3ISZA

Crystal structure of mono-zinc form of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
376
structure length
369
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 122
structure length 369
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iszA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iszA01
2AFXA 2JBKA 4MHYA 2ZEPA 1LAPA 3RAMA 2ZEEA 2PCUA 4JZ0A 4B6ZA 2ANPA 4NFRA 1YMEA 3PB4X 2EWBA 3K9TA 4A38A 4R76A 2ZEHA 1KWMA 2AFMA 4NGMA 2RB7A 4IHMA 1Z5RA 4F8ZA 5DS0A 1HEEA 1CPXA 1ARMA 1TF8A 3KGQA 7CPAA 3S9LA 1AYEA 4DJLA 2F7VA 4AXVA 1FT7A 4ZY1A 2PJAA 3FX6A 3KQXA 1ZLIA 1LCPA 3FJUA 3PBEA 1YSJA 3IJ3A 4P4FA 2PE3A 1ELMP 2PVVA 4OC3A 1CPSA 3IO1A 3PFOA 2WZNA 4LQGA 5LRJA 3SJGA 2V8HA 2CIJA 2C6GA 2C1CA 4ZY2A 4OMEA 2PJ5A 4UEZA 3IIBA 2PJ7A 4MCRA 1Y0RA 2ZOGA 5JGFA 3DLJA 1NSAA 2PJ2A 3WT4A 5I4MA 2GREA 5LYLA 3FVLA 3ISXA 5JM6A 4NGQA 4UEEA 2C6CA 2PRQA 4FAIA 4UIBA 4K3NA 2HC9A 4F9VA 3LMSA 1VGYA 3VH9A 2JBJA 1ARLA 4JYWA 4NGRA 1ZG7A 2POKA 2I3CA 3V38A 1VHEA 5IB9A 4IK2A 3H8FA 3D7DA 1BPNA 3MN8A 3FECA 2ZEOA 3SI1A 3HLPA 2BCOA 2NYQA 1XRYA 3WABA 3KZWA 2O4HA 3SI2A 1CP7A 1M4LA 2ZEDA 1R43A 1LANA 3CT9A 3BHXA 1FNOA 4NGSA 8CPAA 5D29A 4MHNA 2O53A 2PJ3A 4MHZA 2V8GA 2G9DA 2EK8A 3B3VA 4MCSA 1EE3P 4A94A 4FBEA 4X3RA 5HVFA 1BAVA 3FMCA 1HDQA 2FVGA 2IMOA 2HB6A 4ZYQA 4MXUA 3KHZA 2OR4A 3WC6A 3PFEA 4PXBA 1YW4A 5D8NA 3B7IA 4DUKA 2DEAA 3TX8A 2ZEFA 3SJFA 3KR4A 5CBMA 3RZAA 4ONWA 4IAVA 1CX8A 4WJBA 3K2KA 2GLJA 3NH5A 2AFUA 2F8HA 1ZG8A 1CP6A 1ELLP 4NGPA 1DTDA 2GU2A 3NA6A 3FEEA 4MMOA 4OIWA 3JRUA 4ZY0A 1Q7LA 2PJ6A 4OIDA 1XFOA 3S9MA 2XEJA 4F9UA 5JH9A 3CPAA 4PQAA 4ZI6A 2PJBA 4G1PA 5LRKA 5K8OA 1Z8LA 5LYDA 2C6PA 1BPMA 4P44A 2NSMA 4P4IA 3D7FA 1Y7EA 2Q43A 2PJ0A 3KASA 3LWUA 1VIXA 3NH4A 4X2TA 6CPAA 4UIAA 3SJEA 2QJ8A 3L2NA 2ABZA 2BOAA 1LAMA 3B3TA 4OC4A 3FF3A 5CPAA 4R8FA 3SJXA 1GYTA 1TXRA 1HDUA 3KQZA 4WWVA 4MCPA 3GLJA 3QNVA 3HUVA 3WC5A 5HVHA 3D67A 2AFZA 3D4UA 4P45A 4EWTA 3IEHA 2ZEGA 3BXMA 4PXEA 4OC0A 4TNUA 1F2PA 3B2YA 5J1QA 3KL9A 3ISZA 1F57A 4A37A 1XJOA 1PCAA 4OC5A 4P4BA 2IJZA 1YLOA 4ZX8A 3V7ZA 1QQ9A 1XMBA 4PXCA 4FUUA 5ELYA 2CTCA 4EMEA 2RFHA 1F2OA 2QYVA 3PB9X 4P4DA 4OKOA 2CTBA 5K8PA 3D68A 2AFWA 2CF4A 4MCQA 5LYIA 4NJRA 3NFZA 4MHPA 1OBRA 1ZG9A 2V77A 5HXDA 3D7HA 3WC7A 1LFWA 4YU9A 4Z65A 1YW6A 1ZLHA 4Q7AA 1AMPA 4P4JA 3IC1A 1XBUA 1VHOA 2V8VA 4FWUA 4P4EA 3TC8A 2GLFA 3FEDA 4PXDA 3PB8X 4UEFA 3I1UA 3IFEA 5HVGA 1H8LA 4RUHA 3CPXA 5K8NA 1TKJA 2PIYA 4OC2A 3GB0A 2WYRA 4X8IA 2AFSA 2IQ6A 2XEIA 3RBUA 3KR5A 5LRGA 3BI1A 4MRIA 4A39A 2QVPA 3N5FA 4CPAA 2OOTA 3H8GA 2Q51A 1IY7A 3PEIA 3BI0A 3IWWA 1UWYA 3H8EA 1TF9A 3DGVA 3D7GA 2JEWA 2PIZA 4OC1A 4GM5A 1PYTB 4UF4A 2ZEMA 1TKFA 3PRTA 1CBXA 3SI0A 3PB7X 5F09A 1RTQA 4PPZA 4OP4A 2PJ1A 3B3WA 1Z2LA 3PBBA 1CG2A 4O23A 2ZOFA 1IGBA 4NGNA 3FH4A 2PVWA 1DE4C 3VARA 4ZX9A 1JQGA 4H2KA 2Q4ZA 4R7MA 3NH8A 2XEGA 4TWEA 1QMUA 2PJ8A 3S9NA 2PJ4A 4NJQA 5K8MA 2VL1A 4YWYA 3B3CA 3PB6X 2BO9A 1TKHA 2EK9A 4W9YA 4P10A 3VATA 3D66A 1LOKA 4P6YA 2XEFA 4EFDA 4NGTA 1Y0YA 3MRUA 5THWA 3B3SA 3B35A 3KHXA 2PJCA 4DYOA 1BLLE 2ZENA 4KSIA 3GUXA 4R6TA 5LYFA 4BD9A 2V8DA 3T8WA 2J9AA 1R3NA 2PJ9A 3CDXA 2AFOA 3KI9A 2ZELA
chains in the Genus database with same CATH superfamily
2OEKA 3P8BB 3H4QA 4M5JA 4RZRA 1KWMA 4ETZA 3TEGA 4NGMA 3V4IB 4DUTA 1KR4A 4YR2A 4KQZA 5HBMA 3DHWC 1SI9A 4MIAA 3LP1B 3FX6A 1GFWB 4ELVA 5KTAA 4ANDA 3IJ3A 4MY3A 1QAIA 5SUHA 1SC1B 4NZ7A 2VU5A 4N77A 2LQ5A 3ET6A 1NMTA 3PACA 3WC0A 4U96A 1Z8TA 4ZY2A 3W91A 2ZH6A 2M70A 2HHVA 1HWIA 1JLBA 4GKKJ 2X7IA 4OHZA 4XK8C 3W8PA 4NL5A 4WKRA 3GJTB 2Y1IA 2UVUA 4MYTA 1MU2B 2QMWA 4OAEA 1RAAB 2PRQA 3HZEA 4U9YA 3EM1A 5IM0A 2EFPA 2DNOA 5JPHA 2RC4A 3RRKA 3PJ9A 1RT4A 2HK3A 3CJ2A 2QA2A 2VFSA 3LGNA 4RW9A 5C5JA 1VQYA 4AQYJ 3O6QA 2NXUA 3FMWA 1N5QA 4O3NA 1N32F 5ETLA 2YWWA 1FK9A 2G9DA 2OH1A 2C28A 1JLQB 1YJ9S 1Y5NB 2MQNA 1CQNA 1NU4A 1YJWS 4ED5A 1SJ1A 3KLVA 3AHPA 4I2PB 3AFGA 1XWLA 3JTKA 3BJYA 3TO6A 2ZNYA 3K89A 5GADI 2ZUGA 3ITHB 2BKOA 1TAQA 3OVAA 3E01A 3W64A 4KJIA 3I4PA 2NS1B 1CX8A 3BKFA 1VRTA 2IRUA 3KLFA 1HNVB 4OLLA 2D1CA 2HHTA 2GAHC 4DLEA 4JI6F 1ZS6A 1PKUA 2GIQA 4KGZB 3DSBA 2CQCA 2PE8A 2G0BA 1QAYA 3CD7A 5J2MB 4ED4A 1ZZFA 1XEZA 4FP9A 2VPZB 3SQGB 2RKIB 5KFKA 4M6IA 1EX8A 2ZH4A 4B3MF 2K8GA 5D0HA 3HM9A 4WWVA 1N5SA 1YR0A 4CH0S 1Y11A 2KFZA 3PYDA 1NKEA 3KUGA 3WC5A 5HN0A 4Z2XA 2L9DA 4Q5VA 3MD1A 3P5BP 1AXQA 1IUJA 2B0GA 5J1QA 5CYMB 1TKXA 2RQ4A 3FBBA 2RS8A 1PBUA 4ZLJA 2IJZA 1UWAA 1W25A 1RTZA 4HTIA 1MN7A 3M8QA 1JKHB 4A8SA 5ETQA 1P6TA 1YX2A 4DL4A 1S9GB 3OTOF 1GH8A 5K8PA 2P9EA 1NZAA 2ROGA 3WC2A 1RU1A 1XF8A 3HCXA 5J8FA 2MZTA 2CAJA 4JI6J 2N3OA 2JVRA 4DX6A 4EVYA 4GKKF 4B9NA 1T9XA 1VJQA 4CLLA 4L76A 1WI8A 2MEWA 4LRCA 5KG7A 1TUGB 2W2QP 4L6V3 2FE7A 4P4EA 4KAIA 3PEHA 2R98A 4RNHA 2QEXS 1C4AA 3VWSA 4CO3A 3FUYA 3PP9A 4U5YA 1NDLA 3DMJA 1TKJA 3K5PA 4CLZA 2K2PA 4BLGA 1K47A 2MLZA 1T9TA 4KTQA 2BOPA 3H8EA 1XR5A 4EYHB 1TF9A 4B5OA 2JDDA 3AD9C 4DPTA 3KLGB 2X1AA 2LXIA 2DGUA 1NSKL 1JLAA 4C3LA 4ID8A 1WC1A 3DOMB 3MPYA 4DOZA 3SI0A 1D8YA 3GFHA 4W92B 5L39A 1YBTA 3H42A 2OSRA 4OP4A 3D0GE 3Q8PB 4NGNA 