC7 A;  2C28 A;  4DWI A;  9ICP A;  1XSN A;  3KHG A;  2UVU A;  4F8R A;  5KFT A;  5L1K A;  1T8E A;  5HRE A;  4P4O A;  3SYZ A;  5J29 A;  4RPY A;  4ECS A;  4KLF A;  1S76 D;  1ZQE A;  4ATB A;  5KFR A;  1TFR A;  3JPS A;  4GXK A;  9ICN A;  4FH3 A;  2HVH A;  5EWE A;  4ED0 A;  1U48 A;  1NJZ A;  4JUZ A;  4PGY A;  4YN4 A;  3MDA A;  2F1I A;  1ZQM A;  1OU5 A;  5DB8 A;  1KFD A;  4P2H A;  2DVI A;  3GIJ A;  4MFC A;  3ZDA A;  2Q66 A;  5KFQ A;  3ETL A;  3H8J A;  5L9X A;  3PML A;  4FHV A;  4WC7 A;  3RJF A;  4YR2 A;  4E0D A;  7ICQ A;  1L3U A;  7ICI A;  8ICE A;  4PH5 A;  4YD1 A;  4O3P A;  4TUP A;  2ZJ5 A;  4FHY A;  1QTM A;  2KFZ A;  1DOQ A;  1ZQJ A;  4Z6C A;  4ECZ A;  4WBY A;  3JYY A;  4RQ6 A;  3SV3 A;  3WFP A;  4DL2 A;  4NXZ A;  2H5X A;  5DB6 A;  9ICI A;  9ICQ A;  2LYH A;  4QWB A;  8ICJ A;  2BPF A;  5J2J A;  4KMU A;  5J2A A;  4B9V A;  1S77 D;  3SI8 A;  4WC4 A;  4C8N A;  4J9K A;  4FBU A;  4C8M A;  3Q8P B;  3TFS A;  3Q8M A;  2HHQ A;  4NLZ A;  1S0V A;  2JEF A;  3SZ2 A;  4X4S A;  2ASD A;  4S3N A;  3T5H A;  1TVA A;  3HX0 A;  4KLH A;  4DL7 A;  3ZDB A;  5HRK A;  4ECW A;  2ATL A;  3RAX A;  9ICG A;  3C2L A;  3RTV A;  4O5E A;  5KFM A;  2W8K A;  3RB6 A;  1ZQG A;  5KFB A;  1KRP A;  4F5Q A;  4DL3 A;  2FMS A;  4IG8 A;  4F3O A;  2DPI A;  5JUM A;  4AT7 B;  1NK5 A;  3C1Y A;  3ISD A;  3JZ0 A;  5KG5 A;  4XQ7 A;  4B9U A;  4KLO A;  1SKS A;  4KLM A;  1BPE A;  1Y88 A;  3IHQ B;  5J0U A;  5J2G A;  3ISB A;  4J9M A;  4DS5 A;  1MQ2 A;  4KLS A;  1MIV A;  4E7X A;  4JK1 A;  4YG2 A;  4UAY A;  3C66 A;  2DR5 A;  4QZ9 A;  5KG3 A;  5KFA A;  5KT2 A;  5BOM A;  3RB0 A;  1NJW A;  1MQ3 A;  1ZQO A;  5EWF A;  3V6J A;  5HRG A;  1SL2 A;  1Q78 A;  2O1P A;  5J0R A;  1TAQ A;  1NJX A;  7ICT A;  4NLK A;  3RB3 A;  8ICB A;  5J0W A;  5DQH A;  2XY7 A;  4RQ1 A;  1NK8 A;  4HYK A;  3C21 A;  4IQV A;  1C7Y A;  5EWG A;  3OUY A;  4R8U A;  4DFK A;  4F5P A;  4C8K A;  2KTQ A;  1ZQZ A;  2FLN A;  5DB7 A;  4Q8F A;  4AT8 B;  7ICR A;  3B0X A;  3OSN A;  4M5D A;  3C5G A;  5KFE A;  1MIY A;  3JPN A;  1D8L A;  2PXI A;  4IR9 A;  4GXJ A;  4Q45 A;  4RNN A;  3EPG A;  4X4N A;  4YP3 A;  2M2U A;  4NY8 A;  4AT9 B;  5CA7 A;  5D46 A;  1U9L A;  4BGD A;  4QWA A;  2DPJ A;  1U4B A;  1ZQL A;  4R66 A;  4BDP A;  4M0A A;  2HHX A;  1S97 A;  5KG1 A;  5L1J A;  5KFN A;  8ICX A;  7ICV A;  4DEZ A;  3OSP A;  7ICO A;  3RRH A;  3AUO A;  2AGQ A;  2MUT A;  3ZD9 A;  1SZP A;  1L3V A;  1LB2 B;  3OV7 A;  3QZ8 A;  3RJI A;  8ICP A;  1TAU A;  3AU6 A;  4IQT A;  4ECX A;  4MFA A;  2R8H A;  2PFN A;  3K4G A;  2R8J A;  2AQ0 A;  1WCN A;  4PPX A;  3Q8L A;  4ED8 A;  5HRI A;  2ZH8 A;  5CB1 A;  3PX6 A;  1S9F A;  2M9N A;  4ECR A;  1RZT A;  3AQL A;  7ICU A;  3HW8 A;  4RQ0 A;  3GV7 B;  1ZQT A;  1QSY A;  4UQG A;  2V4R A;  4DL6 A;  5DKW A;  5J2E A;  4EYH B;  2OWO A;  1DGS A;  4K4H A;  8ICU A;  3LQC B;  1R8B A;  2NRZ A;  3PX0 A;  3MGH A;  3RH6 A;  3H7I A;  8ICK A;  5KFX A;  2VAN A;  3EZ5 A;  4B9L A;  5BPC A;  4M6W A;  4O3R A;  1BNP A;  2MAX A;  4E8F A;  1XSL A;  2W9M A;  3JPR A;  3V6H A;  5IIM A;  4DL4 A;  3TAN A;  4QZB A;  2FMQ A;  1NOM A;  4ECV A;  2AU0 A;  4PHE A;  4NKU A;  4O3S A;  3WFR E;  4QZC A;  4DLG A;  4YR0 A;  5J0T A;  2IA6 A;  3E2E A;  2NRV A;  4QW9 A;  5J2I A;  2HHP A;  1RYR A;  3OVS A;  4QZI A;  2WTF A;  9ICU A;  1UEU A;  2KFN A;  4J9Q A;  1R8A A;  4RWO A;  9ICA A;  4BWM A;  5C5J A;  2HHU A;  4RNO A;  2ZH7 A;  4DSK A;  4DOB A;  3Q8Q B;  3MFI A;  5J2C A;  4O5K A;  2ZUC A;  2BGW A;  1TKD A;  1L3S A;  5IIL A;  2C2D A;  4MF8 A;  4DLE A;  2RDJ A;  5CJ7 A;  7ICN A;  1UEV A;  5DED A;  3WFO A;  5KFL A;  4O3O A;  4EBK A;  3TAR A;  1ZQA A;  2UVV A;  2VA8 A;  5CHG A;  4I28 A;  2ZTE A;  2BCS A;  5HMM A;  3GIL A;  4I2J A;  3H37 A;  2KZM A;  3LWL A;  4QZD A;  4GLX A;  1ZQY A;  4RPX A;  5HHH A;  2PI5 A;  4I2B A;  2AGO A;  7ICE A;  8ICM A;  2FPK A;  1KTQ A;  3RB4 A;  3N97 B;  5KFH A;  5KT4 A;  4F4Z A;  9ICH A;  4F50 A;  4KLT A;  4M9L A;  2HHW A;  5HRB A;  2BE3 A;  2RFF A;  4X4O A;  4MFF A;  4DFM A;  1UA1 A;  4M2Y A;  4E80 A;  2XCP A;  4LVS A;  3TQ1 A;  3MR6 A;  3V72 A;  3MR2 A;  2W9B A;  3V7L A;  3PMN A;  4ELV A;  1U47 A;  1BPX A;  3GFK B;  1Z3E B;  3G6V A;  4J9L A;  3UQ2 A;  4EEY A;  9ICB A;  1ZQB A;  3H40 A;  4NLG A;  4O9M A;  1NZP A;  4FHW A;  2RDI A;  4EBC A;  5HHI A;  1Z00 A;  4B9T A;  4RUC A;  1ZJM A;  4ED2 A;  4JV0 A;  3JPQ A;  4M9N A;  5DGA A;  4IRK A;  1NKE A;  8ICN A;  4RWQ A;  7ICM A;  1L5U A;  3RJJ A;  4QZA A;  4XQ8 A;  3MR5 A;  1F5A A;  2ASJ A;  3PR5 B;  5J0Q A;  4XA5 A;  2BQU A;  4B9N A;  4PHD A;  4ZH4 A;  1KLN A;  1ARO P;  4ECU A;  4ECQ A;  3AQN A;  4FHP A;  4F5R A;  4RT3 A;  4DOC A;  4C8O A;  4I29 A;  2P6R A;  4X4P A;  1TFW A;  5IIN A;  8ICT A;  3BQT A;  5III A;  2BHN A;  4UD4 A;  4YMM A;  4QZH A;  2XY5 A;  3HPO A;  4QZF A;  2XO7 A;  4YXJ A;  2J6T A;  1QLN A;  4YVZ A;  7ICP A;  3UPS A;  3MBY A;  2IBK A;  