3ISZA

Crystal structure of mono-zinc form of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
376
structure length
369
Chain Sequence
b'MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 122
structure length 369
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iszA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iszA01
4UF4A 2ZEPA 4Z65A 1GYTA 1ZLIA 1FT7A 2PCUA 3D66A 3GLJA 4AXVA 4MCSA 5LYIA 5CBMA 4UIBA 4P4IA 3WC5A 4ONWA 1XRYA 5HVFA 5THWA 5D8NA 3CPXA 4P4FA 3IFEA 2F7VA 2C6GA 4NFRA 2HB6A 1TXRA 1YLOA 4ZI6A 2XEGA 4DJLA 4IK2A 4P4EA 1XBUA 5CPAA 4YU9A 4FWUA 4TNUA 3PBEA 4A94A 4MHZA 3KASA 5D29A 5JM6A 4P10A 3RBUA 2AFXA 3LMSA 1HEEA 1LAPA 4JZ0A 1ZG7A 2BOAA 2WYRA 3ISXA 1HDUA 3D4UA 4YWYA 3D67A 4G1PA 4TWEA 1H8LA 1FNOA 2V8GA 3WC6A 5JGFA 4FUUA 1CBXA 4NGRA 2AFOA 2GLFA 4MCQA 3KR4A 1Z5RA 3PEIA 1OBRA 1TKHA 1LCPA 3LWUA 4F9UA 3MN8A 3CT9A 3V7ZA 4IHMA 1Y0RA 3MRUA 3D7GA 3FH4A 2C1CA 1F2OA 4ZX8A 1M4LA 4OC1A 1YSJA 2DEAA 3PB4X 5LRKA 4F9VA 2JBJA 4NJRA 2IQ6A 2QVPA 2PVVA 3B7IA 2PE3A 3B3CA 5HVHA 2O53A 4X3RA 1LOKA 1ELLP 1BPNA 3H8GA 2PJ9A 3JRUA 4ZYQA 3NH5A 2Q51A 1AMPA 4X8IA 4KSIA 2V8DA 3KHXA 4ZY0A 4H2KA 2PJ0A 5I4MA 3VARA 4ZX9A 3PBBA 5LYFA 2O4HA 4UEZA 3PB9X 4O23A 4RUHA 1YW4A 1IY7A 4MCPA 2PJ6A 2IJZA 3NH4A 3K2KA 2JBKA 4MMOA 2JEWA 3D7HA 2ZOFA 3PRTA 3HUVA 1BAVA 2PJ2A 1VHEA 5LYLA 4CPAA 2ZELA 1TF8A 4PPZA 4OC4A 5DS0A 2XEIA 3DLJA 5HVGA 1IGBA 2QJ8A 4F8ZA 2V77A 3QNVA 4JYWA 4NGPA 4OKOA 1VGYA 3PB6X 4UIAA 3D7DA 5K8MA 4MRIA 4A37A 5LRGA 3FEDA 3BI0A 1ZG9A 4R7MA 1LFWA 4X2TA 3D68A 3NFZA 2C6CA 3SJGA 1TF9A 1BPMA 2PJ4A 4R6TA 2ABZA 2IMOA 1CPSA 4NGQA 4UEEA 1F57A 1ARLA 1CP7A 5F09A 3WABA 4UEFA 3KQXA 5K8OA 4K3NA 4A39A 3FECA 3I1UA 1KWMA 2RB7A 2GREA 2QYVA 3FEEA 4PXCA 7CPAA 1CPXA 2BCOA 3IWWA 1LAMA 4OP4A 3CPAA 4WJBA 3WC7A 1Z2LA 3TC8A 3S9LA 2FVGA 2CTBA 4OC2A 3S9MA 2BO9A 4BD9A 3SJEA 1R43A 4MXUA 2ZEOA 3H8FA 2XEFA 4GM5A 3ISZA 4P4BA 5HXDA 4FBEA 3VH9A 4PXBA 2HC9A 3B3SA 4OC5A 3B2YA 1HDQA 2RFHA 3DGVA 4R76A 2AFMA 3IIBA 1TKFA 4LQGA 1Y0YA 3VATA 2AFSA 1R3NA 3H8EA 2PJ3A 1Y7EA 5K8PA 2PJ1A 5IB9A 1VIXA 3N5FA 1XMBA 2PJAA 2NSMA 3IEHA 1EE3P 5LRJA 3SI2A 3K9TA 4PXEA 4DUKA 8CPAA 3KQZA 2PRQA 4R8FA 3KHZA 3V38A 2ZEHA 4OC3A 2PJ8A 2XEJA 3SJXA 4P6YA 3BXMA 2CTCA 2C6PA 3FMCA 2PVWA 2WZNA 2Q4ZA 1YMEA 2NYQA 1PYTB 3KGQA 1VHOA 3T8WA 1YW6A 4OMEA 2PJ5A 4DYOA 2ZEGA 4P4DA 3WT4A 2G9DA 4NGSA 3S9NA 3KR5A 1F2PA 2ZENA 3PFOA 4NJQA 4IAVA 2J9AA 1ZG8A 1LANA 3IO1A 2AFUA 4MCRA 4OIDA 4Q7AA 1TKJA 3NH8A 1JQGA 4OIWA 2ZOGA 2ZEEA 5JH9A 1BLLE 1Z8LA 4ZY1A 1RTQA 3NA6A 3CDXA 3HLPA 4EFDA 2GU2A 2V8VA 2PJ7A 4NGTA 1QMUA 3KL9A 4A38A 3FX6A 1CP6A 4P44A 4ZY2A 3RAMA 4MHNA 4P45A 1CG2A 2GLJA 1NSAA 5J1QA 3IC1A 1CX8A 2AFZA 4EWTA 3B3WA 3KZWA 4MHYA 4B6ZA 3SI1A 3FJUA 3L2NA 2VL1A 4P4JA 2AFWA 1AYEA 2F8HA 2I3CA 1DTDA 2PIZA 3B3VA 4FAIA 4WWVA 5K8NA 2ZEFA 3SI0A 1XJOA 1ELMP 2ANPA 2ZEMA 4NGNA 4OC0A 2ZEDA 3BI1A 2Q43A 2OR4A 4PQAA 3TX8A 2PJCA 1ARMA 1XFOA 3IJ3A 1ZLHA 3GUXA 1DE4C 3PFEA 3FF3A 5ELYA 3PB7X 1Q7LA 2V8HA 3GB0A 3B3TA 2PJBA 2CIJA 4W9YA 4EMEA 3D7FA 2OOTA 1PCAA 3BHXA 4MHPA 2CF4A 3B35A 4NGMA 2EK9A 1QQ9A 3KI9A 4PXDA 6CPAA 2PIYA 2EK8A 1UWYA 3SJFA 3FVLA 3RZAA 5LYDA 2EWBA 3PB8X 2POKA
chains in the Genus database with same CATH superfamily
5E3AA 3RB6A 2HFZA 2I5JB 4NCGB 3LO3A 4MCSA 5E96A 2E5IA 2NXJA 4UIBA 4OADA 1VC5A 4DN9A 1ZAXA 3QO9A 2CXEA 2IDLA 4IH7A 5THWA 2DXDA 1M44A 3ENWA 2FJBB 1RI7A 4OZ5A 4OZJA 4RZRA 1WOPA 4Z37A 2GV1A 4UOFA 2CPEA 4LF6F 1TK0A 1KQSR 1DLOA 5BYSA 4TNUA 3KASA 1EQMA 4OYPA 4B3MF 1YJRA 3QRQA 2KT2A 4CGLA 1NJIT 1Q5YA 5KOWA 4RN7A 2KFZA 5DM7Q 3DXBA 5A2QY 3MD3A 3H5SA 5CABA 3O6QA 3RAXA 1NK7A 4F9UA 4A8MP 4DL0C 4DV1J 5GVQA 4OX6A 3TAPA 3HFKA 1FX2A 1SL0A 3PB4X 5LSOA 2B5GB 1S3ZA 4OZLA 3FSIA 4J9UE 4ZVQB 4GVBB 4B3TJ 4Y2IA 1S12A 3I3GA 4ILLA 4DR4J 1TZ0A 2WBRA 2XNRA 2M2BA 5KFGA 3JRUA 3I32A 1KQFB 4OZ3A 2Y8WA 4BINA 4KSIA 3M30A 4JLYA 2J7KA 1U6BA 4DCPB 4UZCA 4RUHA 1FI4A 4CM0A 1FD2A 3EXYA 2JBKA 5KG6A 1U24A 3HUVA 1N5SA 3G82B 3G71S 4QIFA 2AU0A 3EYZA 4UQGA 3KK3A 1LW0A 3BJYA 1TF8A 5C5JA 4A33A 5EDWA 3RBZA 4CAFA 3ZZ0A 2OZHA 4JI5F 2XEIA 3K7RA 2KFYA 4N41A 4QWEA 3NCQA 1KR4A 2CPIA 1RP5A 3HHLC 1NCLA 3QGGA 3MPUB 4PYAA 5B0FA 2ZITA 5T14A 3C46A 4URQU 2L48A 2C6CA 1ZM9A 1SJRA 4X4RA 4PG4A 3PTWA 3M8RA 4Q0BA 2HVHA 3HHLB 3KQXA 1FERA 1L3SA 1Q16B 3SFUA 3FEEA 2PA8D 7CPAA 1S57A 2FZGB 1UPPA 1LAMA 5F9NA 5BJRA 1DQ8A 1YQHA 5C42A 2RQKA 4ZK7M 3F5BA 1YX2A 3FZBA 4IRCA 4QR0A 3RYLA 4IYQA 5D0GA 3A8EA 4YB5A 1RHRB 4JI1J 4ECYA 4I4BA 1XQIA 5HXDA 2L41A 4DR5F 4LF5F 3B2YA 2K1RB 5L38A 1L3VA 1N36F 4P74A 1Y0YA 1TELA 3T6JA 4ZS6A 4NASA 2D69A 4NLOA 3H8EA 3KLHA 5CQGA 3FBBA 2DIUA 2J8SA 5ETMA 1RWNB 2R2TA 1UTAA 1EX8A 5HMXA 1YX0A 4QR1A 3SSRA 4LRDA 1QVFR 1U49A 4XNHB 2ZEHA 4XPKA 1R6YA 2XSJA 2JLGA 2L08A 2PJ8A 1RJJA 1I94J 5IOLA 3H4DA 4JYAF 3K5NA 3D1QA 3C14A 1SXLA 1JLCB 4LX9A 1YW6A 3DRSB 3MURP 3MM6B 2H3EB 4X4UA 1FJGJ 4DV0J 2PSWA 2G0CA 4PK2A 2D3ZA 5FIIA 3Q22A 1CBKA 4F02A 2QRRA 4DPTA 4WYWA 3CB4A 3MD1A 2FJXA 3IG1A 2AX0A 2NYHA 3CJ4A 1R89A 4USJC 2OO4A 2XSFA 3BBFA 1HWJA 1RT4A 4DR2F 2B3UA 4IKAA 2CZ9A 3GQCA 