1R0AA 2PA8D 2VEZA 1JQGA 4CGNA 4TWEA 2CNLB 1J5EJ 1FEHA 4FD4A 4QYRA 1JK9B 1RISA 3QIPA 3TQEA 3MRUA 5KFPA 1WDTA 3T1AA 3CCJS 2B3TB 5LYFA 1NK9A 2MKJA 1YJTA 4ZLPA 2NXNA 4ITSA 4CYOA 2CWKA 3CDXA 1UJ5A 1TV6B 2GQ2A 3S6FA 2ZW7A 2W9CA 1VRUB 3SSQA 3I0SA 3N6LA 4JZ0A 3M8RA 2R7HA 2CDRB 1IKWA 4BC7A 4CAWA 4LR8A 5I0CA 1I21A 3KG0A 2EBJA 2I79A 1L3SA 2WPXA 2GFQA 7CPAA 4DR7F 1S0OA 1S0NA 4DFPA 4N8NA 4P7TA 4C8ZA 2ACMA 3HULA 3FEYB 3IRXB 1LCPA 1JKHA 2BX6A 2D74B 1HNXJ 2LDIA 1NSPA 3K8VA 1WWZA 4IR9A 4MTPA 2IM0A 4OJHA 3PFOA 2LXUA 2BKPA 4ZVOB 2HWIA 2WVCA 1UFKA 1U25A 2XYHB 2ZOGA 1IM4A 5A8RB 1FWLA 2UV8A 3UPFA 1M1GA 4ED8A 3J81j 1Q7YT 1FFGB 2QX0A 2ZWPA 1OYDA 4PR6A 2FD2A 3IWLA 4NLOA 1FRXA 2PEBA 1TKDA 1HW9A 2AJQA 3HZGA 2VBWA 4OZ3A 5IB9A 1TELA 4LUBA 2DGSA 5CD4A 3H4DA 3CJKB 1NSLA 2M9KA 3UI3A 2N82B 1BD6A 2YWGA 4I6YA 1TKZA 2PJ3A 2DRDA 1HNVA 3CSKA 1SQFA 2HVHA 2AQ4A 1UJ4A 4DR7J 3HJFA 3HI9A 2I5JB 4DR1J 2DR8A 2E1PA 2O67A 2C2OB 2O1PA 2WRMA 3H20A 1WC3A 2G0CA 4OZ5A 3S1TA 4GRSA 2HYIB 4JP8A 3R97A 1SC6A 4QBUA 1LNQA 4C48A 4DZ6A 2D3UA 2DY9A 5KFGA 4A4JA 1X10A 3TWZA 3EWGA 1I94J 3NGKA 1HHQA 1Q8KA 3RAQA 2XSFA 1YHQS 3EJMA 1HW8A 1C4CA 2ZEJA 3I9ZA 3KOAA 3C8YA 3CE8A 4MFPA 3J7A1 1QD1A 2EG2A 4RNNA 1ELLP 5DLGA 1FK9B 2HHQA 1R7IA 4PKDB 3BYRA 1JB0C 4HACA 4ZLNA 4WYLA 1XFOA 5LXYA 2XEJA 4A8MP 5K14B 4PQAA 1RTIB 3EVOA 1PAEX 4M95A 3Q22A 4LF4F 5LYDA 2Z3LA 4P44A 4P4IA 2DNHA 3B6BA 3D7FA 1LWCB 4RW6B 3SXLA 1CJKB 3B3TA 1T11A 2NZ4A 1I12A 4ICLA 2JH3A 4YB7A 4ILLA 4I6WA 2YNFB 4B9LA 3G8WA 2DF5A 5FVJA 3MPUB 1RCXB 2UZAA 1TK8A 2W2MP 4CYUA 2XMKA 2OP5A 3WBZA 1APSA 5IV0A 2YKQA 2XNRA 4NX9A 3PR5B 4U7UD 3DOLA 4ANCA 4GO5X 4PUOB 2BE9B 1KQSR 1MWYA 3KNGA 1HMVB 5CH7B 3T6BA 2E7VA 3V7ZA 1WSRA 3FQLA 3SSRA 1YLEA 4PXCA 4KE5A 2FY8A 1QLNA 5E7OB 1I51B 1FXDA 3M8PA 3BSNA 3UQSA 2RFHA 2LLZA 3ZJ0A 2AJFE 3D68A 4IF5A 4Q8EA 1WKJA 3NWRA 4N47A 2L3MA 4A48A 2V9KA 3I32A 2MLYA 4YB5A 4Z65A 5GAGU 1F5AA 1XNRF 4W4MA 4KB7A 4P4JA 2W25A 4ZPWR 4ZPTR 3EY5A 2JDJA 1VQLS 3OL6A 2QV6A 4FD6A 1QSNA 5ETRA 2WBMA 2DHHA 1T7PA 2IAJA 4MT1A 4F4YA 3EDRB 3V81A 3KJNB 2E1MC 4QWEA 4RUHA 1GHEA 3CPXA 4GXHA 3HKWA 3FB3A 2OPQB 4DPWA 2CQ2A 4U9ZA 4CGLA 4UOHA 2GGPB 5K9FA 1S1VB 2XZWA 4K4UA 1FRIA 1Z4EA 1MWQA 3RW7A 4CI0B 5F3ZA 3BI1A 5L8RC 1RYRA 2WW4A 3PEIA 3CCRS 1YBUA 2J0WA 1NKBA 1AA1B 3QJLA 1BE4A 2MDAA 1UVLA 3FBEA 4X4QA 1JLFB 3EYZA 3KXDA 4Y2CA 3VGSA 1SVDA 2X3DA 4AUKA 3PB7X 4KUAA 4LRBA 3MR7A 4KH0B 3H90A 3NGTA 3MMJA 3NG8A 3PW2A 3B3WA 2HNYA 1DTQB 3MR5A 1M5VC 1JJ2R 4OX6A 2E9ZA 4OHYA 4HT5A 4YR3A 5CXTA 4KV8A 4HNWB 3VZHA 4NSQA 5C25B 2P8IA 2PJ8A 5A2QY 4KOUA 1BUXA 4ZCIA 5K8MA 1QSOA 4C2XA 2HZAA 4DFMA 1WEYA 4FF2A 1CLFA 2BO9A 3CNQP 4KPCA 2HRUA 1REVA 2R7TA 3B3SA 3M2VB 8ATCB 1EETB 2CPZA 3IGNA 1NM2A 3OTBA 2G2ZA 4FVCA 2VDIA 1MROA 2J8NA 4F0XA 1FE4A 3WX8A 3Q8QB 2ZC4A 4URQU 4U8VA 4DG1B 1A2ZA 3CDEA 4J5OA 4R57A 2XNQA 1JLCA 1RWPB 4JI5J 3OXGA 3TUJC 3D2MA 2CNKB 2GMJA 5DS0A 2QT7A 1CPZA 1HPZA 1CPXA 1S10A 4TYAA 3D1QA 5CABA 1NK0A 5C88A 4LSNA 3BQ0A 4Y2MA 1FFSB 2IYGA 1FT7A 4ZY1A 4B11A 2HPUA 5LXRA 1S7IA 5T7LB 1RABB 4NXNF 2DITA 2GS8A 4IO9Q 1EIYB 2J0SD 3LODA 4Z37A 3BKTA 3IO1A 1DQAA 3MR3A 2CPYA 4OMEA 1W2IA 2V34A 2F65A 1F0XA 3SZ2A 1OO0B 2JLGA 2OEMA 3FKBA 1RTHA 4DR3F 4C7IA 2HFVA 1Q5YA 4ZBGA 5J2PA 1RTHB 1NH7A 4DV0J 3DYAB 3GE9A 4AL7A 2HC9A 2BL1A 1FRKA 3SDEA 5LSLA 3ZNUA 1G1XA 3HVTB 3FZBA 5IC6B 1CJUA 2JZ5A 3T5JA 1VK3A 3AJDA 2EFNA 2ZEOA 4FBTA 2OZGA 1NPKA 1Y00A 2XMMA 4NCGB 4P2SA 3WABA 2B3VA 2CXAA 2YNGA 2VZZA 3KKWA 3N28A 4RW4A 1TUVA 4NGSA 5GCNA 4ZCKA 4KGXB 4IFYA 2CVEA 4R87A 2X1BA 4DS5A 1TAUA 3A13A 4FXDA 2B51A 3ENQA 2HHHJ 1P8GA 3CEDA 3MR6A 3CD0A 2DT9A 2DEIA 4K8RA 2BXJA 4ZYQA 4UOFA 4C8OA 3DDIA 3C15A 1RTJB 1YW4A 5AE3A 2NZCA 4M3SA 2DEAA 3TX8A 3KR4A 4AE5A 2H5MA 4CLWA 3UN3A 2DY1A 5KFHA 1FRHA 4PQUA 4CLYA 3DLGA 3DLGB 3CJ0A 2A1BA 3FNCA 1DTDA 3D1HA 3R5CA 1FKOB 3U1LA 3SI8A 1YG0A 2Q1LA 5D78A 3FRZA 2R8GA 1QAXA 2JJ4D 1NK4A 4ZIVA 2NREA 2QGFB 2PMHA 3T9ZA 3AA9A 2DTJA 3ZZRA 1XMTA 1CSJA 3MF5A 1Y7EA 2PJ0A 1Q86T 3NH4A 2ZITA 1Y5LB 2BOAA 5L38A 1RZMA 4E8UA 2CPIA 3GZ7A 3ZFVA 3DNCA 1U0HA 2Q4VA 3CTRA 1XC9A 2RQKA 4PG4A 2AV5A 3JQJA 1CJVB 2ACYA 4BBYA 3IEHA 4IFYB 3CJRA 2VHGA 4CLFA 2IBKA 1NJIT 5A0YA 4WZQA 2DXDA 3U02A 3NE8A 3P6YC 4R0EA 1T05A 1ZAWA 1HNIA 1XMBA 4FUUA 4YHHF 2CJXB 4KO0B 3UE2A 2Z3PA 1T3OA 1U48A 2W9CB 4QIVA 2MYFA 1KOOA 4X4UA 2CTCA 1F2OA 2QYVA 2VJUA 2DKOB 3W61A 2CF4A 2K1RB 3R7NB 1N5TA 4USIA 3BBBA 4PG7A 1SIWB 2RNEA 2V50A 3WDOA 2OTLS 1GMWA 3GIMA 1PYOB 1NEEA 5HP1A 4LQ9A 1UVKA 4YUDA 1XBUA 1RDRA 4QU7A 4A47A 4RBUA 2VPWB 2ADBA 1W26A 3FJ2A 3W66A 4EU0A 1Q8BA 1KNZA 3UR3C 1T9YA 2FZKB 3EXNA 3FEDA 3KMSA 2VXKA 3I1UA 1HNXF 4KS9A 5KFEA 3N6MA 2HQDA 4O0NA 5CA5A 2QECA 4P72A 2AFSA 3G6ES 2YNIB 1VHIA 5L46A 3GP9A 2QVPA 1SKSA 3BDEA 4ZVRB 4LSLB 3BI0A 1DJ0A 2E44A 3MUTP 3ILOA 3LAKA 2LQ9A 2FC8A 5LSRA 4FVMA 1ZAXA 2F4FA 4C8LA 2RT3A 2IVMA 1UKUA 3NXZA 2J8SA 1PILA 2E5LF 4X4OA 2W9AA 2Z2ZA 2QA4G 4G6VB 1V3SA 4QYZJ 2Q7BA 3M8SA 4CS0B 2NUHA 3CGIA 3NGDA 4JOUA 2PJ1A 3DCAA 2DCLA 2IC3A 2AGOA 1IGBA 2CDQA 1PC5A 3J80U 1D3WA 2RQCA 3KK1B 2Z0GA 3TCVA 2NPIA 1Q0NA 