4M9H A;  1FA0 A;  3B0Y A;  1UET A;  5KG7 A;  1JXL A;  3BQ0 A;  4WBZ A;  4UB4 A;  1X9S A;  4J9O A;  2ALZ A;  3OVA A;  4RQ7 A;  3M8R A;  4QZE A;  3Q8R B;  1TK5 A;  4LT6 A;  5DG8 A;  2ZJ8 A;  1DK2 A;  4EP7 A;  2ZHB A;  4RQ4 A;  1NK9 A;  9ICX A;  1YLQ A;  5F9N A;  1Q79 A;  3M9N B;  3ISC A;  3OJU A;  2W9C A;  3UPQ A;  5DBB A;  2Y1J A;  1N48 A;  2ZH2 A;  3T3F A;  2ZH4 A;  4O0I A;  4M9G A;  4RPZ A;  2NRX A;  5KFU A;  2W8L A;  4QZ8 A;  2FLP A;  4WCW A;  2DFL A;  1JIH A;  4JV2 A;  5DG7 A;  4DSE A;  5CWR A;  1WCL A;  4O5C A;  3ZDE A;  3H4D A;  4DSI A;  2A1J A;  2ZUD A;  4KLJ A;  2ZH6 A;  3KHR A;  5DGB A;  4DQI A;  4F4K A;  3OVB A;  1TFY A;  2BR0 A;  1JN3 A;  3C2K A;  5HNK A;  4PGX A;  1D9D A;  8ICQ A;  5DDM A;  1CUK A;  9ICL A;  4YXM A;  1LV5 A;  1ZQR A;  4J9P A;  4DSJ A;  4O3Q A;  2JZB A;  3EWA A;  4O3N A;  5KFF A;  3M9O B;  4X5V A;  1QSS A;  2UVR A;  2ZHA A;  5DQG A;  3JPT A;  1KSP A;  4UB2 A;  4F91 B;  4WC5 A;  2NRW A;  4DSL A;  4F5O A;  4NLN A;  3H39 A;  3C23 A;  4Z6F A;  2JEG A;  2ZTD A;  4I2I A;  3GQC A;  5KTQ A;  4EZ6 A;  4YCX A;  4JV1 A;  3G6X A;  3PO5 A;  3BJY A;  4X4Q A;  4XRH A;  5KFC A;  3HWT A;  4G3I A;  4ATB B;  5IIO A;  4MEY A;  5J0Y A;  4I2E A;  1ZQN A;  3RRG A;  3PVX A;  4IRD A;  3Q8S B;  5J2K A;  4RZR A;  4ED7 A;  1QSL A;  3NTU A;  1ZYQ A;  2BCR A;  4R64 A;  4M47 A;  3PW7 A;  3TI0 A;  5J0P A;  1XO1 A;  3JPO A;  2W9B B;  4J9N A;  4Z6E A;  3Q8K A;  4FBT A;  4UBB A;  3MAB A;  3PW0 A;  4NM1 A;  5KFD A;  4ECT A;  3FDS A;  4IRC A;  9ICK A;  3WFS C;  4NM2 A;  2NRT A;  3AU2 A;  1KDH A;  4KLG A;  5DEC A;  5DB9 A;  5KFI A;  4DOA A;  4P4M A;  4F4Y A;  2HHS A;  1WOT A;  4C8L A;  3HJ4 A;  1XSP A;  4QWD A;  4B9S A;  4ED1 A;  2ZTC A;  4YD2 A;  1ZQP A;  4J9R A;  1ZQI A;  2FLL A;  3BQ2 A;  5HML A;  3UXO A;  4YFK A;  3M9M B;  3RAQ A;  1BNO A;  4RQ8 A;  5KT3 A;  2PBE A;  4CCH A;  1PZN A;  8ICG A;  1ZQW A;  3T5L A;  2ZH3 A;  4XUS A;  1D9F A;  1H38 A;  5CR0 A;  5KFW A;  1X9M A;  3C5F A;  1JQR A;  4QWC A;  1NO5 A;  2BQR A;  4TUS A;  3M8S A;  4EBD A;  3PV8 A;  4LZG A;  9ICV A;  2R8G A;  4YQW A;  2BQ3 A;  1JAJ A;  2F1H A;  3NGD A;  4DQS A;  5HRD A;  5HC9 A;  1VFG A;  2ZH5 A;  2PI4 A;  3V7J A;  1ZJN A;  5DLF A;  2O5A A;  4I2H A;  2UVW A;  8ICA A;  1ZQV A;  4PGQ A;  3OJS A;  4K4I A;  4F2S A;  1IXR A;  2XY6 A;  2ZUB A;  4TUQ A;  1XWL A;  2XCA A;  1RPL A;  8ICR A;  4GC6 A;  2KP7 A;  4RWN A;  5J2H A;  4DF4 A;  2DRB A;  1COO A;  4TUR A;  1JX4 A;  4R65 A;  5KFZ A;  5KFJ A;  4DSF A;  4AT8 A;  4MF2 A;  3RR7 A;  4M9J A;  5EOZ A;  4RQ5 A;  2B21 A;  2IHM A;  4UBC A;  4UB5 A;  1ZQC A;  3KTQ A;  1JXE A;  2C2E A;  4AT9 A;  3H4B A;  2V9W A;  3WFQ E;  3OUY B;  8ICV A;  4R63 A;  2A1J B;  5KFG A;  4R8U B;  3PX4 A;  3TAQ A;  1D8Y A;  2PFP A;  3RJG A;  8ICF A;  9ICF A;  2DRA A;  4X4U A;  1ZQD A;  4NKT A;  4X4V A;  1ZQX A;  4YMO A;  4FS1 A;  3MGI A;  4X0A A;  4BXO A;  4F93 B;  3RJH A;  7ICK A;  2Q0Z X;  1V4A A;  1TK8 A;  2W9A A;  4UB1 A;  5CP2 A;  2DR9 A;  2JZB B;  1U49 A;  2VA3 A;  1A77 A;  1NKC A;  4DQQ A;  2JEI A;  3JPP A;  2R8I A;  3HT3 A;  2BDP A;  4IQW A;  9ICE A;  4TQS A;  8ICO A;  5HRL A;  5KT5 A;  4I2C A;  3KHH A;  1MSW D;  3TFR A;  3HJ1 A;  5KFO A;  4EZ9 A;  4FS2 A;  3QE9 Y;  5L1L A;  7ICH A;  1BVS A;  8ICI A;  4WC0 A;  2MUT B;  4IQU A;  1NJY A;  4DF8 A;  3EYZ A;  1B43 A;  3GII A;  4PHA A;  3PW2 A;  1S0N A;  7ICJ A;  4KLQ A;  7ICS A;  4F5N A;  2DR8 A;  4DO9 A;  3G6Y A;  2BPC A;  2KN7 A; 
#chains in the Genus database with same CATH topology
 4P4P A;  2JRZ A;  3AMZ A;  3UXP A;  2NO5 A;  3DV9 A;  5J2F A;  1XC9 A;  1MC8 A;  5J2B A;  4YR3 A;  4I2D A;  3CK6 A;  4KN4 A;  1R8C A;  3BS5 A;  4M6W B;  1ZQU A;  2HDO A;  2B0C A;  3RH5 A;  4FO6 A;  4QZG A;  3H0R B;  2V4Q A;  3ERC C;  5L1I A;  2DGZ A;  2IMW P;  1N5X A;  2EAN A;  2E8O A;  5AI4 A;  1L3T A;  5D49 A;  4P0Q B;  4YMN A;  3K75 D;  5AI6 A;  5AK5 A;  3OHB A;  3MR3 A;  3IG8 A;  4B9M A;  3NYB A;  3ZD8 A;  4Q44 A;  3GDX A;  5B3Q A;  4QW8 A;  4NXX A;  2GH1 A;  2JR5 A;  1FFV A;  3H8W A;  1JRO A;  3BDP A;  5GTH U;  4USA A;  2AJQ A;  2OXO A;  5GTI U;  2HOI A;  2KZ3 A;  5DBC A;  3UQ0 A;  1ZQK A;  3EPI A;  3THV A;  5AK3 A;  9ICR A;  5B66 U;  1DXS A;  2HHT A;  2RLT A;  2LMR A;  2FPM A;  5DQI A;  3QZ7 A;  4WC1 A;  3C2M A;  2ISO A;  5CFU A;  2XID A;  1Z00 B;  5G5H A;  5ALM A;  5IIJ A;  1FFU A;  9ICO A;  1UCV A;  2E1F A;  4UAZ A;  1S0M A;  1NK4 A;  1BPY A;  1WG8 A;  2LKY A;  2K60 A;  1ECW A;  9ICW A;  3KOO A;  3M6Z A;  1CI4 A;  5KFS A;  3M1Y A;  2E8N A;  3F2B A;  9ICJ A;  2FPL A;  3GV5 B;  3NWI A;  3SD7 A;  4KLE A;  5F9L A;  4Y2R A;  1L7O A;  3H3A A;  4KTQ A;  3PW5 A;  4I2G A;  3PO4 A;  2BCQ A;  5ALS A;  7ICG A;  3LK9 A;  5HP4 A;  8ICZ A;  1IM4 A;  4LEV A;  5HR7 A;  2ODG A;  4OD0 A;  3KHL A;  4ED6 A;  3OHA A;  3KHG A;  4F8R A;  2G5H B;  4P4O A;  4NL9 A;  5L1M A;  4KLF