3ISZA

Crystal structure of mono-zinc form of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
376
structure length
369
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 122
structure length 369
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iszA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iszA01
1LCPA 2AFMA 2PJBA 4MCRA 4MCSA 1VGYA 2CIJA 3IWWA 4P4JA 2ANPA 1AMPA 2ZEOA 2ZOGA 1TXRA 3S9LA 2RFHA 7CPAA 3HLPA 3VH9A 3KI9A 4OMEA 2PJAA 4UEZA 3N5FA 2GU2A 2NYQA 3FJUA 1ZG7A 1PCAA 1GYTA 1YMEA 2NSMA 1KWMA 1BPNA 3LMSA 5LRGA 3RBUA 5K8PA 3BXMA 1XBUA 2JBJA 2BO9A 3D68A 1Y0YA 3BI1A 3KL9A 4Q7AA 2EK8A 3T8WA 2C6CA 1XMBA 4ONWA 4WJBA 2HB6A 3FF3A 4A37A 3PFOA 2PE3A 2CTBA 3CPAA 2PJ4A 2ZEGA 3FEEA 1Z8LA 2GREA 1HDQA 1TKHA 3KZWA 4ZX9A 2PJ9A 4FUUA 3K9TA 3IIBA 1PYTB 2AFWA 2DEAA 2V77A 4IHMA 2PJ2A 2PJ0A 4FAIA 3V38A 3KQZA 2F8HA 5LYIA 2V8GA 3KR4A 1RTQA 2JBKA 2G9DA 4KSIA 3D66A 2C1CA 4P4FA 1LOKA 4PQAA 4OIWA 1LAMA 2PJ8A 1CP6A 3GUXA 3GLJA 2ZEDA 3PB6X 3CT9A 1OBRA 4MHYA 3WT4A 3FEDA 2AFXA 4PXBA 4ZX8A 3LWUA 1ZLHA 4R76A 1YSJA 4OC1A 2WYRA 3NH5A 3PFEA 4P10A 4P45A 1R3NA 3SJXA 4BD9A 1CPXA 3H8EA 4MCPA 4OP4A 4OC0A 2CTCA 3H8GA 2WZNA 3SI0A 1CPSA 1VHEA 4P6YA 5I4MA 4MCQA 1AYEA 2PJCA 4MHNA 4LQGA 4EFDA 3B3VA 4F9VA 3WC6A 4JZ0A 5LRJA 1ELLP 4NGPA 4MHZA 1FNOA 2PVWA 2J9AA 1TKFA 3B35A 3D67A 3B3TA 3SJGA 1ZG8A 4OC3A 8CPAA 4UIBA 3PBEA 4WWVA 3TX8A 3H8FA 1H8LA 3KHZA 2Q43A 4G1PA 5IB9A 3WC7A 2QYVA 3KASA 1QMUA 1CX8A 1F2PA 3K2KA 4CPAA 3VATA 2BOAA 1R43A 1TKJA 1IGBA 2PCUA 2ZOFA 1TF8A 5DS0A 5LYFA 3RZAA 1IY7A 1CP7A 4OC4A 2FVGA 2AFUA 3D7GA 4X8IA 2OOTA 4NGTA 2IJZA 1ELMP 3FH4A 5F09A 2O4HA 4MHPA 4MXUA 4EWTA 1QQ9A 1Z2LA 1Y7EA 2CF4A 3TC8A 4UIAA 4IK2A 4R8FA 4ZY2A 2AFSA 2ZEFA 1EE3P 3B3SA 4GM5A 1VHOA 4NFRA 3PB4X 4TWEA 2ZELA 4YWYA 4K3NA 2VL1A 3B2YA 3QNVA 4NGNA 