4XAKA 4NLRA 4P2MA 1ZTWA 1T95A 4W9YA 3GIKA 5H9EJ 3VATA 1Y4ZB 2I8EA 2LU2A 3I6PA 1F1BB 2AKWB 2J8RA 3OR2A 4AXIA 2BQ3A 4URSA 4CM2A 2RRNA 2EUIA 4BD9A 2R2TA 4Y2AA 3KJFB 3BSAA 3BGLA 4ZP9A 4R25A 2J0XA 4NXMF 3U7JA 4A33A 2LFVA 2CPDA 2Z2YB 3VGUA 5LJ5Y 2IBOA 3M8QB 2QMUB 5CNPA 2N7CA 1U1NA 4QC6A 3RNZA 3K9TA 2DO0A 4XNHC 4A8XA 3KJVA 2XMVA 1FRJA 1HQEB 1X5PA 4DN9A 2YNEA 4IHMA 2B4DB 3VV2B 3I5CA 1FXRA 1UEUA 5I3QA 4UCPA 2LDYA 3IWNC 3IU1A 2JDCA 3FNNA 3BKUA 1DRZA 4J9MA 3FJUA 1Y9KA 1TFWA 4QIGA 3CJ5A 3H2LA 2QN6B 1K0TA 4LQGA 2OO4A 2B3UA 3PXGa 1IKYB 2E66A 2WVDA 4YHHJ 1BQMB 1F9EB 1CM0A 3DLBA 1BGXT 3H2UB 2AEFA 3H98A 2GHVC 2YNDA 4DF8A 2AJ0A 5I4MA 1BO4A 4DCJB 1B7YB 3GG0A 1CC7A 2VA2A 2HGMA 4EI2A 1U6ZA 5T41A 1IR1A 3K59A 2GQQA 1PO6A 3CJ3A 1VGYA 3SDEB 5IWAJ 5MAOA 2PFFB 4NGRA 3RW6A 4BMHA 3VCDA 1R8AA 1RTJA 3HVAA 2YX4A 3BJ7A 3D0HE 3ZZPA 3TYTA 3SI1A 3QJJA 3PX0A 3J7Z5 3PJXA 4OYMA 3Q8YA 2V4RA 1ZM2A 4MHNA 2W01A 4NLPA 3P4UB 4ZPVR 3GIRA 1YQEA 5EN1A 3ULHA 1EB0A 1EP4B 4ILRA 3DFEA 4DV2F 4X3RA 3DI6B 2DR7A 1SJFA 2Y3YA 1NB7A 4H4KA 2JC0A 2G1DA 4Q36A 2AYMA 3PFEA 2W9BA 2R8IA 3ICLA 1XIXA 3TAMA 4B17A 3LA0A 5F8LA 4G1QB 2M4MA 5CBMA 4LSLA 1GX5A 1R8BA 1YREA 1Z2ZA 5J2PB 3ELHA 2CJ9A 2IM1A 4U8YA 1FCAA 4I4BA 1SUQA 4DG1A 3FRMA 4F3QA 4OX9F 1D0EA 1RWVB 4ZPCA 3JQKA 2JEVA 4MKVA 3T3FA 3JUWA 1C1CA 2QYGA 2RE1A 2XQCA 3L2NA 2HQ3A 1V5VA 2A18A 3H8YA 3W6XA 2HNZB 2GHWA 1HPZB 2A10A 2PO4A 1M5OC 5DQGA 1HWJA 4EWTA 4F0HA 2LEBA 2ZEGA 1S1UA 3NCRA 1U1KA 2OPRB 3VAMA 4C8YA 2WOMA 4F8RA 1FRLA 1SJ4P 1T05B 3R8YA 5MLCV 1S9EA 3M6VA 1IBKJ 3GJQB 4NEZA 1Z8WA 1UW4A 1SL1A 4HPSA 3GFXA 3WZ0A 2P6TA 2Z30B 3DKDA 1K9MT 3JTNA 2V63A 1X7VA 5ISVA 4K0KJ 1IBCB 2YPZA 3LF0A 2HGNA 3NMAA 3WC7A 2GIVA 2V67A 3K2YA 5A8RA 2ALZA 1AMPA 1OZPA 3LAMA 2HFSA 3HVTA 1RWUA 1BQXA 2BEFA 3HFZB 3AQPA 4NLDA 1RQ0A 1UWBB 1T03B 2VFTA 3OWCA 4MHDA 2H3EB 5AG4A 3JYTA 1RHKB 4ZPBA 2FJWA 3KHGA 1XMQJ 2XEXA 4FPIA 3PZPA 2Q0YA 5DQIA 1WOOA 2P6SA 4OC2A 4PWDA 5AXLA 4JI4J 2DR9A 1NK8A 3GFYA 3CMAS 1Z8XA 4CP5A 3CXQA 4C11A 3KHLA 4KY3A 3R2CJ 2MSTA 3M8WA 3BM7A 1O5JA 2JFKA 3C3LA 2QMXA 4DUYJ 4DV0F 4CO4A 4J9UE 2P5VA 3DI6A 1RBLA 2ZPAA 1F60B 2EKYA 3UDVA 1IBKF 2EK6A 2OPRA 5F09A 2BR0A 4LSNB 3RBEA 4R5PB 1Z2LA 3V8IA 1TV6A 4ED7A 4DSKA 1V3RA 2Q6CA 4RUAA 2EFGA 1FDDA 2C3YA 4ZVSB 4P10A 4FF1A 3D66A 5KFAA 2XEFA 1N6QA 1VYAA 4U67Q 3T5HA 2GIRA 1TK0A 4QWAA 1R6VA 4MKYA 4V19J 2CRLA 4M5HA 3CJ8A 4L3KA 1BWVA 2H51B 2FLOA 2AT1B 3HHEA 3IBCB 5KTQA 3G82A 1KS2A 3OTCA 1J5OA 1HMVA 4GVLA 3MTKA 2KT5A 3DOLB 3POTB 3CCSS 5F8IA 1WORA 5I42A 5LMNF 1TL1B 4GMKA 4ZLLA 2HGLA 4M5MA 3MECB 2REEA 1REGX 3AD8C 1KRPA 4EFAC 2APOA 4QVTA 1HWKA 5HLFA 2XM3A 5A0YB 2ABYA 1FJGJ 2N3LA 3CC7S 1FF2A 3OR1B 1S5KA 3EICA 2LXFA 1DY3A 4R9MA 4DU7A 4YDDB 2YX7A 3GR1A 2P2CB 1SJQA 2PQ8A 2VBQA 4MIBA 1Q53A 2AMCB 4YQWA 3SJGA 3M2UA 4KHPF 4UEZA 3GG1A 1LWEB 4K4YA 4KRWA 4H54A 4HACB 3OTEA 4U95A 4RO0A 3JQMA 5LYLA 4DQRA 2ZBCA 4DV6F 4M94A 2VZYA 2AHOB 5D8HB 2BJEA 3PHTA 3CIMA 3FRYA 1R0CB 1YVKA 3EVWA 3D9BA 4ENOA 4R8UB 3MEDB 2I3CA 4M85A 2FLLA 1WC6A 1BQNB 4FD7A 2XMUA 4DBQA 1BQMA 2O4HA 1TUWA 1UEVA 3MPVA 1LANA 4F26A 1KD1T 5DM6Q 5LMNJ 5LOQA 2IC3B 4JI4F 1MJ9A 2YKOA 1V6HA 2ZE2A 2UXBJ 2KYZA 2MKYA 3JXOA 4C0BA 2E9RX 3AOBA 2IMOA 1PG5B 3CJQA 1CBKA 1JIHA 1WACA 4B14A 3OFFA 3ZTOA 3GTYX 1DBDA 1YITS 4X66J 2KKHA 2Y1JA 5BYSA 3ENVA 2UUCF 4RW4B 3QRRA 1NB2A 7AT1B 2I9SA 3BSCA 1PAUB 3QAHA 1OPIA 1V5IB 3NEKA 1ZG8A 1F5BA 2EPIA 3O5TB 2MZJA 5HJXA 4AVAA 1HARA 1LWFB 4ZY0A 2DK2A 2MMYA 2KVIA 2IAJB 1JLGB 2BUNA 2D4PA 3QRPA 3LUYA 3MMCB 1R8PA 2CJQA 1U49A 3RRHA 5KFNA 3ZZZA 3U1MA 2Q7SA 1U2RA 1DQ8A 1QVFR 1NPRA 4UIAA 3B4MA 1XR6A 2ZH1A 1VQ7S 4W98A 2KI2A 3H25A 3T1HF 1B4SA 2ZHAA 3QIPB 2CZVC 3L7UA 1AROP 4L73A 1HQUB 4RNFA 3CJSA 3QSYB 4WFAQ 4K2JA 4OV6A 2YNCC 4B9TA 1M5SA 3MCNA 4FS1A 2DNZA 1FJEB 1WHWA 2CADA 2QRRA 3R9GA 4DL3A 4KLWA 5T7LA 2GX8A 1EP4A 1QSYA 4DSLA 1WC4A 2EEYA 4DSJA 4YEAA 3N7ZA 3CF5Q 1I3OB 5ELYA 1FNMA 2PIIA 3MCOA 4KSEB 4LF9F 3B82A 4BWMA 2CQHA 2XMWA 4DV4J 2FHOB 2CIMA 4Y49B 4RW7B 4HNXB 2L9NA 4IG3A 3IC1A 2Y0BB 4FWUA 4HT7A 1GEHA 1IKVA 2GLFA 4RBTA 4UEFA 2KH9A 1U6FA 4OMFG 2WHOA 5HVGA 4PQUB 2ZW6A 2KZZA 1GX6A 3L7OA 1U8SA 4O44B 4FYVB 1NK7A 3T1HJ 1RSCA 3GB0A 3NGRA 2IQ6A 3EGNA 4LMZA 3D2WA 4IYQA 1X4AA 3OFEA 2ZW4A 5H1SV 5G0RA 2MKKA 1HNWF 1XIQA 1PYTA 3I55S 3QNWB 2ZEMA 1I1GA 2KFYA 1N0VC 3M7VA 2F4VJ 4OI4A 4YOEA 2YTCA 1Q16B 2CPFA 2H5JB 2NSCA 1UTAA 2ROEA 4YB1P 1WJ9A 3CUNA 1Q81T 3M9NB 1VHFA 1P9YA 4QPXA 3CIZA 3DRRB 1FHTA 1T9VA 4BHQA 3B8GA 3NL0A 4DR6J 3SV4A 4NRUA 1Y0YA 3BEGB 1HD1A 3PW5A 3GUXA 4P9SA 3BGRA 3C6UA 3DDKA 2BDPA 2ZH3A 4AVCA 2UP1A 4B3OA 4JI1J 4Q0BA 2AFOA 3KI9A 5A8KB 2JBKA 1S72S 3MAHA 1GXTA 4XO0A 4B6ZA 1N5VA 3O2IA 4DV7F 5KT5A 1EQMA 4U7CA 2OKQA 2EVZA 2ZXVA 4F36A 1M1DA 2CJYB 4WIQA 3NE7A 1EKRA 2JEGA 3AA8A 4UA3A 1OJ4A 1B0PA 1RHRB 1NAQA 2QIRA 3A8KA 2K1RA 2E29A 3SMZA 3KNAA 1UPPA 1RADB 1RT6B 4NLWA 4ERDA 2PGCA 5D15A 4DJBA 3JB9k 2V2VA 2CUYA 2YNIA 4A95A 3LD2A 3OSPA 3IIBA 3KDOA 4AB7A 1CVJA 4LBIA 4B3TF 2GJFA 1YX0A 2GREA 4AVBA 2V69A 1GMUA 1QAJA 2ASDA 1Q82T 4NA3A 4FKYA 3HVRA 2VQFJ 4NLUA 4F25A 2R9LA 