A;  1S76 D;  4GXK A;  5AM4 A;  9ICN A;  4OJ5 A;  4N7R A;  3ER9 B;  4ED0 A;  1U48 A;  1OU5 A;  4PL1 A;  1L8L A;  2F1I A;  1QCK A;  1ZQM A;  3ZDA A;  1JRP A;  5KFQ A;  5L9X A;  4E0D A;  4O3P A;  4NJ8 A;  1ZQJ A;  4WBY A;  4Z6C A;  4DL2 A;  4NXZ A;  5C0Y A;  8ICJ A;  2AH5 A;  4JLZ A;  5J2J A;  3L5K A;  4EEB A;  3NS1 A;  2P35 A;  3TFS A;  4NLZ A;  2JEF A;  4X4S A;  2ASD A;  5CEH A;  3C2L A;  4P0P B;  5ALI A;  2W8K A;  3RB6 A;  4NL9 C;  4F5Q A;  2FMS A;  4XQ7 A;  1RDF A;  3ISB A;  1Y88 A;  4J9M A;  5J2G A;  5AKJ A;  2H3V A;  4JK1 A;  5KT2 A;  1MQ3 A;  1ZQO A;  5EWF A;  2O1P A;  5JTG A;  3QXG A;  7ICT A;  4NLK A;  4F71 A;  2F2A B;  4RQ1 A;  2OYY A;  1S8O A;  1DGJ A;  4R8U A;  4DFK A;  2HN1 A;  1F44 A;  2FLN A;  4AT8 B;  5AM1 A;  3N28 A;  1NNL A;  2OH2 A;  3C5G A;  1MIY A;  4FO1 A;  3JPN A;  2PXI A;  4YP3 A;  3PHZ A;  2DBY A;  4AT9 B;  1OXJ A;  1U9L A;  4BGD A;  1S97 A;  1D8B A;  4US8 A;  3OSP A;  3AUO A;  2AGQ A;  1LB2 B;  4UAT A;  3AN1 A;  2R8J A;  5H2F U;  1WCN A;  4NLB A;  1S9F A;  2H3Q A;  1QSY A;  5AI9 A;  5HRF A;  1R8B A;  1DGS A;  3H7I A;  4UAU A;  5KFX A;  4AP9 A;  4LEZ A;  3KZI U;  4M6W A;  5IIM A;  2KK0 A;  5AK4 A;  3KD3 A;  4O3S A;  3UMC A;  1NZB A;  2OCE A;  4QZC A;  4DLG A;  4YR0 A;  2HHP A;  4RQM A;  9ICU A;  4UAV A;  4J9Q A;  1R8A A;  2KNJ A;  9ICA A;  4BWM A;  3E0F A;  2ZH7 A;  4G9B A;  4DOB A;  4P0Q A;  1VDV A;  4MF8 A;  4DLE A;  3WFO A;  5D61 A;  2ZTE A;  3F53 A;  4I2J A;  2KIC A;  2KZM A;  3CRX A;  4QZD A;  1ZQY A;  4I2B A;  8ICM A;  9ICH A;  2FPK A;  5HRB A;  2RFF A;  4M9L A;  5AI5 A;  5KAI U;  1UA1 A;  2YML A;  3TQ1 A;  1L7N A;  4UB6 U;  2JMG A;  1U47 A;  1N5W A;  1BPX A;  2W11 A;  3G6V A;  3UQ2 A;  9ICB A;  1ZQB A;  3H40 A;  4O9M A;  5AHX A;  1Z00 A;  1ZJM A;  4EEK A;  4RWQ A;  1NKE A;  5ALY A;  2N1R A;  5AM2 A;  3HJE A;  2ASJ A;  4ZH4 A;  4O68 A;  1ARO P;  3AQN A;  4F5R A;  2HBM A;  5IIN A;  3BQT A;  4UD4 A;  1PUZ A;  2BDU A;  4YMM A;  2XY5 A;  4CF3 A;  4YXJ A;  4PZN A;  2J6T A;  2RP5 A;  4UB4 A;  2W7O A;  1X9S A;  3Q8R B;  1N2X A;  1DK2 A;  2ESE A;  1N48 A;  2Y1J A;  5DBB A;  1VJ5 A;  2ZH4 A;  4M9G A;  4RPZ A;  5KFU A;  1V38 A;  2W8L A;  2DFL A;  4RQN A;  2A1J A;  1ZRN A;  5DGB A;  3OVB A;  2BR0 A;  5HNK A;  4PGX A;  4EX7 A;  3VC8 A;  5KFF A;  3M9O B;  4O3N A;  1QSS A;  1KSP A;  4WC5 A;  2NRW A;  2F77 X;  4F5O A;  3H39 A;  4I2I A;  3GQC A;  5KTQ A;  4C0Z A;  4JV1 A;  3PO5 A;  2E8P A;  2W7P A;  4I0U A;  4G3I A;  4ATB B;  3QUT A;  5J0Y A;  4I2E A;  2NV3 A;  4IRD A;  4ED7 A;  4RZR A;  4JLX A;  5ALH A;  2BCR A;  2KSO B;  4M47 A;  4LEW A;  1F5S A;  2ZIV A;  3TI0 A;  2G09 A;  1XO1 A;  5J0P A;  5JTI A;  3Q8K A;  4FBT A;  1X9X A;  5KFD A;  2E8M A;  2I6X A;  1T3Q A;  3AU2 A;  5JU5 A;  5AIC A;  5DB9 A;  2W3R A;  4F4Y A;  2EWR A;  3HJ4 A;  4HX0 A;  4QWD A;  2ZTC A;  4A8E A;  4YD2 A;  3K7D A;  3TAD A;  1ZQI A;  3UXO A;  3RAQ A;  3K1Z A;  4BJQ A;  1ZQW A;  5CR0 A;  5KFW A;  1X9M A;  3C5F A;  4QWC A;  3LYS A;  3M8S A;  2R8G A;  5HC9 A;  3MC1 A;  2Y0S C;  2ZIU A;  2OEH A;  1K5O A;  4I2H A;  4PGQ A;  2ZUB A;  1XWL A;  2YB1 A;  1RPL A;  2XCA A;  4GC6 A;  4DF4 A;  4WOY A;  1JX4 A;  4DSF A;  4AT8 A;  2KHQ A;  3ED5 A;  1O03 A;  5EOZ A;  1Q3V A;  4AT9 A;  3H4B A;  3OUY B;  4LEY A;  5AM0 A;  2HMX A;  4CE6 A;  2BZF A;  2BBJ A;  3TAD C;  1V4A A;  2JZB B;  1A77 A;  4DQQ A;  2JEI A;  1L6N A;  3HT3 A;  1VLB A;  4K99 A;  4TQS A;  4I2C A;  5E79 U;  4FS2 A;  3QE9 Y;  3GZF A;  4IQU A;  4AYB F;  3PW2 A;  7ICJ A;  4KLQ A;  7ICS A;  2D6F C;  4DO9 A;  2KN7 A;  5DGA A;  1X9W A;  2R8K A;  3IG5 A;  3LDA A;  5KL1 B;  3V7K A;  1KL9 A;  2M0N A;  1CEZ A;  5KG0 A;  4ECY A;  5CHE A;  3EW9 A;  1SXE A;  5KFP A;  4RT2 A;  7ICF A;  5HR9 A;  4WJ3 B;  4O69 A;  2B56 A;  1RYU A;  2YQE A;  1SKW A;  2MRL A;  4OAG A;  3IM1 A;  2AQ4 A;  2FI1 A;  4KN7 A;  3N7R C;  2EAP A;  1UT5 A;  4DQP A;  2Y1I A;  3BQ7 A;  1FO4 A;  1UQV A;  3NRZ A;  1T3N A;  1S0O A;  1DRG A;  3RBD A;  1VJ7 A;  4KIT B;  4C4T A;  4F72 A;  2P6U A;  3WK7 A;  1ZQH A;  3NAS A;  2NRK A;  2KEY A;  2JV3 A;  1R89 A;  2WF9 A;  3OGU A;  4CF5 A;  2KV2 A;  5AKG A;  5J2D A;  4ELT A;  4IR1 A;  3E58 A;  3PW4 A;  4XJE A;  3PNC A;  4RQ3 A;  4DS4 A;  1SL1 A;  2GWS A;  9ICT A;  5ALZ A;  3MDC A;  4F2R A;  2HVI A;  1TK0 A;  4BXO B;  2XGP A;  3U26 A;  2ZXI A;  1JUD A;  1UT8 A;  4EBE A;  1NK7 A;  4Q8E A;  2C22 A;  4AT7 A;  4ED3 A;  2YN4 A;  4GXI A;  1UA0 A;  4EEL A;  2VA2 A;  2DKX A;  2DUY A;  2BCU A;  1X6J A;  4RWP A;  2G08 A;  1XS9 D;  8ICS A;  3IRU A;  2I9G A;  1QQ5 A;  3QNM A;  3B9J A;  4K4G A;  2P66 A;  3TKA A;  3ZDD A;  2C2R A;  9ICM A;  5KG2 A;  1JMS A;  5J0S A;  5TZV A;  3TAP A;  1RYS A;  1MIW A;  5KG6 A;  1ZET A;  3HP6 A;  4DCC A;  2W54 A;  1SKR A;  4X4T A;  1BPB A;  3RR8 A;  4MEX A;  5J0O A;  4GC7 A;  2C28 A;  4DWI A;  9ICP A;  2UVU A;  3SYZ A;  5J29 A;  