1MN9A 3CUNA 3EDQB 1N54B 4K0KF 1U4BA 1NSAA 3M9NB 3M8SA 3TO7A 2LKZA 2Z3LA 3KFWX 3B3WA 2J76E 4R25A 2RJZA 1URRA 3L2NA 2DNYA 2RAQA 5DWMA 2R7TA 1QVGR 4FYWB 4X64F 3HSGA 3U1LA 2ARHA 2ZEDA 4F0HA 4DV5F 2JSXA 2ODFA 1Q2YA 5T7LB 4YHHJ 5KG3A 4NLUA 4F2SA 4FPIA 5EMIA 4DN0A 3SSQA 2FCKA 2VBXA 5IS2A 2VIHA 4V19J 4LSZB 1P9YA 3NBPA 1DJ0A 3O5TB 2XYGB 3GB0A 3CTRA 2R7RA 3QSIA 1MLAA 1Y00A 4KH1B 1Y9WA 1RWVB 3OLBA 4YY3J 2CQ1A 5BWAB 1ROFA 4EBEA 3KK2B 3PHTA 4OHWA 3ZTQA 1WG4A 3CIMA 1UWYA 3H42A 4B3OA 1NHKL 5KFQA 3UR0A 4U5YA 4WTYA 1OY6A 4K5RA 4FS1A 4YRHA 1GYTA 4R3LA 2JEFA 1HNVB 3WIVA 2FUG9 2ASDA 4LFAF 4IUSA 2EVZA 4Q8EA 3HHKA 3MAAB 3FFIB 4FN5A 4B08A 2WPWA 4IFYB 4OYBA 2HQYA 1NZAA 3Q89A 3MZIA 4WTOB 1Z4RA 5KFCA 4DZ6A 4IK2A 1S9GB 2X1GA 2JDCA 5KFDA 5GMKa 4LF6J 1S1UA 2YNGB 2CJXB 1JWQA 4ZLLA 4B14A 4QIWD 2YPYA 3CDBA 1HEEA 1MROA 2CZVC 3WR7A 1FK9A 3CO0P 1FFWB 3D0GE 2XHCA 5EX0A 4TWEA 1H8LA 5RUBA 3I9V9 1PUAA 2QLWA 1CBXA 1CQMA 2QLXA 3AFGA 3L3CA 3H4BA 1FE0A 2KCWA 1DTTB 1NPPA 2RF2A 4HACB 3A3OB 1SKWA 3NWRA 1NK8A 1B4SA 1RYRA 5G0RB 4B9NA 4WFAQ 4QIGA 4NX9A 4F6AA 2O66A 3B3CA 1D9AA 1RT6A 3NNHA 2NUUG 2GVZB 5J2PB 1HA1A 4CTAA 2CYYA 4LFBF 2WSAA 2VDIA 3CJTA 2LYVA 1V5VA 5KT4A 2UUTA 4DX7A 2CJ9A 5K14A 2EFVA 2W2OP 4CLYA 4UUXA 1SBRA 3PRTA 4OQJA 1BAVA 1FDNA 2PJ2A 2XHWA 2BBEA 1XR7A 3W9JA 3AJ2A 3OSPA 2AJ2A 3OFGA 2XNQA 3H2VE 2Z2LA 2W24A 4WZMA 1UFHA 4JI5J 3ENQA 2CNLB 3THVA 1PU9A 5ETKA 2OU2A 3S7RA 3NLCA 4AQYF 3JAMU 3FIXA 1Z4EA 1UFWA 1TKXA 2E1CA 1RBLA 2ZW7A 1X9MA 4CO3A 4QWAA 1ARLA 3Q0AA 3JSMB 1JLBA 2ROEA 1LWXA 4RS2A 1H2UX 4ZITA 3GIRA 1GMWA 4NXNF 2KN4A 3UWTA 3IWWA 4LJMA 2ZW6A 4I2PB 4H6UA 4WU2A 2FVGA 4D3HA 2H4YB 1VFJA 3UO0A 4ZPAA 2B4OA 4E8UA 2FJEB 4UFVA 1LWEA 2QL5B 3O1LA 5F8IA 1S49A 1X4HA 4N8NA 3THPA 1SIZA 1WTFA 4DR5J 4LF5J 3DGVA 4R76A 4RPFA 3VAIA 2C22A 3N4WA 3FBCA 3GZ7A 1N36J 4CO4A 2VB6A 5AG4A 5EWGA 2Q0YA 2RU9A 1IBKF 1NK0A 4X4SA 4OC3A 4MK8A 1IM4A 3SJXA 3DSBA 3GSIA 1ZM4A 1YGHA 4NLWA 3FMCA 1IUJA 2WZNA 1S9EA 4JYAJ 4Z7CA 4C3KA 5JQ4A 2CJQA 2ZEGA 4NGSA 3N79A 1YJVA 1UWBB 2AMCB 1R0AA 3QT8A 2Z2MA 2J9AA 3IO1A 4F36A 4MCRA 2FL4A 4DWIA 4KLWA 3U27A 1T9XA 5IT9Y 1H38A 1S72S 3D1HA 4I56A 1TU0B 5JH9A 4FPRA 2DY9A 1FWLA 4ANDA 2AEJA 3CDXA 2DNGA 3R9LA 4DR2J 3DMJB 4MI4A 5ETNA 2LEPA 2QLBB 1Q2CA 4KS9A 2VPYB 4K0KJ 3J81j 1D8YA 2OZUA 1NDKA 5DG9A 1KSPA 3LGMA 4LRFA 2V63A 5JUMA 4ZP7A 5D6GA 1T3NA 2KL8A 3CSKA 3MR2A 4DV3F 4DV6J 2ZEFA 1CJVB 4F2RA 4HH1A 4AB7A 4KGKA 2BRKA 4DMZA 5HANA 2KI2A 4DV5J 3P2FA 2XMKA 1N4LA 3W60A 2R8HA 3CO9A 5KFOA 1S1XA 1NDCA 3SEOA 5AXNA 2BW7A 2G2YA 3W9HA 3VGVA 3UD3P 2QZ8A 5CYJA 1WEYA 1I12A 3FCVA 3OD2A 2YKMA 3D3SA 5HQ8A 3B3TA 1EP4A 4CLFA 3G6ES 1VYAA 2EG1A 3MDFA 4NE9C 2GA7A 3BBCA 1SC4B 4BWMA 3CXSA 1CJWA 4MH8A 1X9SA 3RW6A 1JLEA 3IWGA 2XGPA 3QLHB 5LYDA 4NZ6A 5CD4H 4FF1A 3D66A 3GLJA 2EKYA 2BQRA 1RT5A 3VGUA 1KDNA 3LWLA 4E98A 4LFAJ 1Z9UA 2U1AA 2IC3B 2LU2A 3ET6A 1XC9A 4F04B 1TL1B 1T9TA 2MGZA 1YLOA 2DH8A 4M95A 1VQSA 1TL7B 1S9FA 3OQ2A 2VJVA 3I55S 2IYGA 1ZTTA 4DF4A 2YKOA 3IM8A 4K4TA 4Y49C 4IFVB 1LAPA 1HI0P 4EYIB 3PHEA 2A2DA 3D67A 3PKYA 1B0PA 3FSXA 1HYSA 3UY5A 1D3WA 1HPZA 4Q8FA 4RWXA 3BH7B 1B6BA 2XI2A 1RCOB 3MR3A 1Z5RA 2ZFHA 3N6MA 4OL8A 3VF0B 4KTQA 4DQPA 4DOZA 3PY8A 1DRZA 1Y0RA 3TQEA 3CJ3A 3BQ2A 4EVYA 3AOAA 3QJLA 2HHVA 2XS5A 2J0WA 1HNZF 4ZHRB 5LRKA 1T11A 4OJ3A 2FD2A 2JBJA 3MAQA 2B6AA 3P3DA 2HHWA 2RDIA 2HKEA 2KXNB 1UW9A 3WBZA 2VDHA 4KPYA 1RTJB 1Q95G 5J2MA 3BGFA 4FXDA 4LFBJ 1TKZA 1MW7A 2V8DA 3H7HB 3MR7A 3I5BA 3HJFA 2W9AA 2AJ0A 1T0TV 3FDSA 1FFSB 1DARA 4RUAA 2GJ2A 2XLKA 4DR6F 2ZJPQ 1VC0A 4QW8A 2PN6A 4ICLA 4R0EA 3OVBA 2FVPA 1GT8A 1KLNA 1SVDA 1MWYA 3HXMA 5HVGA 4LQ9A 4OI2A 1Q86T 1RHKB 1HBUB 1VGYA 1X4BA 3R5GA 3MM5B 4WFBQ 2RUSA 1U1PA 4AQYJ 4P71A 3SDEA 3AJDA 2OPQB 6FD1A 1NSLA 2QA4S 4UBRA 3KHHA 1NNDA 2K06A 4OYOA 3NS7B 5F09A 1WC4A 4WIIA 5G20A 2J8RA 5KTAA 4Y2MA 2GJFA 4B9UA 3KDOA 2YH1A 2W4DA 1CPXA 4NXNJ 1HI1A 2BE7D 1KZFA 4JI0J 1XR5A 2LA6A 1G7CB 3S9LA 4E8OA 1XMQF 1RO5A 1I1GA 3HVWA 1KFSA 3LP1A 1B7YB 3SXOA 4EK2A 2X3GA 4PXBA 2C3OA 4JD6A 3UNYA 1S1VB 3G8QA 1H7XA 2YQ3A 4IRKA 2RFHA 2AFMA 4KUAA 4PWDB 1HI8A 1IBLF 3FEYB 5GMDA 1FKOB 3RU0A 1HBMA 2RHSB 2PJ1A 1S0MA 4USVA 4A95A 1DBDA 5F8GA 5LXRA 2DB1A 2XGQA 1Q1KA 3MECB 1Y10A 3TZWA 3NGRA 3CJKB 4ZP6A 4B9LA 4H4OA 1UW4A 1QY7A 3J7Z5 2QIRA 1HNIB 1Q8KA 2DCUB 3HT3A 2NYQA 4NA2A 1VHOA 3L7OA 4P4DA 1T94A 4WFNQ 3TO8A 4NXMF 3TCVA 1FEHA 4ONUA 1U8SA 5D8HB 2Z3OA 3GV8B 1YITS 4ERDA 2QYCA 1RKJA 3DOLA 4LT6A 4YFUA 1WG5A 1UJ5A 3EGZA 3PYEA 4GO5X 2X7IA 3FJ2A 4YB1P 2YQ0A 4UUWA 3S6KA 1E6YB 2AYGA 4F4YA 4MAKA 2FC9A 3ZZYA 2AT1B 4U96A 3BREA 1Q8LA 2DNHA 5IT4A 1QMUA 3I56S 1NE9A 4F67A 1CP6A 3NE7A 4QB9A 3Q8UA 1RUSA 1QAYA 2Y1IA 1OIAA 3RBXA 1RGVA 4UCMA 4OHZA 1SIWB 1XNQF 2AZ3A 1S7IA 1IXKA 1BWEA 1AYEA 3SCJE 2HHQA 3QAHA 1JJCB 4FNIA 1S1TB 4DV3J 4BS2A 2ZJQQ 4ZPBA 1MJBA 1SC3B 2BSWA 3CDEA 2P0WA 4PQAA 2YNCC 1G6BA 1FRXA 5F9LA 1NAQA 1Z1ZA 2EPIA 1MU2B 1UZHA 2GANA 2JEVA 2O67A 1N5TA 3A8JA 1F6TA 2XS7A 1ULRA 2AKWB 1Q7LA 5KFIA 1VQOS 4MFLA 4K30A 3HHLA 3VHQA 2MLYA 2Y1JA 4IF5A 2LXFA 1APSA 5FLXY 2CXAA 2FHMA 4P2FA 2ZXVA 1N6QA 