3ISZA

Crystal structure of mono-zinc form of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
376
structure length
369
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 122
structure length 369
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iszA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iszA01
4NGPA 2C6CA 3NH5A 1YSJA 4FAIA 2V8GA 4MMOA 4OC3A 1QQ9A 5LYDA 4GM5A 4EFDA 1Z8LA 2GLJA 2XEFA 2GREA 1EE3P 2BCOA 2GU2A 4OC1A 1GYTA 3JRUA 2RFHA 2QYVA 1LCPA 4NGSA 1CX8A 3ISXA 4OC0A 3SJGA 3BI1A 2XEJA 3IWWA 3I1UA 4MHNA 2PJ9A 2GLFA 4B6ZA 5LYIA 5CBMA 2JBJA 4OC5A 4PXDA 1ZG9A 2Q51A 5K8NA 3WC7A 1NSAA 2OR4A 3RAMA 1VHEA 4ZX9A 3B3VA 2V8DA 1CPXA 3S9NA 3SI0A 2PJ1A 2ANPA 1FNOA 5HXDA 1ZG8A 1CPSA 2J9AA 1M4LA 4P44A 4P4FA 1RTQA 2PJBA 3B7IA 4MXUA 4X8IA 2CTBA 4NGRA 4RUHA 3FMCA 3KR4A 4IK2A 2ZEFA 3FECA 2PJ2A 5JGFA 1IGBA 2O4HA 5IB9A 1UWYA 1F2OA 4OP4A 4PXBA 4YU9A 2RB7A 4DYOA 4TNUA 3GB0A 5LRGA 4MRIA 7CPAA 4UEEA 2EK9A 3SJFA 2PRQA 2ZEHA 1DE4C 3RZAA 4MHYA 1BPNA 4MCSA 2CF4A 4UIBA 4F9UA 4Z65A 1QMUA 2C6PA 1XFOA 4EWTA 2IQ6A 2V8HA 1XMBA 2ZEMA 3PRTA 2BOAA 4FUUA 4A38A 3NA6A 3VARA 4A37A 3IC1A 1ELLP 4G1PA 4DUKA 2PE3A 2WZNA 1HDQA 3B3WA 3QNVA 3KASA 4Q7AA 5K8OA 4IHMA 2I3CA 5HVHA 3KZWA 1ZG7A 1XJOA 3CPAA 2CTCA 5K8MA 5K8PA 2XEGA 1TKHA 2PJ6A 3N5FA 3KGQA 3V38A 3SI1A 4OC2A 5LRKA 1CP7A 6CPAA 2WYRA 5HVFA 3CPXA 3BI0A 3PBBA 4MCQA 1TF9A 2C1CA 2PCUA 2PJAA 1HDUA 4WJBA 2FVGA 2PJ7A 3PFOA 4ZI6A 2O53A 3H8EA 4F9VA 1TKJA 4NJRA 3PBEA 3S9LA 4H2KA 4ZY2A 1BLLE 1Q7LA 3PB8X 3S9MA 1IY7A 4NJQA 5CPAA 1PYTB 2QVPA 2V77A 3B3CA 3D4UA 4UEFA 2ABZA 4R8FA 2AFWA 5LRJA 4K3NA 5LYLA 4ZY0A 4FBEA 3FH4A 5HVGA 2BO9A 1PCAA 2PJ3A 5F09A 3D7HA 1HEEA 3NH4A 3FEEA 2PJCA 4ZX8A 2PIYA 3CT9A 4KSIA 3IFEA 4IAVA 1VHOA 4ZYQA 4UF4A 1R43A 4NFRA 2F7VA 3D68A 4UIAA 3K9TA 5JH9A 4YWYA 3MN8A 3SI2A 3DGVA 3FJUA 4MCRA 1AYEA 2JEWA 3IEHA 2ZEPA 1CBXA 4P6YA 4PQAA 5JM6A 3T8WA 2XEIA 3PB6X 2C6GA 1XBUA 3BXMA 4FWUA 3IO1A 4OIWA 3SJXA 4PXEA 3GUXA 4ZY1A 1ARMA 5J1QA 4EMEA 1JQGA 4OKOA 3D67A 8CPAA 3MRUA 2ZEEA 3CDXA 3KR5A 4P45A 2IJZA 2OOTA 3WC5A 1KWMA 2PJ5A 2PJ4A 1Z2LA 2ZEDA 4BD9A 2PJ0A 4O23A 1LANA 1ZLHA 3ISZA 3FVLA 2NSMA 3B2YA 1LFWA 1OBRA 2PJ8A 3KQXA 3TX8A 5LYFA 4WWVA 5DS0A 4PPZA 3RBUA 3PB9X 1CG2A 5ELYA 3D7GA 4MHPA 1F2PA 4P4EA 4X3RA 2ZEOA 4JYWA 2Q43A 2AFXA 3WT4A 4P4BA 3VH9A 2AFSA 3PEIA 3H8FA 4AXVA 4P4JA 2EK8A 4JZ0A 2EWBA 3HUVA 2NYQA 3B3TA 5D29A 1YW4A 2POKA 5I4MA 4F8ZA 1YLOA 3KI9A 4CPAA 4NGNA 4MCPA 3H8GA 2F8HA 1AMPA 1VIXA 2ZEGA 4W9YA 2CIJA 1ARLA 1TXRA 2G9DA 3DLJA 3SJEA 3B3SA 4NGTA 2AFUA 2ZENA 4OMEA 1VGYA 3B35A 3KHXA 1Y7EA 2ZOGA 2VL1A 2AFZA 1XRYA 1LOKA 4R6TA 3BHXA 1BAVA 4DJLA 2ZELA 3HLPA 4A39A 1ELMP 5THWA 1TF8A 3VATA 3FX6A 3WABA 1TKFA 4PXCA 3KL9A 3LMSA 1YMEA 4OIDA 4NGMA 1LAMA 1F57A 1YW6A 3NH8A 1CP6A 3K2KA 4TWEA 3D7FA 2PVWA 3NFZA 4LQGA 1DTDA 3V7ZA 2ZOFA 1Z5RA 4R76A 3D66A 3TC8A 2AFMA 4OC4A 3L2NA 3KQZA 4NGQA 3KHZA 3PFEA 3GLJA 3IJ3A 3IIBA 4R7MA 3FF3A 2DEAA 4ONWA 1FT7A 1H8LA 1BPMA 3FEDA 1LAPA 1Y0YA 4P10A 3PB4X 3LWUA 4P4DA 1R3NA 2QJ8A 2V8VA 3PB7X 4P4IA 2JBKA 2HB6A 2IMOA 4A94A 2HC9A 3D7DA 4UEZA 2AFOA 1ZLIA 4X2TA 5D8NA 2Q4ZA 1Y0RA 3WC6A 4MHZA 2PVVA 2PIZA
chains in the Genus database with same CATH superfamily
3FJ2A 1VRUB 2XGQA 3NE8A 4H4OA 1S6QB 1S48A 2I8EA 1EP4B 2GJFA 3OHAA 2AJFE 2QL5B 3FGVA 5T41A 4JWPA 3DLKA 1ZPVA 2QMXA 1WKLA 4X65F 4MY3A 4X4OA 2FJBB 2BQUA 1FCAA 2E5JA 3HULA 4B3OA 3I5CA 3RAMA 3VF0B 4U9YA 1J4JA 4MYUA 4C3KA 4C7QA 2VPYB 2CXAA 4CM0A 3AFGA 3ZJ0A 1CPSA 3HHLD 1KN6A 1VQ8S 3B7IA 1ITPA 4RUHA 3KR4A 2HQDA 2CQ0A 2Y1IA 4TLRA 3FSXA 3W66A 1TV6A 5MLCV 5HSPA 4GVBB 4MKAA 1GT8A 3DGPA 1YBTA 4YU9A 2WB1D 5LRGA 1R8HA 3OUYA 3TJAA 4MIBA 5M2PA 1HBUB 4DV5F 3RGIA 1U24A 4P72A 4DQPA 3ZTRA 1VQLS 4IRDA 4JI7F 4IYQA 3TO8A 3QWPA 2J9CA 1XFOA 4X4QA 2IQ6A 2G1HA 4OZ1A 2J7WA 4A38A 5ETVA 3M9OB 4DUKA 2A18A 3P6YC 3B3WA 1SKUB 1NSQA 3KZWA 4UFWA 4E8UA 2JRSA 3M2VB 3VCDA 4R5PA 3A9LA 1KFSA 3GZ7A 2OFGX 4OC2A 4ZP8A 5KTDA 2B8PA 2QZ8A 3SFUA 3ZFVA 4IKAA 3CW2C 3MM7A 4Z2XA 5KOWA 1J5OB 4C68A 2J6SA 4FBTA 2X1AA 3DLLQ 2Q7BA 2MKKA 5K5MA 3HZGA 1HNVB 3K2YA 2VBWA 2C2EA 2LQBA 1SJFA 1KC8T 1TKJA 4RN7A 2V0NA 2OJ3A 1S7LA 3MDFA 3B82A 1S1VA 1HPZA 1MWQA 1HD0A 2P6SA 4ITSA 4CAFA 5GMKa 2FLPA 1SL0A 3CDEA 2AKWB 2YX4A 1JIHA 2CWKA 2ERRA 1S4EA 2PDOA 4PUOB 1BQXA 2HWIA 3SCIE 4ANCA 1SH2A 2QYGA 3BR9A 4LFCJ 3T6BA 1K0VA 4DSJA 5F09A 1MMDA 3D9BA 2PJCA 4LBHA 3OPKA 4UOCA 3VTIA 4Y2KA 4JI3J 4NMLA 1UWBB 5AT1B 1UA0A 2F3JA 3DOLA 3W5YA 3GFXA 4X4SA 4WE1A 3CJRA 2BJ3A 4CGMA 2ZBQA 3BGRB 5EWGA 9ATCB 3R27A 4I2PA 1HBUA 4CNZA 1Z1ZA 2VPWB 3QSYB 1U6MA 5B7WA 1ARMA 3MPWA 2MY8A 4ED1A 2GVZA 2IMWP 1ELOA 3J80Y 2XS2A 2W9CA 2V69A 3TQ1A 4F25A 1FRLA 3ENQA 1UFWA 2LU1A 1QVGR 4LQ6A 3DXBA 2D3ZA 1F6TA 4HNWB 4F6AA 1AFJA 2JDCA 4A47A 3H4QA 3EJMA 5KT3A 1X0FA 3DDNA 1QE1A 5H9FJ 3TAPA 4P4BA 1DY3A 3HX9A 2G2YA 4M5JA 2CPZA 1M1KT 3HUVA 1YKWA 3OVAA 4MKBA 3VQTA 2W2MP 3F56A 1F2GA 1JLEB 1F3VA 2D4PA 3DLJA 1FEEA 3SJEA 3B3SA 2J8AA 2X1FA 2Q3PA 2MZTA 1CEZA 1SQEA 1RB0A 2YQ0A 2J5AA 2CY2A 1RADB 1SV5A 1TF8A 4USJC 3MAAB 3D0HE 1QSTA 4NLRA 3LMSA 4DFPA 