3HUVA 5J1QA 5JH9A 1UWYA 1HDUA 1FT7A 2Q4ZA 4YU9A 3SJEA 1DE4C 3WC5A 3B7IA 2AFZA 2OR4A 3FECA 3DLJA 3B3CA 3KR5A 3S9MA 2PVVA 2QVPA 4FWUA 4NJRA 3KHXA 2AFOA 4PXDA 4ZYQA 3L2NA 3IO1A 4P4IA 1LFWA 4P44A 1YLOA 4A38A 4FBEA 4R7MA 5THWA 1XJOA 3BHXA 2POKA 3I1UA 4NGRA 3PB7X 3JRUA 1VIXA 1ARLA 4ZY0A 4MMOA 2GLFA 2ABZA 5K8OA 2I3CA 1CBXA 2PJ5A 3B3WA 4DYOA 3IJ3A 3BI0A 6CPAA 2GLJA 2PRQA 4P4DA 4F9UA 3WABA 4ZI6A 3KGQA 3ISZA 2Q51A 4TNUA 4OC5A 5CBMA 2F7VA 2JEWA 5D8NA 1M4LA 4O23A 3MRUA 5ELYA 2EK9A 1BAVA 1Z5RA 2PJ1A 4IAVA 4OC2A 1LAPA 3PB9X 1DTDA 3S9NA 3DGVA 5JM6A 3NH8A 5HVHA 4A39A 1ZG9A 2ZEMA 2PIYA 3D4UA 1BLLE 1ZLIA 4X2TA 2O53A 2QJ8A 4R6TA 2PIZA 4PXEA 2PJ3A 3FX6A 3FMCA 4A94A 3PEIA 4W9YA 4NGSA 1ARMA 3IC1A 1Q7LA 1JQGA 3SI1A 4UEFA 4OKOA 3D7HA 4DJLA 1TF9A 3PB8X 1XRYA 5HXDA 2HC9A 4UF4A 3IFEA 2C6GA 2XEFA 3FVLA 2PJ7A 5K8NA 2ZENA 4Z65A 1NSAA 5LYDA 4AXVA 4PPZA 2XEJA 1BPMA 5K8MA 1F57A 2ZEEA 4OIDA 2V8VA 4B6ZA 1Y0RA 2ZEPA 2RB7A 5D29A 1LANA 4DUKA 2XEGA 3CPXA 3D7FA 4H2KA 2XEIA 4EMEA 3SJFA 4NJQA 1CG2A 3MN8A 4NGQA 1F2OA 2ZEHA 5LYLA 5JGFA 4X3RA 4MRIA 4RUHA 2V8HA 1YW6A 4PXCA 3NA6A 3PBBA 5CPAA 2BCOA 1HEEA 4NGMA 3SI2A 3VARA 3RAMA 4P4EA 4ZY1A 4F8ZA 2PJ6A 5LRKA 4P4BA 5HVFA 2V8DA 3V7ZA 3NH4A 2IQ6A 3PRTA 4UEEA 3IEHA 2IMOA 2C6PA 3NFZA 3GB0A 5HVGA 2EWBA 3CDXA 4JYWA 3ISXA 3KQXA 1YW4A 3D7DA 1XFOA
chains in the Genus database with same CATH superfamily
1LCPA 1N34J 1UFHA 2KVIA 2VA3A 1U49A 3EVWA 2JFDA 5IC4B 3MEEB 1T11A 2Z2ZA 4H6UA 3BN7A 4XNHB 2BJ8A 1Q2CA 5LMUJ 3LMSA 3UR3C 1X4HA 1XBUA 3U1NA 5E5NA 4HPSA 5BJRA 4CYUB 8AT1B 4X2BA 4CM0A 5E3PA 2GHPA 5CHCB 5EN1A 4OYPA 3B82A 4DR4J 4RW8A 1XEBA 3VGTA 1RTIB 4KYZA 2QTWA 1WUUA 2CZ9A 5FDLB 2R2UA 1XR7A 3IWEA 4HNXB 5DQGA 2XULA 1HNZJ 2UXCF 4LQ3A 4DR3J 1YTYA 4AVCA 1U1PA 4J7CA 1B64A 1U1KA 2AX0A 2WAQD 4P4FA 2WCXA 2G0IA 2EUIA 2B7CB 