1I51B 1P4NA 1YQEA 1R57A 4LSLA 3G3SA 3FBFA 1FRKA 3UDCA 3A13A 3PZJA 2MZ1A 3HVTA 1FT7A 4UWJA 1PILA 4C8MA 4QWDA 1WSRA 1YVOA 2DRAA 5F46A 4XPDC 2O3DA 3KHRA 1JLFA 4WKYA 3HX9A 3CCTA 2RQMA 3AAWB 2H5EA 1UETA 1CJTB 4AUKA 3DRXA 2XCAA 4XPDB 2CNNB 5CPAA 4KB7A 3L09A 2XY7A 2AYMA 4J9MA 4PZVA 3KNAA 1ZG7A 1C4AA 1JLCA 5LT5A 3BGOP 3DRSA 1VBKA 1K44A 2DITA 4G1PA 3EGVA 3MM7A 3BGRA 4Q2LA 3S01A 2V8GA 2J6SA 2FY8A 5KFEA 3Q8YA 1R8BA 2HFNA 1CSJA 4QPTA 2Z3MA 2M8DB 2BQUA 3GYNA 5L9XA 3M2UA 3TUJC 2I1RA 3FRMA 1HNZJ 4XIUA 3S6EA 1S59A 3VQSA 4L75A 4LR8A 4A2ZA 4CNZA 2XLJA 1LOKA 3R9FA 4ZYQA 2DKOB 3OTCA 3PCOB 3T1HF 3KHXA 4ZY0A 2R8VA 4C11B 4ZX9A 1K0TA 2GCFA 3CWJA 3MOZA 2I00A 2UU9F 3MCSA 3F41A 2A6OA 2GFQA 4OAEA 2E5LF 1W26A 4DR6J 3ULHA 4KZTA 3QATA 4LSNB 2R8KA 1Y5LB 4EYHB 4JOUA 3QNVA 3T5JA 2VJUA 2HEKA 2NPFA 2LA4A 2D7SA 5K8MA 1VQ4S 1QSOA 5KG1A 3TA0A 1V3SA 3JTPA 1QSNA 4USUA 3R5DA 4UEEA 1CP7A 5K8OA 4RUBA 4F3OA 3O2IA 4DG1B 3TRGA 3N01A 2HUZA 1RHQB 3GCWP 1VHIA 2DHSA 5KFRA 1JJ2R 5F3ZA 2R7SA 2QN6B 4DPYA 3MAAA 2MJNA 1XMQJ 3FFIA 3ZTOA 2ZEOA 3H8FA 4IFYA 3MEEB 2ASLA 2VFSA 3NY0A 4FBEA 2XBPA 3KUHA 5A8WB 4PQUA 2E7XA 1MJ9A 1ACMB 1S9GA 1FKPB 2AFSA 1IBLJ 1WC1A 3HP6A 4QWCA 1NK5A 3CCLS 3F56A 5G22A 4F8RA 1PYOB 8CPAA 3PW4A 5IV0A 2CWKA 1SJ1A 3D3CJ 4MK7A 2J7WA 3JB9k 5E33A 1M5KC 4P6YA 2C6PA 1N5YB 3SCLE 4B5PA 3ZFVA 2MLXA 4K50A 1M5OC 4X2BA 3TWZA 2UZAA 4OMEA 4PABA 5CYQB 1G2EA 3D28A 2FDNA 4WE1B 3TZZA 3F44A 4AFFA 4ILMA 4ZJQA 2D41A 4WIQA 4DL2A 3JYTB 3G87A 2LCWA 2KU7A 4TLQA 2MPUA 2GVZA 4DL5A 4UOGA 2OLWA 2OPRB 4B9VA 3O44A 5E7OB 4NGTA 4A38A 5AG5A 3R7SB 4ZPWR 3N0VA 2ZNZA 1PBAA 3LP2B 2BUEA 2MTLA 3ZNUA 1CX8A 1P6TA 1PGZA 3RJMB 3K9UA 4ED6A 5D77A 4RR5A 1HR0J 2AJ1A 4CH7A 1XNQJ 4FAIA 2AYBA 3NRBA 3DLEA 1KONA 2MQNA 2ZHOA 4HVZA 1QUVA 2AF6A 2DIVA 4WK3A 2EBEA 3GCXP 1QD1A 3I4PA 4ZCKA 4U7UK 4TYBA 3IJ3A 2GZOA 4UY85 4KUBA 2EC2A 1PSDA 3KHLA 3PZPA 5J8FA 1UVJA 3I0SB 4RJVA 3JSMA 1M4GA 2LP4A 3NMAA 2CKWA 2I79A 3C66A 4TN2A 5ETLA 3ZZRA 2JDDA 2XY5A 2PIYA 3FQLA 1KVKA 4I2PA 1VQKS 1IB1E 3HZGA 4CH0S 3J7A1 2Z2ZA 3E2EA 3RNZA 1N0UA 3R3TA 4AXVA 4C0BA 1HMVB 2HFUA 2JEGA 2VH7A 2G3AA 4KAIA 1FRLA 2OD4A 1T3OA 1DQ9A 3DDNA 5LMNF 2V4JB 3QIPB 1WC5A 5D8NA 2M3DA 4ZOSA 3D6MB 4YB6A 1PAUB 1FXDA 5HMZA 2OGUA 4KFBB 3J81U 4U9ZA 1FRMA 4Z2XA 2AGQA 1M1DA 2R8JA 2YWHA 4MHZA 1HBOA 1UVLA 2HHHF 3PNIA 2DT9A 4FVMA 3V6JA 3WC6A 3QAUA 5F8HA 3LWMA 3KJQB 4BDPA 4MCQA 1VQ9S 1H3DA 3D8PA 4U7UD 2EC0A 3GPAA 2HAFA 1YZ6A 3W9IA 4DV4F 1U09A 2F3JA 1GK8A 2V9WA 4YGOA 3FH4A 3OPKA 4MHDA 1Q8BA 2DEAA 3GMGA 1VR6A 1ZBTA 2R42A 3A8KA 1RHJB 3HKZD 2E9RX 3K2YA 1N0VC 2PE3A 4BLGA 4B02A 2XEXA 1SC1B 4HHHA 5HMYA 1LW2A 4EGLA 2DNZA 3T1HJ 3KXDA 3MMBB 4RW9B 3ZZOA 2JLEA 1RADB 4V1Ak 1U48A 4NYZA 4M5HA 8ATCB 1YJ7A 5DWNA 1AT1B 2VQFF 2UU9J 4ILRA 3LPYA 1CJVA 5DGBA 5KFMA 4EU0A 2DNMA 3HD2A 2XMMA 4ZVSB 4NYPA 2M9KA 4EUVA 1IBCB 2CQ4A 2VPXB 2W8LA 2JWNA 4DR7J 5D3GA 1R8PA 4O0NA 3ONQA 1VRUB 3JUWA 2ZBIA 2GMLA 2QJ3A 4F8ZA 3KLEB 4CCHA 3EC4A 4U7CA 4FD5A 4ED4A 4QC6A 1IU8A 2XZTB 2IYIA 4AYBD 1B7FA 2A6MA 3TT2A 2XQCA 2X51A 3LQVA 3EX7B 1KBRA 2JEJA 1WDTA 2IVMA 2QLFB 1WUUA 2GS8A 5SUHA 2P6GA 3LODA 3OUYB 2QT7A 1SJQA 4F3QA 4ER8A 5MLCV 3QLHA 4I68A 3ETMA 3ENVA 3V6DB 2G2OA 3GFXA 2LQJA 1T95A 4P75A 1JKHA 4AL6A 4O3RA 4OC2A 2C27A 2M52A 2BO9A 3C3LA 2IC3A 3T5HA 2FLNA 2HVIA 4NLXA 2RIJA 3GONA 1VCTA 1JX4A 2OFGX 2A4NA 3B3SA 4HEA9 4W4MA 3IIBA 1A2ZA 2GIVA 2JRSA 5A76A 4KKOB 1YLEA 2UUAJ 2E5GA 5IB9A 2WW4A 2J8NA 4DSEA 4H4KC 1SCJB 3C8YA 1WK4A 1FY7A 5DQHA 3QJPA 5B08A 4IOBA 2XEJA 1X4EA 2RKIA 4YOEA 3RTVA 4B13A 3ZZIA 3CXPA 1QSTA 3EWGA 3CC2S 4E0DA 1DQAA 5C25B 3TEHB 3WT4A 5IQQA 3S9NA 2YKNB 3IS9B 3GIMA 2FLPA 1FXLA 1KOOA 2I2YA 1X7VA 4IAVA 2YGWA 4OJHA 4EZ6A 1VDHA 2KKHA 5KT2A 4HKQA 1TVRA 2LQ9A 3RW7A 2ZBPA 2B7CB 1GH8A 4RO0A 1M1GA 3RGIA 2CQDA 1BQNA 5ETTA 1BQMB 4IR9A 4OIWA 3L7UA 3CCUS 2R3VA 4R57A 1K1QA 1S77D 2V8PA 3ZNJ1 2J8AA 3GIJA 2ZW5A 2UV8A 2P6TA 2KXHA 4ZGYB 1D8ZA 2NLWA 5ISVA 1RT1A 5GAHI 3GG1A 4USIA 3SQOP 3RR7A 3DR8A 4MHNA 4P45A 3KLIB 3MF5A 4KHMA 3GIKA 1S97A 3G9CA 2NQPA 2F65A 1NB7A 3MOJB 2IY5B 3AXKA 3K59A 3UN2A 2OUGA 5HLFB 1UAWA 1C0UA 1RAEB 2WCXA 4P4JA 4OYIA 3SV3A 2HNDA 1FX4A 1S6PA 2LQBA 3CVKA 4WFYA 5K8NA 2PEBA 2CJYB 5LSLA 1XJOA 2XLIA 4KJIA 3TX8A 2EKNA 1RAOA 1ZM3A 4DX5A 4X62F 2HHXA 5GCNA 2RHQB 4C97A 4YUDA 3MM5A 4UOCA 4Q43A 3UD5A 2UV8G 2YXLA 3ADAC 2OPPB 3KJVB 3KMQA 4C7IA 2YKQA 1WD6A 2DGWA 4EMEA 2OOTA 4ZVPB 2NZCA 1TL4A 3EY5A 1FDBA 2HGNA 8RUCA 2BJ1A 4J9VA 2MZRA 4J9SA 1XNRF 3PRBA 4ED7A 4M3SA 3C16B 2PQ8A 2LEBA 4N7TA 4RBTA 1QSSA 1Q78A 5DDPC 1X4GA 2W7AA 3H20A 2B4VA 1ZLIA 1OZPA 2Q7BA 1R27B 1RSCA 5GAGI 3X1LB 4M63A 1S1VA 3EGNA 2B7BB 1T05B 2E29A 2GAHC 4MIBA 3MI7X 5LMNJ 1F3VA 1FKOA 1ZPWX 2XO7A 4KV8A 2FE7A 4I2QA 1UFLA 5KTDA 5KTQA 3T6BA 2NSCA 5M2RA 1L3UA 2RNEA 1K47A 5GAGU 5JM6A 1CC7A 3HJVA 3GV7B 2XCPA 5IM0B 2AFXA 4AVCA 4ZVGA 1HNIA 1YDLA 1FCAA 2MQOA 1XMOF 5KT3A 2X3DA 4ZPDA 1X9WA 5A27A 5HJXA 5C2CA 3J80U 1U1KA 2AGOA 3IN5A 4DV4J 4OI4A 1WKLA 3AODA 1VHFA 2KH9A 2HLTA 2GIFA 4ECUA 4UFWA 4CRYB 4LREA 3BDPA 2WBMA 1N8RT 1MWQA 2ZKUA 2BJ9A 1S5KA 5A8KB 4I7FB 3QMQA 