4JI1F 1U1PA 4D3GA 2VG6A 1LK7A 2FJXA 2AX1A 1VLOA 3KK2A 3W6SA 1BPNA 2NQPA 3MN8A 3UCGA 4MFJA 1X9WA 2NYQA 4WFNQ 5D4LA 4DV7J 3KG4A 1T94A 3GONA 1YJNS 1JJ4A 1WG4A 2MZSA 5J2QB 3N5BA 3FGVA 2UXCF 1RT3A 3N01A 3H40A 1NDCA 4JUZA 2RF2A 4MY0A 4FYDA 2GJ2A 4Q45A 1KKHA 1RT1A 1OYEA 2I5JA 2F8MA 1QSTA 2LEPA 3HFKA 4Y65A 4HKQA 2LYVA 1R57A 4J37A 1B6BA 4HTJA 4U6PA 1NUEA 4CLTA 3QAYA 4DR5J 3DLEA 3MMAA 3CCVS 2FJAB 3RGIA 1DAXA 1UZDA 2F8HA 1A9NB 2UUBJ 1LKZA 4OIWA 3UR0A 4DR4J 2RJZA 1Q7LA 5G1ZA 4NLGA 5IB0A 1U1OA 1VQ9S 5AXKA 2HHUA 5JH9A 4J9LA 4Y2IA 2V9WA 2ZZMA 4E0AA 2QG9B 4IOBA 3IRWP 3MOJB 2KXNB 1U1MA 2C3MA 2C6PA 3DLKA 3W2WA 4WIIA 1VDHA 3IMQJ 4ZITA 3LWUA 3N6NA 1D09B 3TJAA 2R2UA 4P2FA 3AAWB 3QQCD 2Z2MA 4OC4A 1HDUA 2KT2A 3KQZA 4ATNA 3EDQB 1B0TA 4LFBJ 1S9GA 2DPTA 1GTEA 3D4UA 5D0EA 5KFZA 3EPGA 4M8LA 5IS2A 2R8KA 3GKRA 2GIFA 4PV6A 1YLXA 1VMBA 2BJ9A 4A37A 1HHSA 1C0TB 1PCAA 2HUZA 4ECWA 3PIPQ 4DQQA 3GSIA 2QE5A 4F6AA 4QYZK 4X64J 3KFWX 1KN6A 3C16B 1CJKA 4MCQA 4B3MJ 2OIHA 4I7FA 1FI4A 4BWJA 2ZM6F 2DPJA 2R7QA 2W4CA 4K4XA 3IS9B 1H72C 2D3ZA 4M5LA 3OBIA 3CXPA 4ZN1A 3SXOA 1RTIA 3QT5A 1X5SA 4FS2A 4I64A 1RLCL 3RBXA 3C6TB 3H5XA 1Z4RA 5E2QA 3E8OA 4OJ1A 5IV4A 4H4KC 4QWDA 4F7VA 3DHXA 2PIYA 2KU7A 3T19A 3HJVA 1J2VA 2IVYA 2WB1D 4H4OB 2V68A 2C2RA 2KXFA 5J8CA 4HKFA 1N6QB 4CIOA 4MRIA 2M8DB 4HI2A 1A7GE 4KOTA 1WHVA 3RB0A 1HYSA 3MR2A 5KTDA 2REFA 1G3OA 2VG5A 3BSOA 5JJBA 3CJTA 5SZTA 1ZTTA 2DGWA 2YVSA 3EPIA 3F5BA 2XZDB 4KYZA 4NOHA 2DNNA 2XLKA 2CPHA 1Q2YA 4OJGA 5AXMA 3DOKA 3PBBA 3DRSA 5A6PA 4OI3A 4RNMA 1YZ6A 4P75A 4UZCA 1M0SA 1DTQA 2O5DA 2LQ8A 1WC0A 4NJQA 3CJKA 2KB2A 4BBHA 4V19X 2B43A 3GJRB 4DR5F 4N41A 2AX0A 2B4DA 4P6YA 4TN2A 4PG6A 1UJ6A 4H6ZA 1FEEA 2CQGA 4OL8A 3F8KA 4J91A 3HP6A 1CJVA 3RJMB 1QE1B 5EGYA 3SBMA 2UUBF 1RT4B 1FKPA 4K4TA 2B9WA 3NY0A 4LVOP 5KFIA 2MKCA 1SH3A 2YKNB 1FXLA 1XQIA 2A6MA 3J7YI 1RHJB 2OAUA 2HS3A 3LACA 2ZELA 4NEYA 2G3TA 2QZ8A 4DWIA 2CNOB 1DQ9A 2UUCJ 3RAMA 2RH3A 2PCUA 4QZVB 1HNZF 4NFRA 2ATLA 4B9MA 2B56A 2BJDA 1A0OB 4CYQA 4TU9A 2DHGA 5KAKA 1N52B 2QLBB 2CJBA 1HBUB 1FKOA 1WELA 5U47A 1MJAA 3UD5A 1NE9A 2LA6A 4IKAA 2F7VA 3O44A 1WD6A 3NAHA 2P9GA 1XN9A 3WQPA 4DV1F 3BJ8A 1YKWA 4C8NA 3D3SA 3V6DB 2HMIB 3OL7A 4PABA 3OW2R 2P0WA 3WHIA 3BPDA 4PAAA 3Q8SB 1N36F 2B6AB 3PNIA 4MCRA 2GANA 4GVBB 2GCFA 2YNCA 3Q86A 4X64F 1NSAA 1NJXA 3B8HA 4F50A 5JVHQ 2H5EA 2K3IA 3MUVP 1WSVA 3FZ2A 3MUMP 4P6QA 4ECYA 2C2EA 4PYAA 1FE0A 4ZCMA 5M2PA 1YZ7A 1C2PA 4F9VA 4UFWA 2Z2LA 1RA7A 2YNGB 4NYZA 1U02A 4MJKA 3UNGC 5BYQA 2Z0ZA 2Y9HA 4QWBA 2RDDA 4MYUA 4ZVUB 3HLPA 1CJUB 4TLRA 4JI0J 3KZWA 3CCWA 2YH1A 4CAVA 3HO1A 4A30A 3VAKA 5FJ4A 2KRRA 1NXIA 4DQIA 2R2RA 1YRXA 4ED1A 3JSRA 1VHSA 1YJRA 4QIFA 3OL8A 5GAEU 2R7VA 1I1DA 5HVFA 2HZCA 3FMCA 4ZA1A 3EGWB 2QYCA 3LQVA 3TANA 2HW3A 1LW0B 3G8QA 2R7WA 5CYJA 1SQGA 4PZVA 2Y8YA 3MEGB 1S6QB 2VF3A 2OELA 3PO4A 3DMJB 4Y0FA 2DGOA 1ZAVA 4WU2A 2XSJA 4RW8B 3K5NA 2AE6A 2C42A 4KPYA 2QA4S 4PK3A 4ECVA 1FRMA 1JMTA 1TKZB 2F4VF 3LPEA 2PJBA 1UA0A 2UVRA 2EVNA 2ILZA 3KASA 3A3NB 1VIXA 1QUVA 4CO0A 1UVIA 1CJTB 1X4EA 1XBWA 4CH7A 4J9OA 1S1TA 3IAS9 3DXBA 3T1YF 1O8BA 2A3JA 2Y1RI 3CCMS 1RO5A 1SJRA 3RU0A 3FBFA 1N33F 2OLWA 5C42B 3NBPB 4O0IA 3G8TA 2E1AA 3MM6A 3CCES 4EBCA 2G9OA 4G65A 4PXEA 5DG9A 2LKZA 3GSDA 3KL9A 4ORFA 2BW2A 2GVZB 2C2NA 1PYSB 4USVA 5LT5A 4ZX8A 1X4HA 2W8LA 2VKZG 4M5GA 2V6AA 1S6OA 2K7JA 3VF0B 3Q83A 4LF4J 3AJ1A 2JOQA 3QT7A 3R6LB 1F9FA 2MQOA 4P4DA 2LA4A 1QTNB 2E1CA 1TL3B 3BR8A 5KOXA 1RAJA 4KBIA 3T9NA 1R8CA 3QGIA 1NJZA 1AB8A 3MM5A 5JXSA 1UMJA 4ILMA 4B5PB 3HD2A 4B13A 2BV3A 2BQUA 1S0MA 1Q95G 3D6HB 4A46A 4KOVA 1SIZA 2VI7A 4I6AA 5F48A 3EE3A 3I96A 4PXDA 1NBEB 2BZ2A 4DU8A 4R3LA 5AG5A 5K8NA 1S6PA 2DXEA 4B5PA 1S99A 2WYRA 4WFBQ 3PO5A 2RUGA 3RBUA 3MD3A 3P96A 1AFIA 2CWXA 3W9IA 5H9EK 3H8GA 3BR9A 3W2VA 3KLHB 1RHUB 1X4GA 1LXJA 3CJ4A 1GT8A 4OI2A 3E51A 2VC1A 1PYTB 1BMQB 3ZTSA 4Z7CA 3S6EA 4DFKA 3M2RB 4GKJJ 4LF2A 3PRTA 1VFJA 1G6BA 3TR5A 2WSAA 1IQZA 4DI6A 2RRAA 3Q24A 3ETOA 3VARA 1DE4C 4PG8A 5IT0A 1IKWB 2GV1A 2V2QA 1TFYA 2IL4A 1ZM3A 1TKHA 4X84A 2FJEB 5KG1A 2HLTA 3MM7B 4A8YA 3VAFA 3A8EA 5F0UA 4KSIA 2E5GA 4UT4A 3PG9A 3OXFA 5ETPA 1DLOA 3QT8A 4V1Ak 4OHXA 1UETA 2YNFA 2NMTA 2H65B 3AH6A 2KRBA 2PSWA 3QGPA 4KGMA 2F5IA 1URNA 1MROB 3VVUA 2WSEC 2GO9A 4OIXA 3K5OA 5DZ7A 2QSFA 4FNHA 1OPZA 1B87A 1WHXA 4ZPAA 5D4PA 1W2BR 4F8ZA 3NBPA 1PJ6A 3V4MA 1S6QA 4DX8H 1TVRB 3P2FA 1KONA 2JC1A 3PX6A 3VTIA 1M5KC 4OX8A 2VBYA 4I2PA 1VBZA 3HVWA 2JLFA 3O1LA 2FUG9 3CC4S 4CRZB 3VQTA 3DLHA 4ZJOA 2J8AA 4KO0A 2HEKA 4NWBA 2AJ1A 1J27A 1CPSA 2VG7B 2B58A 2V8HA 2C1CA 1YWXA 4LF8F 1KVIA 1UCNA 1WG5A 2C3PA 3NS5A 2EWHA 5JGFA 4JXRA 4J7CA 1TKXB 4PRFA 2W7PA 2Y8WA 2ZDOA 2DIUA 3MM9B 2UV8G 1HIYA 2GGPA 4LF5J 4M5NA 1KQKA 2ZOMA 5HQLA 1ZG7A 4ZGYB 4EK2A 2GVDA 4ZIWA 1FDAA 3CDBA 4IK2A 3H8FA 4C7QA 3TVYA 4B3SJ 2XG8A 4OLPA 4E8OA 2NXCA 4ZHRA 1VQSA 1G4CA 3D0IE 5E33A 3L09A 3KG1A 5IT9U 2V8GA 5A8WA 1VI7A 3QLHB 3I9V9 2BSWA 3B3VA 4CGOA 1Y7PA 1VQ8S 4UY85 1IYKA 4ER8A 2PMZD 1VQNS 1BAVA 2FYXA 2VB6A 1SXLA 2DNRA 4OZNA 2VBXA 2VOPA 1F5CA 2OZUA 4TY9A 4CYNA 1PU9A 1SC3B 1LWXA 4OHWA 3PY8A 