2AJ1A 2C1EB 4IOCQ 3MPVA 2EFOA 3MOZA 2HZAA 4TWEA 2Y0BB 3NFZA 2PGCA 1LXNA 3DRYA 3C6UA 1FRKA 3BO2A 1N32J 3HXMA 1GX5A 3UY5A 4PG4A 2CPFA 5KFZA 3ZZZA 4X5KA 3PW4A 2VDIA 3NAHA 4F3MA 3RO0A 1CLFA 3BGOP 3Q8UA 3BGRA 4II9A 2XY5A 5G0RB 5C42B 2CVIA 1RHQB 4M85A 3RAQA 1IKYA 2QLXA 4AUKA 1XNQJ 2WVEA 2PMHA 2GQ2A 1MNEA 1Z8WA 3I0RA 2HEKA 3PJXA 3R9EA 2NS1B 5D8NA 1XR7A 2FLOA 2HGLA 2PIZA 3IN5A 4EZ9A 4NCBA 3VAKA 1RTJA 2RS2A 1PJ6A 1M4DA 2QLBB 1MW7A 3ULHA 1KQKA 5L1LA 4K8RA 1UWAA 4WP9A 2GREA 3A1YG 2BCOA 1TFYA 1IM6A 4GS4A 2OU2A 2ZH4A 2DHSA 3OXGA 1WHYA 2N4DA 2E1MC 2F8MA 1FXLA 3EICA 1R0BG 4UCPA 2YX7A 3TWZA 1KLNA 1C4AA 3CNQP 2YWKA 1KUVA 1S1WA 2GLFA 3G2XA 2XHCA 5E7OB 3WC2A 4ECVA 4ZVSB 2B3UA 1M4GA 2PE8A 4NLVA 1WI6A 1WSVA 3RU0A 3N9UC 3G6ES 3HVTA 3M6UA 3D0IE 2ATLA 3VV2B 1U0HB 4C6AA 1FKOA 2CADA 4NI2A 3W3SA 4RNMA 2B5GA 5DQIA 3EGNA 4AD6A 4CS0B 4ZHRA 5JXSA 2GAHC 3EYZA 2EKNA 2K1RA 5KFTA 3ZXWA 4RUCA 3M32A 3VAMA 3KK3B 4CLSA 3TARA 2GVZB 4DYOA 3TO7A 3M2UB 7CPAA 1TK0A 4OHVA 3I4PA 5L46A 5HN0A 1RT7A 2J0WA 3NGUA 3ZTPA 3PXGa 2YNGA 3MFIA 4QWEA 3NGDA 1QMUA 2DGWA 3K9UA 3C66A 3FCWA 2BV3A 1T9TA 2YWWA 2ARHA 2P2CB 3M8QB 3AHPA 3SEOA 3W7BA 5IFMA 4WFBQ 2HK3A 2VFVA 1N5YA 4L6V3 2HHQA 4O4GA 1HL6A 3CCWA 1RTIB 4DV2J 3KHGA 4QR1A 3IBCB 4ZITA 5HVFA 1RWKB 3THTA 5CCLA 1IQTA 1Y5IB 4AQYJ 5HBMA 4MCQA 5IWAJ 3TE4A 1A6LA 2HBQB 2J0XA 1S5KA 3RRKA 3BKFA 4Y49B 4CT8A 4NLQA 1N5YB 1M1GA 3KHHA 1VJQA 2O28A 1SQFA 2WB4A 1XNRF 3Q2TC 3RB3A 2W4DA 1U8WA 2B56A 1X5TA 3UR3C 1NMTA 2COLA 2CNOB 4DQIA 3IU2A 4UEFA 4DL4A 2VH7A 1VYAA 5L1JA 1HI8A 1IU8A 2VB6A 3C2PA 3BKUA 4DI6A 2A10A 4DCPB 4I6AA 3IR5B 3JAMY 2QSFA 2F4VJ 1L5UA 4HT7A 4K4XA 2R7SA 1VHOA 4A8FA 1HWLA 4HH0A 1F0XA 4QVTA 4KQZA 2M2BA 2VQYA 1FEHA 3NRBA 2YNGB 1JNRB 1GMWA 2BA9A 1CBXA 3L09A 4PQAA 1M5KC 2K2PA 2MKHA 3T8WA 1IBMJ 4C7IA 3QB8A 2DRBA 3Q8RB 3D8PA 3NE7A 3IS9B 1CC8A 4NYZA 4ID5A 1H2UX 4OZ3A 2C22A 1EQMA 2HVEA 2K1RB 5AXKA 4MKVA 3CCMS 1TKXA 2PA3A 1N0UA 3RG6A 2CIMA 4PG6A 4B3RJ 4BWJA 1KKHA 3KLFA 2DY9A 3T5HA 4H6UA 4PK2A 1NXIA 4G1QA 4GKKF 4P7TA 4LRCA 2VF3A 4G3IA 2WPXA 4R57A 3CMQA 4D3HA 5LMNJ 1FDDA 2IDLA 3ZZTA 3OHBA 4J9MA 1WHXA 3OTEA 4B3TJ 4HH1A 4P52A 4AYBD 1JJCB 3VZIA 1VFJA 3LWLA 4AXVA 5DDOC 2M7SA 5C24A 4ZCIA 1KLMB 1D8ZA 3PYGA 3DI6A 1ARLA 1NK6A 3I82A 2L08A 1MJAA 2ZDPA 4EYHB 2YWGA 3FBUA 2AFZA 2BANA 1WF2A 1Z2ZA 3MR5A 4DX7A 1S9FA 2V9KA 2CRLA 1YGHA 3K58A 4DV7F 3UN3A 1CVJA 3NWRA 1TMMA 2U2FA 3X1LB 1APSA 1FWPA 2YNFA 2DIVA 3D3CJ 2JEVA 2XY7A 4K4UA 2W7PA 4P2MA 2NSCA 3D7FA 4XPKA 2LDIA 4MFLA 1MMNA 5F48A 1QM9A 3SV3A 4LR8A 4RNOA 5D4PA 3R5DA 3FK4A 5GAGI 1WJ9A 3TC8A 5L9XA 4J90A 4NGQA 5B0CA 4OX8A 4EEYA 2HBRB 2GIRA 2DPIA 2NYHA 3GONA 2Y1RI 4JI4F 3BB5A 4Q8FA 1OO0B 4DFMA 3HHLA 2JC1A 3IU1A 3KLHA 1VBZA 1J5EF 3PYDA 3CJKB 1YLEA 1CJWA 2IRYA 1S1TA 1R3NA 3R97A 3TRGA 1RTHA 4H4MB 2FZKB 4ZVFA 4ZP6A 2AU0A 2IYGA 4MHZA 3PG9A 3NH5A 4FAIA 1AW0A 1FTRA 4Y6IA 3H5SA 5DQGA 3UCGA 1FI4A 2N7YA 3L7UA 4UWIA 3NGTA 1QSLA 3MR2A 4QWAA 2RFHA 1RWNB 1X60A 4NGSA 1ZO0A 5IV3A 4OC0A 3QGHA 3MMAB 4F0KA 2BUNA 3OTBA 1HWIA 5F41A 3BYPA 4B6ZA 4AT1B 2KTQA 1ZG9A 2Q51A 3KUGA 2JDDA 2VG7A 4OX9F 1NK9A 4QZVB 3WR7A 3OR2B 1M4LA 2ZOMA 1YJWS 2BKPA 5KFHA 5HP1B 5EN1A 1YJNS 2Y8WA 4RWXA 2YKPA 2JFDA 2X1BA 1AB8A 3BSOA 5C25A 1UWYA 1F9HA 3V6DB 4U8YA 4DR1J 2CNTA 2P5VA 1PAEX 2BM0A 2L3MA 5KFYA 5B0GA 3CD0A 4DN9A 1Q2YA 2O3DA 5HATA 3OL7A 4MCSA 3SDEB 4L76A 3OL6A 5D0GA 2JLMA 2EPIA 3CE8A 4FUUA 4TY8A 4DX6A 2QMUB 1RK8A 2HFSA 1XEZA 5ETOA 1HW9A 5ETKA 3V81B 4W90B 3DM2A 2Q4YA 1IR1A 1MJBA 3PGPA 5E3PA 4DR5J 2OTJS 5DG9A 1WF0A 3ENVA 1Q4RA 1SJRA 2XMUA 1JLFB 1D09B 1XNRJ 4AXIA 4YB1P 3DRSB 1MROA 2AYMA 3CF5Q 3H25A 3P3DA 3PCOB 4WJBA 3PFOA 3ITHA 2GC8A 2V68A 2UUAF 4ES3A 1VMBA 2P0WA 3PBEA 1M5HA 3W61A 5DO2A 1KZFA 1RABB 1U1QA 1HLWA 3L4BC 5GAGU 3TAQA 1J27A 5LRJA 2CJ9A 1L3UA 4KPYA 5D0RA 2V2KA 4CO1A 3FH4A 2A2DA 4WZMA 3T3FA 3RJMB 2Y1JA 4ID8A 2L9DA 4QUSA 3A8IA 2K06A 3OJUA 4MIWA 3SCKE 1UPPA 1VBKA 4FYWB 1RTDA 1HNWF 3PEJA 4TU9A 2X3DA 2MZQA 4LQ9A 2ZM6J 5JQ4A 4KR0B 4RR5A 2ZEPA 2FJAB 3CCZA 3CXQA 2IRUA 2N4CA 5BYSA 5LMUF 4ZLLA 1X8DA 4M95A 5KFNA 2OB0A 3P2FA 4NXNF 4UCMA 2QV6A 3P96A 4OKOA 1TUGB 2SXLA 2DEJA 2IM2A 3HSGA 2KG1A 3BPDA 1PU9A 1S79A 2LQ9A 1L3TA 4ECRA 1TVRB 4FVMA 3S6EA 4ZPAA 1F5AA 4R87A 2K7KA 1I51B 5F9NA 4L74A 1M5OC 2DXQA 4LF4F 3RW6A 3B2YA 1LFWA 3IWGA 2EC0A 2XS7A 1NE9A 3GFZA 5F47A 1I12A 5FIIA 1FJEB 2OPQA 3T9YA 1C2PA 1F2PA 4DZDA 4KVOE 4KAIA 4KORA 4KBIA 3VH9A 1IR2A 4MJ8A 2PO4A 2RILA 3P45B 4UBRA 1RJJA 1ZBTA 2ZM6F 2ZXVA 2DPTA 1OY9A 4CCHA 1SB6A 4U95A 4F8ZA 4CPAA 4WYWA 4NGNA 2J9EA 2YNCC 5F49A 2OLWA 2ZBPA 4NGTA 2ZENA 4RW8A 3KHXA 4QYRA 2A2CA 2BZ2A 1FVQA 2I1RA 3IWEA 3TEGA 2R2UA 4B3SF 1QUVA 2E9ZA 1RKIA 2R9LA 3O3LA 3RAXA 4ZLNA 3NXZA 3N6LA 3BN4A 1JLBA 3DLEB 4F3OA 4A2ZA 3PACA 3I0RB 3UNGC 4JYAF 4MFPA 3ADAC 3EGZA 4B9SA 1DTDA 1HQEA 4NCGB 2HGMA 1BO4A 3D66A 2QEXS 1LWFA 2VKZG 4CYUB 1DQ8A 1FHTA 2HW3A 3EXYA 1BD6A 1VQ7S 5KG1A 2XMJA 5LMUJ 5A6WA 3KJNB 1EETA 1Y3KA 3FEDA 1KOOA 3I0SA 2PEHA 4P10A 2IBOA 3R5JB 5JPHA 4P4DA 2AGOA 2GE3A 4DSLA 4DOZA 3PB7X 2BEIA 2WHOA 1TV6B 1VKCA 2HBYB 1PJ7A 1YITS 