3PJ9A 1H73A 4FXWA 2WVBA 4LF1A 2PJ0A 3I4HX 1X0FA 1DTQB 4W98A 1RWMB 2YX1A 4UEZA 4IH5A 3CMES 2YNIA 2K7KA 2IJZA 3W2VB 4C2XA 2QX0A 2VQFJ 1OYDA 3B8HA 4IOAQ 4HTJA 4DHVA 1NUEA 1N71A 4OC4A 1U0HB 1MU2A 5KAKA 2LECA 3SSSA 3ITHB 3CF5Q 3P45B 4ZLNA 4KSFA 2YNDA 2J6TA 1HQUB 3FZ2A 2EFGA 3QAEA 2YNCA 2BE2A 4A30A 3FRYA 2B0GA 1KKHA 1WJ9A 4EI2A 5KG0A 4A46A 2Q7SA 2ZH8A 3CIZA 1JK9B 3NFZA 5JJBA 1TF9A 3EGWB 2PA3A 1G1XA 2ZNYA 4M5GA 5ETOA 4WKRA 1GEHA 1CPSA 3MCMA 4KHRA 1IOIA 2A0FB 2H65B 5B0CA 2RB7A 4DJBA 1TUVA 3DLKB 3M1VB 4K4XA 1IKYB 2DPTA 3BO4A 1BXNA 3M6UA 4G1IA 1TL3B 1FNXH 3ILJA 2KM8B 2QMUB 2KO1A 4KLVA 5DO2A 1F0XA 4OZ1A 3ZZZA 4BD9A 3MM9B 4CP5A 3VCDA 1IQZA 1R43A 4QIVA 5J2QB 2D3OR 1URNA 1IVZA 2XEFA 2W9CA 4P4BA 4C68A 1VRTB 2MJUA 3VH9A 1N48A 3Q83A 1F2HA 4KOUA 4Q44A 4OV1A 1Y7EA 3DI6A 3L9ZA 3QT5A 4NLSA 3TAQA 1GAOA 1KVIA 3B8GA 3KQZA 2R7XA 1JLAA 2NSBA 3MPYA 4UOHA 3HO1A 4LBHA 4KVXA 3GYXB 4MFBA 3SQGA 2OMLA 1SQHA 2GMHA 3HKWA 3TI0A 4HHJA 3G8SA 4C3MA 4YEAA 3J7ZT 3D9BA 5KFPA 3QFHA 3PKMA 5B09A 3IAS9 1TK8A 1VK3A 1AROP 1RB0A 4FYXB 1I6JA 3JTNA 1Y9OA 3UCUP 2XZWA 5HJYA 4ED8A 3GJSB 2Y1RI 1X4FA 2FHJA 3SFGA 5AE1A 5KFVA 2ATLA 4PUOB 2FC8A 1Q79A 3CC4S 2XTJP 3OT9A 4NI2A 4RL1A 1G4CA 3Q2SC 4L74A 5LJ5Y 3KTQA 2FQQB 5GAEI 5GMEA 1RT3B 1EAYC 4ED2A 2ZW4A 4ID5B 3L7PA 3CD6S 1PYTA 4NMXA 4KR0B 3MUMP 1OQ3A 1Q81T 2HFOA 5KFTA 4HDHA 3C6UB 8AT1B 1WC0A 2PJCA 4M85A 2MMYA 4TU8A 4JI8J 3HULA 4X62J 5BR8F 5CNPA 2XS2A 1RT7B 2HW3A 2V5HG 4Z7YA 2NYIA 4Y6IA 3PXGa 1DE4C 1C0TB 3CCVS 2G1HA 1UZDA 1HNXJ 2VA2A 1KC8T 3D6HB 1VK8A 3R2DJ 3UW1A 4TKTA 2CUYA 3T41A 2VF3A 1GX6A 4CO0A 4I1TA 2BMBA 4DNCA 4ZVFA 3PW7A 2DH7A 3HM9A 4UA3A 2J0XA 4TY8A 4K4ZA 1DURA 1XNRJ 3SIPB 3M8QB 1HNWF 1RT2A 4K4WA 3SJFA 4QJVA 4BBHA 3ICLA 1N88A 2HBYB 4GMKA 4HT5A 3PB8X 2EW9A 1YJUA 4Z65A 3CJ2A 1NKCA 4NEYA 3IBFB 2CNOB 1BE4A 4UTGA 4QUSA 1S4FA 5A8WA 2X1AA 2CG8A 5DETA 1ZETA 5CCLA 3LA0A 5HVFA 1EJ7L 3M8YA 2FIAA 4KGVB 1IIDA 4C4WA 3NOGA 1AB8A 1U0SA 1SB6A 2VA3A 4IG0A 4CT8A 1N5QA 3LP0B 5KFNA 3GP9A 1LWCA 5F0UA 4MJKA 2K2PA 3D2WA 1UPMB 1B99A 4QVTA 3CGIA 3PBEA 1IWAA 1N5YA 3BSOA 3IRXB 3ZTPA 4OX7A 1FRHA 1FJ7A 5KFSA 4F4AA 2BANA 4YWYA 5CYQA 3PJWA 1U45A 4LFCJ 1Y4ZB 1FNOA 1VMBA 2YNHA 3H98A 1XMOJ 3LALA 2B4BA 4NCZA 2EFOA 2Z0GA 2MKSA 5BXIA 5HAOA 1FDAA 1FDDA 3MN8A 1FTCA 3JYTA 2WSCC 1IKVB 3GJTB 4RW6A 2VU5A 1SUQB 1M1HA 2W2PP 3NGDA 3FCHA 4O0IA 3MM8B 2WW8A 3BF4A 3K8WA 1M4LA 3FCWA 1YKWA 2MB0B 4DV2F 2WUUA 4HNWB 3FB3A 2F9DA 1IJEB 1LEOA 1HWIA 3EE3A 4BMHA 4ZPTR 2ZUAA 3ETOA 4CYUB 2N4CA 2K5TA 3TA1A 1M5HA 1K0VA 1OMSA 4XAKA 2DO0A 3UVJA 3TW0A 3VR1A 2W2NP 3TQ1A 1F9EB 3W5ZA 2BZ2A 3OSNA 1S1WB 1UFKA 2AD9A 1YJWS 5SZTA 4IQXA 1RAFB 4CPAA 4OI1A 5HN0A 3DFEA 2MHEA 3V2UC 2GO9A 3KK1A 2W7OA 3KYLA 4NGPA 1REVB 3OXGA 3CCMS 2LFVA 2AJFE 5HQLA 2QE5A 3GR0A 3D7DA 3QGHA 4QYZK 5JXSA 2QA4G 3BI0A 2RU3A 2V50A 1ZG9A 1MMDA 1X31C 4C0OC 4ZLPA 3NGKA 1SL1A 4JI2F 2XC9A 1F5CA 3EZ5A 4QQBA 2BUNA 3PW0A 1GQEA 1V6HA 2P2CB 3GWCA 4FKYA 4DUTA 3QRPA 2BCOA 3V4MA 2W2MP 4OP4A 1JLGB 1H72C 4M1KA 1RU1A 1Z2LA 5DQIA 1PC5A 4O3OA 1QSYA 3S6FA 4OLLA 2Q66A 4FP9A 2V4JA 5CYMB 4NZ0A 4IG3B 2IRYA 3QWUA 3POTA 3DC2A 4DSKA 4YDDB 5KG5A 3RB4A 2FVRA 2ZH4A 4G1QA 1ZPVA 3DYAB 3NWGA 2YQ1A 4BBYA 2X1BA 2Y0BB 4EMDA 4JI3F 3R97A 2NSMA 4CO5A 5LRJA 3SI2A 5J1EA 4MY3A 3KUGA 2MDAA 3AOBA 1KNZA 3BXMA 1VQPS 2V68A 1YMEA 1HARA 3W62A 5HROA 2EEYA 1GMVA 5H9FJ 1YHQS 4HH0A 4O3NA 2EK1A 4NLYA 5LL6d 4X4NA 2HQGA 4FVCA 2FVQA 2Z8QA 2YBVA 5EHHA 1FE4A 2G0IA 1PIEA 2Y0SD 2XG8A 2DR5A 2ALZA 3W8GA 4LVNP 4DDFA 4JV0A 3R1KA 3VAMA 2NREA 3BSAA 4C8KA 1OSCA 2VZZA 2DNRA 5HBMB 2OZGA 5HMNA 4J9LA 2V8VA 2PJ7A 3DRPB 2AW0A 4RW9A 5A28A 4HTIA 1BUXA 1VQ6S 3H4QA 2N82B 1FO1A 1NO8A 1SJFA 1SPBP 5HK4A 4MHYA 3A3PB 4NXYA 5JMNA 1NSQA 4RU9A 2W8KA 2IBOA 3KDNA 1ELMP 4NGNA 3NNCA 1VRUA 2B8PA 1ZOTA 2HQ3A 1U02A 4DX8H 4A8FA 4IOCQ 2XMUA 2HBQB 5K5MA 5BR8J 2PMWA 3QO9B 5AE3A 2C2EA 5DRKA 3W91A 4MKBA 2HZAA 3PFEA 1GMUA 3FF3A 2MHNA 4UY8T 2HHTA 3GY9A 1T9UA 3NGTA 3RAQA 2AWZA 3OUYA 2HS3A 4QIEA 3EM1A 2CFXA 2JFKA 4OI6A 2EK9A 3MTJA 2CVIA 3NEKA 1XERA 1PC4A 3PIPQ 3MXHP 3F0NA 3FKBA 5FVJA 3V6DA 2XO6A 2HVEA 2FIWA 2IRXA 2H9ZA 4FZVA 1MG7A 1YRUA 4R87A 5H9EJ 3KMSA 1U1RA 3BSNA 1QTMA 4M5IA 2ZEPA 2JFDA 1ZZFA 4J9OA 1W25A 3PYDA 4X66F 3IA0A 4K2JA 3RG6A 3D3BJ 3CCES 2MZQA 3HZEA 4WF9Q 3VVUA 2RVJA 4KKOA 4FD7A 2CQ0A 2DCLA 4NFRA 4ELTA 3ZZUA 2J5AA 1YRXA 3S6HA 5HP1B 1XBUA 4I69A 1SQEA 4R5PB 2HNYB 4J5OA 1RHUB 3TJ9A 1QSMA 4NLTA 2CA9A 3I31A 4DFKA 4AVBA 4JZ0A 5LXYA 1JJ4A 3ILOA 2BOAA 2JNJA 2KYZA 4H4KA 3ZC4A 4RUCA 5C25A 3DDDA 2OTJS 4F0KA 3T9ZA 2YKNA 4DUZF 2YH0A 2VG7B 4FUUA 3D7SB 4F0XA 3P2HA 3KK3B 1LW0B 1UWAA 4X65J 2XB2D 2QV6A 2LDIA 3DN9A 3DRYA 1VISA 2P9CA 2UXDJ 2C1CA 1BQXA 1F2OA 4ECVA 2DGVA 4ZX8A 4YFJA 4Y2KA 1GMWD 5J2NB 2HZCA 4PG5A 2HIYA 4DV2J 2YX7A 1IKXB 2D9PA 5CA5A 3B7IA 5T41A 1RACB 1S7LA 2YTCA 3PX0A 4CGMA 4A48A 1HHSA 4XNHC 3EVMA 2MY7A 1FJEB 3DLHA 3MGDA 2C2MB 1L5UA 2N3LA 4LRAA 2FSRA 4JJXA 4LUBA 1VC6A 5I4MA 4UT4A 1HWKA 5E3PA 2PD1A 5HLFA 4O23A 4L89A 4FS2A 1NHVA 2Z30B 1KEKA 4ZVHA 2G2ZA 3D7HA 4J9QA 3GKRA 1R31A 4A8XA 5LYLA 2RD5C 3TZXA 3DXSX 