2HVZA 3S6HA 4O3PA 1U6MA 4GKJF 5CCLA 1HR0J 4WE1B 5KFMA 4DUKA 2MHNA 1S7KA 5KG4A 2CQ4A 4DX5A 3PEJA 3GILA 4EGLA 2XMJA 2FIUA 2CZ9A 2CFXA 2AFUA 5IC4B 1T3NA 4NZ6A 8AT1B 4KLVA 3RYOA 2ILYA 4NGPA 3NA6A 3FEEA 4KGKA 2M2BA 3NRBA 4RJVA 1JJHA 4HI1A 4OYZA 4Y00A 4XDCA 3CULA 3IBFB 3JAMU 4ZI6A 1HI0P 1Z8LA 2X7BA 2LVWA 3KLFB 3S6KA 2DGXA 4WP9A 3HSJA 3TAQA 2FZGB 5KG2A 2R8JA 2GE3A 5K14A 1KSPA 2IJNA 2JSXA 1RT1B 4WTOB 4GS4A 1TMMA 3AXMA 2VG7A 1UW9A 1VC0A 4CZCA 4KHMA 1HBUA 4ELUA 4OZ0A 5AE2A 2YQ0A 3OLAA 1ELOA 1SJ3P 1KVJA 3CMQA 1LW0A 2CQPA 3BQ2A 1RT5B 1XJOA 2IM3A 4RU2A 2ZH8A 1UVJA 1RJJA 1YLOA 2V2ZA 3RB3A 5JMNA 1PGZA 2AIRB 1QQ9A 2QIFA 3GCXP 4XPCA 3RO0A 3R3TA 3PW0A 3HHLD 2EFVA 1YJVA 3NNHA 4LSZB 2FHJD 2V94A 5D0RA 3THVA 4X65J 3O3LA 2QMLA 2ZBPA 1OBRA 2IPOB 5HBMB 1S1TB 2EXUA 2MQ8A 2XLJA 1X5TA 1WF1A 2F63A 3ZZOA 3CDUA 1RAOA 2M7SA 2KTQA 1Y7RA 3RAXA 3C6TA 4IH7A 2HURA 4F0YA 2N7YA 2J7UA 1H8LA 2R8VA 4J9NA 5IFMA 5CHCB 2B4BA 2PFDA 3R9EA 4IH6A 3IS9A 1YQHA 3I5AA 4IFVA 1OY8A 3M1VB 2ZH9A 4X4VA 3C16A 1S12A 4FPRA 3FQKA 3H5YA 2A6OA 3D6MB 2V5HG 1NJYA 5CD4H 2GAGC 4DDFA 2DR5A 2IDEA 2WK4A 3I9SA 3SCKE 3ENAA 4WYWA 2LQBA 3KTQA 3IN5A 1FERA 2GJIA 1TL7A 2JEIA 2Q44A 3P2HA 1RTQA 3V6HA 2V4JB 1AT1B 3FH4A 2E5HA 4NLSA 2Q4ZA 1NPPA 3H5UA 4C97A 4R3KA 4JI0F 4MH8A 4OYWA 3BO4A 5L9NA 3BS9A 3IR7B 1TQLA 3R5DA 3F44A 2HQFA 4YWYA 3D3BJ 3EC4A 4NE9C 4L3NA 5F8HA 1Y9OA 3TFYA 5CYMA 4WF9Q 1LOKA 3US5A 4WK1A 1T0TV 3UY5A 1EAYC 4PG5A 3I56S 3GIUA 1NHVA 2BE2A 1LRZA 3JSBA 2CNNB 3BLNA 1Q79A 2MPUA 4H4MA 5HMNA 2V8DA 3HMJG 3HHDA 2E5LJ 5DQHA 5GADU 4JI3J 3JS9A 2HVEA 1WC5A 4RX6A 2RKIA 2C27A 1IBMF 4YS2A 4MHYA 4AFFA 2WONB 3A1YG 2XI2A 2J5AA 5J2MA 1TL3A 4F4KA 1NMEB 4TQRA 3OFHA 4R76A 2B5GB 4JI8F 5AXNA 5F9LA 2I2YA 1LEOA 3HHLB 2Z10A 1T02A 2PI5A 2MTLA 1AYEA 5IWAF 1IOFA 2PC6A 2DNMA 2GVZA 2MZ1A 3L95X 3K8WA 1N5YB 2DHXA 3TJ8A 1U26A 2DRAA 1U8WA 3FK4A 5DM7Q 1XMQF 1IQTA 1ELMP 3I87A 2UUAJ 4CM0A 3IWGA 1GQEA 4RUCA 1S1XB 1TKTA 4PSWA 2OFGX 2HRTA 4UUXA 2ZBRA 2CJKA 3WT4A 1N33J 3KLIA 2J76E 3RB6A 1SH2A 5FDLA 2D41A 4F0KA 4JWPA 4DUYF 1P1TA 5IX3A 4ETXA 1TK5A 3RYLA 2YQ3A 1VR6A 3MM7A 3PYFA 2VA3A 3NGUA 2PT0A 4F4WA 2BCOA 2ZKTA 5EBVA 3LWMA 1M4LA 2ZEDA 1R43A 2YPYA 4UUWA 4N5SA 1FNOA 4JI8J 3NS6A 1RLDA 5DGAA 2EK8A 3RUBL 1VLYA 4F3MA 1EE3P 5J2QA 4EZ6A 2R7OA 2VFVA 3GR0A 3P49B 3DOKB 3M2RA 2AZ1A 1OY9A 3R9FA 1CULA 3TOQA 3W65A 3GQCA 2ZVIA 2GO8A 3ET6B 1LFPA 4N56A 3GIIA 5EDWA 4Q43A 2OPSB 5HAOA 2GW8A 1GXUA 4ES1A 2R7SA 1V3ZA 1JLGA 1HYSB 9ATCB 4TKTA 1KC8T 3OLBA 4IDKB 1Q4RA 5E3CA 4DR3J 4B9SA 3GPAA 2OMOA 1NLKL 4OZJA 2M8HA 1E6VA 2RUSA 1DLOB 2K5TA 4OIDA 1AFJA 4CCHA 3CPAA 2FQQB 4USUA 3QFWA 3QMQA 3VWEA 4ZHRB 3C6UB 4ECZA 2VBZA 3AY0A 4NLTA 4B12A 2HFOA 4ZP8A 4C7HA 5DWMA 3ILLA 4J9SA 3MEEA 4X2TA 1FJCA 1MG7A 1WK4A 4DEZA 2ABZA 4K0KF 2M52A 3X1LB 1HD0A 4R8FA 4LT6A 2ZNZA 1HBOB 3MPWA 1R27B 2HMIA 2YKMA 1YI2S 1GK8A 5EWEA 1Z1ZA 4F2RA 1RWKB 2A2CA 2Y0MA 3NAIA 4P45A 1KEKA 2YBVA 1Q2CA 3J7YU 1NDPA 2IJRA 1ZYQA 4ANEA 5BWAB 4C4WA 1Q8LA 1VJWA 2E7WA 4N7TA 3M32A 5B0AA 4OX9J 5C42A 2GC8A 4E98A 4Q0BB 3RG6A 2OSQA 3AQOA 4DR2J 2QL9B 1RT3B 5KTCA 2DBBA 4MFBB 2CTBA 3OHAA 3AOAA 4NI2A 2Q66A 1OS5A 4RBVA 4UQTA 3S8SA 2FJVA 2HBYB 7FD1A 1L3VA 4A8FA 1UL3A 3KK2B 3ZXWA 2MLXA 1VS3A 2YKNA 1SV5B 1X5OA 2VG6B 3SFGA 5KT6A 3UDLA 1HFEL 2V8VA 2CZ4A 5J2NB 1B7FA 3EXCX 2E9TA 3MGJA 4LF7J 1RBOB 2CKWA 2QC3A 3JTOA 1VRQC 2H4YB 1YBAA 5AT1B 3GYNA 1IR0A 2XSJB 4JV5F 4IG0B 2EG1A 2ATCB 1RTDB 1VBYA 3MAAA 3R5AA 4TY8B 4A8KA 1XTZA 2CPEA 1S49A 3EGZA 3BGUA 5IQ6A 3N5FA 2A2DA 4QPTA 5B0FA 3TEHB 3D7GA 2XB2D 4DQSA 3SXNA 2WOMB 1VQOS 4GM5A 2NUUG 1KQGB 4XPDB 3H59A 2JVOA 4JXQA 4CRJA 4I2QA 2LP4A 1Q8IA 2BW7A 3G8SA 4C8KA 3BO2A 3IG1B 2KHCA 2VUGA 2QLWA 1R0BG 3M4XA 4M5IA 1CG2A 2YX1A 3W9HA 2PD1A 1C1CB 5KFFA 3NMRA 4C9DA 3S9NA 2IRYA 2NLWA 1UP1A 2XMAA 3KLGA 5DWNA 1NK6A 1RKJA 2B5JA 4EFDA 3F0NA 2VFUA 5THWA 1S60A 3B4DA 2JFDA 2O3DA 1CQMA 3LW5C 2EO8A 5HMYA 1MJBA 1RE1B 1RT2A 4ZJLA 3WIVA 4TQSA 5GAHU 3D6TB 1VBXA 3QGGA 3SIPB 1V0CA 2DVIA 4NLXA 2BQRA 3W63A 5B0EA 5D77A 3I82A 4DCPB 5F9NA 2XWXA 2W9BB 1S3ZA 5FLXY 3K0JA 3R2DJ 2HHPA 4X5KA 4ZVGA 2ZEHA 3D6FB 1NNDA 2F9JA 3WIUA 4XPLA 4WU3A 4CQ1A 1RHMB 4I49A 5BJRA 3H5ZA 2Z57B 3EVMA 2CNTA 3CDAA 3TVZA 3D3CJ 3GIJA 1YIJS 1RGVA 4DV3J 1WDDA 2HNDA 4C2YA 1U4BA 3TUZC 4GC7A 3QB8A 4ZVPB 2IY5B 3MM8A 3PKYA 2PA3A 2FB0A 3N0VA 3WR7A 3KLHA 3MZIA 4FF3A 3R27A 2VDHA 3D8PA 2QO3A 4ZCLA 2B7BB 1U1QA 4JI7J 3ZNJ1 2AJ4A 5D3GB 1M5PC 1N71A 2QL7B 2PJ2A 2WVEA 3MCMA 3TUPA 4CGPA 1WF0A 1RYSA 2Z58B 4IRCA 1FDNA 1FY7A 1IKVB 3QFHA 4B3OB 1K1QA 2I00A 3LMSA 1IYLA 2FC9A 2ZW5A 3SQGA 1S6UA 3BGRB 4C3KA 2XO7A 5DLFA 2BBEA 5KFQA 1RXTA 3D7DA 2MJNA 1T8EA 1ZPVA 1CS4A 1LOUA 1XRYA 2BACA 3NCQA 1LWEA 4JV5J 4X65F 2XGQA 2H54B 1A6LA 3HHLC 2R7XA 1RWOB 4HH1A 4A94A 2C1EB 2Y1LB 3L3CA 2OD6A 1Q1KA 3PRDA 1C1BA 4KOSA 1O51A 3CVKA 4MXUA 4IUSA 3PW4A 2HWTA 1QVGR 2B8PA 4A8WA 1JNRB 2W2NP 4TU8A 2FVPA 3TOBA 3ISND 2JEFA 2ZEFA 4WJBA 2EI5A 4KOXA 2KM8B 2OTJS 3M6XA 3NNCA 1P0HA 4XPEA 4QR2A 1JLQA 1SUQB 1SKUB 1NHKL 4DPOA 2KDOA 4WCEQ 3JRUA 3BBCA 2BRKA 1AUDA 2IFXA 3V2UC 3S9MA 1RBAA 1D9AA 