4W98A 3E8OA 3IP0A 4CLWA 2VA2A 3VAFA 2XLKA 4U6PA 2Q4ZA 3CIMA 3W63A 5FLXU 3H40A 4PSXA 1WG4A 2NZ4A 4HVZA 2C6CA 3AA9A 1QQ9A 4UOFA 1F60B 1U4BA 1I6JA 2OIHA 5EUHA 3BM7A 2OPRA 2MQOA 2GU2A 2VQFJ 3M32B 3MECA 3GU0A 1YI2S 2EEYA 1O5JA 3IS9A 1RT3A 1CX8A 1CS4A 4M5MA 4EVYA 2GQCA 3EDQB 3MR6A 2DGQA 2NXNA 1PGZA 1VRUA 3RRGA 3GIKA 1ZM9A 1N56A 4C0OC 5IC6B 4M3SA 1NSAA 2W9BA 1Y9WA 1NPKA 3K8WA 5DQHA 1TL3B 2KB2A 2XNRA 3JVNA 3GQCA 1D9AA 2QLWA 1TAQA 3PYEA 4KVME 3NP5A 2Y0SD 2DNLA 2RRBA 1V0CA 3MPUB 2V63A 4C4WA 4TQSA 5A76A 2Z0ZA 4IFVA 2HWTA 1S6PA 1Q1KA 3SQOP 4PRFA 1HBOB 1OMSA 2KN4A 4CLPA 1FX4A 4CZCA 4F4ZA 3PHTA 4E0AA 3RTVA 2XMKA 4YHHF 3F41A 4KV8A 2RQ4A 3I32A 4TQRA 2C6PA 4RS2A 5IOLA 4ECTA 3C46A 4B9LA 1IM4A 3AOAA 4PWDA 2DR7A 3NA6A 4DS4A 1R89A 4ZMMA 1HQUA 1YVFA 4GO7X 1SPBP 4O0NA 5G0RA 1U2RA 2MHEA 3CPAA 1HYSA 1T11A 5K8PA 3FMBA 2PJ6A 4I2QB 4J9UE 3V38A 4CDIA 4ED3A 4IFYA 2B58A 3DI6B 1RAIB 1UVNA 3UNYA 3JTNA 2DEIA 2MHNA 1UW4A 3T41A 3KK1B 2ZKTA 4WZQA 4IOAQ 2CQDA 3NKYA 3EZ5A 4KLVA 5EWFA 3UD3P 3UD4P 4XPDC 4OHWA 2PI4A 4W92B 3PP9A 3LTOA 1HHQA 2AEMA 2CZVC 4ED6A 5DLFA 4CRJA 2I00A 3M8RA 2BE9B 1XMTA 2GHPA 2EG1A 3D7HA 4C8YA 2KZMA 2ZNYA 4EK2A 4KSIA 3BV8A 2OZHA 4DSKA 2BM1A 3D6HB 4UF4A 4LF9J 3R3TA 2F7VA 3D68A 3IAS9 5CAAA 2WPWA 3SI2A 3DGVA 3IWNC 2I2YA 3K17A 3V2UC 4J7CA 2JEWA 1GFWB 1VBXA 1KR4A 5JM6A 2WOMA 1NLKL 3C26A 2DNRA 5A2QU 4JI6J 2C3YA 2YKAA 2ZBIA 2M9KA 2H3EB 2DH9A 2MQMA 4UWJA 3UDCA 3ILJA 5J2PB 2KYXA 4V19X 1OPZA 2QMLA 2R2SA 2NUUG 2E7XA 4K50A 1Q5VA 3Q22A 5C88A 4P45A 2IJZA 3WC5A 3DOKA 1D1UA 2KYZA 3DDDA 2R8GA 1QTMA 1ZH5A 3O5TB 3PV8A 5KG4A 4O23A 4FF3A 4YB6A 5BJRA 4I69A 2ZZMA 1VHIA 3FMWA 3AT1B 2CAJA 1OBRA 1NB2A 1TFWA 1Y9OA 4A8MP 4EGLA 4PPZA 4JI0J 1B3TA 2M8DB 3G8QA 2E1RA 5E3CA 2K8GA 3CCES 2EC2A 4USMA 3WT4A 4P74A 2JH3A 1VRTA 5J1EA 2IDEA 3D6FB 3BQ2A 1S6UA 3D1QA 1IOIA 1SC4B 3J7Z5 1NRKA 2EWBA 4NLPA 3BGUA 7AT1B 3JYTA 2ZE2B 5I4MA 2B5JB 5LMNF 2RAQA 3EPIA 2F8HA 2N3LA 5CXTA 1S0OA 3L9ZA 4UTGA 2YKMB 1R8BA 2NREA 4B9UA 1LWFB 1JLBB 4PG7A 4Y2CA 2NXUA 3GYAA 4C0HA 5DM6Q 1FDBA 3W6XA 1HARA 4CYPA 1HPZB 1S1VB 2DNPA 2K5TA 5EGYA 1URRA 1VISA 4PG5A 2REEA 2KDOA 4CO5A 3PM9A 1XN9A 4DDFA 3SV4A 3J7AN 1PYTA 3LQVA 3TA2A 3NH8A 2R7TA 3QT6A 2PR1A 5AE2A 3LGMA 1XTZA 2J7KA 4CRZB 1WHWA 2KJWA 1N71A 5LSOA 2DK2A 3LPYA 3G82B 4OC4A 3L2NA 2R7XA 2WAQD 2Z2ZA 4O3PA 2JZ5A 4BBHA 4ZGYB 2IM0A 3KLEB 1SL1A 4NLDA 4ZIVA 1X5OA 4PYDA 2IAJA 4LRBA 2MKJA 1L3KA 3R6GB 1D0EA 1BQMB 3HT3A 4K59A 2FIAA 1HMVB 2C2OB 4PK3A 1VR6A 2J9DE 2ZNZA 2VEZA 2XMAA 1UVKA 3MPDA 3QIDA 2DYAA 2RKIB 3FVYA 2C2DA 1W7WA 4OFZA 1TL1B 2XEFA 3KK2B 5C7PA 5KFKA 2C2KB 4NA1A 1U45A 5D3GA 1S4FA 3TANA 2QL9B 4ATNA 1CULB 4FS2A 2JHEA 3FBEA 5EX0A 3MD1A 4K30A 3NMAA 3A4TA 3CDWA 1FY7A 2VASA 4NYOA 1LW0A 5HLFA 4UT4A 2Z3KA 3PJWA 2G0JA 4DX5A 3FFIB 2V8DA 4WXWA 5F9LA 4LF5J 2FY1A 3MEEA 4ILMA 1T3NA 1ZG8A 1PIEA 3D4JA 4JUZA 4FPIA 3BSCA 2J8RA 1WC6A 4ZPDA 1RT1A 3ENAA 3LF0A 4IOBA 3S8SA 5I3UA 2O4HA 3LALA 5CD4H 3EXCX 2JVOA 5KG7A 1XIQA 1RYSA 3GB0A 1DFDA 3A8KA 3SJFA 1B7FA 5IM0A 3P4UB 3JSRA 4IUFA 4DLEA 3E3XA 5HP1A 3AXKA 5B0DA 5A27A 1MWYA 2OPPB 1IIDA 4A95A 1XMQF 2ASLA 3MGJA 1KRPA 1RGVA 1N5SA 2FQQB 3QATA 5HQLA 5A8RB 5K8OA 4QB9A 4DSFA 2XYHB 1X4BA 3B78A 1TKHA 3A12A 6CPAA 3OFGA 5K9FA 2W2NP 5C25B 4QC6A 3QGIA 4LIRA 1XK8A 1NEEA 4JV0A 2PCUA 2PJAA 2B3VA 4J9NA 1CJTB 2PJ7A 2JOQA 1Q8KA 2V50A 4F9VA 4B13A 3DM2B 4DR2J 3V6HA 3CJ0A 5CPAA 2R42A 3QSIA 1PYTB 1WC3A 3JTOA 4B9VA 2V77A 5J2QA 3B4MA 4XK8C 1RUSA 3OWCA 1KFDA 3K89A 4DPOA 2BYCA 4DCJB 2VG5A 1V6HA 2FVSA 3S01A 3K5LA 4IAVA 2DXDA 3N0VA 3JSMA 4JI8J 3N4WA 1VQSA 3NS5A 3FKBA 5BR8J 3BO4A 2KL8A 2I79A 2JEJA 1FRIA 1I1DA 1UKUA 2G1DA 4RW4B 1PUAA 3DLGB 2WVFA 4WE1B 2UVWA 4QW9A 3S1TA 4MI4A 3HHKA 1YZ6A 3CJSA 1JLFA 2B9YA 1YJRA 3A3NB 3EXNA 4YDXA 1RO5A 3EM1A 1VQMS 3QLHB 3W1YC 4R3KA 2QA4G 4CTAA 2EK6A 3JQKA 3VHQA 3GG0A 3S7RA 5IB0A 3N6MA 4YR0A 2NSMA 3GFYA 3KQXA 3VQSA 3TFYA 4WFZA 3QIPA 3CCTA 2Q43A 3LAMA 1LV5A 3I9ZA 3OJSA 3P2HA 1U26A 4H4KC 4JI8F 2BE2A 3ILOA 4GXHA 2ZH2A 4RW9A 2D1CA 2Y8YA 5J2MB 1YW4A 5B0BA 1YLOA 2ZBCA 2ZEGA 4F4AA 1H2TZ 4KLWA 2G9DA 2V8PA 1RT4B 2CQGA 1U02A 1OY8A 3KKWA 2ZOGA 2VL1A 2MQ8A 2DISA 2MMYA 2RQCA 1EX8A 4GVLA 5HAOA 1G4CA 1QE1B 3NLCA 1IR0A 2XG8A 3G4SS 2WW8A 2DO4A 1H6KX 1KLMA 4KGVB 3EGWB 3WQPA 5FDLA 4A8WA 1X12A 4IO1A 5KT7A 2AGQA 1Z5RA 2Q0YA 4DQQA 1BHNA 1DJ0A 2K7JA 1IBCB 4KT0C 4CIOA 3WIVA 4DUYJ 2B3TB 2ZJQQ 1WWZA 2W9CB 3BGLA 1HNIA 2LEPA 1OYEA 1N48A 1U7LA 4C9DA 1YG0A 2VKRA 4ECWA 2BSWA 2X51A 1HYSB 2FB0A 3GIRA 1C1CB 3GMGA 3I55S 2J8MA 3PB4X 4I0WA 3D1HA 1SXLA 3HD2A 4I2PB 1AZSA 1T95A 2XS5A 2XMTA 1WC0A 1VK8A 2ZFHA 1FKPA 2IM3A 4FDFA 2MQQA 4ZIWA 2LEBA 2CVEA 3HJFA 4B5PB 4YOEA 4B3RF 1AROP 2NXJA 4JD6A 1DTTB 1G2EA 3PO5A 1U6BA 2WSFC 4RL1A 2Z8QA 2IA6A 1YQHA 1LW0B 4V19J 2KFZA 3K59A 2XEXA 4CRYB 2IVMA 3HMJG 3NWGA 4DG1A 3R5BA 3ISXA 4LUAA 4JXQA 3N6NA 5CQGA 3SJGA 1FE4A 2FHJD 2DNZA 3LP2A 3W2VB 4F67A 2ZZNA 1K0TA 2VBZA 2DBBA 4QPTA 2JBJA 1XWLA 5GMEA 2WBMA 2XLIA 3V6KA 5K8NA 1XOVA 4CH0S 3TZWA 1F3FA 3MD3A 2OSRA 1TL7A 2ZEJA 3DOMA 3N7ZA 2YH0A 2HURA 5KG3A 2HLTA 1WTBA 3TZYA 2H48B 