4OMFG 1C1CB 2MKKA 5J8CA 2DR6A 2OPPA 5F47A 3WC0A 1UVNA 1RWKB 2BEFA 1XEZA 3MCNA 3R27A 2ZH7A 3N6NA 3SJGA 3KUEA 3KLHB 4DS4A 4M5DA 2WB4A 4IUFA 3TE4A 1U1LA 3NG8A 4JI2J 5KFWA 1ZO0A 2CPHA 2I38A 2Z57B 4FD4A 3CJ5A 2XSJB 4M8LA 3B4MA 4KBIA 1EQ0A 3CPAA 4W92B 2OJ3A 4ZCLA 2C2OB 1LNQA 3T5LA 3ENAA 3E3XA 4R9MA 5DDOC 3CCJS 5KG2A 2XMTA 2HYIB 2JDJA 2ZE2B 3PRVA 1TUGB 4MKAA 2N3OA 3EZUA 2IA6A 4F4ZA 3GFHA 3DOMB 4FF3A 4EFAC 3H5UA 3R8YA 4NRTA 4QCLA 1XMBA 4RI1A 1J5OA 2F4VF 2RILA 1NPKA 5C82A 3AB2B 1JXLA 3V38A 2IFXA 2FGCA 2OEJA 3BH6B 5D4NA 4ANEA 4X4VA 1HKAA 3W64A 3K57A 3PACA 3QT6A 3MFHA 1YJ9S 2H5MA 4CDIA 4WXOA 2ZUGA 3VAGA 1S4EA 4H89A 2W7PA 1R8HA 3ISND 4KPCA 5CCMA 4RNMA 2J0SD 2ZENA 1OSDA 1N33F 3W2WB 3FMWA 1LANA 2GNKA 2DGUA 2KRBA 3PVXA 1D09B 5HI7A 3LUYA 3I9SA 4L3NA 1RLCL 4KHPF 4Y65A 3M6VA 4KOVA 4O3PA 3W65A 2FB0A 2DEJA 5LJ3Y 1Z4UA 1V0CA 5A6WA 1TV6A 5A8KA 4M94A 1RTQA 2JOQA 2PE8A 3CULA 2GU2A 5DZ6A 1DTQA 5AJ3F 1JXEA 5ETSA 2O28A 1C1BB 1CG2A 3W2VA 3AA9A 4P2XA 3KHGA 2VG6B 1FD8A 4B3MJ 3T1AA 2XYPB 4LF7F 4J9RA 3DU5A 1X5OA 1YWXA 4IH6A 1WTBA 3JAMY 2I3CA 1CJKA 2VZ9A 3QAYA 1M4IA 3BKUA 3ITHA 2IJFA 2FZKB 2IM0A 3CD0A 4ECRA 1T03B 3BV8A 4RNHA 3K5MA 2NXEA 1HQUA 3TVKA 2GVDA 3M2VA 4RBVA 3Q2TC 1GHEA 4U9RA 5ETPA 3N5BA 2RUGA 4ID8A 2P9GA 3LPEA 2M4MA 5D15A 4WP8A 4CNYA 5EX3A 5ITHA 3EZOA 4ZIVA 3HT0A 3D7FA 5LMUF 1PCAA 1UEKA 1CM0A 1RABB 1QQ9A 3M1VA 3U02A 1IKYA 2X7BA 3P96A 2EK8A 1MROB 1RBOB 1NZ8A 4OJ1A 4FBTA 2B3VA 4ETXA 3RZAA 3IWNC 5DLFA 3OJSA 4KOWA 2POKA 1U25A 5J2QA 3DLGB 1VRTA 3MTKA 2RF2B 2EG2A 2ZHAA 4X66J 2E1MC 4A8QA 2BJ7A 2FVCA 4A4JA 4CLPA 1NMEB 2OPSB 4DQRA 2HB6A 4CS0B 1TXRA 2BXJA 2RMLA 2Z3NA 4FYDA 4O3QA 3OL6A 2VODA 4C8LA 1TIQA 3MEDA 1WSVA 4HNXB 3FGVA 1HL6A 4RBUA 3EXNA 5K14B 3DRRB 1WOSA 2C1EB 2QLJB 4LR9A 5JGFA 4DUZJ 2XWYA 3FVYA 1IKWB 2EBJA 1DAXA 1TKHA 4U8YA 5G1ZA 5I3PA 1RXTA 3HPOA 2A2CA 2DVIA 3GIUA 1OO0B 1N34F 1YK9A 5ETVA 3H25A 3UCGA 3LACA 1WHVA 1KHWA 4A32A 4NJRA 2IQ6A 2QVPA 4USWA 5I42B 5J1NA 3DKDA 4NCBA 1TKXB 3VAFA 4HL9A 4C8NA 3H8GA 1P9QC 3F73A 3R2CJ 4JI7F 1IYKA 4Q36A 2RS8A 3ZO7A 3GILA 1VQ5S 1IY7A 4MCPA 4OFZA 1N32F 3BQ1A 2C2DA 1D0EA 2FY1A 3FC9A 2D9OA 2AEFA 2F8EX 1BOBA 3AXMA 3N9UC 3DHWC 3EO4A 3HDSA 1I21A 4KC5A 2W25A 5EWFA 1ZH5A 2FPHX 3DLJA 1LWEB 1TL5A 3BS9A 2ZWPA 1RBAA 2HK3A 4OKOA 2VC1A 1PG5B 3RO0A 3LAMA 1JXVA 1RKIA 4P7VA 1FESA 1S6QA 2BJ8A 5KOXA 1X4DA 1RWPB 3M8QA 3OL8A 4WFXA 2DR8A 1VQ7S 3I5AA 3SMZA 1LRZA 1P27B 2H5IB 4RNOA 1NH8A 1X4CA 2E5JA 5G21A 2JH3A 3AQOA 2J6UA 4ZMMA 4DV1F 3VWSA 1RHMB 2MYFA 3IXQA 2ZDOA 4NF1A 1R0AB 1HWLA 1NEEA 4MXUA 4X64J 3TYTA 4P9SA 1M0SA 5KG7A 4XO0A 4K59A 4B3TF 4F4XA 5MAOA 2VFRA 3NL0A 1T02A 3CJSA 3I0RA 1TKFA 2R7HA 3QZ8A 1HLWA 3OWCA 1NRKA 1RE1B 1FEEA 2WONB 3TUZC 4P6QA 5F8LA 1LXJA 2VFUA 2JHEA 1YBTA 4S0MA 4C7HA 2HRUA 1FRJA 3UNGC 1B70B 3NKYA 1AXQA 1OJ4A 4K4YA 3W3SA 3HHLD 2B3TB 3RUBL 5EBVA 1SUQA 3UFCX 1W2BR 5DG8A 4L73A 2HGLA 1N33J 1M4DA 3MMAB 4PR6A 1X8DA 3LANA 1LWFB 2XWXA 4ZCMA 2HG4A 2ZH6A 1HW9A 3VAJA 2VI7A 1S1XB 2WSFC 5A8RA 1HBNB 4ZY1A 2V0NA 4DL6A 3A3NB 3WC2A 4EFDA 4FDFA 1EP4B 3G6VA 1BWVA 3M32A 1BC6A 1KN6A 5AJ3J 5D4LA 4WP9A 3R95A 1S1WA 4R8UB 1YBAA 4DSIA 4LF7J 3AT1B 3OLAA 2HWIA 3H2UB 3B3VA 2DXEA 2PIZA 1UEVA 4WWVA 2ZVSA 3H5XA 4JI1F 1NJXA 1Z8TA 2Z58B 2DRBA 1RWUA 4CRZB 1VQLS 1XFOA 4J9KA 4NYOA 5I3UA 3ET6B 5F0WA 2ZVIA 3D0IE 5LSRA 3CDUA 2VFVA 4Y2CA 1RTHB 3Q24A 2MGZB 2PJBA 4URSA 2ALYB 4AXIA 4IR1A 2YWWA 4E0AA 5LMUJ 3BHXA 3W8PA 5I0CA 4FXVA 3NAIA 3D6TB 4N77A 2JLFA 1GTHA 3WIUA 2MLZA 3R5CA 2AJ4A 3TFYA 2Q1LA 1RXOB 1HYSB 1O6XA 1HPZB 4GVLA 3QYYA 3NP5A 4RWWA 1R0BG 3FSYA 5CBMA 4MY0A 2BW2A 1UVIA 6FDRA 4EZ9A 1B64A 4ZN1A 1EKSA 1DY3A 2MQMA 4B5OA 2HQCA 4B3RF 2HHUA 1LKZA 3ZXWA 1S6UA 4NOHA 4WCEQ 4DV7F 5J2MB 2KTQA 4YU9A 3HFZB 1TKZB 3IRWP 4ECXA 1S7FA 3AQPA 3G6YA 2HVZA 1HHQA 1VOMA 2FHOB 2RQCA 3FXTA 2RRNA 2WYRA 2VG5A 4K8RA 4G6VB 1RTZA 2MQ8A 3V4IA 4CM2A 3OJUA 2HNZB 2ZC3A 4DR3F 2AFOA 5DZ7A 2GLFA 3G6XA 3VZIA 2I5JA 4NCGA 1AUSL 4H4MB 3CT9A 2KHCA 2BQ3A 5GADI 4ZKAA 1N34J 4OHVA 2NXCA 4CLKA 1F3FA 5L39A 4DPUA 3IU1A 2PO4A 3AOCA 5H84A 3HSDA 2XMAA 2DNKA 3QSYB 1NXIA 3SDEB 4M5MA 1TMJA 2HQFA 2DPJA 4DR1F 3N6LA 1AMPA 4X8IA 4ITSA 5FD1A 4DEZA 4K5SA 1IBKJ 2BE9B 1UVMA 3OBIA 4CAVA 1CQNA 3TNVA 1EARA 4NLGA 1N32J 4KOSA 1XMTA 2MKYA 1V3RA 1R7IA 1U6ZA 4OHXA 2OELA 1VHEA 1JMTA 2PI4A 2U2FA 2ZELA 3IR5B 4OLPA 5DS0A 4CI0B 3LP1B 2AJ6A 4LQ6A 1JJHA 2B5GA 2MQQA 4OYWA 3EPIA 3SCKE 4GVBA 2J8MA 1REGX 1U6FA 2PDOA 1VQYA 3FMBA 3QPIA 3OXFA 1HBMB 1KUYA 3KNGA 1A6LA 2PJ4A 4R6TA 2BEIA 3V5RA 3WX4A 4UW2A 4LRBA 2DBBA 2ZD1B 3PIOQ 4K3NA 5CZXA 4LF4F 1N5VA 5CAAA 4A39A 1KTQA 3ZTRA 3FECA 4DZDA 1KWMA 4H4OB 5C24B 3PR5B 4D3GA 2HPUA 2C42A 1JB0C 4K4SA 3VAHA 3RB0A 5F8JA 1NM2A 4WJBA 3G82A 1PJ6A 3WC7A 1FVQA 1YI2S 2P6SA 4PAAA 2NXNA 1U1QA 2IM3A 4GM5A 2RC4A 2BM1A 2HC9A 4TYAA 2HBZB 5KT7A 2KRRA 1HDQA 4Y2AA 4W90B 3DOLB 2DHGA 3BN4A 3IM9A 4HLBA 2GW8A 5HP1A 3Q23A 2AV5A 1AW0A 4R5PA 2HNYA 3JSYA 4CO1A 3FEXB 4V19X 4DSJA 3PEJA 2XMVA 2VUGA 3TA2A 2OD6A 1R8AA 2GHPA 3FRZA 2VG7A 1IICA 2LXUA 5CH7B 2VPWB 3CMAS 3V6HA 1X5SA 1FXRA 2HZVA 2HRTA 2RT3A 4MKYA 