4F9UA 5KT3A 3DGPA 4USKA 4G1PA 4X4PA 3W60A 3P45B 1BPMA 2NSMA 4RW8A 4CTAB 5KG3A 3DNSA 5C2GA 1EKSA 4EEYA 1VIOA 2CY2A 3QO9B 2DH9A 2YKAA 4Q2MA 4NXMJ 4PYDA 2Z56B 2ASLA 4X66F 2N4CA 3PVXA 5I3UB 3D28A 3SHPA 3IWXA 4HLBA 1SB6A 4B3TJ 3UWTA 1TL1A 3C14B 4ECQA 4UWIA 3IM9A 3QAUA 4QOTA 4CT9A 1NK5A 1VQPS 4TNOA 1C0TA 1S1XA 3B54A 4P74A 4R5PA 2MQLA 4OC5A 1M1KT 3H7HB 2AU0A 2RS2A 3W62A 3VALA 5G21A 3SCLE 2XGPA 4KVXA 4M63A 4J9VA 4K30A 2A4NA 2WZ1A 4NA2A 3ENWA 3LP1A 4AD6A 1CJWA 2VQEJ 4Y34A 1U1LA 2OB0A 3MEKA 1RWXB 1ZG9A 5HXDA 2VOOA 3OV7A 5B09A 1BQNA 4UOGA 4KOWA 3TZZA 3AT1B 3C2PA 3MDFA 1KUYA 4EZ9A 3IXQA 3RBDA 4O3QA 2MKIA 2HWHA 1RWWB 2OHDA 4MIWA 3DDNA 2DXFA 3PB8X 4RS2A 2GVDB 2RU3A 2X1FA 1HI1A 4LIRA 3W3SA 2UUAF 4X8IA 1HNIB 1OIAA 5GAHI 4LFCJ 3Q8RB 4LR9A 1KHWA 1H2TZ 1IY7A 3THPA 1IJFB 1N54B 4DL2A 1VQ5S 2JEWA 4DZDA 4ECSA 4C11B 1IKXA 2P6EA 5L1LA 3EZ5A 2XS2A 3HHKA 2RF2B 4IUFA 3GY9A 1YGYA 1CBXA 4IRDA 4NPOA 3S7RA 1JLEA 5LMUJ 4YP3A 3WX4A 3BH7B 3AJ2A 2BKNA 2OPQA 2MZQA 4KGVB 1T03A 3M30B 1S9FA 3ZTQA 3OHBA 1X4CA 4PK2A 4P7VA 1WTFA 4ZK7M 3O8WA 4A2ZA 2QLXA 2OFHX 1VKCA 1H73A 3P5TL 3MAQA 3HK2A 5KFOA 5E5NA 2EK9A 4CO2A 1J4JA 4MKAA 1NSQA 3EZUA 2YNHB 3B35A 2W7OA 2E1RA 2C3OA 3I4HX 2CQIA 1BLUA 4AXJA 1E6YA 2RIJA 1S4FA 1ACMB 4UCMA 4JYAJ 4LRDA 5AGEA 3R1HA 2NCKL 4XNHB 1X12A 1Y9WA 2RDIA 2AFXA 1KLNA 3NS7B 1YGHA 5HK4A 4YY3J 3C15B 4FN5A 4ED0A 3F0AA 2IMWP 2ZUAA 4DUZJ 1TL5A 3TJ9A 4A38A 3JSYA 2AFMA 1X0PA 2GMLA 1ZM9A 3TAMB 3AB4B 1QDUB 1PIEA 3VWDA 3BZQA 1TF8A 4B3RJ 3S9LA 3GV8B 2K7KA 3R7BB 3RR7A 3W9JA 5B0BA 2PJAA 5ETOA 5LMUF 4FYXB 1BOBA 2CNSA 1YSJA 4Y3CA 2LU1A 3ZZUA 4ZMMA 4WP3A 2IYIA 4UWJA 4OC3A 4ID5A 5KT4A 4YN3B 3ZZTA 1WF2A 3FFIB 2XY7A 1PC4A 4YGOA 2DEJA 1IOIA 1Y0RA 5B0GA 3FBUA 2D9PA 1YK3A 3BGFA 4OZ1A 2UUWA 3W1YC 4ZP7A 3T41A 2R7UA 5EWGA 2LECA 2K06A 1UA1A 7FDRA 2YY3A 2DH8A 4P71A 3ZO7A 1ITPA 1UVMA 4DQPA 4ES2A 1NO8A 2HFUA 4LJMA 3I5BA 5F3TA 2XCAA 2ROPA 1YVOA 3QRQA 2HRYA 1WNEA 5GAGI 1IVZA 4EO6A 3LTOA 3OJUA 4CLKA 5RUBA 3KHHA 2HHWA 2DXQA 1S7HA 3QAEA 3MM5B 1CEZA 2ARHA 3TO9A 1JXEA 3GMGA 1FDBA 4DV5J 4LFCF 2HV2A 2UXDF 4RU9A 1G7CB 2F3JA 3E0KA 1X31C 4M5DA 1VK8A 3TRGA 4YMEA 3FEZA 1HDQA 2HB6A 4KKOB 3LGMA 4WE1A 3KHZA 1GTHA 4KC5A 1BHNA 2AZ3A 3NWGA 3GFZA 3T5LA 5D8NA 3B7IA 1IBLJ 2XULA 4KHPJ 1X8DA 1I6JA 1KFSA 1LW2A 3DC2A 2FVSA 4CT8A 3NH5A 4S0MA 3LH2S 3H0PA 5F8NA 4UOCA 5KFTA 1NDKA 3M2VA 1NJWA 1WEZA 1REVB 3UN5A 2UXCJ 1LW2B 2RILA 2R4FA 3UO0A 3UDCA 2JHEA 1RCOB 2PMWA 5J1NA 3QSIA 3EFAA 4DMZA 2JLMA 5LRKA 3I31A 2BANA 1NZ8A 4L75A 5HL7Q 4DV1J 4C68A 3G96A 2L48A 2OPPA 3I0RB 3IM8A 2KZMA 3J80Y 3SJEA 1ULRA 1BWEA 3MWBA 1NH8A 5K20B 1M5HA 5HO4A 3BQ1A 2W1BA 1HLWA 2B8QA 2F40A 4J3GA 4UBRA 4J90A 1LQ9A 2BJ7A 2HQCA 3VAJA 3R1LA 1JLFA 2FVRA 1HQEA 3R5JB 4DUZF 4KT0C 3K57A 5DJBA 1M44A 1DZ5A 2VV5A 3OUYB 1SKWA 4RPFA 4DFJA 4NEXA 4QU6A 3ADAC 3KWMA 3BN7A 2ERRA 3I0SB 2A0FB 3ILIA 2WPWA 5CZVA 5F41A 1PUAA 2QLJB 2K3KA 3TZWA 1EZZB 2OD4A 1MN9A 4EMEA 5C24B 3W5XA 1VQMS 3FEXB 5I42B 1RAFB 4ZN3A 3DYAA 1FTCA 3W7BA 1RI7A 3CZXA 3POTA 4NCAA 2C2MB 5DS7A 1LFWA 2Z3KA 4YU9A 1VC5A 2RHQB 2CA9A 3A4TA 3QWUA 2HS4A 2CYYA 2DIVA 1HA1A 3CCZA 2VASA 2DNLA 2DNGA 4B9UA 1Y3KA 5L1JA 2XEIA 1OSDA 4YDXA 2G3AA 1Q5VA 1NKCA 4DR1F 1PJ5A 1U1RA 2YGWA 1YK9A 1MK4A 4QJVA 1BC6A 3DGVA 2HSEB 2FZCB 5ETMA 1M4DA 2PIZA 1N56A 4MK9A 1Q2DA 4GVBA 2F5GA 4UF4A 3R96A 3TX0A 5DRKA 5ETSA 3N79A 3K5LA 2UXBF 2G1HA 2UXDJ 1JXLA 2VJVA 2G13A 2KXHA 2FSRA 4CNZA 2MY8A 1KLMB 4O23A 5HMXA 1RTDA 4B08A 3UD3P 1HNZJ 1LWCA 4RW6A 4C3MA 4RL1A 2RD5C 3J7ZT 1YTYA 3JTPA 2DPIA 1RKIA 5EX3A 1IR2A 2OGUA 2VKRA 4Y6IA 3SFUA 4TU7A 5DDPC 1WI6A 4ED6A 4NGTA 4KSAA 2PJCA 4DYOA 4R6TA 4CLPA 3J81Y 4LRAA 2HKEA 1UWBA 4W90B 3T8WA 4JBCA 3DDDA 2CPXA 2FY1A 2D69A 1VC6A 1PBAA 4J9QA 2NXJA 2HQYA 2B4PA 1N36J 1NCLA 2E5JA 1KTVA 2EC2A 1H74A 2ANPA 2Z4PA 1X60A 1RK8A 3EO4A 2MQPA 4RN7A 1Q7LB 1L3UA 3IU2A 2J6SA 2MY7A 2DISA 1S1WB 4I68A 3KLEA 3KGQA 2XY5A 4DJLA 4C0HA 5HLFB 4QW9A 4CH1A 3OT9A 2R42A 4MFLA 2IDLA 3DRSB 4PCQA 1EHWA 4U7UK 2M5YA 4F2SA 1FA0A 4HHJA 3DM2B 4J9PA 2EBGA 5FLXU 2HNZA 4FXWA 2Z3MA 2LQJA 4MFQA 2FXFA 4DR6F 3MM6B 3DLJA 3MEDA 4TVAB 4DL5A 2AYEA 3ZC4A 3G9CA 4KFBA 2XHCA 2HG4A 2C6CA 4ED3A 4F3OA 4P2XA 1MMNA 4OV1A 2JBJA 5EWFA 5HP1B 2DNPA 5CYQA 4IQMA 3V6JA 3HFVA 4FZVA 4RI1A 3NLCA 3MPDA 4AYBD 3HDSA 2D4OA 1CULB 4FF4A 3G71S 3OVSA 2CPJA 4CRYB 2O53A 4G1QA 2HK2A 3E2EA 2CG8A 1D9DA 3CXSA 4QB9A 4KVME 4GC6A 4O3RA 1RT7A 1RT7B 2ZJRQ 2ZH5A 2OR4A 3WC6A 1O6XA 3UVJA 2BEIA 3CCTA 3PGPA 1S79A 2G2OA 3HPOA 5C2CA 4KSFA 5KFLA 4B02A 2DPSA 1TZ0A 3PV8A 1ZOTA 3SCIE 1WKKA 1UFHA 1D9FA 4MMOA 3I0RA 3NOCA 5BXIA 4KUBA 4QW8A 2D3OR 4PEOA 2B9XA 2XZTB 1SBRA 4LBHA 4F4ZA 4QUSA 2BM0A 3VAGA 5E3RA 4QCLA 3W2WB 4MI4A 1VCTA 3RTVA 2BA9A 2R3VA 2RU9A 4WFYA 4OLOA 3FF3A 4C6AA 2FTRA 4KOYA 4MCPA 3GLJA 1U6BA 3C26A 4IQXA 3HUVA 1H0HB 3R1KA 1EARA 1KUXA 4EO8A 2UU9J 4LF5F 1F57A 5E3QA 3K9UA 4P4BA 3DN9A 3MGDA 4N8OA 3KLEB 4P73A 3OUYA 2XS5A 3CW2C 1YJUA 2F8EX 5G4DA 3M8ZA 1KQFB 5EHHA 1IWAA 2Q6BA 1MMLA 4YY3F 3D2PA 2AFWA 1OWXA 1HI8A 2QJ3A 4NF1A 2R2SA 4RLEA 1ZZNA 5CCMA 2MQMA 4MFKA 1TIQA 1FFWB 2V77A 