3BSNA 4NZ6A 2EFVA 4MXUA 2GIVA 1S59A 3TAMA 2LYVA 5LT5A 1TL4A 2FHMA 1BWEA 1IGBA 2IJFA 4C2MA 4NMXA 1KD1T 1DBDA 1F2OA 4NXYA 3SCLE 3S6GA 2RB7A 2R7WA 5HMNA 3T1AA 2FJDB 1X9WA 2ROEA 4OLLA 1DE4C 1IJEB 2UUCF 3U7JA 1C1CA 1X9MA 3K8VA 4JV5J 4UIBA 3T6JA 3CC4S 1IVZA 4Z65A 4ILLA 1Q2CA 1VQ6S 3QT8A 1RISA 1FDNA 2MY7A 4EMDA 4AXJA 4PQUB 3TW0A 4CM2A 1QVFR 1S1XB 3QNVA 2B4UA 1IICA 4USIA 4QW8A 5HVHA 4X4PA 4DXLA 1HIYA 5KFWA 2XY6A 2CTCA 4Y65A 1KVKA 3I5BA 4A8OA 1WDTA 5FVJA 4NLGA 5L9NA 2OD6A 2XZDB 3PJ9A 3OT9A 3KG1A 1GXUA 2OELA 3ETOA 3HM9A 2R7VA 2DJWA 1U1LA 1X4FA 2CA9A 1F9EB 4XPDB 2HAFA 5A8KA 4RNHA 3S9LA 2V4RA 1FO1A 3U1LA 4ZY2A 3R9GA 4LF8F 2R7UA 3GCWP 2C28A 5FDLB 2RNEA 2P6EA 2NXEA 3B8GA 2QVPA 1T02A 3S6FA 2B4DB 3IXQA 4J91A 4J5OA 1IYKA 3I9SA 4R8FA 1PC4A 2BJEA 1U25A 2HRTA 4KJIA 3DRSA 3CT9A 5RUBA 2OHDA 4ZVGA 1R43A 1ZM3A 4DR3F 5A0YB 2FZGB 3MMCB 4P75A 1SJ1A 4IH7A 2DGXA 4Z37A 4QU7A 4DU8A 1N52B 3QBCA 1AUSL 4MIAA 3ZZ0A 2LXIA 4K0KJ 3SQGA 4HKQA 2IVFB 1YRUA 1V5IB 2D9PA 2KG0A 1N6QA 2GMHA 2DGVA 2DNYA 1A7GE 1RTJB 3C6UB 1XR5A 4P71A 3M2UA 4MY0A 4ZY1A 2EKYA 2DNMA 2AEJA 1VC5A 3FIXA 2AMCB 3HSZA 2ZEEA 2ZITA 4DMZA 2B4VA 3GPAA 3CGIA 4ZVHA 3AXMA 3TA0A 3L7PA 1Z4RA 4J9VA 3QRPA 2YWFA 4DV6J 3IM8A 3AH6A 3C14B 2E7WA 2W01A 4CH7A 1K1QA 2W2PP 1TKZA 4QBUA 3FVLA 3TR5A 4B17A 4DR6J 4F0HA 2DIUA 2M3DA 3PB9X 1CG2A 2UVRA 5EDWA 3BJ8A 2W1BA 2H5JB 1QAYA 3L7OA 5KFBA 4Y0FA 1ZYQA 1S1WB 3G6YA 3DLGA 2I9SA 5HMWA 4P4JA 2G4BA 3PRBA 1TELA 5KFVA 4FYXB 4AL7A 5D29A 3FNCA 4DSEA 3SYZA 4CO2A 4DJBA 1GHEA 3IMQJ 2QMWA 1NHVA 1TXRA 4G65A 2OP5A 3VAHA 1YR0A 2XC9A 1DURA 2Z2LA 3H42A 2EUIA 4KO0B 1KDNA 1SV5B 4DUYF 2RE1A 2HQGA 4CAXA 3RNZA 3GYGA 5D4LA 1J2VA 3HLPA 4ZDNA 4QWCA 3PX6A 2V4JA 2ADCA 1CJTA 3LAKA 2ZE2A 3OFFA 2CPEA 2UVVA 1F57A 1YK3A 1G1XA 4I67A 1RA6A 3K0JA 2NPIA 4FF1A 3MTJA 1XBWA 2ZOFA 2LXUA 2KM8B 1RACB 5KFRA 2BR0A 2BRLA 2W2OP 3GJTB 2VZ9A 4A8YA 3HHNB 4WBFA 4YY3F 5D8HB 3UD5A 1LOUA 4ZPBA 3CO9A 2Z0GA 1ICEB 1G3OA 3TVZA 3VALA 2ATCB 2B0GA 1VQKS 4FF4A 4DV4J 2J0QD 3AAWB 4PR6A 2ACYA 2V8VA 4MJKA 1NK4A 4FYVB 2IY5B 3H5YA 2HHHJ 1R7IA 4DR7J 1JLEA 2ZUAA 3KLGA 2HC9A 1S7NA 4C2XA 1B0VA 1KTQA 4DV1J 1LW2A 1RAAB 2Q79A 2Z3LA 4LR9A 2W4CA 2KHDA 1AXQA 1SH3A 3M9NB 3DN9A 2GQQA 2WVCA 1T94A 4R0JA 4OC1A 2JJ4D 3CXSA 3HP6A 1H73A 1KONA 3HD1A 3HSJA 4ZPWR 3LP0A 3IWWA 4MHNA 1Y3JA 1T0TV 3BO3A 2DTJA 2BABA 2BANB 5D0HA 2BEFA 3PIOQ 4TXSA 2H4WB 5BR8F 3TO6A 4KKOA 1EAYC 1SL2A 1FD8A 3UDVA 2MGZB 2OPPA 4M5DA 1PBAA 4P44A 2XQCA 1RTQA 2FVPA 2O01C 4N8NA 4I64A 4NF1A 3PTWA 5J8FA 4LJMA 1T7PA 1KTVA 1TAUA 2UV8G 4F26A 1LFPA 2BRKA 2F9DA 1CQNA 4QBJA 4HKFA 3I31A 2O66A 1CJKA 1IN0A 3C16A 1X4DA 2Z11A 2GANA 5DM7Q 2NUHA 4WTOB 2EXUA 1GK8A 1XR6A 3J7YI 3JTPA 1NKBA 4NRUA 1K4JA 1F5BA 4WYLA 5DWNA 1NKCA 4CYNA 2V67A 2FYXA 1UZDA 2WZNA 4EI2A 1DRZA 3AOCA 5DZ6A 4KGMA 3KASA 2H4YB 4OYPA 3PVXA 1W26A 1PC5A 3TO9A 3C16B 4M6GA 2VBXA 1HBOA 2Y3YA 1U6FA 2QFIA 3DXSX 1OPIA 3U27A 4ZN3A 2VIHA 5LRKA 3UDEA 2E9TA 4Q8EA 4Q43A 4DL5A 1RKJA 3BI0A 3MR7A 3EPGA 1YBAA 3FRZA 1TF9A 3TP2A 3J7ZT 1RHKB 4U7UK 3W2WB 4DL2A 2XCPA 3TA1A 3CPWR 1U6ZA 5T14A 1K44A 1H74A 2VPZB 4HDGA 4USHA 1JJ4A 4Q0BA 4F2RA 4NJQA 1U48A 1IKXB 3SXOA 3AJDA 4RW7B 1S12A 1KUYA 4FBEA 2Z10A 4M6HA 1JK9B 2AD9A 2G0CA 1GAOA 5M2UA 2PJ3A 3NH4A 4OYWA 2EFNA 4HNYB 2KRRA 3I3GA 2BJ1A 5D3GB 1URNA 2KFNA 1FRXA 3FCHA 4B5PA 2N3OA 3K9TA 4X4TA 1RHRB 3QFHA 3MN8A 4YGOA 1HWKA 3UO0A 3CCUS 1AYEA 2GW8A 4UY85 3PX0A 4U5YA 4D3GA 3RW7A 1CJKB 1B0PA 2RKIA 2CPJA 1DLOB 1YRXA 3SJXA 1RT5B 3GUXA 3CMAS 3BYRA 1U1MA 3KWMA 2DD8S 3OVSA 3IRWP 4B08A 8CPAA 4OV6A 4QIWD 2DGUA 2BBEA 3KR5A 1KHVA 2G2ZA 2V2VA 4QYZJ 2PJ5A 1Z2LA 4YN3B 2HRUA 2G13A 2WVDA 2DGSA 3FNNA 3HFVA 5HMYA 1V9OA 1VS3A 4KRWA 1D9FA 4B10A 2IRXA 1B87A 2EBEA 2MZJA 4DF8A 3RBUA 2KVQE 2HHVA 5CABA 2CFXA 3D7GA 4FYDA 2RHQB 2HVIA 4TNOA 5AXNA 4DL7A 2CQCA 1N32F 1TL7B 4AB7A 3C8YA 4KHPF 2CQHA 5KTQA 3KFWX 1QLNA 2DNOA 3GIUA 3CJ5A 1HQ2A 4IRCA 1F5CA 3KJFB 1JJHA 3QWUA 2DNQA 4URQU 4B5OA 1S1TB 1SJ4P 1RAHB 1P1LA 5CD4A 2KM8C 1YVKA 4JBCA 2PC1A 1BAVA 1Z8TA 1RDRA 1WC4A 2YX1A 1JLAA 4WPAA 1Q8BA 4NSQA 3I56S 3OXLA 3WABA 4LX9A 2H65B 1LWCA 4K4VA 4AG9A 4C48A 3TUIC 2YNDA 3JYTB 3K2KA 4RNFA 3PW2A 3C6TB 4ETZA 3GP9A 2ZPAA 4OZLA 5KFXA 5KFJA 2HKEA 2YNEA 4ZVOB 2IJRA 3PR4A 1Q86T 3FF3A 5GMDA 2DEAA 2WSCC 4OMFG 1QSRA 5BYQA 1NCLA 2J7UA 3MM5A 4WXOA 2DHHA 2DR8A 1PJ5A 5D78A 3KDNA 5CYJA 2H5MA 3SBMA 1LW2B 2DRDA 5GVQA 3BR8A 3GY9A 2QJ8A 1O6XA 5CYMA 3FEYB 3EGVA 2MB0B 7FD1A 1FESA 3EFAA 2L41A 5IV0A 4RW4A 4ANDA 5GAHU 3IGVA 1YREA 5T7LB 2GO9A 1LEOA 1TP7A 2BVZA 3TUPA 4KC5A 1PYOB 1YSJA 3TTHA 3RBEA 1FK9A 3OL9A 3LGNA 4I68A 2J8NA 1TKTB 2C27A 2HNYB 1X4GA 2HVHA 2WZ1A 3AD8C 4AVCA 3X3UA 1JLGA 1WG1A 4A46A 1R8CA 5IT0A 5KG6A 2M8HA 2ASJA 4DX8H 2MKSA 4JI3F 2CWXA 3QO9B 2D4OA 3I1UA 2HVDA 1RZMA 3KJQB 3RB4A 3D3BJ 2DXFA 5CBMA 2FGCA 3ETMA 2AV5A 2DNGA 3JS9A 2KO1A 4F04B 4B11A 3HPOA 4CLTA 3T5JA 1VHEA 1P9YA 2KXFA 3G6XA 5G1ZA 2CQBA 4C8OA 4IQMA 2MZRA 4O4RA 1P4NA 4ZPTR 4RW9B 1ZOTA 3J80U 4JV1A 2Y1LB 2Z4PA 2OTLS 4OLPA 2ZH1A 1SQGA 5IB9A 1FE0A 3F0AA 1Y5LB 3QAHA 2MPUA 1S1UA 4I1TA 4ZKAA 5DDQC 4RNNA 