2DF5A 4ALZA 2YKAA 3HK2A 4ETZA 5J2NA 1NJWA 1ZG8A 3CD7A 4DFPA 1QAIA 1WEZA 1IKXA 1TTHB 4DI6A 2IVYA 4PWWA 2WPXA 2K1RA 2VOPA 4AG9A 2VASA 5B0BA 3VGSA 1NSPA 3Q8SB 2JVRA 5A2QU 3NA6A 4OIXA 1Q7LB 2R7OA 3G86A 2OI2A 4B12A 3KL9A 2G0JA 4C6AA 2UVUA 3THTA 2CQBA 1N6QB 5K9FA 5J1QA 3R6GB 2KG1A 4EWTA 5BYQA 1TR0A 2V67A 3BLNA 4CAWA 4LSLB 4JV1A 4MFZA 1DTDA 3MM6A 4ECWA 3IP0A 1RAIB 1C1CA 2ANPA 3HVTB 2DHAA 3AY0A 5J1PA 4OZNA 7FD1A 1KUVA 3VAKA 2UXCF 4KGXB 1JLFB 4QZVB 3EUNA 4JUZA 1ZLHA 3WX8A 3T19A 2AGPA 2KXFA 4CQ1A 3NE8A 2UXBF 2UUCF 2B56A 4DL7A 3W1YC 3IR7B 4WXWA 5I3QA 2BJEA 1WORA 1EETB 1YBUA 4EBCA 2APOA 1JNZB 1XBWA 1RTIB 4EBDA 5E2QA 3PYFA 4ZCIA 3MM7B 3BGRB 5ETQA 4L8AA 2NUHA 1YVFA 4CT9A 1O5JA 1X5TA 4PCQA 3D2PA 1FT8A 3W7BA 2ZE2A 1MN7A 2BACA 5T7LA 1U47A 4OYMA 5HQMA 2OSQA 5B0DA 2ZBQA 4HI2A 1QLNA 3WC5A 1GTEA 1Y0HA 3HSJA 3M2UB 3DOMA 1F1BB 3RRKA 3CJRA 4PSWA 1N56A 1WHWA 4B3RJ 3TVYA 4ZI6A 2CIMA 3JTOA 4YMEA 1NDLA 4DV7J 1L3TA 4LBPA 1SH2A 1SKRA 3JQJA 1U26A 3JXOA 2KJVA 1T8EA 1WACA 3KK2A 3P49B 2D3O1 4O44B 2RH3A 4FYYB 3NMRA 4KSEB 5B0EA 1O51A 2NPIA 4DV6F 1DZ5A 2F5GA 2XM3A 4N5SA 1YLXA 1Q7YT 3TJAA 4MFPA 4DR3J 3KR4A 3W2WA 3PRDA 1K4JA 3C19A 3LWUA 1LCPA 1HNVA 4OYAA 3R1LA 2WK4A 4KE5A 2MY8A 2MEWA 2WTFA 3KLFB 2QA2A 4F9VA 4L6V3 3BQ0A 2PVVA 1RCXB 1WWZA 1O0PA 3HVAA 1SV5B 2DK2A 1F5AA 1S60A 2VV5A 2ZZMA 1LK7A 2YNGA 1C1BA 4MYUA 2Q51A 4DR1J 2VG6A 2J9EA 4U8VA 4Y28C 2H51B 4K2XA 3AD8C 3BYPA 3KWMA 3RBDA 2YPZA 2YNEA 2R7QA 3GG0A 3K2KA 2JC0A 3EXCX 1T03A 1HHTP 1UKUA 1VLOA 3TOQA 2PRBA 5E3QA 1DTTA 3EVOA 2HSEB 4HACA 1QJHA 3UCZP 5IXUA 4NXMJ 3A8IA 1IGBA 5KT6A 1NKEA 5G0RA 4PQUB 2P8IA 4ZLJA 4AL5A 2IDEA 1WHXA 3QT7A 4FBUA 4YR0A 3T3FA 1LFWA 4ATNA 1NK6A 3D68A 1JNRB 5J2PA 4DPOA 4G3IA 1BPMA 2L3MA 2VONA 3RBEA 5JVGQ 4MFJA 2IAJB 4QR2A 4LF4J 3LD2A 4E2AA 4UCNA 3UD4P 3D54A 1FHTA 1LOUA 1KHVA 3VV2B 4B5PB 3DLGA 4DPWA 4AVAA 3BPDA 5DDRC 3LGHA 1NBEB 2PMZD 3J81Y 3QWPA 1S0OA 3S9MA 4KOXA 3AHPA 4BC9A 3R9EA 2DJWA 4KSAA 3CCSS 3PW5A 3F8KA 2ACYA 3GV5B 3TOBA 2OPSA 1YK3A 3UN3A 2QL7B 2ZBRA 2YX4A 1D9FA 2XY6A 4I67A 2V34A 3K0JA 4PYDA 3LAKA 2VXKA 6AT1B 4ZVOB 4RW4B 4XDCA 2D4OA 3W66A 2R2RA 3IEHA 5DGAA 3IR6B 1EB0A 3M2RB 4JB8B 3OR2B 2MQLA 2HHSA 1VBXA 3DRRA 1SQGA 2A3JA 3ZZTA 4NSQA 1KRPA 2FJVA 4RW8B 3IGNA 4WU3A 2N7YA 3G4SS 1IKWA 5K20B 2V9KA 1KP6A 3KGQA 1KUXA 3DLEB 2DNNA 3VZHA 3U1NA 3ILLA 4CYOA 4KGMA 2B4PA 2ZH5A 4OV6A 1S7KA 3HF5A 3HCXA 4Q7AA 5LM7E 5I42A 1Y5NB 5F49A 3JTKA 4PSXA 1EZZB 3PP9A 2I9SA 2V4QA 3O8WA 3MEGB 3LTOA 4GC6A 1LV5A 4HPSA 3DDKA 4NLVA 2KVIA 2ZEJA 3OFFA 1S10A 2CQCA 1MK4A 3VTIA 4DXLA 4OZ0A 4OZ2A 2ILZA 7AT1B 1QAJA 3RRGA 1J2VA 2B9XA 4K7QA 3G8WA 4JI0F 2AFZA 4H6ZA 3MAHA 1H6KX 4B6ZA 1LQ9A 1UA1A 2GQ2A 3TAMB 3TANA 2IMWP 2DRDA 3CDWA 2AFWA 3GJQB 2F8HA 2HAIA 3BGUA 5AXKA 2QFIA 1UWBA 5CXTA 2AE6A 2ERRA 4B9MA 1V9OA 5AXLA 2EXUA 3S6GA 2HURA 3BBBA 2UXCJ 3JQKA 1HD0A 4OJGA 1FKAF 2F40A 1A7GE 3JS9A 3I5CA 4ENOA 1DFDA 2F4FA 2B58A 2CQ3A 2ATRA 4ZVUB 4X4OA 4DS5A 2UXBJ 2UUCJ 9ATCB 2CIJA 3DMJA 1K73T 2VKRA 1ON0A 2CF4A 5IC6B 4CAEA 2L9NA 1HBOB 2NZ4A 4Y34A 4PV6A 3H0PA 4PG7A 4XDDA 4BHQA 1WKJA 5L8RC 5AGEA 4WWSA 3PV8A 4CWBA 2DHHA 1YJNS 1WG1A 2PDAA 3H40A 3LOUA 2HQIA 2LQ8A 1LFPA 1MSWD 2Z3PA 2QMWA 2E5LJ 3TOAA 1V5IB 3OVSA 4F4KA 2CPJA 1PJ5A 1CJUB 2VQYA 2EVNA 4OI3A 4C2ZA 4RNNA 2WONA 1YJTA 2C2RA 1ZAVA 4P4FA 2C6GA 1WWHA 1CC8A 3PDNA 3KJNB 1IWGA 1XIXA 4C2YA 2CPYA 1RISA 5E0OA 1LW2B 2XMJA 4FF4A 2R8IA 3BEGB 3D4UA 1JIHA 2FLLA 1WC6A 3M8ZA 9RUBA 4J37A 4MT1A 2VOOA 3PEIA 3MMAA 2C3YA 3IAM9 4YDXA 1LWFA 3DOKB 2IPOB 5D3GB 1YGYA 4IHMA 3G8TA 1U2RA 1C2PA 1HBNA 1Y3JA 2RS2A 4C8OA 2HBRB 2BV3A 3TR5A 2CQGA 3MMCB 2HQDA 2GJIA 3R7BB 2ZOMA 1TL1A 1PO6A 2O1PA 3D0HE 2GFFA 1H74A 2FZCB 5KFUA 4KOYA 3KLGB 4JV5F 1TL7A 3HLUA 3E0KA 3WDOA 4RNFA 2ZH2A 3Q8QB 4IFVA 3VARA 4CH1A 2QMXA 4R8UA 2VPZB 5IT9U 1MNEA 4X4TA 1YW4A 3SBMA 3P4UB 5A0YB 4XK8C 4DU7A 1W2IA 2MKCA 2JEWA 1NPRA 1TP7A 2VKZG 1JKHB 4CGOA 4CLLA 1UMJA 2HS4A 1PYSB 3W61A 2ZWOA 1VRQC 4OLOA 4QYRA 4ZHRA 2V77A 4C3LA 1RTHA 3PB6X 2EWHA 2WOMB 1NSKL 4N56A 5LRGA 4ELUA 4R7MA 1RTJA 3DHXA 2VBYA 2V2QA 4NGQA 4KQZA 1SI9A 5KT5A 2PC6A 2F8MA 2UUBF 3H90A 1GX5A 1MWZA 3JSBA 3I1UA 2BABA 2FHJD 2GREA 2QYVA 3W6XA 1A9NB 3R5JB 5HH1A 2RKIB 1KD1T 4Y49B 2FJAB 2UUWA 1OY8A 1WI6A 1RZMA 5L1IA 4I6WA 2CG4A 4CO2A 1ZTWA 1U1OA 3T1YF 4CLSA 4M5KA 1TVRB 4KOTA 1BQNB 1HQ2A 3BR9A 1HBUA 5GAHU 2D74B 1S48A 2Y1LB 3BGLA 3BKTA 3VATA 3IBWA 2Q79A 2A10A 2OPQA 5U47A 4HT7A 2PJ3A 2CDRB 4M5JA 3RYOA 1FTRA 3DGPB 3J80Y 2PR1A 1RT1B 3K9TA 4LF2A 1NB2A 2OH1A 2BJDA 2ATCB 4PK3A 1TAQA 2DR9A 2WVCA 2HNZA 2IJRA 1H2VZ 4USTA 4P52A 2XI3A 1C0UB 3T8WA 3R9GA 2HNDB 2OTLS 1S6PB 4H4MA 2L9DA 1RLDA 3OV7A 4PEOA 2QSWA 1XK8A 4GXHA 1QUPA 2VQEF 3KR5A 3UE2A 5IC4B 1HW8A 2A18A 2ZZTA 3OFHA 4M5NA 4J9NA 1XTZA 3FBEA 2OSRA 2CWXA 1ZAWA 1TKJA 1JQGA 5C2GA 2LXIA 1SKSA 2JEIA 4PWDA 4ED3A 5KG4A 3X3UA 2OH2A 2HWTA 3BSCA 4U9YA 4U6PA 1R6VA 4C8ZA 3MECA 3UR3C 4PKDB 1P0HA 3FX6A 4M6IA 2J9CA 3CJKA 4P44A 1S6OA 2RDDA 1CPZA 3RAMA 3F0AA 2OAUA 2GLJA 4ZJOA 2NMTA 1Y3KA 1BGXT 3RR8A 1C4CA 2KFNA 1OYEA 2KZZA 3UQSA 1JLQB 3HI9A 2IIHA 2HHHJ 1VQMS 2VL1A 