3B78A 1UZHA 2PRBA 1YW6A 1ZLHA 2DHAA 5G0RB 3TAPA 1VISA 2DNYA 5IOLA 2I0XA 2BANB 1MLAA 1XK8A 4NYOA 3QBCA 5K5MA 2J7WA 3A12A 3MFIA 2FPHX 1KDNA 2XLIA 1J5EF 4O44A 8RUCA 4B9VA 3TE4A 4ALZA 4O3SA 3GCWP 3M2UB 5ETTA 1FO1A 5AG6A 3HSZA 2EBEA 3KK1A 1TL7B 2ADCA 4NXYA 3RB4A 4JI5F 4FYYB 4JV0A 4RW7A 1KLMA 2GZOA 4X4TA 2ZHBA 1X4BA 2O66A 3SQOP 2VPYB 2C22A 2VH7A 5DETA 3OVBA 3BF4A 3MECA 4KKOA 3MXHP 3GYAA 1RT6A 3CCQS 1JWQA 3TUIC 4H2KA 1K4JA 4ONUA 2XEGA 4NASA 2WCXA 3LP0B 4LBPA 1SKRA 5BYRA 2J6TA 1P9QC 5LJ3Y 5LM7E 4NLQA 2H4WB 3JAMY 5L1IA 2VG5B 4DV5F 5AJ3J 1HKAA 1FWKA 1UPMB 2LMIA 5A8KA 3LGHA 1DHMA 4ZDNA 2IHR1 3L7PA 4M6HA 1DFDA 5HSPA 3PR4A 4PWDB 1R0AB 2PJ9A 2DH7A 1EETA 3GV5B 3J7AN 2BYCA 1IBLF 1BXNA 1VBKA 1IKYA 4Q38A 4DX7A 1WWHA 3LP0A 3CDWA 3PRBA 2QTWA 3MMCA 3TA0A 2M0GB 2EWBA 1JLAB 1U2CA 1JJCB 3ILJA 4RUBA 1LWFA 5HATA 4OQJA 1NRKA 1TR0A 2BJ3A 4JI2F 3BDPA 4DCOB 2QSWA 3VAIA 2W7AA 2F1FA 4OYIA 1HBMB 1ZLIA 2MZRA 1Y3JA 3Q8VA 4I56A 2DYAA 3H5SA 3VGVA 2OJ3A 5LRJA 2F9DA 5C7PA 1WTBA 4L74A 1SV5A 1B70B 2KJVA 3FCVA 4USHA 2ZDPA 4E0DA 2PJ7A 4OYAA 5GVQA 1NHUA 3HT3A 1N8RT 1X4FA 2DCUB 1AZSB 3JYTB 3OD2A 3FBCA 2HZVA 4I69A 3ISXA 1WOSA 3X3UA 4UEEA 1Q78A 4DF4A 4YB6A 3UNYA 2RHSB 5EC4A 3H4BA 4KFBB 1M90T 1ARLA 2L41A 4K5RA 5CAAA 3M32B 5DZ6A 5KFYA 4WTYA 3BO3A 4UZBA 1C1BB 3AOCA 2FLNA 2EFOA 5D6GA 3BHXA 2J9DE 2AF6A 3M8PB 1S5ZA 3MURP 4JI2J 3FCHA 2JX2A 3EUNA 1S9EB 6FD1A 2FS5A 1H2UX 3MFHA 1HWUA 3GYXB 2KT3A 1FT8A 1JLEB 3DR8A 4JI3F 5CZXA 2V8PA 4USTA 3R95A 4EBDA 3M6UA 3OQ2A 1S48A 1L3KA 1TP7A 4CNYA 3PTWA 1OY6A 3BN4A 3VAHA 3UVJB 2MB0B 4CAXA 1FVQA 5F0WA 3EZOA 4B3SF 4CWBA 3QGHA 2FIAA 2VFRA 2JRSA 3G2XA 3PCOB 4M5KA 5GAEI 5I3UA 2H9ZA 4OI0A 4MJ8A 4ICLB 2B7CB 3J81U 2VICA 1H7WA 2GU2A 1KZFA 2HVIA 4NYPA 1S0VA 5L9XA 3AODA 5AJ3F 4A31A 2EFQA 3NKYA 1J5OB 3DXSX 2JEJA 1OQ6A 2QJ8A 4NLYA 2B9EA 3G86A 1SQHA 5KT2A 2ASYA 2B5JB 2BMBA 1I94F 4ECTA 4WWSA 2W24A 4HEA9 3T9YA 5A28A 4HHUA 2RRBA 3D67A 2AFZA 1N88A 3LANA 4OADA 3BXMA 1TVRA 4X4NA 3TZYA 1LK5A 2G0IA 1F2PA 4RNOA 2CQ0A 4K4VA 2JWNA 2U2FA 2L9WA 5E3PA 2M3DA 4ED2A 2CG4A 4H89A 5KFVA 3GV7B 2GNKA 1VQ4S 1U0HB 2YWKA 1MWZA 3TW0A 3CPWR 2RMLA 2YH0A 1S57A 3V6KA 4EUVA 2OPPB 2Y0SD 5FDLB 3D7HA 5DO2A 4WFZA 3THTA 2MJUA 2Q4YA 3CWJA 3K5MA 4DL7A 1H6KX 2CQ1A 2AWZA 2WVBA 2IA0A 1IIDA 4PWWA 3KJVB 3PX4A 2U1AA 1ZETA 5IZHA 2CQ3A 1N4LA 3TC8A 1YVFA 2D3O1 4R8UA 4ZKAA 4IRKA 5M2RA 1Y10A 5FD1A 1YRUA 4KV8B 3IWWA 5C25A 4MFBA 5A6WA 2OUGA 2HNYB 4OC1A 2L08A 4I1TA 5E0OA 1Y0HA 2RDJA 1RHQB 4M5DB 1XNRJ 4CO5A 3W2VB 4CYPA 4F02A 2BJ1A 4IG0A 5KFBA 4Q44A 1IKXB 3HXMA 2PVWA 4R7MA 1FNXH 3PHEA 2PI4A 4KORA 4WXOA 4DL0C 4JV1A 1M1HA 3B3CA 1TMJA 4CGMA 4A8OA 2CQBA 5G20A 2CQDA 1RAGB 5HROB 1DARA 3HSGA 3G6XA 4HNYB 1V9OA 5IV3A 3EX7B 2I6WA 3OR2B 1H38A 2DB1A 3G82B 3TVKA 2NYHA 2B4OA 4QR0A 1QSSA 2XWYA 2EW9A 1LAPA 2HIQA 4DS4A 4TLQA 4TYBA 3KMQA 4A32A 3PB4X 1WOPA 1C0UB 4OI1A 2WAQD 2I38A 1Z5RA 4EMDA 2Q04A 4RR5A 2R7RA 1M4IA 1FX4A 3T1YJ 4PPDA 2KCWA 4PWUA 2KG1A 4ZVFA 1KFDA 3AB2B 4JJXA 1RUSA 1URRA 4PUOA 3VR1A 1P27B 3UW1A 4O3OA 2AYGA 2O28A 2ASJA 3OL9A 3M05A 5B08A 4OFZA 5JUMA 5F47A 3Q89A 4LF7F 4I2QB 3MEEB 5C24A 4P4FA 2DHSA 2PE3A 2MQQA 1S97A 1KBRA 2PVVA 1JLCB 4C2MA 2WVFA 1IICA 2CIJA 2LEAA 1BY9A 3BV8A 4CDIA 2WTFA 4NCGA 1F3VA 1FKAF 1KVKA 1L0CA 2MHEA 3MM9A 3FVLA 1D8ZA 2WB4A 4RW9B 4JD6A 1IXKA 4UTGA 4OYOA 3DGPB 5F49A 5F46A 2NR0A 1RAEB 5J2NA 2CXEA 1TL4A 3ZZ0A 2P6GA 4XIUA 1RT2B 1N34J 3BYPA 4JLYA 4DLGA 3AXKA 2G4BA 4NXNJ 3FECA 4NLVA 4U9RA 3UN2A 4M1KA 2J9CA 2KHDA 3CXCR 1TTHB 1ZBTA 3KUEA 5KFWA 5D29A 1XR7A 4BDPA 3N9UC 2R1IA 3GWCA 5DDRC 2FGCA 3MI7X 2YKPA 1ZA2B 2D7SA 3JVNA 4RWXA 2AEMA 4LQ3A 4E2AA 1RU2A 3TQ1A 2H5IB 3DRXA 3PYGA 4N76A 2J7KA 5IT4A 1H3DA 1F2HA 2BVZA 1IB1E 3FSIA 2AJ2A 4PXBA 1K0VA 3FVYA 4C0OC 1XNQJ 4IR1A 1SQEA 3UD4P 1WEXA 2J9EA 5D4NA 4LF8J 2BRLA 1I5OB 2ZJQQ 4P52A 5CQGA 3RZAA 2EC0A 3FXTA 2YQ1A 1R8HA 4UFXA 5EX0A 2E5IA 2XYGB 2VODA 2ZE2B 1IU8A 2FVCA 5KFCA 2KM8C 1E6YB 2BJ8A 4ZJQA 1F6TA 1SL2A 2XI3A 4ZVHA 3SCJE 3HHNB 1N34F 4QR1A 3D4JA 2XHWA 2Q43A 2NPFA 3C19A 3R9LA 4FXVA 4OI6A 4DPUA 1LAMA 2QLFB 5EMIA 3LP2A 3M6WA 4JI7F 5KOWA 5CPAA 2AEJA 1TXRA 4NZ0A 4IOCQ 4NI2B 4Y28C 1S7NA 3QNVA 4HDGA 4USWA 5HVHA 3CCLS 4NA1A 2M88A 2OEJA 2COLA 4J9KA 3V4IA 3MM8B 5HI7A 3K7RA 1QSLA 2J8MA 1K44A 3BH6B 3IRXA 3C66A 1SL0A 3ISZA 2HNDB 5A76A 4QQBA 3RR8A 1QY7A 4Q2LA 1ZH5A 4LREA 4WFXA 3FFIA 5L1KA 4ID5B 3T6JA 3OR1A 4NMLA 2BE7D 2X3GA 2ZHOA 3FSXA 4CO1A 2Z11A 3PB9X 3R6GB 1SCJB 5GMKa 1ZA1B 4ZP6A 3OPKA 5LYIA 4NJRA 3NFZA 4MHPA 2JL9A 4K4SA 3FMBA 1DTTB 1GXLA 4XPDC 4I0WA 2ODFA 2O01C 1HL6A 3NNAA 4DN0A 4K5SA 1XEBA 2Q3PA 3HLUA 2I1RA 4JB8B 1MU2A 1X9SA 3CCUS 1IM6A 5JQ4A 3C46A 4O4GA 1JLBB 2AP6A 2B4UA 5HJYA 2CJAA 4DR2F 5E96A 3OJSA 2PR8A 2OOTA 3IGRA 2Q51A 5HANA 2WSFC 1QSRA 1LXNA 4ZPDA 2MGZB 2ZWOA 2OPSA 3IG1A 3TI0A 2XCPA 4MK8A 1RA6A 3LOUA 1L3TA 1YRTA 3W5YA 1ZM4A 1XE4A 1S4EA 2QL5B 3KDNA 4PPZA 3CC2S 3U1NA 5D4OA 4Z7YA 3I3GA 2HFZA 2AGQA 1U47A 3NH8A 3TNVA 1SH0A 4KH1B 3GYGA 2B5GA 1OMSA 5I3PA 1HR0F 3VQSA 2PJ4A 4TY8A 4LIWA 1LV5A 3VGTA 1XNQF 3PB6X 2FDNA 4WXWA 1IN0A 1WUUA 2FJBB 3VHQA 4CTAA 