3W5ZA 1SKRA 2GHVC 4LF1A 3V6JA 4DR6F 4Q36A 1G7CB 4QPXA 4LMZA 3A3PB 1SJQA 2O67A 2BMBA 1VQ9S 1LK7A 4JB8B 1OYDA 1EETB 4CO4A 4DU7A 3PRTA 5E41A 5KT5A 4DUZF 1U1PA 2QA2A 1IKVA 1KEKA 2PE3A 2PSZA 4MFJA 2EW9A 4N56A 3R7SB 2LQ8A 2C2NA 4NPOA 1NK7A 2MJNA 3GR1A 3JQJA 2WYRA 3QAYA 1ZZFA 5ETPA 1RT1B 2RQMA 3QMQA 4XIUA 4ED5A 1HBNA 1S7IA 1FVSA 4C8NA 1CJVB 2D3UA 2XO7A 1FXDA 4N7TA 3HKWA 3AB4B 3QRQA 4KGXB 1JLCB 3KKFA 2MKYA 1V3RA 5ETSA 3M8PB 1T03A 1UAWA 3K5MA 4C97A 3D4UA 1O8BA 1LWCB 3ZNUA 5AGEA 5LYLA 2D74B 4YR2A 2QC3A 4F02A 3CCSS 3BQ0A 3IBWA 4HHJA 2FPHX 4IR1A 3W64A 1XEBA 1HEEA 4FBUA 5E3RA 4B9TA 1N88A 3QGPA 2WSAA 1RWOB 4JI2F 2VPXB 4BMHA 1VI7A 2U1AA 4URGA 4ES2A 3BSAA 5F8HA 2UV8A 4LF2A 1XF8A 1UEUA 1BQNB 1H38A 3PYFA 4KSFA 5ETMA 5A8KB 4NX9A 2ZC3A 4PPDA 3IA0A 2NXCA 1JQGA 3LUYA 2GAGC 1UETA 1OS5A 5IT4A 3EVWA 1FKAF 4PWWA 1UVMA 2O1PA 1I94J 2FHOB 3ZZUA 3T5LA 4HHUA 3DNCA 2ZEDA 1Y5NB 3O2IA 2AJ0A 5G21A 3GG1A 2ZH8A 2RDIA 1WKJA 3W8GA 2ZW5A 4EBDA 5IC4B 3IWXA 2PJ8A 3VVTA 5LYFA 2H1YA 2N7CA 2A6MA 3WIUA 4UW2A 1NK0A 2XMMA 2Z2YB 2FSRA 4JI6F 3I96A 4ZVQB 1E6VB 3VR1A 4JXRA 4UZBA 4MAKA 3QJPA 1QTNB 3BBBA 3KHLA 1Y4ZB 2QTWA 4HL9A 3Q83A 4G1IA 3BLNA 3TYTA 1S0VA 2A1BA 2JNJA 2CIJA 1RAFB 3E0KA 4NLSA 2FHJA 3F8KA 1Q78A 4O4GB 4DV2F 4X84A 1SH0A 5L1IA 5LSLA 4R6TA 2ZELA 1C1BA 4A39A 4X62J 5KFPA 4ZBGA 2MLYA 3W2WA 4C8LA 1N5VA 4DR4J 1MROB 4QJVA 3EDRB 2KFYA 1OQ6A 1F2HA 4DV5J 3VVUA 1NJXA 5KFQA 2HFOA 1M44A 2KRBA 5F8NA 5LXYA 3KLGB 4R76A 2EWHA 2AFMA 4QIVA 4ECUA 4KOWA 3M4XA 2CQ3A 2VBYA 4HYKA 5E3AA 4E8OA 5EX3A 3NBPA 3VWSA 2FCKA 4P9SA 2FJXA 4A30A 4TY8B 4ONUA 1P9QC 4FP9A 4NLXA 2A3JA 1BUXA 5L8RC 4R3LA 1JKHB 4YRHA 2YNCA 3QFWA 2AGPA 4LSLB 4C8ZA 1U8SA 3QQCD 1U1RA 4QOTA 1PO6A 2R2RA 2JX2A 4LF6F 1S1UB 5HQMA 3EE3A 3BH7B 3CXPA 2JC0A 1CQMA 3US5A 3KLEA 2ZHBA 2IVYA 4KUAA 3R9FA 4LBIA 3GIMA 5LOQA 3UVJA 1ZLIA 1JX4A 2IPOB 3F73A 2DHAA 2PFDA 4WU2A 2VQEF 4RLEA 5K14B 4CGPA 2HNZA 4ED2A 4OI6A 4MMOA 4WF9Q 4PWUA 1R31A 1IBKJ 2CQPA 3GIJA 2J0SD 1AT1B 4M5DB 3KTQA 3JUWA 1MMLA 3NOCA 1GYTA 4RBVA 1ZA2B 2GVDB 1X4CA 3UI3A 1UP1A 1XERA 1ZA1B 3SXNA 2D69A 4E2AA 2Q6CA 1TU0B 1DTQA 1S9GA 3W2VA 4KH1B 2FE7A 2IIHA 5LYIA 3G87A 4RW6A 3CCLS 3MPYA 1RWWB 4I6WA 1RT6A 4O3QA 1EQ0A 3MMAA 2G9OA 4AVAA 4WKYA 2ZH9A 5E96A 5E0OA 4U96A 1SKWA 2LP4A 1CPXA 2EK1A 2UXDF 4CO3A 3HHDA 1DTTA 2CPIA 2A6OA 4DCOB 3PKMA 1FNXH 3FRYA 2FVQA 1YJTA 2CTBA 3ZZRA 3FMCA 4K0KF 3KUHA 6FD1A 3ZZIA 3AA8A 3GTYX 4ZN1A 5L39A 3R7BB 2CKWA 3ZTOA 2MDAA 1RTZA 2Z58B 3HVRA 3M6WA 1CC7A 3P5BP 1QSNA 1MN9A 3TJ8A 5F8IA 4DUZJ 2EK9A 2QIFA 4RI1A 1HQUB 4TY9A 2ZEHA 4GC6A 3PHEA 1YDLA 2FC8A 3QIPB 3I5AA 3H20A 4F2SA 3HVAA 4EWTA 4XPEA 2DKOB 4DR2F 3JSMB 3M8WA 2DPSA 4ZVUB 3OSNA 2DITA 2EBGA 1VQ4S 2I3CA 1ZG7A 1XJOA 1NZ8A 2KVIA 2PSWA 2FL4A 4ENOA 4GC7A 3M1VB 2CPHA 3CIZA 4DFKA 4K5SA 3CCJS 4X4NA 2CPDA 3R7NB 1IWGA 2CNLB 2HS4A 1VCTA 2F8EX 4P2XA 2BKOA 1JLAB 2AYEA 2WONA 4ZI6A 3W9HA 1CPZA 2HS3A 5DLGA 1FFGB 2CNKB 3C19A 5LJ3Y 3PB8X 1XMQJ 3GYNA 2CUYA 3PO4A 1AFIA 1RT4A 2VG6A 3LODA 4NWBA 4EBCA 2Q66A 2RSQA 3NGRA 3UN5A 4Q5VA 1B64A 3LP1B 1U2CA 2D41A 2AFWA 2J6TA 3TOQA 4G6VB 2DNNA 3MCNA 2UXCJ 2XNQA 4WKRA 4OZ0A 3QRRA 1QDUB 5HI7A 1CULA 4ED8A 1XIXA 3FSYA 1P27B 5LJ5Y 4ZYQA 1NKEA 1FWKA 1X10A 2DHGA 5IV4A 3NBPB 1FK9B 1VDHA 4MCRA 3AQOA 3MF5A 1AUDA 1H98A 5LXRA 3IEHA 5J8CA 4P6YA 3GKRA 4I2QA 4ELUA 4NASA 2KT5A 3OD2A 2C6GA 4C3LA 4IF5A 1B99A 4LR7A 1MJ9A 3BH6B 2W8KA 3SZ2A 2YKOA 1N36J 1VC0A 4ECYA 1HBMB 4UFXA 3MRUA 4DEZA 1Q7YT 1HI1A 3M2VA 5J1PA 4HI2A 3R1HA 2OPSB 4O3OA 1KWMA 3CC2S 2PMWA 1JXLA 1SUQA 4BD9A 4X62F 1RWUA 3D28A 2OI2A 2UU9F 3CDAA 4PZVA 1IKWB 3N28A 2LFVA 5DS0A 1R8AA 1TKXB 3ZTQA 2AJ4A 2CQIA 2LA6A 5M2RA 2ALZA 2CJYB 3G8WA 1S7HA 1ZPWX 4N8OA 1V3SA 2Y9HA 3CD5A 3DNSA 4J9SA 1C0UB 2EVNA 4MFQA 3UE2A 2DVIA 3MHYA 4RX6A 3M2RA 5HMXA 4U7UD 5CHCB 2W9BB 1WF1A 2AFUA 5E33A 4U9RA 4EU0A 3UFCX 2DO0A 4MHDA 3DU5A 2XWXA 2OZGA 3BEGB 1U47A 3ILLA 2J76E 4J9PA 1CJVA 4RKUC 1NH7A 4I7FA 1TKFA 5SUHA 2ZBRA 4NZ7A 3EMTA 4ZP7A 2VBQA 1BY9A 5ADZA 3DCAA 1LRZA 4AE5A 1HNZJ 4KS9A 2W9AA 4DV7J 3LD2A 2ZUGA 4M5KA 1JKHA 4JI5J 4OX7A 3KQZA 3M30A 3NG8A 4C8MA 1S1XA 3RBDA 2OPSA 4QU6A 3MCMA 4R7MA 2P6GA 3Q89A 4KGKA 3J7A1 4L89A 3TI0A 3HO1A 5DWMA 1VQOS 1TL1A 5I0CA 5KFLA 4WFYA 1LAPA 1S0MA 3PNIA 4L8AA 5AJ3J 4NXNJ 2MJUA 3CJ2A 2FVCA 4K2JA 2IMOA 1YK9A 3KJVA 2GX8A 3FZBA 4DL0C 2ADBA 2C42A 4KSAA 3TOBA 3ZZOA 4HT5A 3DYAA 2VJVA 4IH5A 4HEA9 1EE3P 4X66J 3M9MB 2IHR1 1Q16B 3VWDA 3JAMU 5E5NA 4A8KA 4IG0A 1K1SA 1ZTTA 2ZW6A 2QN6B 2Z57B 2V6AA 5AE1A 4CLUA 2QLFB 1B4SA 2V9WA 2ZW4A 1H7WA 1K8AT 3H4DA 4I56A 4N41A 3ITHB 1N8RT 1GTHA 3VZHA 1Q8IA 2QIRA 2HS0A 4IK2A 4UOGA 3THVA 1PBUA 3MUVP 1NJYA 4OYMA 4M1KA 1RU1A 5BWAB 5IQQA 5A6PA 3KK3A 4DS5A 1NSPA 2F5GA 4ICLA 2IAJB 3CJ3A 4MRIA 2B43A 1T9WA 1AZSB 2M52A 2JFKA 4UEEA 2PRQA 3AOBA 3MCSA 4BS2A 4L73A 1HBMA 2YNIB 4M94A 1S7FA 2CF4A 2E1AA 1NDLA 4KYZA 2ILYA 2AWZA 1CM0A 2ZEMA 1S97A 4A37A 1ELLP 4F0XA 2LMIA 3KNAA 3CD6S 2LQJA 4Q7AA 3G8SA 4KSEB 1REVB 4WK1A 1QSSA 3SI1A 4DQRA 2UVUA 2YY3A 5HL7Q 1CJUA 4KHPJ 1RHJB 2HHHF 4E0DA 2KZZA 4J9LA 3MM9A 2O53A 3H8EA 4OI3A 4NJRA 2G3AA 