4RW7B 2VICA 1WEXA 5IZHA 2QECA 3H5ZA 2IM1A 2K3IA 3GTYX 3D6FB 4WBFA 2Q43A 2GHWA 1ZYQA 2BR0A 4ED0A 3KKWA 1Y7PA 1TAUA 4AD6A 2CJKA 2ZJRQ 3GUXA 1X0PA 2G1DA 2FXFA 3U1MA 5KFAA 2CVEA 4KV8B 3PB7X 1E6YA 3SYZA 3GFZA 3QJJA 4I2QB 4GKJF 2A1BA 1TKTB 3EICA 2ZD1A 4ZP8A 5D0EA 2HFSA 2JC1A 3M6WA 5C24A 4K4UA 5IX3A 2OHDA 4LUAA 4PXDA 1LK5A 4DF8A 2COLA 2GQCA 2UP1A 1CVJA 5E3CA 4ZDNA 3HHDA 4UQTA 2GE3A 3FVLA 2GC8A 4HYKA 1GXTA 1SH3A 3JVNA 2EWBA 5LOQA 1S1TA 3O3LA 2PGCA 4ES3A 2C3MA 2EK6A 4TU7A 2SXLA 3I87A 3DR6A 4ONWA 1XRYA 1CS4B 2O01C 4AT1B 3FQKA 4KO0B 2B43A 3BKFA 2B51A 3DM2B 2B5JB 2DO4A 1UVKA 4A8KA 3KG0A 1U2CA 3AA8A 1KFDA 2BOPA 3T5KA 2E1RA 4BC7A 3M05A 1CLFA 5KFKA 4RU2A 1G3OA 4FWUA 5F41A 4NEXA 1Q5VA 4KGZB 3W5XA 4AXJA 3V8IA 4P10A 3CNQP 4A8WA 2HIQA 2KM8C 1HR0F 1TKDA 1J27A 5BYRA 1HDUA 3SZ2A 1UJ4A 2BKNA 2YNIB 5HATA 2X1FA 1CEZA 1MMNA 2CRLA 2ABYA 1H98A 2H1YA 5IV4A 3OW2R 4RLEA 2VC0A 4NA3A 2C2NA 2MKJA 2J0QD 3V7ZA 2W9BB 3DDIA 3P5TL 3QFWA 2YWGA 3TEGA 4OC1A 2GGPB 1F2GA 1SQFA 2BJ3A 2OP5A 2XULA 4MIAA 2BE2B 2CY2A 3BN7A 1CJTA 3M7VA 4Q45A 4CYPA 1ELLP 2PJ9A 1ZM2A 2CQIA 3MMJA 2FYXA 2Q44A 1ZS6A 4JV5J 4J90A 4N76A 3BZQA 2HRYA 5HO4A 2Q6CA 4KH0B 4LMZA 4B17A 1RAHB 3VWDA 2H5JB 4KIAA 1AA1B 2PJ6A 3NH4A 2M88A 4MMOA 3SV4A 5E3RA 2ZOFA 4LF9F 2VHGA 2DNLA 1CULB 1PKUA 4NZ7A 3UPFA 2MKHA 2DNOA 1X4AA 2LVWA 3W5YA 1VKCA 1ZA1B 2E7VA 3J7YI 2D3UA 2W9CB 2QJ8A 4DFJA 1GNKA 1Y9KA 2JL9A 4UIAA 3CD5A 4YB7A 1WI8A 5IWAF 4X5KA 2VFTA 3EFAA 3FEDA 2BX6A 2JVOA 2HS0A 2H4WB 2AHOB 2F63A 1EETA 1JWWA 3DI6B 3DLLQ 2ABZA 1B0VA 3TVZA 1F57A 2HGMA 1RTIA 4C11A 1JLAB 1OQ6A 5H86A 3QIDA 5DG7A 2UUBJ 3OR1B 4A8OA 3FNCA 4CLUA 2V2KA 3J7YU 4Y00A 4NPOA 4MFBB 4YR2A 2FT0A 3SQGB 3BB5A 2KVQE 3B54A 2K8GA 1VI7A 4ELVA 2QG9B 4MKVA 4OI0A 3GYGA 3CJ8A 2CTBA 3SJEA 3EPGA 5FLXU 1NKBA 4WZQA 4LSNA 3R96A 3TTHA 2R9LA 1Q2DA 3T1YJ 5DLGA 3M8WA 3Q8RB 2IA0A 4OC5A 2JZ5A 3R5BA 3CCRS 2RE1A 4FYVB 1XWLA 4URGA 5CHCB 1H2TZ 5D0HA 3Q8PB 1FFGB 5GAEU 1RU2A 2JLMA 1R3NA 1SH0A 4NI2B 1XF8A 2PJAA 3KG4A 4GKKF 4Q2MA 4DUKA 4O44A 3E01B 4DG1A 4AE5A 1RWOB 2V94A 2YWKA 2LLZA 3SI8A 1HD1A 4O3SA 1KLMB 2CTCA 2ZC4A 4ECSA 2CQ2A 5AXMA 1PYTB 1FWPA 4DR7F 2PJ5A 5B0AA 2ASYA 2VQEJ 5KFXA 4NJQA 4DL3A 5KFLA 3KLFA 5FDLB 3MEEA 2I8EA 3MCOA 1S7HA 1RTDB 3GR1A 3M8PB 3FBUA 3DNCA 4L3KA 3QNWB 3N28A 4DQQA 3NAHA 1SV5A 1FKPA 1WNEA 1BLLE 2V69A 2DPIA 1FWKA 1QSLA 4FKXA 3BM7A 3B4DA 4GC7A 1XN9A 3PW2A 3KJFB 1NJYA 2CNTA 5KFYA 3AB4B 2QFJA 4R3KA 1S79A 4LVOP 3PJXA 1QAXA 2AYEA 4II9A 3PM9A 2Q3PA 5DS7A 2PMHA 4N47A 2H48B 4TY8B 5C7PA 4ZVTB 1E6VB 1DHMA 1RT2B 4L76A 1R0CB 4DLGA 3TUPA 1J4JA 2DGTA 2ZEMA 4WE1A 3BI1A 1IR0A 4LR7A 2DGXA 2HMIB 3AH6A 4ED5A 1X12A 2GO8A 4DL4A 4TXSA 2RDJA 2R8GA 1O8BA 2IRUA 1KTVA 2PC1A 5ELYA 2UUAF 4JI4F 3OTEA 4IG0B 3ZTSA 2HFVA 4X4PA 1LWCB 1FF2A 4O4GB 4JXQA 4GKJJ 1IYLA 2FIUA 2OPRA 4QU7A 5CD4A 2IAJA 4W9YA 3K5PA 3K8VA 3OTBA 2YVSA 1AZSB 3LP2A 5DQGA 1U8WA 1Z8XA 2IBKA 5L9NA 3TO9A 4ZP9A 2BANB 2CPXA 2DD8S 2YNHB 1NJZA 2DGSA 2CQPA 2NCKL 2PCUA 5DJBA 2C2KB 1XJWB 4NMLA 1NH7A 2MKIA 4CYQA 3LH2S 4NCAA 4P4IA 1F60B 1VBYA 1VS3A 4RW6B 5D0RA 2WVDA 3I9ZA 5D78A 1LXNA 1I5OB 3PGPA 1RA7A 2F7VA 3GJRB 2EUIA 4LF8F 4RW4A 1I3OB 2E9TA 3I0SA 2PFFB 5D4OA 4YQWA 2WRMA 4IRDA 2HK2A 3M2RA 1SKUB 4GS4A 3OR2A 2C3PA 2Q6BA 2REEA 3MR6A 2RQ4A 4X84A 2BA9A 4A94A 4QBUA 1Y11A 4PG6A 4RW8A 3LMSA 3CXCR 5EN1A 4DQSA 3UN5A 3HHNB 1HIYA 4GRSA 3UVJB 2DGQA 2C28A 3KOAA 1HWUA 1I1DA 2Z11A 3OTOF 2ZM6F 4ES2A 2ASJA 4CRJA 5B0GA 1HMVA 1IOFA 1XIQA 4ZPVR 3KK1B 1M90T 3MRUA 3D7GA 1IR2A 2HV2A 3QIPA 2DEIA 2WSEC 3NNAA 4OX9F 2YWEA 3MEGA 5A6PA 4KT0C 3MHYA 3GSDA 2BDPA 3BJ7A 4KFBA 2GX8A 3OFEA 3WZ0A 1BPNA 3C2PA 1VHSA 4WPAA 3IGVA 4QW9A 1TFWA 1GXLA 4ANCA 3H8YA 3R6LB 3PBBA 3NGSA 2KG0A 3QZ7A 3TAMA 4C48A 4J7CA 2W1BA 5CZVA 1WHYA 2B9YA 2W4CA 2F1FA 1VQNS 4LF9J 2DXQA 3EJMA 4UWIA 1QM9A 4DFMA 4F7VA 4MBUA 4CGPA 2QYGA 2BM0A 5EUHA 1VBZA 3CMQA 2XZDB 1R8CA 3QQCD 4PWUA 4XTTA 2V2ZA 2WVFA 3V81B 4B3SF 4JYWA 5JVHQ 3POTB 4ES1A 2FLOA 2W2QP 2CQHA 7FDRA 4MRIA 2AEMA 4G1QB 4A37A 5IWAJ 3OTDA 1OS5A 4X2TA 2QEXS 1WC3A 1D9DA 1QE1B 1XE4A 2YNFB 2YY3A 1BLUA 4EO6A 4UEFA 2Q4VA 5J1EB 3L95X 2W4PA 4ZIWA 3OL9A 3MMBA 2OEMA 4MYTA 2R1IA 2B4DB 3C15B 2GIQA 2LQ5A 2KZMA 5FJ4A 4PXCA 1S5ZA 3PEHA 2HWHA 1HQEB 3UDEA 2QA1A 5HROB 3C6TB 4IDKB 1M1KT 1YTYA 1CJUA 4DQIA 1K1SA 2V2VA 1Y5IB 3CJQA 2WAQD 3ISZA 4FF2A 3KLEA 1B0TA 2LU1A 2E5HA 5B7WA 4DCJB 1NK4A 2O5DA 1PJ7A 4LQGA 2MZTA 2V6AA 2BKOA 5KFBA 4A8SA 5EGYA 2QC3A 3BYRA 4R0JA 3PG9A 2VBZA 4GKKJ 3IBCB 2ZH9A 4OHYA 3QGIA 4NLDA 1DLOB 1SC6A 5ADZA 3CJ0A 1Q0NA 4F25A 2PVWA 2NR0A 1EIYB 5HMWA 2KHDA 1HNWJ 1QSRA 2B9WA 3DOKA 3EVWA 3VALA 3ILIA 5E5NA 2LEAA 2REFA 2ILYA 3Q8VA 3FUYA 3PFOA 4MK9A 2EO8A 3MMCA 4MFQA 2CNSA 5AE2A 3ZZPA 2DPSA 3G2XA 4BCAA 2ZEEA 2Q4YA 2ROGA 3KLGA 2GHVC 4ECQA 5EC4A 1BO4A 3TARA 3U7JA 3HMJG 3J7AN 1UJ6A 4O4RA 2CADA 1OWXA 5A0YA 3IC1A 4WFZA 3M30B 3S1TA 4C0HA 3KLVA 4CAXA 3SI1A 3FJUA 3S8SA 2K3KA 2LMIA 1B87A 4HDGA 2CJAA 3MWBA 3OHBA 4DCOB 1FNMA 3RB3A 3N7ZA 1VQ8S 4P73A 3P6YC 3IS9A 4OC0A 1Q4RA 3CCZA 2FJDB 4AG7A 1OPIA 3IMQJ 1ARMA 1AUDA 4WK1A 2WOMA 4A8YA 4YP3A 1BQMA 