3LD2A 3HSJA 3J7YI 2CQDA 1U0HA 4DN9A 4ATNA 4BBHA 1ZPWX 5SUHA 3KJNB 2EK6A 3AD8C 1F9FA 3LWUA 4OC1A 3FIXA 4QU7A 1ZA2B 2ZD1B 3BO2A 1KUXA 3B8HA 5H9FJ 4PABA 2KB2A 1NKEA 4HL9A 3RYOA 3MUMP 2CWKA 1HR0J 5H84A 2B8PA 2E5JA 4TU9A 1WSRA 4C98A 3QPIA 4OFZA 4F04B 3QBCA 4O3SA 4HHHA 2B4VA 3OTDA 3W2WB 1M1HA 1I21A 1RI7A 2LP4A 2GGPB 1LW2A 4JI5J 1PU9A 2B4DB 3WC7A 2R8GA 4KGXB 4OYXA 2ZZTA 1HBOB 2LQ9A 3I5BA 1CULA 2ASYA 4A8MP 2FJXA 4ZPWR 4W92B 2ZKUA 4JJXA 4ZHRB 5T41A 4ZLJA 3P96A 3N6NA 1NK8A 5GAGU 1MN7A 4UFXA 1WDTA 3QWPA 5AXMA 4QYZJ 4NPOA 2DO0A 4ONUA 1KKHA 1VHOA 2IRUA 3KJFB 3PB4X 5D8HB 3B2YA 4FYXB 2RIJA 2RUGA 4ED3A 2VQEJ 4QBJA 5JH9A 3L09A 1OS5A 3CCMS 2EC2A 2Q4ZA 2VU5A 1S4FA 3QT5A 3S9MA 4M6GA 4K4TA 3PR5B 2A18A 1EIYB 2F9DA 4DF4A 1Y5IB 2B4UA 4KUBA 1P0HA 4BHQA 3EDRB 2Z3KA 2F4VJ 1VIXA 3AJDA 2E1RA 4NE9C 4KFBA 1W7WA 1FI4A 1KC8T 5KFYA 4ICLB 2LDIA 5A8KB 3C19A 1YBAA 3KJVA 1NMTA 4TYBA 3VWSA 4KGVB 3DRXA 4DQQA 3BKTA 3Q83A 2J6TA 2A2CA 2RAQA 4NLPA 1S6PB 4FNHA 4IH7A 2ACMA 3PR4A 3CCZA 1UPPA 1LAPA 1TKTA 4PAAA 4LF5F 1KFDA 1BQMA 3GR1A 5AG5A 1GXLA 4DUZJ 4KOYA 2Z0GA 2DEJA 1VRTA 2Z3PA 1HQEB 1OPIA 2XYPB 3V4IA 1RXTA 3KLVA 1WF1A 1YQEA 3S1TA 4A32A 3SI1A 3MM6A 1YVFA 5A8WB 2WVDA 1VI7A 4UF4A 2C6GA 1X31C 1HWIA 3ET6B 1U02A 5KT2A 2GMLA 3G6YA 2P6SA 1X4CA 5HROA 1ICEB 3ENVA 4PG5A 4MJKA 4ALZA 2CJAA 5GMDA 5BYSA 4KV8A 3FBEA 1F0XA 3AD7C 1U1NA 3C16A 5SZTA 5AE2A 2W7PA 4QIWD 5J8CA 3M2RA 3CWJA 4JV5J 4CM2A 4DZDA 3M2VB 1HMVB 3V81A 4H89A 2WSEC 4F4ZA 1FDDA 1ZM2A 4KRWA 3FQLA 2V8HA 2HHHF 2P6FA 3QZ7A 3PYDA 3LUYA 4PXCA 2FLPA 4B13A 1QSNA 4ZY1A 2E7WA 3FK4A 2UV8G 5L8RC 4F0YA 3ZTQA 5ETVA 5GVQA 2R7UA 3TJ8A 4IYQA 3A3OB 3F41A 3NGTA 1T9XA 2R7WA 3KOAA 4K0KF 4HR2A 3KQXA 4ORFA 1XFOA 4C9DA 2PJBA 3CXSA 4UT4A 3KLIA 3BGRA 3MF5A 1YIJS 1Q2YA 3AT1B 3HLPA 4FN5A 1TL7B 2DXQA 5IT4A 5DWMA 1S1XB 