1LWEB 3LACA 3HKZD 4TU7A 1KQSR 2PR8A 1IY7A 4USWA 1NDKA 2FD2A 2HYIB 4C0BA 1U0HA 1UL3A 3VGVA 5KFDA 5F8GA 3S6HA 1W2IA 2I0XA 3B3CA 4V1Ak 1R6YA 3QJLA 2UUWA 4L3NA 2ABZA 2QECA 2KT2A 3OQ2A 3CUNA 4ZK7M 1GH8A 3EZOA 3FDSA 3TVYA 5HMZA 1IUJA 1C0TB 4Y34A 1CS4B 4B02A 2MLZA 3VAGA 4PWDB 2QYCA 1WOSA 4XPLA 4R9MA 4ZVRB 3FJUA 1L3VA 3UVJB 1XC9A 1NU4A 3R8YA 4LRFA 2YBVA 4ECZA 2VDHA 1MWZA 2YKQA 3DOKB 5EC4A 1XBUA 4F4WA 4JI4J 3T19A 3M1VA 3VAIA 1EB0A 1I1GA 4OIWA 2ODFA 1D3WA 3MM8A 1S9EB 1NBEB 2D3OR 2AEFA 2XBPA 4IFVB 1JLGB 4M5LA 1WOPA 4AVBA 3NCQA 2AYGA 4JI0F 1XE4A 4KOSA 2J6UA 4M8LA 4QIEA 1DLOA 5A8WB 1JLQA 3C15A 1RAGB 1GNKA 2RS8A 3CDUA 3SSRA 3NCRA 5KG2A 2Z3OA 1ACMB 1W25A 4JYWA 4X65J 1WD6A 1U1KA 2CJKA 5EWEA 3DYAB 2YWEA 2EBJA 3G8TA 1S6OA 2LA4A 3TZXA 3PEIA 3IWLA 3M8ZA 4KO0A 4JZ0A 4ERDA 1U49A 4C11A 4ER8A 4LT6A 1VIXA 1HD1A 3FFIA 2UXDJ 4OMEA 3M8YA 1RA7A 3D2WA 2OH1A 3TX0A 3BHXA 4K4SA 1R8PA 4ZA1A 5C24B 4NLOA 2EO8A 2ZH5A 3FX6A 2O5DA 4IFYB 3D6TB 2QL7B 3B54A 4QCLA 2RDDA 5L38A 3UDLA 3D2PA 1CP6A 1YQEA 2V5HG 2W2QP 1HHTP 4B3MF 5B0EA 1HR0J 1S60A 2HQYA 4HPSA 3FEXB 2OEJA 2N82B 3C14A 2KXHA 3CVKA 3IGNA 4X66F 1HNVA 4U67Q 3KHZA 3NS7B 4LSLA 1X4AA 3KLFB 1YX2A 4XTTA 4H4MA 4PV6A 5KT2A 2AYBA 1LNQA 4OZ2A 1QSMA 4OX9J 2RD5C 3H59A 3NCPA 1NJIT 1LQ9A 1O51A 1R0CB 1C4CA 1RHUB 3NOGA 2Z56B 4HI1A 5D15A 3H2LA 4Q44A 2ZWOA 1N6QB 3HF5A 4M5GA 2C2RA 2LDYA 2ZKUA 1S76D 4CQ1A 1KQGB 3SSSA 1B6BA 5HROA 4A4JA 1IYLA 4GKKJ 4LF6J 1SJ3P 1C0UA 1NHUA 3M6VA 4E2FB 3LH2S 4IG3B 3POTA 5LYDA 4AL6A 4H4KA 3KNGA 4K4YA 2JVRA 2PQ8A 3OUYB 4KOUA 3KOAA 5LM7E 5ETLA 1KQFB 2WVBA 3MMBA 1IB1E 1GMUA 1LCPA 1V5VA 1EZZB 3P5TL 5HK4A 1UJ4A 5IQ6A 4KGZB 4P2SA 2HUZA 1ZTWA 4I6YA 4ZJOA 5AE3A 3EY5A 4KFBB 1YGYA 3FSIA 4YFUA 3W8PA 3RUBL 5SZTA 3WC7A 1I5OB 2B5JA 3V5RA 3ET6B 4TN2A 3T1HJ 3O44A 4F50A 1DZ5A 3QNWB 4URSA 1IKWA 1A0OB 5E3QA 3FXTA 3KK2A 2ALYB 2Q44A 1YBUA 2PJBA 4H4OB 3M8QA 2VQEJ 4Z7CA 1FKPB 1RBLA 2ZEFA 5JGFA 2LECA 5HROB 1HA1A 3R1KA 4LSNA 5DDPC 2D9OA 4Z7YA 2IYIA 2DNHA 2E5LF 4IRKA 3D3SA 1VHFA 3EVMA 4J37A 1RT5A 2B9EA 5I3QA 5AXMA 1M5VC 1IWAA 3PW7A 2BJDA 1HHSA 3WZ0A 3UR0A 2XWYA 5DG8A 4JJXA 3OR1B 4FZVA 2BOAA 4XDCA 1QAXA 1S10A 2GGPB 2IC3A 3OFEA 1VRQC 6FDRA 4OYXA 2ILZA 3D54A 1RT2A 4NI2B 4IHMA 3BQ1A 1UA1A 1BQNA 5FLXY 1T9YA 2G2OA 4ETXA 3LP0B 1S72S 4HACB 1UPMB 2LU2A 1JWQA 3TEHB 1N5QA 3F0NA 4W4MA 3EC4A 4LRDA 4GVBA 3MMBB 3R6LB 4OYZA 3PY8A 2FHKA 2VG6B 1VOMA 3OXFA 2BL1A 4BLGA 4NA2A 4ZS6A 5ETNA 2HHPA 2HIYA 4LFBJ 2NSBA 5HJXA 1N34J 2DCLA 2YNHA 1Z8XA 2C3UA 2AIRB 1WEYA 4F3QA 3H2UB 3OL8A 3CMES 2ZH6A 4GKJJ 2YKMA 4X4UA 4K3NA 3LPEA 4ZY0A 3ISND 1PCAA 2P9GA 4JV2A 1TUVA 1SUQB 3BN7A 4B3OB 4Y00A 4BWMA 1JLCA 4F0MA 2RF2B 4C2YA 5KT4A 2MKIA 1RAOA 3F44A 1HWUA 3KK1A 2APOA 3PEHA 3IG1B 4H6ZA 2B7CB 3M8SA 4LF5F 3WC0A 1SC3B 3W62A 3LGHA 2UXCF 4RO0A 3BDEA 3HLUA 4WCEQ 2ZHOA 4QQBA 5H9EK 1QD1A 1F1BB 4FWUA 5IX3A 3D1OA 4PXEA 5KAKA 4OYAA 1IKYB 1NO8A 1UFKA 2EFQA 2VJUA 1EKRA 3IG1A 1ZZNA 5FJ4A 3CZXA 1QAIA 3MEDA 4CGLA 2OGUA 3QT7A 4UCNA 1JXVA 1NJWA 2OOTA 2GNKA 1L3SA 2PJ4A 3FCVA 3C6TA 3HI9A 4USTA 4B3TF 2PJ0A 3H98A 2GIQA 5DDRC 3E51A 5EMIA 3UCZP 1NH8A 4QR0A 2M4MA 1S0NA 3RBZA 3H5XA 4CLKA 3MM6B 3Q0AA 2YNHB 2QRRA 2AFXA 4KB7A 4NEXA 1W2BR 4I49A 4KOYA 1HNWJ 4KUBA 1E6YA 4Y2AA 3GV8B 5DJBA 3M05A 4IUSA 5DETA 2C2ZB 4N76A 5H9FK 1VK3A 1FKOB 1AMPA 3LWMA 3H90A 2OEKA 1VGYA 1N34F 3TCVA 2OO4A 2RQKA 1FJ7A 1XRYA 1LOKA 1Q7LB 1WOOA 1Q5YA 4GKJF 4ZVEA 4Q45A 3PZJA 4DPTA 3NGKA 2MSTA 4C2ZA 4ZP9A 2NQPA 1RHMB 2DGTA 4OIDA 4NXMJ 1IBKF 2F5IA 3E2EA 1B70B 3H0PA 1OSDA 1FDAA 1DQAA 5L1KA 3V7ZA 1GMWD 3NNCA 4DSIA 1L0CA 2JLEA 1T3OA 3N79A 4DV3J 5CYQB 1RU2A 4NOHA 5HQ8A 2I6WA 2OKQA 3GLJA 5I3UB 3DRRB 2VV5A 2DGOA 4H89A 1HNZF 2B4OA 1TKZB 4DLGA 4XPCA 4DBQA 3CULA 1HNXF 4X4VA 2OD4A 4CAEA 3MZIA 2HNDB 2PT0A 4DF4A 3Q8QB 1PILA 5GADI 3Q23A 4ZVTB 2V2ZA 1Q53A 1WHVA 3FQLA 4KOVA 3DLBA 1PKUA 2JL9A 2RMLA 2BX6A 3FEZA 4X2TA 4DV6F 5E2QA 2V4JB 4OZJA 2F1FA 2FIWA 3LA0A 4KY3A 3EWGA 1NUEA 4YB5A 1WG5A 2W7AA 1BWVA 3DOMB 2P9CA 2RF2A 3TQEA 3JRUA 1NNDA 3CJ4A 3DR8A 3CB4A 4A32A 4NLWA 2AX1A 4UFVA 3BF4A 1SI9A 3BS9A 1WKKA 3BBCA 4OC5A 4ALZA 4PKDB 3LO3A 4DHVA 2KJVA 1P1TA 2OR4A 1NZAA 3QAUA 2VD3A 2ASDA 4Y2IA 6AT1B 3S9NA 2PJ1A 3JB9k 4AG7A 1FA0A 2YKNA 3BJYA 4ZJLA 3MCOA 3VGSA 4XNHC 3CJQA 3TUZC 3PZPA 4B3SJ 4CH1A 4CT9A 1OQ3A 4EO6A 3DFEA 2AQ4A 3KLIA 1TVRA 2QE5A 2VC0A 3BDPA 2ZHAA 3BKTA 4YS2A 3TAMB 3O1LA 1SVDA 4NYPA 1VQ5S 2NCKL 5F3TA 1NK5A 4MHYA 8AT1B 1VLOA 4YY3J 4LBPA 3GIIA 4OAEA 3KXDA 3IGRA 1RT7B 1FF2A 2OMLA 3PR5B 3OLBA 5BXIA 1V3ZA 4B14A 3FYNA 3RBXA 3F5BA 3RR8A 5GAEU 4DNCA 3I6PA 2E44A 3TVKA 4JOUA 2B4DA 3PBBA 2G0BA 4WP3A 1UJ5A 2AJ6A 1RWXB 2R8JA 2C1CA 4FS1A 4KE5A 4ZLPA 2JEFA 4OQJA 2RDJA 5JMNA 4M6IA 1BLLE 1H7XA 1FNMA 2GFFA 3OTOF 5KTAA 3THPA 2V2QA 2X7IA 2PI5A 1S57A 3Q8PB 3DLKB 1M5PC 2QG9B 3Q8SB 3BGFA 5HVGA 1LK5A 3FQKA 2B8QA 2LXFA 2YWHA 4R25A 2PEBA 4C98A 4CYQA 1EP4A 3MEGB 3PRVA 4OX6A 2IL4A 4DG1B 1JJ2R 1TTHB 1MU2B 3UN2A 1VC6A 4YWYA 2Z3NA 1QSYA 2FJEB 3W9JA 3GJRB 1S9EA 5H1SV 3KLIB 1S3ZA 2BW7A 2MZ1A 2BJ9A 2WOMB 3IR6B 4X64J 1SIZA 4O3RA 3SDEA 3BPSP 4USKA 3EVOA 