2RQ5 A;  5B5E U;  4ECS A;  1C20 A;  4CRX A;  5KAF U;  4ATB A;  2YMM A;  4FH3 A;  3RFA A;  4JUZ A;  4PGY A;  4YN4 A;  1B0X A;  3MDA A;  2KSO A;  5DB8 A;  1KFD A;  3GIJ A;  4MFC A;  2Q66 A;  4FHV A;  2CXY A;  1IV8 A;  3RJF A;  4NXT A;  4YR2 A;  4PH5 A;  4YD1 A;  1L7M A;  2KFZ A;  1DOQ A;  3N7S C;  3JYY A;  3WFP A;  2GAF D;  2H5X A;  9ICI A;  2LYH A;  1Q3U A;  5AM3 A;  2QB0 A;  3WKA A;  4LJX A;  5ALD A;  4C8M A;  3Q8M A;  5EE1 A;  4KLH A;  4S3N A;  3HX0 A;  4DL7 A;  5HRK A;  4ECW A;  3RAX A;  1SWW A;  2W04 A;  5A0L A;  1LKY B;  1KRP A;  1YZ7 A;  5JUM A;  4C7Z A;  1MQ2 A;  1MIV A;  4DS5 A;  1Z4N A;  4E7X A;  1SGG A;  1PK1 B;  4QZ9 A;  5KG3 A;  5BOM A;  3RB0 A;  5HRG A;  5AM5 A;  1NK8 A;  4IQV A;  3OUY A;  3QU2 A;  3MCR A;  3NVV A;  7ICR A;  3B0X A;  3OSN A;  2ES6 A;  4X4N A;  5D46 A;  4M0A A;  1U4B A;  4R66 A;  3KKA A;  5KFN A;  8ICX A;  3OPX A;  4DEZ A;  7ICV A;  3OV7 A;  5HR6 A;  4BX9 C;  2HCF A;  1TAU A;  3AU6 A;  4IQT A;  4MFA A;  2R8H A;  3K4G A;  2AQ0 A;  3S6J A;  3PX6 A;  4ECR A;  1COK A;  1KKX A;  3GV7 B;  5DKW A;  5J2E A;  3PSF A;  3PX0 A;  2WF7 A;  3RH6 A;  2LPE A;  3CYM A;  3SQI A;  5ALT A;  4UAS A;  4K8V A;  2R18 A;  3NVO A;  1BNP A;  4DL4 A;  3TAN A;  4QZB A;  2OM6 A;  4PHE A;  3WFR E;  2DL0 A;  3AQE A;  3IN5 A;  2IA6 A;  3E2E A;  5J2I A;  1RYR A;  2KFN A;  4RWO A;  2LBO A;  2KJ8 A;  2HHU A;  4RNO A;  2FDR A;  3KKA C;  2KVS A;  3MFI A;  2ZUC A;  1TKD A;  1SWV A;  5IIL A;  5J8Y A;  2MU2 A;  2RDJ A;  5CJ7 A;  3SMV A;  1UEV A;  1ZD3 A;  4AYB C;  4O3O A;  2UVV A;  2VA8 A;  2BCS A;  3GIL A;  3H37 A;  1OW5 A;  4IS7 A;  4GLX A;  4RPX A;  2AGO A;  5ALN A;  5KT4 A;  5JRT A;  4X4O A;  4MFF A;  4M2Y A;  4LVS A;  3A0H U;  3MR6 A;  4KMO B;  2W9B A;  3V7L A;  2Y0S F;  4ELV A;  4IL6 U;  1Z3E B;  2NYV A;  3VCB A;  3SR6 A;  1YZ6 A;  3K1R B;  4B9T A;  3WKE A;  3JPQ A;  4OJL A;  8ICN A;  7ICM A;  2WB1 C;  3ETR A;  4IC9 A;  2BBH A;  4QZA A;  1F5A A;  1RQN A;  4US9 A;  5J0Q A;  5J8Y C;  4XA5 A;  2H3Z A;  4B9N A;  1V97 A;  2G5I B;  4ECU A;  4CNQ A;  4U6P A;  1TFW A;  3JCF A;  2BHN A;  4QZH A;  5EE3 A;  2XO7 A;  4YVZ A;  2IBK A;  3B0Y A;  1UET A;  1JXL A;  2ALZ A;  4RQ7 A;  3M8R A;  3AQF A;  4PJ0 U;  1TK5 A;  5DG8 A;  2ZJ8 A;  4EP7 A;  2K4E A;  4C7Y A;  1NK9 A;  1KBU A;  3I76 A;  2LM4 A;  1JIH A;  3FAH A;  4JV2 A;  4O5C A;  4Y2X A;  3H4D A;  2ZH6 A;  1P7D A;  1TFY A;  4JMU A;  1D9D A;  8ICQ A;  5DDM A;  1CUK A;  4O3Q A;  4X5V A;  5DQG A;  3JPT A;  4F91 B;  1RQL A;  3C23 A;  4Z6F A;  2ZTD A;  2KG5 A;  3QYP A;  1JI7 A;  5KFC A;  1KN5 A;  3PVX A;  3Q8S B;  5J2K A;  3NTU A;  2CN1 A;  3BZK A;  4GIB A;  2KD1 A;  3WK6 A;  4J9N A;  4O3M A;  2WAQ C;  3MAB A;  3PW0 A;  4NM1 A;  2K89 A;  4C4R A;  2NRT A;  5DEC A;  1J97 A;  4DOA A;  3EF2 A;  4O6A A;  1WOT A;  4C8L A;  2F3N A;  4Y2U A;  4J9R A;  1O08 A;  3BQ2 A;  4YFK A;  3M9M B;  2KMD A;  3QU4 A;  1PZN A;  2FJ6 A;  8ICG A;  1D9F A;  1H38 A;  2GLE A;  2O6K A;  2BQR A;  3PV8 A;  2BQ3 A;  2ZIW B;  4DQS A;  2WHE A;  5HRD A;  2OHF A;  2UVW A;  4K4I A;  5AKX A;  3OJS A;  4F2S A;  1YT3 A;  2XY6 A;  1ZD4 A;  1AQ6 A;  1Z1V A;  2KP7 A;  5J2H A;  1COO A;  4TUR A;  3WK9 A;  4R65 A;  5KFZ A;  4M9J A;  4RQ5 A;  5AKH A;  3KTQ A;  4WQL A;  3WFQ E;  2V9W A;  2KJ5 A;  5KFG A;  3TAQ A;  1D8Y A;  4X4V A;  1ZQX A;  1SV0 C;  5CFT A;  2HBK A;  4FS1 A;  4F93 B;  5AKL A;  2BDP A;  9ICE A;  2IHO A;  8ICO A;  5KT5 A;  5KFO A;  4EZ9 A;  1M6Y A;  7ICH A;  4WC0 A;  8ICI A;  4WH5 A;  1NJY A;  3EYZ A;  4PHA A;  3IDW A;  3G6Y A;  2BPC A;  2EZX A;  4C80 A;  4I27 A;  1TV9 A;  1S10 A;  2J6U A;  2ZJA A;  5KFY A;  4X4R A;  5HRH A;  4KLU A;  4MHV A;  9ICS A;  3UM9 A;  4FH5 A;  2FMP A;  5CFS A;  2JGA A;  4M04 A;  2XGQ A;  2PFQ A;  3L9D A;  4UB3 A;  2ASL A;  9ICC A;  4ACO A;  1ZQ1 C;  1HIW A;  1V9P A;  4Q43 A;  3QUQ A;  1J2N A;  1SIJ A;  4NWI A;  1NK6 A;  2ZH9 A;  1L8O A;  1T4G A;  2HW3 A;  1HJP A;  3BQ1 A;  1U45 A;  1Q8K A;  1RXV A;  4I2A A;  2YTU A;  3WKC A;  1PX5 A;  3HIY A;  1WUD A;  4X0B A;  5F2V O;  2IHN A;  2QB1 A;  3C1Z A;  1NKB A;  3ZDC A;  3IP4 B;  4J9S A;  2PFO A;  5EE0 A;  5KNI A;  3I28 A;  3GIM A;  1OUQ A;  3SV4 A;  4BWJ A;  2JEJ A;  5KG4 A;  5KT7 A;  2BPG A;  5DDY A;  8ICW A;  1ZQS A;  4FHX A;  2ZH1 A;  4RU9 A;  4OJP A;  4RNM A;  3FM9 A;  4WC3 A;  1KFT A;  4UD5 A;  4P0P A;  2RRD A;  3WK5 A;  8ICH A;  5DLG A;  3LWM A;  3V6K A;  3PR4 A;  7ICQ A;  2IOF K;  3T5K A;  3QEB Z;  2IUB A;  2E3T A;  3FYH A;  4KB6 A;  3QU9 A;  2LYA A;  5ALG A;  2J6S A;  2HHV A;  4ELU A;  3T5J A;  1XU4 A;  4BUG A;  2KOB A;  5KFV A;  3GIK A;  4Y2Q A;  1BPD A;  5AKZ A;  1KW4 A;  5DBA A;  3RJE A;  4KLI A;  2A3V A;  4F92 B;  2W9C B;  2M2T A;  4KLD A;  1T7P A;  3ORY A;  1BGX T;  2AGP A;  2BKE A;  3H8S A;  4QWE A;  1KFS A;  2WF8 A;  3C18 A;  4TQR A;  1B4F A;  2EZZ A;  1XSN A;  5KFT A;  5L1K A;  5HRE A;  2HBL A;  