3OR2A 4ERDA 4F6AA 3TARA 4QWAA 3FNCA 3TUPA 2Z58B 3M8PA 2YKOA 2WRMA 4USUA 4WCEQ 3QO9B 3LP0A 5DJBA 3RAXA 2MDAA 2VBZA 4RBVA 3EXNA 3F56A 3MURP 4WKYA 4HDHA 1KLMB 1HWUA 5CXTA 1Y00A 3Q89A 2C6CA 2B43A 2KZMA 1NHVA 3CCTA 3GCXP 1W2IA 4RW9B 1F5BA 2DHSA 2PT0A 2VZZA 2JLFA 4ECTA 2GZOA 4R9MA 3D6TB 4WFBQ 3F0AA 3TTHA 4F0HA 2HBRB 3NKYA 3KQZA 3M30A 1TZ0A 3JVNA 1C1BA 2ZWOA 2C1CA 1L3UA 4CAVA 1UW9A 1W26A 2F40A 2HHTA 4ES2A 2WVFA 3CSKA 1NBEB 4P45A 2QE5A 1RT3A 4BD9A 1JKHA 2PGCA 2J8NA 1NKBA 4OP4A 3H8GA 2PI5A 1FWPA 1VOMA 4YS2A 1RHUB 1WHXA 2JLMA 3I4PA 4DSLA 2OMOA 2MQNA 4DCJB 2DCUB 2BQRA 1SB6A 4LQGA 3AXKA 4M5DA 4WYLA 4ZMMA 5BWAB 3IR7B 5AJ3F 2AT1B 1JJHA 3PCOB 2M2BA 1FF2A 4Z37A 3GFYA 4CTAB 1NH8A 3Q8YA 5HBMA 5JPHA 3C6TB 2RU9A 2MZRA 1JNRB 1NZAA 3HVAA 2X1GA 2VONA 3LANA 3KDNA 5J2NA 5J2PB 1T05B 1KVJA 2NPFA 5C42A 3SCIE 2DH9A 4CPAA 2DNMA 4LSNB 5KFMA 1IGBA 3MM9A 4LFCF 5HN0A 1XOVA 1SJQA 3T9NA 4MK7A 3W6XA 4OJGA 4X65F 4AT1B 3H4QA 2QFIA 3SDEB 4XO0A 4R25A 2R8IA 4PPDA 1HD0A 2DNRA 1KQSR 2LDYA 2UXCJ 2DPJA 1RTHB 2CF4A 2W2QP 2H5EA 3GFXA 3ZZ0A 1QTNB 2HVIA 2OELA 1FXRA 2W2PP 4GM5A 3AHPA 4CGPA 4LF7F 4ILMA 2ZELA 1T9TA 4K3NA 1SV5B 4WZQA 4TN2A 3MGJA 2MKJA 1O8BA 2Z0ZA 1HDUA 3U02A 3QJPA 4CO2A 2VPWB 1U7LA 3TZZA 2BQUA 2AX1A 2AFZA 4QCLA 2RQCA 2RS8A 2B7BB 4LUBA 1PIEA 3FQKA 2Z3NA 1Z1ZA 1FJCA 2VIHA 1S5ZA 2HG4A 5THWA 3MR3A 1WC3A 1S48A 5A27A 3Q0AA 3ITHA 5K8OA 5KG6A 2Z57B 3KNAA 4OYIA 2E1AA 4XPEA 5C7PA 3CJ0A 2DPIA 2W9CA 5KG1A 2R8VA 4WWSA 1F9HA 3JSRA 1AXQA 3OJUA 3A1YG 3HK2A 3ZZIA 3MMAA 1VQPS 3CD5A 2Z56B 4C3MA 4XDCA 4X4TA 4R8UA 3CE8A 2E29A 3V4MA 5IWAF 1Y7PA 3PEJA 2DR6A 4O23A 4OHZA 2X7BA 2ZH6A 3IMQJ 3OW2R 3R5BA 2R7OA 2ZKTA 4A39A 3Q8QB 2OB0A 2BRLA 2YKNA 4KOXA 4PZVA 1RHKB 4DCPB 2A10A 2DGVA 2CJQA 2RRNA 4EO6A 1DHMA 2JLEA 1KP6A 4UEFA 3JXOA 3D7HA 1SI9A 5K8NA 1TK5A 1QSLA 3CGIA 