5M2PA 1KVJA 4I6YA 2DNQA 2DY1A 2KT3A 4LIWA 1WELA 2IM2A 4NEZA 4JI4J 2VZYA 4ED1A 5HSPA 2DHXA 4OYXA 1K8AT 2WZ1A 4MHPA 3B35A 3T90A 4USMA 4NGMA 4DUYF 3B6BA 5IFMA 1P1LA 3KLIA 3PYGA 1YREA 1FVSA 2ZKTA 4I6AA 4Q0BB 2B8QA 3TJ8A 3TP2A 2K7JA 2DH9A 3RRHA 5IB0A 2J9DE 2Y0MA 2FTRA 3D1OA 3E8OA 2AX1A 2BRLA 4YR3A 3B82A 2AQ4A 1J5EF 1X10A 4LBIA 5C42B 1UP1A 5LYIA 4EO8A 3CPWR 4ORFA 5H9FK 2Z0ZA 5L1JA 3CXQA 4G65A 2E9ZA 5IT0A 4DU8A 4KVME 2UVRA 5AG6A 4LF8J 3I6PA 3DGPA 3KJVA 2XEGA 3K89A 3G96A 2Z56B 2ZPAA 4P4EA 4TQRA 3MEKA 2OMOA 5C88A 5F3TA 5D29A 1F5BA 2B9EA 2OFHX 2ZH3A 3RBUA 1WF2A 4ZVEA 1ELOA 2RSQA 3C16A 3CDAA 2WB1D 4KRWA 1U2FA 3ISXA 3OTOJ 4USHA 2ZM6J 1T9WA 2KDOA 2KT5A 4ZPCA 2CZ4A 4JI6F 1M5VC 2PI5A 2OKQA 4JI8F 4EEYA 3C14B 4YN3B 2E7WA 3CC7S 2Z10A 4JWPA 3M9OB 1T05A 1PBUA 1U7LA 2EFQA 2Y3YA 1X5PA 1YIJS 1HNXF 1RAGB 1Z2ZA 4OX9J 1P1TA 3FEZA 1AFJA 3OVAA 5JPHA 2MXYA 3BDEA 1W7WA 2L9WA 5KFFA 1VLYA 4X3RA 3WHIA 2J7UA 2QIFA 3US5A 4J9PA 1MJAA 3IG1B 4C8YA 4M5DB 2C2ZB 3NH5A 1RT4B 4JXRA 3SXNA 2B4UA 3BR8A 3MUVP 5IM0A 3L4BC 4JI3J 3IWLA 1JLQA 3PB9X 4RW7A 3TO6A 1BY9A 5M2UA 2CPDA 1T9YA 3JSRA 3HVRA 2I0XA 1VJWA 4RKUC 2CAJA 2IL4A 4CLTA 2E44A 3UDLA 1OY9A 4AL7A 1WOOA 5KTCA 2IJNA 3DNSA 5H9EK 4PPZA 3MFIA 3MGJA 3NCRA 1V3ZA 4F26A 4I64A 2W01A 2FHKA 4M6GA 3D4JA 4B3SJ 5H1SV 4A31A 1T9VA 3I96A 1TKTA 2G4BA 4ZBGA 2AP6A 2JX2A 1RA6A 3NGUA 3BPSP 1K9MT 5DDQC 3NBPB 4I7FA 4ECTA 4TVAB 2MSSA 3WABA 3I82A 1J5OB 3NCPA 2ZH1A 3IWEA 4LFCF 4NLPA 1RK8A 3QGPA 1L3KA 3EMTA 1MMLA 3R1HA 4GO7X 5F8NA 3M4XA 4TY9A 1HFEL 4B3OB 3H59A 3DU6A 1YG0A 1CS4A 1U0HA 4KO0A 3DM2A 2B5JA 3IWXA 1RWXB 2ROPA 2GMJA 3IU2A 4X4QA 4ZJLA 5DM6Q 1Q82T 2HLUA 2OIHA 1M5PC 2Y9HA 1NK9A 4B9SA 4CIOA 1TV6B 3LF0A 4P7TA 3QB8A 1VJQA 2WHOA 4NLRA 1VIXA 3N5FA 4USKA 3NOCA 4C2MA 4B11A 3MPDA 1SJ4P 4PXEA 2VD3A 4R8FA 2V4RA 1YRTA 2M5YA 1UL3A 2QTWA 4CZCA 1S1UB 2R2UA 4I49A 2UVVA 3DLKA 1RQ0A 4TQSA 2DGOA 2FVSA 4MTPA 3TX0A 2Q4ZA 1NU4A 1TL3A 4ZVRB 5AG7A 1IBMF 1FK9B 2M8HA 1T7PA 1CJKB 1P8GA 4DPXA 4DYOA 2G9DA 2W9BA 3P8BB 2G3TA 3MM9A 1F2PA 1ICEB 2GGPA 2M0GB 3IGRA 3HSZA 4FNHA 2GVDB 4A47A 1N52B 3R7NB 1S99A 3AD9C 1IQTA 3M2VB 4OIDA 3GYAA 3NH8A 4HNYB 2ZOGA 4HHUA 1IM6A 3PO4A 3CE8A 4P72A 4HI1A 1EKRA 1H7WA 5KFZA 3FNNA 1D1UA 2DYAA 3HLPA 1RAJA 4XPCA 1RT6B 3EDRB 4IQMA 1UCNA 5L46A 4CTAB 2EBGA 2C3UA 4L72B 1TK5A 2PIIA 1B3TA 4F50A 1NMTA 1F9FA 4H54A 2KJWA 3MUTP 5L1KA 3BO3A 4ZA1A 1CULA 1VIOA 2P6EA 4CGNA 3SI0A 3H5YA 1Q8IA 2R98A 3VGTA 4YS2A 2ZZNA 2QMLA 4C9DA 2R2SA 2E66A 1IJFB 3GIIA 4CLZA 1NHUA 4PUOA 4C7QA 3PX4A 2V8HA 3OHAA 2G0BA 3AJ1A 2Z2YB 4C98A 4LRCA 1GXUA 2CJBA 3OR1A 4CLWA 2FGOA 3TUIC 2RRBA 2JJ4D 3MEDB 4DUYJ 1RT3A 2D4PA 2ZBCA 4MIWA 6CPAA 4ID5A 1JLBB 5G4DA 2FS5A 4KY3A 4PRFA 3DLBA 2R7WA 2VEZA 3CEDA 4NRUA 3SHPA 4QOTA 4BWJA 3CW2C 4UF4A 1RYSA 3FYNA 4F0MA 4I0WA 5IV3A 5HL7Q 4B10A 4NL5A 1J5EJ 3C6UA 4OX8A 5F48A 1S0NA 3CCQS 2MQPA 1BMQB 1RT7A 3D2MA 4QYZJ 3BO2A 1RWWB 2IVFB 1C0TA 2DXFA 3M6XA 3CPXA 4JP8A 3IFEA 2YWFA 2ZHBA 1YR0A 4UCPA 4KVOE 3WQPA 1RAAB 4DJLA 2E1PA 5EWEA 4JV2A 3ELHA 1WF1A 3E01A 2D1CA 1IN0A 3QRRA 2MZSA 2ZDPA 1UA0A 3JQMA 2Q04A 2DISA 1KLMA 3K5LA 3C26A 3AD7C 4ECZA 2LDYA 2OB0A 3NXZA 2NXUA 4KORA 2AZ1A 2R7UA 1S0VA 2G9OA 2Y8YA 1ZZNA 3OXLA 1AFIA 4NGRA 1WDDA 1S9EB 1TUWA 2QL9B 3UI3A 5FDLA 1OBRA 4JI6J 1RTDA 3M8PA 2CDQA 1GFWB 3HHEA 3M9MB 2CNKB 1ZA2B 3MPVA 4F0YA 4M5LA 1KQKA 1YSJA 4U95A 4P2SA 4QWBA 1U6MA 4NA1A 1KS2A 2PFDA 1QDUB 5KFHA 3LP0A 5HVHA 2O53A 4DR4F 2CPZA 4P2MA 3PO5A 1S6QB 1OPZA 4XPEA 1XOVA 2BYCA 1A0OB 2H54B 1H0HB 4UZBA 1E6VA 2MSTA 4H2KA 2XYHB 3IRXA 3PR4A 2P5VA 1Y7RA 5LYFA 2O4HA 4DSLA 1S76D 2F4VJ 4DSFA 2N7CA 1UEUA 1FA0A 5ETRA 1U1MA 3A9LA 4DLEA 5F8MA 2RRAA 2HMIA 2KB2A 4K4VA 1IKVA 4WP3A 4J91A 1WF0A 3MM8A 4FD6A 2EI5A 2CPFA 3A12A 3H2LA 3GE9A 2BL1A 2ADCA 3ISNC 3I0RB 4UFXA 3A4TA 4O4GA 3DCAA 2N4DA 2BKPA 4KHPJ 1IR1A 4XPLA 4B9TA 4CYUA 2HHPA 2HVDA 1AZSA 2M70A 3NS6A 2BVZA 3UDVA 2IMOA 1NDPA 2YKMB 2DR7A 2J9DA 3FK4A 1QTNB 3R5AA 4HR2A 1YVKA 2ACMA 4NLQA 3GFYA 3LGNA 3E51A 4QU6A 4X65F 4PG8A 1JLEB 3GU0A 3TC8A 2UXDF 5KFJA 1PAEX 2PR8A 1KQGB 4J3GA 1KOHA 4WYLA 1FRIA 2GIRA 3K58A 1RT5B 3T9YA 2IHR1 2VBWA 3TZYA 1REVA 2PT0A 3VQTA 4E2FB 1RDRA 1X60A 2P6FA 5A8RB 4PPDA 1SJ3P 1XR6A 2DNPA 1S7NA 2CNMA 1WKKA 1TQLA 1TMMA 4QPXA 3HFVA 5E41A 5K8PA 4IO9Q 4Q5VA 4LIRA 1EE3P 2ADBA 3K17A 4DBQA 3M32B 2PRQA 4QBJA 4OYZA 4F3MA 3V6KA 3KHZA 2QO3A 1Q53A 2QGFB 1I94F 4JBCA 3MPWA 2F5IA 1JLGA 2NS1B 2AJQA 3A1YG 3Q86A 3PX6A 1IBMJ 4Y0FA 4M6HA 4TLRA 3OL7A 1FJCA 3HD1A 2PEHA 1FJGF 3KG1A 4CYNA 4DV0F 2G13A 5CYMA 4Q38A 2PSZA 2EFNA 4IG3A 2YKPA 3SXLA 4TU9A 2AFUA 2I6WA 3P5BP 4NWBA 5I3UB 3W6SA 4MJ8A 3DYAA 1Z8LA 2F9JA 1SL2A 3D5MA 2B6AB 2VBQA 1Z8WA 3CCWA 3NS5A 4KYZA 4MFKA 4U67Q 4DX6A 3SCIE 4ZY2A 1AUGA 4HKFA 2GQQA 1BD6A 2FJWA 1XEBA 2M7SA 3ZJ0A 1U1NA 1BHNA 3KZWA 2XMWA 1ITPA 4LQ3A 2UVWA 2R4FA 3VVTA 1NLKL 5L1LA 2P9EA 2QSFA 4Y3CA 1L0CA 4YHHF 3V81A 3KKFA 2OR4A 4TNOA 4F4WA 4ICLB 3T9NA 2Z4PA 1M5SA 2DTJA 2WVEA 2GAGC 4ZN3A 1TFYA 4IO1A 2R7VA 1QE1A 2YNFA 4N8OA 5IQ6A 2E1AA 5HBMA 1EHWA 3K5OA 3MR5A 3LW5C 3CZXA 4RX6A 3BJ8A 3DRPA 2EFPA 2B4DA 3C15A 4YY3F