1TFR A;  1NJZ A;  2FCL A;  4GFJ A;  5AI0 A;  2QAR B;  1N61 A;  3FC4 A;  3ETL A;  3H8J A;  3PML A;  4WC7 A;  2HOF A;  1L3U A;  4WQK A;  3C28 A;  4TUP A;  4EED A;  2ZJ5 A;  2QLT A;  4FHY A;  1QTM A;  2ZG6 A;  2ZIX B;  4NV0 A;  9ICQ A;  4QWB A;  2BPF A;  4OAF A;  4KMU A;  3RF9 A;  5J2A A;  1PVQ A;  1S77 D;  3SI8 A;  5D63 A;  4J9K A;  3LVV A;  4Y2P A;  3Q8P B;  2HHQ A;  1Z4O A;  1S0V A;  3T5H A;  3ZDB A;  2A1A A;  2ATL A;  3HKZ C;  9ICG A;  3NVW A;  3RTV A;  1CRX A;  4O5E A;  1JAL A;  1A6S A;  1ZQG A;  5KFB A;  4IG8 A;  2E5S A;  2ZIW A;  1NK5 A;  3ISD A;  1QQ7 A;  2WB1 F;  3LVW A;  1UPH A;  1SKS A;  1BPE A;  3IHQ B;  5J0U A;  4YG2 A;  4UAY A;  3C66 A;  4Y2J A;  1NJW A;  3CP8 A;  1ED1 A;  4CDG A;  1SL2 A;  5J0R A;  1NJX A;  8ICB A;  3RB3 A;  5J0W A;  1J2M A;  1MN8 A;  5DQH A;  4HYK A;  3C21 A;  5EWG A;  3WKD A;  4F5P A;  5DB7 A;  3R9K A;  2GOL A;  1GPJ A;  4Q8F A;  4M5D A;  1D8L A;  4IR9 A;  4RNN A;  2M2U A;  4NY8 A;  5CA7 A;  2DPJ A;  2AXT U;  4BDP A;  2HHX A;  5L1J A;  4FE3 A;  3RRH A;  1L3V A;  3ZD9 A;  5FP0 A;  1SZP A;  3RJI A;  8ICP A;  1TE2 A;  1XNS A;  2YMQ A;  4PPX A;  2LI6 A;  4ED8 A;  5HRI A;  1RZT A;  2M9N A;  3AQL A;  3HW8 A;  4RQ0 A;  2EAO A;  2V4R A;  4DL6 A;  2OWO A;  4KM5 A;  8ICU A;  2NRZ A;  4C4S A;  5ALE A;  4KX3 A;  4B9L A;  4Y2S A;  3JPR A;  3V6H A;  3H0M B;  1RG6 A;  2FMQ A;  1N63 A;  4ECV A;  2E1E A;  4NKU A;  4NXU A;  5J0T A;  3WU2 U;  3OVS A;  4QZI A;  2WAQ F;  2IOF A;  2EH9 A;  7ICN A;  4EBK A;  5DED A;  5KFL A;  4KX5 A;  3TAR A;  1ZQA A;  4I28 A;  5HMM A;  1SZH A;  3LWL A;  3OVA A;  2PI5 A;  5HHH A;  5KFH A;  2BE3 A;  2D8C A;  2HHW A;  1V85 A;  2IOH A;  4DFM A;  1PVR A;  2GA9 D;  1URJ A;  2W03 A;  3KZX A;  3GFK B;  4EEY A;  3SAH A;  4NLG A;  1NZP A;  4FHW A;  5HHI A;  2XIC A;  5F3X B;  4RUC A;  4JV0 A;  1SB3 C;  4M9N A;  4IRK A;  3L4P A;  2YB4 A;  3PR5 B;  2BQU A;  4PHD A;  3O0F A;  1KLN A;  5AKE A;  3PSI A;  1A0P A;  4C8O A;  4HAI A;  5III A;  3HPO A;  1QLN A;  7ICP A;  3UPS A;  5ALQ A;  2XI9 A;  3MBY A;  4M9H A;  2K8C B;  4LT6 A;  2F44 A;  4RQ4 A;  1YLQ A;  9ICX A;  5F9N A;  3M9N B;  2W9C A;  3OJU A;  2ZH2 A;  3UPQ A;  2DWQ A;  3T3F A;  2NRX A;  2FLP A;  2VIX A;  5ALF A;  1WCL A;  2ZUD A;  4KLJ A;  4NXW A;  3H0L B;  3KHR A;  4Y2Y A;  4DQI A;  3N7P D;  1JN3 A;  3C2K A;  2KHV A;  5KL8 B;  1ZQR A;  2KJ9 A;  4J9P A;  4DSJ A;  2JZB A;  2UVR A;  2H3I A;  4PL2 A;  4NLN A;  2QAR A;  5ALR A;  2WF6 A;  3D2Q A;  3PST A;  2Q4T A;  2K8B B;  3BJY A;  4XRH A;  3J81 j;  5IIO A;  2GO7 A;  4MEY A;  2KIW A;  5T14 A;  3RRG A;  3MGV A;  1UHU A;  2ZIX A;  3SAG A;  3H8M A;  4UB8 U;  3JPO A;  5ALL A;  4UBB A;  4ECT A;  4IRC A;  1KDH A;  5ALU A;  5KFI A;  4P4M A;  2HHS A;  1XSP A;  4B9S A;  1ZQP A;  3NVY A;  5HML A;  3QU7 A;  1BNO A;  5KT3 A;  4CCH A;  1N62 A;  2PMZ C;  3OWG A;  2DKZ A;  4UW9 A;  5ALJ A;  1JQR A;  4EX6 A;  2YMP A;  2D3D A;  4LZG A;  9ICV A;  5AKI A;  4YQW A;  1JAJ A;  5ALP A;  2F1H A;  2PI4 A;  1ZJN A;  2O5A A;  5DLF A;  1ZQV A;  3D2S A;  3ZI4 A;  2A19 A;  3WK4 A;  8ICR A;  2DRB A;  5KFJ A;  4MF2 A;  3RR7 A;  2B21 A;  2IHM A;  4UBC A;  8ICV A;  2A1J B;  8ICF A;  2PFP A;  9ICF A;  2YX8 A;  3RJG A;  2DRA A;  4X4U A;  1ZQD A;  4NKT A;  4YMO A;  4QNL A;  3MGI A;  1GO3 F;  4BXO A;  3RJH A;  7ICK A;  2Q0Z X;  4UB1 A;  5CP2 A;  3SEN A;  2R8I A;  4IQW A;  4OAH A;  2Z7J A;  2HBJ A;  3HJ1 A;  3KHH A;  1MSW D;  3TFR A;  3QX7 A;  4O67 A;  2W43 A;  3M7D A;  1BVS A;  2MUT B;  1SXD A;  2DR8 A;  1S0N A;  3D6J A;  2M2V A;  3IV6 A;  2F1J A;  2ISP A;  3PY8 A;  3AQK A;  2ZIV B;  1WWU A;  1FEZ A;  1RXW A;  1ZQF A;  4EYI B;  1BPZ A;  1LVH A;  1N56 A;  2B51 A;  4F4X A;  4I2F A;  4U7C A;  3MFH A;  1KNY A;  5KFK A;  1XO0 A;  2KE7 A;  4DQR A;  8ICC A;  3WK8 A;  3AQM A;  7ICL A;  1DK3 A;  1NK0 A;  5ALO A;  5J0X A;  3HKZ F;  2H3F A;  4JWN A;  2ID1 A;  5ALX A;  2M2W A;  2HSZ A;  2XC9 A;  3GV8 B;  4JWM A;  2ZIU B;  3UMB A;  4PZO A;  4EEN A;  5G5G A;  1SL0 A;  5BOL A;  8ICY A;  1K1Q A;  2G07 A;  5AIA A;  4F4W A;  4K98 A;  5AIB A;  2VJ5 A;  3NKU A;  3F2D A;  5AK6 A;  2K4I A;  4KLL A;  3M6K A;  4Z6D A;  3N4M B;  3RBE A;  4EBJ A;  3BS7 A;  3UXN A;  2BCV A;  1QH9 A;  1B22 A;  1HUO A;  4UAW A;  5D4B A;  1WYG A;  1A76 A;  2W55 A;  1LKY A;  2HI0 A;  4MKP A;  1SV0 A;  4ZOH C;  2K4P A;  1EXN A;  4RUA A;  1HUZ A;  5TIS U;  1ZQQ A;  2KZZ A;  2DR7 A;  3T79 A;  2PKE A;  3H38 A;  4DFJ A;  1PK1 A;  1K1S A;  5IIK A;  4WC6 A;  1X2I A;  4NXV A;  1Q46 A;  5KT6 A;  1PVP A;  5DG9 A;  4RQ2 A;  4LZD A;  8ICL A;  3TAC B;  3RH4 A;  3QEA Z;  2MSN A;  4PHP A;  1HEK A;  4FZL A;  4WC2 A;  2CRX A;  4DL5 A;  2I1Q A;  1KEJ A;  3RJK A;  4DFP A;  4OJO A;  1NI3 A;  4Y2V A;  2LHT A;  1T8E A;  4RPY A;  1ZQE A;  5KFR A;  3JPS A;  2HVH A;  5EWE A;  2LM1 A;  3OTQ A;  2DVI A;  4P2H A;  7ICI A;  8ICE A;  2WFA A;  1SV4 A;  2EZY