2HYIB 1YJTA 3UI3A 1RSCA 2LYVA 3HT3A 4DS5A 2CPZA 5D0EA 2VQYA 3CPXA 1NB2A 1PUAA 2MY8A 3SJFA 3CJ5A 3RG6A 1ZBTA 3HVTA 5JVHQ 1WF0A 2DNPA 3IRXB 3BJ7A 1NJZA 4LJMA 1WD6A 3S6HA 3OLAA 5ETTA 1ZYQA 1OY6A 3K0JA 1QTMA 5HLFB 3V7ZA 1FA0A 3T90A 4DPWA 4FD4A 2AJ1A 3T1HF 2B6AB 2XWXA 2XQCA 4U96A 4JXRA 4YR3A 5F41A 3HHLD 4F3MA 4PWDB 3D7DA 2QZ8A 4ED1A 3CCWA 2LQJA 1GMUA 1S0NA 2W4CA 3RUBL 1Y10A 5LJ5Y 2QYCA 5HMYA 1UJ5A 2RFHA 5ETSA 5IV0A 3FB3A 4WBFA 4ZPTR 2PJAA 3EM1A 3KLFB 4L8AA 1K0TA 3SXOA 1N5QA 3QJLA 3G71S 4I0WA 1GYTA 3JSBA 3VAIA 1KWMA 3QGPA 2ZBCA 4UBRA 2HS4A 5F8GA 1PJ7A 1NEEA 2D4OA 4LF5J 3A3NB 2XO6A 3SXNA 2C2KB 3MR7A 4H6ZA 4QPTA 4HKFA 3PTWA 3KL9A 3ILOA 4DSIA 2ATRA 3CJ2A 2REFA 1M5VC 4UY85 1F9EB 3C2PA 1E6VB 2LU2A 3EZ5A 4KLWA 1WEZA 1SC1B 3V6DA 4OJ3A 3GIIA 3KG0A 2HV2A 4HT5A 5F0UA 2HMIA 1GQEA 3CXQA 2PD1A 4IHMA 2DEAA 4QOTA 5KOXA 1UWBA 2M0GB 2VXKA 4KSIA 1YVOA 4JXQA 2HNDA 2V9WA 4OZJA 2F4FA 4TKTA 2E5GA 2EW9A 2ZEDA 1OBRA 1OZPA 1Z4RA 2HHHJ 1SH3A 5HQ8A 2CJXB 5FVJA 2AV5A 3PM9A 2IC3B 1WORA 3HD1A 2MYFA 5F9LA 2XMMA 3LO3A 1LRZA 3KWMA 1U6BA 3PRVA 3UCZP 2D3ZA 1LK7A 2GO9A 2CQ4A 1RP5A 4AG7A 3HHLC 4UCPA 5I4MA 3JTKA 2RUSA 2V4JB 2MPUA 2WZ1A 5KG2A 1BE4A 4ZA1A 3IS9B 1TKZB 1TKFA 4B5OA 3EY5A 4BC9A 3TZYA 4OYZA 1FJ7A 3UD4P 1S7NA 3RU0A 4WWVA 4AG9A 4K50A 3TAPA 4USHA 3T6JA 4OIXA 2QV6A 3CC4S 1YJVA 2R7TA 1Q79A 2Q7BA 4LRDA 2XY5A 3UNGC 4OI6A 5JXSA 1WK4A 3S6GA 5AG7A 1R7IA 2XMUA 4MAKA 1TK8A 2R7HA 2XSJA 2MB0B 1M1KT 2IY5B 3RTVA 2D9OA 4OC4A 2DK2A 4LIRA 4MK8A 3NOCA 4RW8B 2X1AA 2DR5A 3PV8A 1X5PA 3NNAA 3OR1B 2R1IA 3CW2C 3K5LA 2EKNA 3SFGA 1I3OB 2A3JA 1QQ9A 4IK2A 4P2XA 4R8FA 4WTYA 1BWEA 3TAMB 3PGPA 1UFKA 5ETMA 4CQ1A 2IPOB 2YKQA 3W9IA 3KUHA 4Y00A 4MT1A 4JD6A 4QW8A 2KKHA 3BH7B 4FXDA 2HAIA 2QL7B 3SJEA 1YJUA 1FDAA 1Q16B 5H9FK 2W2OP 3B3CA 2Z3MA 3J7Z5 5CYMB 4O4GA 4KLVA 1X4AA 