3HCXA 3AB2B 2CJXB 5DS7A 5J1QA 5MAOA 2D3O1 4DPWA 2M0GB 3W5XA 4ED4A 4MFZA 2HFNA 4L3KA 4ZHRB 4UUXA 2B5GB 5ETQA 4RWWA 1D9DA 2DR9A 2CG4A 1BMQB 4M5IA 2NZCA 2R2TA 1BE4A 1IXKA 1PAUB 1KUXA 3SHPA 1R57A 3ISZA 5EBVA 5J2NA 3TX8A 4WP8A 1Y7PA 4M63A 2R1IA 2CNMA 4HR2A 5EHHA 5ELYA 2XO6A 1Q8LA 1FRJA 2VG7B 3JSYA 2MGZA 3R5GA 2RRAA 3GCXP 1PSDA 3T90A 1HBNB 3GSDA 1UEKA 2NYQA 1GXLA 2DPJA 1RXTA 3MEKA 2FJVA 4Q2MA 5CYQA 1HNXJ 3U1NA 4FNIA 2LEAA 3EUNA 4WFXA 2HNDA 1FXRA 2Y0MA 2F65A 4A8XA 1ELMP 2KHCA 3JQMA 4F8RA 4C11B 4OZNA 4DV3F 4OHXA 2IBKA 3MEDB 3LP1A 1YMEA 3H2VE 2ZJPQ 5J2MA 3R1LA 4LVNP 3MR3A 1RTHB 3JTKA 4OJ3A 2G0IA 1X7VA 3L3CA 1JLQB 3CD7A 3RB0A 1UFHA 4DQSA 5CNPA 4WK3A 4Q38A 1B0TA 5I42B 1R0AA 3I9V9 5AG5A 4DR7F 2HFVA 4R0EA 5F0UA 4ZPCA 3V81A 2E5GA 4JLYA 1BLUA 2BUEA 1DAXA 3OV7A 5D4NA 2R4FA 2RUGA 4P4IA 4KOXA 4RBTA 4ZJQA 1BC6A 2Q1LA 5I42A 3MMJA 2AFOA 2GJIA 1N0VC 4NLTA 4MFKA 2WW4A 4EZ6A 2E1PA 5C2GA 2IA0A 2HQCA 5GCNA 3FBFA 4NEYA 3TT2A 4NGPA 2DHXA 4PEOA 2MLXA 2V8GA 1ZETA 4FD7A 3V8IA 4EFDA 1EARA 1Z8LA 1N5TA 2DY1A 4RUBA 2ZD1B 2W7OA 1UMJA 4ED0A 1YWXA 5H86A 1OIAA 1SC1B 2VODA 3MI7X 2ZVIA 3BI1A 3QO9A 2ROGA 2K3IA 2XMVA 2PJ9A 1EJ7L 2GO8A 2P6TA 1FWLA 4F4XA 5A8RA 3OR2A 4YP3A 3AODA 5B08A 3B3VA 1Q0NA 1REVA 3DU6A 2W8LA 5HXDA 2XM3A 4QIGA 1Y11A 4NZ0A 2BQRA 2FJWA 1QJHA 2JEIA 4NGRA 5IWAF 4FXVA 2DRAA 4WTYA 3RRHA 3FECA 2PJ2A 4KIAA 4OYIA 1FFSB 2YTCA 2M88A 4O44A 2PC6A 4U9ZA 2HRYA 2CG8A 1GMVA 3I0SB 2CZ9A 1NPRA 3MFHA 2RJZA 3RZAA 5F8JA 2W4PA 3RYOA 2M5YA 4ICLB 3ICLA 2IC3B 3CSKA 1FJGJ 1K73T 4QYZK 3GSIA 2XULA 3IR7B 4O0IA 1BOBA 3QAEA 3PW0A 5KG0A 2F4FA 2HSEB 4LUBA 4A8QA 1WELA 3M6XA 2UUTA 4JV5F 4S0MA 5AJ3F 3GR0A 4KH0B 1ROFA 4LFCF 4RW8B 1PYSB 3GE9A 3ZZPA 2DNKA 1Z4UA 1BXNA 1YJVA 3DKDA 1SIWB 2FTRA 1TL3A 4OJ1A 1HDUA 2HQFA 1MU2A 1LKZA 1RAJA 2FVGA 2PN6A 5IXUA 5A2QY 4YQWA 3NGSA 2FT0A 3POTB 1O0PA 5DZ7A 1C1BB 2DCUB 3S9MA 4IDKB 1FTCA 1HKAA 3B4DA 4Y3CA 2UXBJ 2QSWA 4NLUA 5F3ZA 5IT9Y 4LSNB 3VGTA 1VQPS 2AE6A 3D6MB 5KTCA 4RU9A 2RU9A 4MYTA 4R5PB 4JYAJ 2BO9A 3MXHP 2G3TA 1RI7A 5D6GA 1A2ZA 3FEEA 2HHXA 4ZX8A 4A48A 3FBCA 4J3GA 1Q2DA 1XQIA 2VOOA 3E01A 3CO0P 1SCJB 1M4IA 3G9CA 2CQ1A 3OR1A 2WSEC 4FYYB 4L75A 4Q0BB 1TUWA 2AX0A 1TMJA 4FNHA 2C3OA 2R8VA 4WFNQ 2ZWPA 2LVWA 1UJ6A 3NEKA 3PB6X 5IM0B 3G71S 3WBZA 3P49B 3WX8A 2R7RA 1GEHA 1XJWB 1IJFB 4BDPA 1P0HA 1WEXA 2CJBA 2QJ3A 3O6QA 1M1DA 5K14A 3WX4A 2DT9A 1LANA 3J81Y 2Q04A 5KFUA 1CBKA 5HJYA 3OBIA 3M30B 4CYUA 5JVHQ 3ZTSA 3ET6A 2E7VA 1T05A 3ONQA 1WEZA 1PG5B 3HHEA 2YPYA 3ISNC 4I7FB 5U47A 5LL6d 3H8FA 4DPXA 3PRDA 1N36F 3BREA 3HVTB 2EK8A 2WONB 1I3OB 3IRXA 4KVXA 3K5NA 1RWVB 3KI9A 3LP2B 2PDAA 4M5HA 5KFIA 1VJWA 3KHRA 2HK2A 3MTKA 2UU9J 1FFWB 2PD1A 2UP1A 4CLZA 3FC9A 2VFUA 4DJLA 1UVLA 2B4PA 4OYBA 5THWA 1HMVA 5GADU 4UY8T 2VI7A 2NLWA 2FDNA 5IT9U 4CTAB 4HTIA 4DL6A 3HFKA 4DPYA 2UZAA 3CXCR 3UPFA 4P7VA 3FZ2A 1X5PA 2Z3PA 3RB6A 3DHXA 1FD2A 4XO0A 4EYIB 3UWTA 2CNSA 2UUCJ 1KNZA 1N54B 4JI7J 3PFEA 3HJVA 3IJ3A 4LF7J 2FLLA 3A3OB 3HFZB 2J9DA 2HGNA 4F0YA 1FT7A 1H8LA 1VHSA 2C3MA 2JSXA 4OLOA 1MSWD 1DARA 3H7HB 2R8HA 1Y0YA 2XYGB 4WWSA 4WFAQ 4K7QA 3LW5C 5B0FA 4OIXA 1X31C 2MKCA 4M5NA 2BKNA 1OZPA 2HIQA 1N33F 1H3DA 4A31A 1UW9A 3N5BA 2PVVA 2LCWA 4NXMF 2FC9A 3OTOJ 3G86A 3EZUA 2QA1A 4MKYA 1WUUA 4GM5A 4DR1F 2VXKA 1YZ7A 4R8UA 1NMEB 4LF8J 4BC7A 1RBAA 2A0FB 4Y2MA 1HW8A 1UFLA 1GTEA 2FIUA 3MAAA 3CCVS 3QT5A 2WK4A 3CJ8A 4CGNA 1Y9KA 3P8BB 3T1YJ 4XNHB 1R6VA 4K4TA 1Z9UA 5KFCA 4LF9F 5F46A 3CDBA 2HHWA 4ZX9A 3Q8VA 4C3MA 1RLDA 1FJGF 4TYAA 3VAJA 1K9MT 1KSPA 2AT1B 3HT0A 3N01A 2XMWA 4P4FA 3LOUA 3KMSA 1LWEA 2V34A 2CJAA 2VFTA 4EUVA 2EI5A 4A33A 5HH1A 3SQGB 1K47A 2I5JA 1IBLJ 3ZO7A 4OP4A 2FS5A 4PXBA 3WDOA 2E1CA 2ABYA 5JVGQ 1C0TA 5F0WA 4OL8A 3LANA 3D2MA 3CCQS 5C42A 2GV1A 1SKSA 1BPNA 1FERA 4UQGA 4ORFA 4U8VA 3KYLA 5GAEI 4G1PA 4MTPA 4IR9A 2YGWA 1RAEB 3V4MA 1J5EJ 2B6AA 5ETTA 3KLVA 5JJBA 5CA5A 4KV8B 2EG2A 4PYAA 4UA3A 5G4DA 1HQEB 2H54B 4NA3A 5DGBA 2P6FA 5K8MA 4FD6A 4J9KA 3MM9B 2E66A 4ZVPB 5C2CA 3QYYA 1CP7A 3SIPB 2KXNB 3CC7S 4ED7A 1NHKL 1S99A 2HVZA 3MEEB 3OTDA 2HAIA 4CP5A 5AG4A 3Q24A 1WI8A 4ZCMA 2DB1A 1A9NB 2VG5B 2BJ8A 4YHHJ 3KUEA 2V4QA 1N4LA 1DTQB 2XI2A 1FRHA 3GJQB 4JI2J 5GAHI 1TKDA 1X4EA 2DF5A 3I87A 4PUOA 5CZXA 2Q7SA 3MGDA 4RBUA 3T1YF 3W9IA 2PA8D 2AF6A 4PSWA 2MYFA 1M0SA 4JP8A 2XYPB 4CLLA 3AJ2A 3L95X 4PQUA 2HBZB 1RQ0A 3DR6A 2X3GA 5IS2A 4G1QB 1ZAVA 4UQTA 1ON0A 1OY6A 4PABA 4A8SA 2CZ4A 3H5ZA 4GMKA 3TJ9A 2HQ3A 1Q79A 4N5SA 2VFSA 3S6KA 2VU5A 4LSZB 1YTYA 3KLHB 1S6PB 1T05B 4TYBA 1S7KA 1NPPA 4HTJA 2ZJRQ 3EO4A 4MK9A 1S5ZA 1T8EA 2ZZTA 3KDOA 1WNEA 4YEAA 2FGOA 1ZLHA 5KG5A 3UQSA 2WTFA 2XLJA 3U02A 4NL5A 5CYMB 4WIIA 3VGUA 2ZEOA 5HO4A 1HI0P 2VQFF 4O3NA 2YNFB 2AFSA 2QLJB 1EKSA 4QR2A 4Y49C 3G6VA 1YJ7A 3H4BA 1RT3B 2JLFA 3BZQA 3OW2R 4ILRA 1HR0F 3B3TA 1BGXT 2POKA 4LF7F 1ZM2A 2GS8A 4K5RA 2D7SA 4DR5F 1JNZB 1T9UA 8RUCA 4P73A 4KFBA 1RTIA 5HANA 1IKXA 1Y7EA 5J1EB 4BINA 3G3SA 2JWNA 2YQ3A 4FPRA 3J81U 2R98A 3CEDA 3ENWA 1FT8A 3DC2A 2XGPA 1T9VA 3OVBA 2J8SA 4PAAA 4H54A 1UVJA 1S49A 1YJUA 3KL9A 1RCXB 2HV2A 3K5OA 2UXBF 4NGMA 3DLHA 2AZ1A 2PVWA 2FZCB 1E6VA 