A;  5K4L A;  3BZC A;  4ECZ A;  4RQ6 A;  3SV3 A;  2KIV A;  4QJF B;  5DB6 A;  3WKB A;  3NVZ A;  1X42 A;  3F5A A;  4CGZ A;  4B9V A;  2B4V A;  4WC4 A;  4C8N A;  4FBU A;  2EAM A;  3SZ2 A;  2F8K A;  1TVA A;  4FZM A;  3AM9 A;  4QIW F;  5KFM A;  4J03 A;  2MA1 A;  4OAI Z;  4DL3 A;  4F3O A;  2DPI A;  4AT7 B;  3C1Y A;  3JZ0 A;  4FZN A;  5KG5 A;  4B9U A;  4KLO A;  1X40 A;  4KLM A;  3HRD D;  4KLS A;  2DR5 A;  1F0M A;  5KFA A;  3QU5 A;  3F5E A;  1ZOL A;  3V6J A;  1Q78 A;  1TAQ A;  5EE9 A;  4K96 A;  2XY7 A;  4OJ6 A;  1C7Y A;  4C8K A;  2KTQ A;  3D2N A;  1ZQZ A;  2FE9 A;  1FIQ A;  5KFE A;  1X66 A;  4GXJ A;  4Q45 A;  3EPG A;  2G0A A;  3KFU F;  1IG6 A;  4QWA A;  1ZQL A;  5KG1 A;  7ICO A;  2CPR A;  2MUT A;  3QZ8 A;  1ZD2 P;  4ECX A;  2PFN A;  1T94 A;  1MA7 A;  2Y9U A;  3Q8L A;  2ZH8 A;  5CB1 A;  7ICU A;  1QQ6 A;  1ZQT A;  4UQG A;  4EYH B;  4K4H A;  3LQC B;  3UMG A;  4UAR A;  3MGH A;  8ICK A;  2L5Y A;  4B6J A;  2VAN A;  3ALR A;  3EZ5 A;  4FFD A;  5BPC A;  4O3R A;  4E8F A;  5B3P A;  2MAX A;  1XSL A;  2W9M A;  1NOM A;  2JHD A;  1ZRM A;  3ER8 C;  2QB0 B;  2AU0 A;  3GU3 A;  2NRV A;  2G06 A;  4QW9 A;  3BS5 B;  5ALK A;  2WTF A;  1UEU A;  1RM6 C;  5C5J A;  4DSK A;  3Q8Q B;  2I5H A;  5J2C A;  1L3S A;  2BGW A;  4O5K A;  2RHF A;  2F76 X;  2C2D A;  3ONN A;  1PK3 A;  4JB3 A;  5CHG A;  1IIP A;  5D62 A;  7ICE A;  1KTQ A;  2PMZ F;  3EUB 2;  3N97 B;  3RB4 A;  4F4Z A;  4F50 A;  3ICX A;  4KLT A;  3CW2 C;  2HN2 A;  4E80 A;  2XCP A;  3V72 A;  2JH7 A;  3MR2 A;  5CRX A;  3PMN A;  2KVC A;  4J9L A;  4EGW A;  2RDI A;  4EBC A;  1N60 A;  5AI8 A;  2K8A A;  4ED2 A;  3PSP A;  4ICA A;  2DF4 B;  1L5U A;  3RJJ A;  3SEI A;  4XQ8 A;  3MR5 A;  4FHP A;  2XVT A;  4ECQ A;  4RT3 A;  3F2C A;  4DOC A;  4I29 A;  2P6R A;  4X4P A;  8ICT A;  4CF4 A;  4QZF A;  2WF5 A;  1FA0 A;  2K4H A;  4OCZ A;  1ZXI A;  5KG7 A;  3BQ0 A;  4WBZ A;  4K9B A;  4J9O A;  4QZE A;  2ZHB A;  1Q79 A;  3ISC A;  4K9A A;  2EDU A;  4O0I A;  2VKQ A;  4QZ8 A;  4WCW A;  3SAF A;  3CNH A;  4DSE A;  5CWR A;  5DG7 A;  3ZDE A;  4DSI A;  1TAM A;  2JXJ A;  4F4K A;  3DEE A;  3HIL A;  2W3S A;  9ICL A;  4YXM A;  1LV5 A;  3EWA A;  3L3F X;  2ZHA A;  3KBB A;  3C29 A;  4UB2 A;  4DSL A;  2JEG A;  4EZ6 A;  1S5L U;  3AL0 B;  4YCX A;  3G6X A;  3A0B U;  2NO4 A;  4X4Q A;  3HWT A;  1ZQN A;  3PZP A;  2B6G A;  1QSL A;  1ZYQ A;  4R64 A;  5AKY A;  2KKV A;  1X6I A;  1Z1B A;  3PW7 A;  2W9B B;  4Z6E A;  3WFS C;  3FDS A;  9ICK A;  4NM2 A;  1L7P A;  1WWV A;  4KLG A;  5ALV A;  3NUQ A;  2LYB A;  3NRW A;  2HOQ A;  5AKK A;  5ALW A;  4ED1 A;  2FLL A;  2VJ4 A;  2F8L A;  1KQQ A;  4Y2T A;  4OO1 J;  3I1Y A;  2YY6 A;  4RQ8 A;  2PBE A;  3T5L A;  2ZH3 A;  4XUS A;  2AHO B;  1NO5 A;  2JH1 A;  2ZXH A;  4TUS A;  4EBD A;  3NGD A;  1VFG A;  2Y9T A;  2DQN B;  2ZH5 A;  3DDH A;  3V7J A;  4NLC A;  8ICA A;  1IXR A;  4TUQ A;  2EQY A;  4RWN A;  3QUC A;  4K97 A;  1ZQC A;  4UB5 A;  1JXE A;  2QKQ A;  2C2E A;  4R63 A;  4R8U B;  3PX4 A;  4QIW C;  4X0A A;  1TK8 A;  2W9A A;  2DR9 A;  3QUB A;  1U49 A;  4DFD A;  2VA3 A;  1NKC A;  3AEV A;  4EV6 A;  3JPP A;  1ZD5 A;  5HRL A;  5L1L A;  4DF8 A;  1Z19 A;  1B43 A;  3GII A;  4F5N A;  2KKP A; 
#chains in the Genus database with same CATH homology
 4P4P A;  3LDA A;  3V7K A;  4I27 A;  3UXP A;  2M2V A;  1TV9 A;  1CEZ A;  5KG0 A;  2F1J A;  1S10 A;  4ECY A;  2J6U A;  5J2F A;  2ZJA A;  1XC9 A;  2ISP A;  3PY8 A;  3AQK A;  1MC8 A;  5KFY A;  5J2B A;  4YR3 A;  5HRF A;  3EW9 A;  5KFP A;  4X4R A;  4RT2 A;  1RXW A;  1ZQF A;  7ICF A;  5HRH A;  4I2D A;  4EYI B;  1BPZ A;  4KLU A;  5HR9 A;  4KN4 A;  1R8C A;  1N56 A;  9ICS A;  4F4X A;  4I2F A;  4FH5 A;  3MFH A;  4M6W B;  1ZQU A;  2FMP A;  1KNY A;  5KFK A;  1SKW A;  3IM1 A;  2AQ4 A;  4M04 A;  2XGQ A;  3RH5 A;  4FO6 A;  4DQR A;  2PFQ A;  8ICC A;  3L9D A;  4UB3 A;  4KN7 A;  4QZG A;  2V4Q A;  2ASL A;  9ICC A;  1UT5 A;  5L1I A;  2Y1I A;  4DQP A;  2IMW P;  4Q43 A;  1V9P A;  3AQM A;  7ICL A;  1DK3 A;  1L3T A;  5D49 A;  1NK6 A;  1NK0 A;  4YMN A;  3K75 D;  3OHB A;  1T3N A;  1S0O A;  2ZH9 A;  3MR3 A;  3RBD A;  5J0X A;  4KIT B;  1VJ7 A;  1T4G A;  4B9M A;  2P6U A;  4JWN A;  2HW3 A;  1HJP A;  3BQ1 A;  2ID1 A;  3NYB A;  1U45 A;  2M2W A;  2XC9 A;  1RXV A;  3ZD8 A;  3GV8 B;  1ZQH A;  4Q44 A;  3GDX A;  4I2A A;  4JWM A;  2NRK A;  3HIY A;  1PX5 A;  4X0B A;  4QW8 A;  1R89 A;  3H8W A;  3OGU A;  5F2V O;  2IHN A;  3BDP A;  1SL0 A;  3C1Z A;  1NKB A;  5BOL A;  5J2D A;  3ZDC A;  4J9S A;  2AJQ A;  1K1Q A;  2PFO A;  4F4W A;  8ICY A;  4ELT A;  2KZ3 A;  5DBC A;  3UQ0 A;  1ZQK A;  4IR1 A;  3PW4 A;  3EPI A;  3THV A;  3GIM A;  3PNC A;  9ICR A;  4RQ3 A;  3SV4 A;  4KLL A;  2HHT A;  4BWJ A;  4Z6D A;  3N4M B;  2JEJ A;  5KG4 A;  2FPM A;  5DQI A;  4DS4 A;  3QZ7 A;  3RBE A;  4EBJ A;  4WC1 A;  5KT7 A;  3C2M A;  3UXN A;  1SL1 A;  2BPG A;  5DDY A;  2GWS A;  2ISO A;  2BCV A;  8ICW A;  1ZQS A;  4FHX A;  