2KYZA 1SUQA 2MMYA 4ED2A 4OQJA 2BANA 4P44A 4IRKA 2KJWA 4CYPA 1XJOA 1KTQA 1PKUA 3DYAA 3A12A 2C42A 4LFBF 2MQLA 3BPSP 3N9UC 2GLFA 3MD1A 1BHNA 3CTRA 3HT0A 1GH8A 1XIXA 1FDBA 2CQ2A 4A2ZA 2VASA 2H5MA 2FLNA 1RT7A 2PRQA 4E2FB 1UFLA 2RKIB 1S10A 4WK3A 2NPIA 2JLGA 4LR9A 2AYMA 1BMQB 1HBNA 1S0MA 1L3KA 2HBZB 5AXKA 4CAEA 3J81U 3BN4A 3BR9A 1M4LA 2Y1RI 4MKAA 3CCVS 1CULB 3QIPB 1XK8A 5DQIA 4R57A 4LF4F 2RU3A 3I56S 3TEGA 1V9OA 4LFCJ 4LRFA 4OYOA 2PIZA 4QYZK 4X65J 2WPWA 1TU0B 1RAGB 4W9YA 1NK6A 5LSLA 1DQAA 1Q7LA 5IV4A 1IJEB 3GJSB 1FKAF 5J2MB 1HW9A 2JEVA 1RAOA 3H42A 5K14A 5KFQA 1WJ9A 4ZVPB 2G0CA 4LF7J 3Q86A 1YJWS 1F57A 2AD9A 2V8VA 3ZZRA 3RBDA 5EX0A 1JLAB 3MR6A 5JJBA 1S1WA 4FD5A 4KR0B 3T41A 1NB7A 3FBUA 4U5YA 4CO0A 1V6HA 4M5HA 1T9WA 4NJQA 2NUUG 3UY5A 3FGVA 3S01A 1KN6A 4C8YA 1QE1A 1MMDA 4NGQA 3IU2A 3MM8B 4LQ6A 1IB1E 2UUBJ 4L73A 1NRKA 3QWUA 5IX3A 1OQ3A 4OHWA 3DXBA 3MEGB 1GNKA 3GKRA 2NUHA 4DL3A 2ZHOA 1SXLA 2K7KA 1X0PA 3M1VB 4G1QA 1EAYC 3NH4A 4ZCLA 2IQ6A 2OD4A 3PRTA 3UCUP 2XCAA 1KFSA 2CNNB 8RUCA 3TA2A 1YZ7A 4O44A 4MCSA 3PO5A 4EMDA 2CIJA 4M5JA 5EX3A 4DL4A 3O3LA 2CQCA 3OFHA 1CJKA 1PAEX 1EZZB 1MW7A 3AJ2A 2XHWA 2DR7A 4CNYA 5HAOA 1HW8A 4A8KA 5IOLA 5IWAJ 3FJUA 2HHUA 2QG9B 5C5JA 2IMWP 1VQYA 4ZPBA 4Y2AA 2ZJRQ 1BQMB 1F60B 2CAJA 3D68A 3CIZA 2ZPAA 4M5IA 2VDIA 4KVOE 2BL1A 3B6BA 3HLUA 1Z8TA 3EGNA 4JI3F 1KHVA 3J7AN 1CS4A 4FXWA 3GP9A 3LF0A 4IUFA 3MM6B 3SBMA 4DDFA 3S6FA 2FJBB 3MOZA 2CADA 3BV8A 2FCKA 3W62A 4H4OA 2KI2A 1JLCA 3LP1A 5K20B 5KFPA 4LFAF 2DCLA 5A6WA 1Y4ZB 2LVWA 2PJ2A 3T9YA 3GIKA 3N5BA 2GE3A 3DM2B 3KR4A 4YDXA 4QVTA 3RBZA 4OX8A 4Z7YA 2YNCC 4KOSA 3UO0A 3VZHA 5HQMA 3PDNA 2RJZA 5B7WA 1CJVA 2MZ1A 3V81B 4MFLA 2HLUA 4B12A 1MU2B 1QY7A 4ZX8A 3H8YA 1KQGB 1Y0HA 2VC1A 3K5OA 4PQUA 2ZXVA 1S3ZA 4X4OA 3UQSA 5DG9A 3G82B 4ANDA 3T1HJ 5J1EB 4DV0F 3BYRA 1ZM9A 