4RJVA 4CLYA 4LQGA 4RUAA 4PCQA 2CQ4A 3W60A 3IM9A 3V4IA 4HHHA 4XDDA 2ROPA 3UW1A 4QIFA 1M90T 2VUGA 3IIBA 2AJ2A 4DN0A 4U7CA 4ONWA 1G6BA 2ZW7A 4NRTA 2KT3A 4CYOA 3E01B 3G96A 2ZDOA 4YDDB 4GRSA 1UVIA 3NY0A 1TIQA 3CWJA 4KOTA 2ASYA 3PDNA 1WWHA 1NDCA 2GGPA 2YPZA 4EBEA 2JBKA 4OJHA 4JI1J 2AJQA 2PMZD 4A94A 2A4NA 2Z30B 3J81j 4HDHA 4AQYF 2LQ5A 3V6DA 4CGOA 1MN7A 3U1MA 3T1HF 3QZ8A 4OYOA 4Q2LA 4NEZA 2GFQA 2CJQA 4P2FA 4OHZA 3OSPA 3MURP 1IBLF 4LF4J 5KT6A 3DGPB 4BC9A 1NSKL 1M5SA 4DWIA 4DFJA 2NPFA 2XEJA 4CNYA 4FD4A 4WIQA 2PRBA 2F4VF 5KFFA 1YX0A 3GJSB 3D5MA 1QSOA 1RXOB 3QLHA 4XAKA 4YR3A 1T03B 2MQPA 3HSDA 2F9JA 1WK4A 1GX6A 4DV4F 5CH7B 3NMRA 2MQNA 3PX4A 1RWMB 2OSQA 4MK8A 4K2XA 4WU3A 2LLZA 4JI1F 3J7YU 2CXEA 2OEMA 1EIYB 1S6QA 3C15B 2BDPA 1X9SA 2GZOA 3BJ7A 2MXYA 1XMOJ 3W6SA 3HZEA 3TNVA 4BBYA 2ZD1A 3T9ZA 3AD9C 1SQHA 2UUBJ 2JLGA 4LIWA 3DSBA 2B9WA 2Q6BA 3QJJA 1Y7RA 3RR7A 4CWBA 1WORA 4IG3A 4F36A 2R8KA 5A8WA 4FN5A 4ZPVR 1H72C 1F9FA 1RP5A 2CDQA 4LVOP 3MM6A 4TVAB 2V8HA 1XMBA 3R2DJ 1RTDB 5J2QB 1R0AB 4LFAF 2RUSA 1KVJA 3VARA 1SC6A 3IC1A 2HLUA 1HDQA 1YRTA 2H9ZA 5J2PA 3GV7B 1RBOB 1QAJA 1H0HB 4P6QA 1QY7A 1XNQF 4ECQA 5KFSA 4IO9Q 3N5FA 1FJCA 2NMTA 3CPXA 3K7RA 2GJ2A 5F8LA 1FX2A 3B8HA 2FVRA 2Z2MA 3R95A 2L9NA 4USVA 3IBFB 1TK8A 2QX0A 3HDSA 4GO5X 2ZH3A 4BHQA 2BACA 2HQIA 1REGX 2I38A 4UOHA 2YH1A 1KBRA 1MK4A 1TQLA 4Y28C 1U1OA 2F63A 2V94A 4ELVA 1B7YB 2OH2A 3PW5A 3O8WA 2WRMA 2PIYA 1NSLA 2CYYA 2QA4S 5G20A 4N47A 3IFEA 4DUTA 2HHTA 4NFRA 1Q95G 3ZZYA 5ISVA 2PIIA 3FRMA 2EVZA 4OI2A 2OUGA 2B7BB 2REFA 3MAQA 3GFHA 2RH3A 1XMOF 2XEIA 1RSCA 2CNNB 1WTFA 2P9EA 2AZ3A 3KG4A 4DV0J 3OFHA 2BQ3A 2QGFB 3MM5B 2KKHA 1UEVA 1NJZA 3M7VA 2R8IA 4NCGA 1IQZA 3CDXA 2KU7A 2ZH7A 3NAIA 3TOAA 3CJKA 2IJNA 3TUJC 2XI3A 4NCZA 4F4KA 2MEWA 3GYXB 2QT7A 5B09A 4WWVA 4ZCLA 2HFUA 1YHQS 1WACA 5HLFB 2OFHX 4ANEA 3R2CJ 2XB2D 4MHPA 2VA3A 4LFAJ 4P4EA 4X3RA 1RT6B 2DH8A 3SMZA 4UZCA 4FVCA 1S77D 2P8IA 2F40A 5FD1A 3W91A 4NCAA 2HNZB 3B6BA 2DR5A 4IG0B 3NS6A 4FD5A 1U09A 5DRKA 1WC1A 2R3VA 3AJ1A 3H8GA 4CI0B 1RCOB 3MMCA 4W9YA 2DH7A 1ZM4A 3Q86A 4MFBB 2VFRA 1YJ9S 4HACA 4PG8A 1BQMA 3B35A 5A28A 5J2NB 3H5UA 1JMTA 3DHWC 2B51A 2XSJB 2IM1A 3UCUP 2E29A 4NE9C 1I94F 5CCMA 3IRXB 3CCRS 1OWXA 2R7QA 2ACMA 2OPQB 3SXLA 4OJGA 2YXLA 2CPYA 3ELHA 4KZTA 3R5CA 3VATA 2ZC4A 2OPRB 2Z3MA 1U2FA 4QWBA 1WSRA 2E5LJ 4FKXA 4OV1A 1LAMA 1YW6A 4OADA 4ID5B 4ES1A 2E9RX 1AUGA 4R8UB 1RT2B 3GWCA 5D77A 4LRAA 5G22A 5CZVA 3A8JA 2XTJP 3HVWA 2LKZA 2FXFA 1TL5A 4RPFA 2HWHA 1X5SA 1IBMF 2GMLA 2WBRA 1JXEA 2B9XA 3G82A 1FRMA 4ECXA 1QUPA 1BPMA 1I21A 4DV1F 4OI4A 3CJTA 2BJ7A 1VQNS 4YUDA 2BE7D 3H8YA 4MK7A 4FKYA 2DR6A 4ECSA 3RYLA 4AL5A 4X2BA 2VC1A 3BBFA 2XHWA 1YIJS 1NM2A 3A13A 3WC6A 2W24A 1UWBA 4LFBF 5IZHA 2RIJA 2GHWA 4KPCA 4OC3A 1UZHA 3R96A 1YVOA 1NAQA 4RW7A 2GLJA 4MBUA 3DLEA 4LQ3A 1Y0HA 2XSJA 5DG7A 3HHLC 4ZLJA 2QYVA 2R7OA 1UCNA 1GXTA 4MH8A 5F8MA 1T9XA 2C2MB 4N77A 5C5JA 3FB3A 2BW2A 3MEGA 4KTQA 3MAHA 1RE1B 1JWWA 1VRTB 4IH6A 4RU2A 8ATCB 2X1GA 4PXDA 2CQ2A 1LWXA 3Q8YA 1MLAA 4DR3J 4ZCKA 4IDKA 4MFBA 3SI0A 2ANPA 1FNOA 4CAWA 1J5OA 3MM7B 3M8PA 1GQEA 2J9AA 3VWEA 3DDKA 4OHYA 5KFOA 4K4ZA 5KFAA 2VONA 3SFGA 3AQPA 4X8IA 1DQ9A 1HFEL 1SBRA 4OI1A 2BOPA 5AG7A 4J9QA 1VQYA 5HBMB 2H51B 5H84A 2MTLA 4QWDA 4TLQA 4TNUA 5B0AA 4B9NA 2CDRB 3EX7B 2RRNA 1AA1B 1X0PA 4JI5F 3K5PA 3PKYA 1D8YA 5I3PA 4F9UA 5AXLA 1NB7A 1KHWA 4YMEA 2YKNB 3JSBA 3R9LA 1M1HA 1HNIB 4EFAC 4O44B 1JB0C 2FY8A 4ZOSA 2HFZA 1ULRA 2X7BA 2MZSA 2GIFA 2BXJA 1YLXA 2L9WA 1VBYA 2KI2A 3GV5B 1VLYA 3KG0A 2XEGA 3CTRA 3KGQA 2NYIA 3QPIA 4J9OA 1DHMA 5LSRA 5D0EA 5KFEA 1IOFA 2AHOB 3ZC4A 3K57A 2I5JB 3ILIA 2GCFA 4KKOB 2NR0A 2QO3A 7FDRA 2IFXA 4FF2A 2Q4VA 4LREA 2HNYA 4ELTA 4OI0A 4DV0F 2EFGA 4H2KA 1Q7LA 3C3LA 3MOJB 3DMJB 2RC4A 4OZ5A 1VIOA 3R5AA 3NL0A 2WCXA 2E5HA 5C82A 2KH9A 3D7SB 4DR4F 2OZUA 4C8KA 1P8GA 2OMOA 2BE2B 4DZ6A 1ZAWA 3AY0A 4EO8A 1OJ4A 3T5KA 4MT1A 4B9MA 5BYRA 5KFGA 2VHGA 2K3KA 2VICA 4UIAA 5JH9A 1OSCA 3DRRA 3M2RB 2B4BA 4CAVA 3JXOA 4YB7A 2GA7A 3W65A 2XCAA 2YVSA 4CO0A 3TZZA 5AG6A 2JEGA 1KOHA 9RUBA 2YQ1A 1TZ0A 3BXMA 3IO1A 2HZVA 3ZNJ1 2MSSA 4TU8A 1U1NA 2MQLA 4F7VA 5ITHA 1LXJA 3OTCA 4EMEA 1CJUB 1U0SA 5H9EJ 4KHRA 5A0YA 3D67A 2HMIB 2EFPA 3MM8B 3A8EA 5JUMA 1KVIA 2CPXA 2RT3A 2GMJA 1EHWA 2FLNA 2M70A 1Q82T 2XSFA 3SSQA 3DRPA 2AP6A 1WC5A 5D4OA 5T7LA 1N33J 1RLCL 3T9NA 2RVJA 1IKVB 1UTAA 3KMQA 1Z4EA 1MG7A 4FXDA 4TKTA 1TR0A 3GILA 2ATRA 3AD7C 3MECB 2XZWA 1NDPA 3DOLB 3MUMP 1RYRA 4X64F 4B3MJ 2YNIA 3DMJA 3QGGA 5KFMA 4KHMA 1HWJA 3Q2SC 5K20B 4E98A 3MUTP 2H5EA 1E6YB 3HK2A 4BCAA 4X4RA 4HLBA 1H2VZ 2VOPA 1S9GB 5ETRA 4MCPA 1ZS6A 1KP6A 2UUAJ 2RU3A 4YFJA 3SCJE 3KJVB 3NNAA 1R27B 1TKTA 1ZAXA 1P6TA 1CSJA 2VZYA 2FUG9 2JDJA 4CLFA 4RW6B 2GVDA 4O3SA 3QZ7A 2PFFB 3DDIA 2UUBF 4K4WA 1Q81T 4PXCA 1NK8A 2H5IB 4RZRA 2OAUA 2KCWA 2DXEA 1KS2A 2L48A 4FXWA 2RHSB 2R7HA 3NNHA 2VZZA 3IAM9 2HHSA 4HNXB 2B6AB 4J9RA 2XZTB 2W25A 3SI8A 4USUA 2ZVSA 3DRPB 4B12A 5DGAA 2QFJA 2HPUA 3FBBA 3FUYA 3I4HX 2HMIA 1TK5A 3DRXA 2HHUA 5KOXA 3WHIA 2E5IA 2C3PA 4L72B 1X4HA 4UUWA 1Y00A 1WDDA 3V4IB 4DL3A 3MWBA 3LWUA 4NLYA