1B22 A;  2ZH1 A;  1HUO A;  1X9W A;  4RU9 A;  4UAW A;  2R8K A;  9ICT A;  4RNM A;  3MDC A;  5D4B A;  4F2R A;  1A76 A;  1TK0 A;  2HVI A;  4BXO B;  4WC3 A;  1Z00 B;  1KFT A;  4UD5 A;  2XGP A;  8ICH A;  5DLG A;  3LWM A;  5IIJ A;  3V6K A;  1UT8 A;  3PR4 A;  1EXN A;  4RUA A;  4EBE A;  2C22 A;  1NK7 A;  1HUZ A;  3T5K A;  3QEB Z;  4ED3 A;  4Q8E A;  9ICO A;  4AT7 A;  1ZQQ A;  4GXI A;  2KZZ A;  3FYH A;  4UAZ A;  1UA0 A;  1S0M A;  2DR7 A;  1NK4 A;  2VA2 A;  1BPY A;  2BCU A;  9ICW A;  4RWP A;  3H38 A;  4DFJ A;  1XS9 D;  8ICS A;  2J6S A;  2I9G A;  5KFS A;  2HHV A;  4ELU A;  3T5J A;  1K1S A;  1XU4 A;  5IIK A;  1X2I A;  4K4G A;  4WC6 A;  2P66 A;  3ZDD A;  9ICJ A;  2FPL A;  5KFV A;  3GV5 B;  2C2R A;  5KT6 A;  9ICM A;  5DG9 A;  3GIK A;  5KG2 A;  1JMS A;  5J0S A;  4KLE A;  5F9L A;  4RQ2 A;  4LZD A;  1BPD A;  5TZV A;  8ICL A;  5DBA A;  4KLI A;  3RJE A;  3RH4 A;  3TAP A;  3H3A A;  4KTQ A;  3PW5 A;  3QEA Z;  4I2G A;  1RYS A;  4F92 B;  2W9C B;  3PO4 A;  1MIW A;  4PHP A;  2M2T A;  2BCQ A;  5KG6 A;  4KLD A;  1ZET A;  1T7P A;  3HP6 A;  7ICG A;  3ORY A;  1BGX T;  2AGP A;  3LK9 A;  5HP4 A;  8ICZ A;  4WC2 A;  2BKE A;  3H8S A;  4DL5 A;  2I1Q A;  1KEJ A;  4QWE A;  1KFS A;  3RJK A;  3C18 A;  1IM4 A;  1SKR A;  4X4T A;  4TQR A;  1BPB A;  3KHL A;  4ED6 A;  4DFP A;  4MEX A;  3RR8 A;  3OHA A;  5J0O A;  4GC7 A;  2C28 A;  4DWI A;  9ICP A;  1XSN A;  3KHG A;  2UVU A;  4F8R A;  5KFT A;  5L1K A;  1T8E A;  5HRE A;  4P4O A;  3SYZ A;  5J29 A;  4RPY A;  4ECS A;  4KLF A;  1S76 D;  1ZQE A;  4ATB A;  5KFR A;  1TFR A;  3JPS A;  4GXK A;  9ICN A;  4FH3 A;  2HVH A;  5EWE A;  4ED0 A;  1U48 A;  1NJZ A;  4JUZ A;  4PGY A;  4YN4 A;  3MDA A;  2F1I A;  1ZQM A;  1OU5 A;  5DB8 A;  1KFD A;  4P2H A;  2DVI A;  3GIJ A;  4MFC A;  3ZDA A;  2Q66 A;  5KFQ A;  3ETL A;  3H8J A;  5L9X A;  3PML A;  4FHV A;  4WC7 A;  3RJF A;  4YR2 A;  4E0D A;  7ICQ A;  1L3U A;  7ICI A;  8ICE A;  4PH5 A;  4YD1 A;  4O3P A;  4TUP A;  2ZJ5 A;  4FHY A;  1QTM A;  2KFZ A;  1DOQ A;  1ZQJ A;  4Z6C A;  4ECZ A;  4WBY A;  3JYY A;  4RQ6 A;  3SV3 A;  3WFP A;  4DL2 A;  4NXZ A;  2H5X A;  5DB6 A;  9ICI A;  9ICQ A;  2LYH A;  4QWB A;  8ICJ A;  2BPF A;  5J2J A;  4KMU A;  5J2A A;  4B9V A;  1S77 D;  3SI8 A;  4WC4 A;  4C8N A;  4J9K A;  4FBU A;  4C8M A;  3Q8P B;  3TFS A;  3Q8M A;  2HHQ A;  4NLZ A;  1S0V A;  2JEF A;  3SZ2 A;  4X4S A;  2ASD A;  4S3N A;  3T5H A;  1TVA A;  3HX0 A;  4KLH A;  4DL7 A;  3ZDB A;  5HRK A;  4ECW A;  2ATL A;  3RAX A;  9ICG A;  3C2L A;  3RTV A;  4O5E A;  5KFM A;  2W8K A;  3RB6 A;  1ZQG A;  5KFB A;  1KRP A;  4F5Q A;  4DL3 A;  2FMS A;  4IG8 A;  4F3O A;  2DPI A;  5JUM A;  4AT7 B;  1NK5 A;  3C1Y A;  3ISD A;  3JZ0 A;  5KG5 A;  4XQ7 A;  4B9U A;  4KLO A;  1SKS A;  4KLM A;  1BPE A;  1Y88 A;  3IHQ B;  5J0U A;  5J2G A;  3ISB A;  4J9M A;  4DS5 A;  1MQ2 A;  4KLS A;  1MIV A;  4E7X A;  4JK1 A;  4YG2 A;  4UAY A;  3C66 A;  2DR5 A;  4QZ9 A;  5KG3 A;  5KFA A;  5KT2 A;  5BOM A;  3RB0 A;  1NJW A;  1MQ3 A;  1ZQO A;  5EWF A;  3V6J A;  5HRG A;  1SL2 A;  1Q78 A;  2O1P A;  5J0R A;  1TAQ A;  1NJX A;  7ICT A;  4NLK A;  3RB3 A;  8ICB A;  5J0W A;  5DQH A;  2XY7 A;  4RQ1 A;  1NK8 A;  4HYK A;  3C21 A;  4IQV A;  1C7Y A;  5EWG A;  3OUY A;  4R8U A;  4DFK A;  4F5P A;  4C8K A;  2KTQ A;  1ZQZ A;  2FLN A;  5DB7 A;  4Q8F A;  4AT8 B;  7ICR A;  3B0X A;  3OSN A;  4M5D A;  3C5G A;  5KFE A;  1MIY A;  3JPN A;  1D8L A;  2PXI A;  4IR9 A;  4GXJ A;  4Q45 A;  4RNN A;  3EPG A;  4X4N A;  4YP3 A;  2M2U A;  4NY8 A;  4AT9 B;  5CA7 A;  5D46 A;  1U9L A;  4BGD A;  4QWA A;  2DPJ A;  1U4B A;  1ZQL A;  4R66 A;  4BDP A;  4M0A A;  2HHX A;  1S97 A;  5KG1 A;  5L1J A;  5KFN A;  8ICX A;  7ICV A;  4DEZ A;  3OSP A;  7ICO A;  3RRH A;  3AUO A;  2AGQ A;  2MUT A;  3ZD9 A;  1SZP A;  1L3V A;  1LB2 B;  3OV7 A;  3QZ8 A;  3RJI A;  8ICP A;  1TAU A;  3AU6 A;  4IQT A;  4ECX A;  4MFA A;  2R8H A;  2PFN A;  3K4G A;  2R8J A;  2AQ0 A;  1WCN A;  4PPX A;  3Q8L A;  4ED8 A;  5HRI A;  2ZH8 A;  5CB1 A;  3PX6 A;  1S9F A;  2M9N A;  4ECR A;  1RZT A;  3AQL A;  7ICU A;  3HW8 A;  4RQ0 A;  3GV7 B;  1ZQT A;  1QSY A;  4UQG A;  2V4R A;  4DL6 A;  5DKW A;  5J2E A;  4EYH B;  2OWO A;  1DGS A;  4K4H A;  8ICU A;  3LQC B;  1R8B A;  2NRZ A;  3PX0 A;  3MGH A;  3RH6 A;  3H7I A;  8ICK A;  5KFX A;  2VAN A;  3EZ5 A;  4B9L A;  5BPC A;  4M6W A;  4O3R A;  1BNP A;  2MAX A;  4E8F A;  1XSL A;  2W9M A;  3JPR A;  3V6H A;  5IIM A;  4DL4 A;  3TAN A;  4QZB A;  2FMQ A;  1NOM A;  4ECV A;  2AU0 A;  4PHE A;  4NKU A;  4O3S A;  3WFR E;  4QZC A;  4DLG A;  4YR0 A;  5J0T A;  2IA6 A;  3E2E A;  2NRV A;  4QW9 A;  5J2I A;  2HHP A;  1RYR A;  3OVS A;  4QZI A;  2WTF A;  9ICU A;  1UEU A;  2KFN A;  4J9Q A;  1R8A A;  4RWO A;  9ICA A;  4BWM A;  5C5J A;  2HHU A;  4RNO A;  2ZH7 A;  4DSK A;  4DOB A;  3Q8Q B;  3MFI A;  5J2C A;  4O5K A;  2ZUC A;  2BGW A;  1TKD A;  1L3S A;  5IIL A;  2C2D A;  4MF8 A;  4DLE A;  2RDJ A;  