3FIXA 3MOZA 3VVTA 2HS0A 4EYIB 1GAOA 2HVDA 3KHXA 2CVIA 1U7LA 3F41A 4MK7A 1VQ6S 2HHHF 2UUTA 3D54A 5T14A 5ETVA 2FL4A 1XOVA 3PDNA 1OQ3A 5M2UA 1S7LA 2FT0A 3MEGA 4CAFA 4DHVA 1SPBP 4X62F 5HMZA 4K7QA 2HFNA 2OZHA 4J9RA 1GMVA 1GMWD 1ZPWX 1K73T 1YMEA 2J6UA 3M30A 2H1YA 3PM9A 4X4SA 6FDRA 2FHMA 4L8AA 3Q2SC 1ARMA 3IWEA 3BBFA 5FIIA 3PKMA 4WBFA 6AT1B 3FCWA 4AXVA 2VD3A 4NRTA 2P9CA 4QWCA 1S6PB 2FIWA 2BM1A 3VZIA 1HWLA 5DDOC 1IJEB 5B0DA 4USJC 5J1EB 5E3AA 5IXUA 4USMA 1S1VA 2B9YA 2C6GA 4NCZA 3TTHA 1ZO0A 4CAEA 4Y2KA 1S1UB 4LVNP 1QSMA 2IVFB 4YRHA 4FYWB 2MKSA 1JXVA 4WPAA 4QIWD 2WONA 3QIDA 1P1LA 2DD8S 2VC0A 4C98A 3FSYA 3MMBA 4NGQA 3V5RA 3UDEA 4E2FB 2MXYA 4H4MB 1S76D 3RRGA 3DLEB 3MMAB 4MKBA 1FD8A 4PSXA 2HBZB 3ZZIA 1IBMJ 5J1EA 4NMXA 5A2QU 5D3GA 3D7SB 2GFFA 1B0VA 1L5UA 2XBPA 3PYEA 1VRTB 8CPAA 1EQ0A 4ECUA 5KFUA 4FNIA 4MCSA 2HAIA 2PN6A 4FBEA 2FHKA 4LX9A 3DOMA 4D3HA 2WW8A 3OFGA 4OZ2A 3IR6B 1QTMA 2OU2A 1PSDA 4HYKA 3ZTRA 4Q8FA 4G1IA 3BGOP 4JYAF 3IGVA 5LL6d 3JSMA 4HL9A 1MSWD 1RAHB 1S77D 2DNKA 2C2ZB 2JLEA 1YDLA 4TXSA 4GO7X 2MKHA 5IQQA 3CD5A 4IAVA 3GJSB 3K2KA 3M8YA 3QJPA 3MAAB 3N4WA 4O4RA 4XPKA 1KTQA 3QWPA 3BB5A 5DG8A 1MNEA 3DRPA 4FDFA 1DURA 1TU0B 1CP6A 5KFJA 1VQKS 4DNCA 2HAFA 2QA1A 2E7XA 2ZKUA 3A8IA 3DRPB 3L4BC 4AG7A 4II9A 4B3RF 1Z4UA 3G6VA 2PJ6A 3F73A 2RQMA 2YWEA 3TZXA 4DV2J 5K8OA 3PRVA 3H2VE 1IWGA 3UCUP 1B99A 3QZ8A 3DLLQ 2N4DA 2ZD1A 3K58A 3FC9A 2FCKA 1OSCA 5CYQB 1K1SA 2VQEF 4LQ6A 2X1GA 3HT0A 3SJXA 4DXLA 4C2ZA 1MW7A 3MCSA 4ZOSA 3A9LA 1QM9A 4FBUA 3ISNC 4R0JA 3DU6A 4K2XA 1UVNA 2ZZTA 5E41A 2NYIA 2YNHA 4LUAA 4ECRA 3AD7C 4OC0A 2EKNA 3B2YA 4CLSA 3G3SA 1JWWA 1FWPA 4HR2A 2FJDB 5ETKA 3DM2A 2RSQA 2ZVSA 2XS7A 2FGOA 1U0SA 1RXOB 3HX9A 4L89A 3IBWA 2FHJA 3NP5A 3E3XA 4AQYF 2RAQA 1HBOA 1S59A 1FVSA 2HQIA 5D0GA 4OKOA 2HBQB 1K8AT 4LFAF 1G2EA 1N32J 2C2KB 3CB4A 1MMDA 1S1WA 5KG0A 1AUSL 1F9HA 4FKXA 4RWWA 5AE1A 1WKLA 3EGVA 4H6UA 3FYNA 2V2KA 3TOAA 4HH0A 5KFRA 3Q8UA 4Q7AA 2B6AA 3EXYA 2DO4A 3ZZYA 4OZLA 4C8MA 2XTJP 1Y5IB 2KG0A 4OJ3A 2AW0A 2HLUA 1UFLA 3V81B 1HBNB 4K4WA 5B0CA 1CC8A 2V0NA 2IA6A 4A39A 4DL6A 2XO6A 1R31A 2NXEA 4ECXA 4URGA 1UWYA 2PC1A 2CNMA 4BS2A 3GU0A 3U27A 3DU5A 4WP8A 1XERA 5F8GA 2BUEA 3TA2A 4ELTA 5ADZA 5KFDA 2AYBA 5H9FK 4ZVTB 2G0JA 3PJWA 2WBRA 2DGQA 4DSFA 5LSOA 2DJWA 4ZX9A 4OYXA 4OYBA 4HDHA 3KHRA 3DLKB 2J9DA 3HKZD 3HSDA 3QLHA 1YJ7A 2W8KA 5H84A 1QE1A 1VRUA 4DR4F 1T9UA 3UFCX 2VIHA 4UCNA 1M4GA 2H48B 1FJ7A 1CJTA 3R7SB 1H2VZ 3C14A 3T5KA 1FJGF 1R6YA 1PJ7A 4K4ZA 1BLLE 4OX7A 2W4PA 4BC9A 3KYLA 5A27A 4KHRA 1RACB 2VQFF 5F8JA 3HD1A 1UFWA 3T90A 3EMTA 4UFVA 1F3FA 3P3DA 1KHVA 4EBEA 4IOAQ 3QO9A 2AGPA 2DR6A 2DNQA 4IDKA 3W8GA 2ZEPA 2P6FA 2ZEEA 2UVWA 3OTOJ 2LCWA 2GHPA 2MGZA 2IRXA 3BPSP 1P4NA 2XC9A 3DR6A 4RKUC 2RB7A 3LO3A 3NGSA 2HQGA 4K50A 4L72B 1HEEA 5ITHA 2D9OA 2ZC3A 2XYPB 4YFJA 1RT5A 4DPYA 3R5BA 3MTJA 2MSSA 4LR7A 3S01A 2KL8A 2PR1A 1HQUA 3KQXA 3BREA 3PBEA 3S6GA 4OYPA 2WUUA 2R8HA 1N0UA 3F56A 4WKYA 1JNZB 5KFXA 5DGBA 2ZM6J 3KK3B 2G2YA 2WZNA 1N48A 4XTTA 5HQMA 3NCPA 3QZ7A 2EK1A 2PJ5A 1KOHA 2GQCA 2AJ6A 1RP5A 2JNJA 2ALYB 2VPXB 2BABA 1HHTP 3TP2A 2RVJA 2DGVA 3MHYA 5HQ8A 1X0FA 4LFAJ 4X4RA 5JM6A 4M6GA 1HQ2A 4HHHA 5KG6A 3SV3A 5F8MA 4FAIA 4UIBA 4K3NA 3VH9A 4LF6F 4JYWA 3CMES 2POKA 3L9ZA 3V38A 4F0MA 1CS4B 1VHEA 1FTRA 4ZVEA 2FVQA 3SEOA 1T9WA 3G6YA 1F2GA 3D5MA 3SI2A 4LRFA 1CP7A 4BCAA 1FX2A 3CT9A 3SSSA 1RWMB 4MHZA 3IA0A 2V4JA 3G4SS 4LFBF 3FDSA 5KT7A 3ONQA 4MBUA 1EJ7L 4XDDA 4ES3A 1N5YA 2PSZA 3TARA 4DV6J 2ZJPQ 3LP2B 2FVGA 4DSIA 3IR5B 4HVZA 5C82A 3Q0AA 5EUHA 2ZZNA 3E01B 4AL6A 2B4VA 2KN4A 4MFZA 1D1UA 1Z9UA 3TO7A 3ITHA 2UVVA 2QFJA 3LWLA 1QJHA 1RWNB 4IFVB 3TO8A 3SJFA 5A8WB 5BR8J 4ONWA 1XJWB 5GMDA 1FESA 2FLPA 5DDQC 2GLJA 3PW7A 4CYUB 1RAIB 2Z8QA 4ZVQB 1HBNA 2KJWA 1XMOJ 3CO0P 2GA7A 3A8JA 1AZSA 1X4DA 3QATA 5HROA 2OH2A 2KVQE 4AT1B 3TT2A 4LF6J 2C3UA 2NSBA 2HBRB 1E6VB 3KKFA 3V6DA 2XY6A 3A3PB 3DRRA 4F4XA 1U24A 2HIYA 2X51A 1VOMA 1WHYA 5HMWA 6CPAA 3Q2TC 3M9OB 2C2DA 4LF9J 4NCBA 4YR0A 3G87A 1GYTA 2OMLA 3KK3A 1HBMA 5IM0B 2W2OP 1AW0A 4AG9A 4FD5A 1B64A 4UW2A 3HF5A 2Q79A 5AG7A 5KG5A 2XMTA 1ON0A 2ZH2A 4TNUA 3Q23A 4B10A 1SC4B 3W5ZA 4OHVA 4CLUA 4X2BA 4KZTA 2Z3NA 2PDAA 2OI2A 1TKTB 4IH5A 1UEKA 3M9MB 1ROFA 4F04B 3DRYA 2V4QA 5HH1A 5KFSA 4DV3F 4AL5A 1X9MA 3PZJA 2WSCC 4BINA 4F4AA 4A8QA 5BR8F 5H86A 3RBZA 4X62J 3M1VA 4QIEA 5GMEA 4QBJA 2PEHA 2ZBQA 3QYYA 2VONA 1QUPA 1HNWJ 1KP6A 4O4GB 4H4OA 3K17A 3QT6A 4IG3B 4UY8T 2Z3OA 2IM2A 3HHLA 3LPYA 1W7WA 2ZD1B 2ATRA 3TA1A 1H98A 1S7FA 1VHOA 2ZBIA 3ZTPA 4KR0B 4F67A 3A3OB 2SXLA 2VQYA 2GMHA 3LALA 3KLIB 3IFEA 3MMBB 2YWHA 4MAKA 1DTTA 2DGTA 2PDOA 4WZMA 2ZH7A 3KJQB 1AUGA 3KR5A 4YFUA 5LRGA 4IO1A 2DRBA 4CPAA 1WG1A 1B3TA 2BE2B 3CD6S 4DSEA 2HHXA 3OSNA 2VZ9A 1C0UA 3KUHA 3JSMB 4DV4F 5B7WA 1TKFA 2QFIA 3ETMA 2IIHA 3D1OA 9RUBA 2W4DA 4JV2A 2HHSA 4KIAA 2ZOFA 2YWFA 2ZFHA 4WK3A 1UAWA 4UQGA 2KFNA 5J1PA 1QMUA 2IJFA 4K59A 1FD2A 3UCZP 1O0PA 4ZS6A 3SYZA 5IT9Y 1RB0A 2VL1A 4KVOE 1GNKA 5G22A 2KO1A 1U2FA 1R89A 3OXLA 5ETNA 1KUVA 3R5GA 1H7XA 4LF1A 4I7FB 5JVGQ 4I67A 2UU9F 2ZENA 5H9FJ 4DPXA 3QPIA 4G3IA 5DG7A