5CJ7 A;  7ICN A;  1UEV A;  5DED A;  3WFO A;  5KFL A;  4O3O A;  4EBK A;  3TAR A;  1ZQA A;  2UVV A;  2VA8 A;  5CHG A;  4I28 A;  2ZTE A;  2BCS A;  5HMM A;  3GIL A;  4I2J A;  3H37 A;  2KZM A;  3LWL A;  4QZD A;  4GLX A;  1ZQY A;  4RPX A;  5HHH A;  2PI5 A;  4I2B A;  2AGO A;  7ICE A;  8ICM A;  2FPK A;  1KTQ A;  3RB4 A;  3N97 B;  5KFH A;  5KT4 A;  4F4Z A;  9ICH A;  4F50 A;  4KLT A;  4M9L A;  2HHW A;  5HRB A;  2BE3 A;  2RFF A;  4X4O A;  4MFF A;  4DFM A;  1UA1 A;  4M2Y A;  4E80 A;  2XCP A;  4LVS A;  3TQ1 A;  3MR6 A;  3V72 A;  3MR2 A;  2W9B A;  3V7L A;  3PMN A;  4ELV A;  1U47 A;  1BPX A;  3GFK B;  1Z3E B;  3G6V A;  4J9L A;  3UQ2 A;  4EEY A;  9ICB A;  1ZQB A;  3H40 A;  4NLG A;  4O9M A;  1NZP A;  4FHW A;  2RDI A;  4EBC A;  5HHI A;  1Z00 A;  4B9T A;  4RUC A;  1ZJM A;  4ED2 A;  4JV0 A;  3JPQ A;  4M9N A;  5DGA A;  4IRK A;  1NKE A;  8ICN A;  4RWQ A;  7ICM A;  1L5U A;  3RJJ A;  4QZA A;  4XQ8 A;  3MR5 A;  1F5A A;  2ASJ A;  3PR5 B;  5J0Q A;  4XA5 A;  2BQU A;  4B9N A;  4PHD A;  4ZH4 A;  1KLN A;  1ARO P;  4ECU A;  4ECQ A;  3AQN A;  4FHP A;  4F5R A;  4RT3 A;  4DOC A;  4C8O A;  4I29 A;  2P6R A;  4X4P A;  1TFW A;  5IIN A;  8ICT A;  3BQT A;  5III A;  2BHN A;  4UD4 A;  4YMM A;  4QZH A;  2XY5 A;  3HPO A;  4QZF A;  2XO7 A;  4YXJ A;  2J6T A;  1QLN A;  4YVZ A;  7ICP A;  3UPS A;  3MBY A;  2IBK A;  4M9H A;  1FA0 A;  3B0Y A;  1UET A;  5KG7 A;  1JXL A;  3BQ0 A;  4WBZ A;  4UB4 A;  1X9S A;  4J9O A;  2ALZ A;  3OVA A;  4RQ7 A;  3M8R A;  4QZE A;  3Q8R B;  1TK5 A;  4LT6 A;  5DG8 A;  2ZJ8 A;  1DK2 A;  4EP7 A;  2ZHB A;  4RQ4 A;  1NK9 A;  9ICX A;  1YLQ A;  5F9N A;  1Q79 A;  3M9N B;  3ISC A;  3OJU A;  2W9C A;  3UPQ A;  5DBB A;  2Y1J A;  1N48 A;  2ZH2 A;  3T3F A;  2ZH4 A;  4O0I A;  4M9G A;  4RPZ A;  2NRX A;  5KFU A;  2W8L A;  4QZ8 A;  2FLP A;  4WCW A;  2DFL A;  1JIH A;  4JV2 A;  5DG7 A;  4DSE A;  5CWR A;  1WCL A;  4O5C A;  3ZDE A;  3H4D A;  4DSI A;  2A1J A;  2ZUD A;  4KLJ A;  2ZH6 A;  3KHR A;  5DGB A;  4DQI A;  4F4K A;  3OVB A;  1TFY A;  2BR0 A;  1JN3 A;  3C2K A;  5HNK A;  4PGX A;  1D9D A;  8ICQ A;  5DDM A;  1CUK A;  9ICL A;  4YXM A;  1LV5 A;  1ZQR A;  4J9P A;  4DSJ A;  4O3Q A;  2JZB A;  3EWA A;  4O3N A;  5KFF A;  3M9O B;  4X5V A;  1QSS A;  2UVR A;  2ZHA A;  5DQG A;  3JPT A;  1KSP A;  4UB2 A;  4F91 B;  4WC5 A;  2NRW A;  4DSL A;  4F5O A;  4NLN A;  3H39 A;  3C23 A;  4Z6F A;  2JEG A;  2ZTD A;  4I2I A;  3GQC A;  5KTQ A;  4EZ6 A;  4YCX A;  4JV1 A;  3G6X A;  3PO5 A;  3BJY A;  4X4Q A;  4XRH A;  5KFC A;  3HWT A;  4G3I A;  4ATB B;  5IIO A;  4MEY A;  5J0Y A;  4I2E A;  1ZQN A;  3RRG A;  3PVX A;  4IRD A;  3Q8S B;  5J2K A;  4RZR A;  4ED7 A;  1QSL A;  3NTU A;  1ZYQ A;  2BCR A;  4R64 A;  4M47 A;  3PW7 A;  3TI0 A;  5J0P A;  1XO1 A;  3JPO A;  2W9B B;  4J9N A;  4Z6E A;  3Q8K A;  4FBT A;  4UBB A;  3MAB A;  3PW0 A;  4NM1 A;  5KFD A;  4ECT A;  3FDS A;  4IRC A;  9ICK A;  3WFS C;  4NM2 A;  2NRT A;  3AU2 A;  1KDH A;  4KLG A;  5DEC A;  5DB9 A;  5KFI A;  4DOA A;  4P4M A;  4F4Y A;  2HHS A;  1WOT A;  4C8L A;  3HJ4 A;  1XSP A;  4QWD A;  4B9S A;  4ED1 A;  2ZTC A;  4YD2 A;  1ZQP A;  4J9R A;  1ZQI A;  2FLL A;  3BQ2 A;  5HML A;  3UXO A;  4YFK A;  3M9M B;  3RAQ A;  1BNO A;  4RQ8 A;  5KT3 A;  2PBE A;  4CCH A;  1PZN A;  8ICG A;  1ZQW A;  3T5L A;  2ZH3 A;  4XUS A;  1D9F A;  1H38 A;  5CR0 A;  5KFW A;  1X9M A;  3C5F A;  1JQR A;  4QWC A;  1NO5 A;  2BQR A;  4TUS A;  3M8S A;  4EBD A;  3PV8 A;  4LZG A;  9ICV A;  2R8G A;  4YQW A;  2BQ3 A;  1JAJ A;  2F1H A;  3NGD A;  4DQS A;  5HRD A;  5HC9 A;  1VFG A;  2ZH5 A;  2PI4 A;  3V7J A;  1ZJN A;  5DLF A;  2O5A A;  4I2H A;  2UVW A;  8ICA A;  1ZQV A;  4PGQ A;  3OJS A;  4K4I A;  4F2S A;  1IXR A;  2XY6 A;  2ZUB A;  4TUQ A;  1XWL A;  2XCA A;  1RPL A;  8ICR A;  4GC6 A;  2KP7 A;  4RWN A;  5J2H A;  4DF4 A;  2DRB A;  1COO A;  4TUR A;  1JX4 A;  4R65 A;  5KFZ A;  5KFJ A;  4DSF A;  4AT8 A;  4MF2 A;  3RR7 A;  4M9J A;  5EOZ A;  4RQ5 A;  2B21 A;  2IHM A;  4UBC A;  4UB5 A;  1ZQC A;  3KTQ A;  1JXE A;  2C2E A;  4AT9 A;  3H4B A;  2V9W A;  3WFQ E;  3OUY B;  8ICV A;  4R63 A;  2A1J B;  5KFG A;  4R8U B;  3PX4 A;  3TAQ A;  1D8Y A;  2PFP A;  3RJG A;  8ICF A;  9ICF A;  2DRA A;  4X4U A;  1ZQD A;  4NKT A;  4X4V A;  1ZQX A;  4YMO A;  4FS1 A;  3MGI A;  4X0A A;  4BXO A;  4F93 B;  3RJH A;  7ICK A;  2Q0Z X;  1V4A A;  1TK8 A;  2W9A A;  4UB1 A;  5CP2 A;  2DR9 A;  2JZB B;  1U49 A;  2VA3 A;  1A77 A;  1NKC A;  4DQQ A;  2JEI A;  3JPP A;  2R8I A;  3HT3 A;  2BDP A;  4IQW A;  9ICE A;  4TQS A;  8ICO A;  5HRL A;  5KT5 A;  4I2C A;  3KHH A;  1MSW D;  3TFR A;  3HJ1 A;  5KFO A;  4EZ9 A;  4FS2 A;  3QE9 Y;  5L1L A;  7ICH A;  1BVS A;  8ICI A;  4WC0 A;  2MUT B;  4IQU A;  1NJY A;  4DF8 A;  3EYZ A;  1B43 A;  3GII A;  4PHA A;  3PW2 A;  1S0N A;  7ICJ A;  4KLQ A;  7ICS A;  4F5N A;  2DR8 A;  4DO9 A;  3G6Y A;  2BPC A;  2KN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...