4OZ3A 1S0OA 4CLZA 1IYLA 4USJC 2ZJPQ 4F9VA 4IDKA 1ULRA 3G8TA 2MLXA 4WP8A 2I1RA 5EWEA 3TP2A 3KLIB 1M5OC 1X5SA 5F8HA 3FYNA 1XMQF 4AD6A 3MHYA 2XMAA 3V8IA 2DY1A 3FEYB 5HI7A 2Q43A 5KT7A 1FJGF 2G3AA 2AW0A 3M8PB 3M6XA 3RR7A 4JI6F 4ZITA 2XS7A 1F2PA 2KHDA 3DU6A 4F0KA 3G8WA 3LP0B 4UW2A 4V19J 5LM7E 4LF8F 3ZZTA 1NH7A 2AZ1A 2H65B 4KORA 2KCWA 5HQLA 2BKPA 3W63A 2NYIA 1JLFA 1EJ7L 4ZVTB 2HQDA 1J5OB 3EZUA 4C11B 1TKXA 2OOTA 4M6HA 3UD5A 2IFXA 4MHPA 4MXUA 3E01A 4DQPA 3NBPA 2RRBA 4UIAA 2OSRA 3QAUA 2Z8QA 1FKOA 2QX0A 2JJ4D 2C2ZB 1RTJA 2P2CB 1B70B 2V2KA 3Q8RB 4ZJQA 2CPDA 3M30B 3H7HB 4MFJA 2KU7A 1LW0A 1S9GB 1H38A 1VC5A 1RHJB 4OYAA 1D0EA 4K4VA 1Q8KA 3DLJA 4QWDA 5I3QA 4MTPA 2L41A 2AYBA 2KT3A 2YBVA 1RT3B 4LF1A 2CNMA 1LWEA 5KT3A 4DR6F 2MQMA 1P9YA 2VG6A 4XTTA 4XIUA 2YH1A 2QA2A 4NLWA 1Z9UA 4JP8A 2PR8A 4ZCKA 1CBXA 4QR1A 2BJEA 4DYOA 4M5DB 4P7TA 3R97A 2IJRA 5G0RB 1IBMF 2VKRA 3PVXA 3NGRA 3KGQA 5F49A 3SV3A 4ID5A 5HBMB 1FCAA 4OC5A 5A76A 4DPUA 3CCLS 5J2NB 5C42B 3OBIA 1S1VA 4CZCA 3PX4A 4IR9A 3S9NA 4KB7A 3DGVA 2JVOA 2RF2A 3OTBA 2BW7A 3MM9B 3N0VA 4PSXA 2KT2A 5U47A 5D77A 3T1YF 4OI0A 4NGSA 2RRAA 4PCQA 4LBPA 2CNLB 4OJ1A 1KUVA 1WG4A 3CCUS 1TF9A 1S0VA 5CH7B 2PJ7A 4A46A 2RSQA 2A1BA 3ZTOA 4Z65A 5KFNA 3DHWC 4RNHA 1FJEB 4IH5A 2AYGA 2P5VA 4Y65A 1JIHA 4CLYA 4NYZA 3BBBA 1DTTA 1SKSA 2GCFA 2JH3A 2XEIA 3T5KA 4LMZA 1WELA 4RU9A 1NSLA 2CIMA 1V3RA 3GYAA 2XB2D 2DO4A 4MKBA 2WSCC 2KM8B 1HL6A 2C3OA 2HAFA 2P9EA 5BXIA 4P4BA 3CDUA 2V8DA 5IQ6A 4LFBJ 2CPXA 5IQQA 2PE8A 3CDXA 4C6AA 4ZGYB 2ZUGA 2HVZA 1HHSA 2QL9B 5I42A 2O1PA 1JXEA 1KLNA 4MCRA 2YPYA 5JMNA 4EO8A 4J9PA 3G8SA 4IFYA 3PHEA 3VV2B 3MUVP 1RHMB 3MMAB 2UUCF 4USIA 4LSZB 3J80Y 1JLGA 3FXTA 1RA7A 1Q78A 1Q5VA 2HEKA 4UTGA 3MCSA 5KFLA 1MROB 1GX6A 4LF4J 3TUJC 3HULA 2YKNB 1NXIA 3D6MB 4MH8A 1UETA 4DXLA 3TVZA 1F2GA 4CO3A 4F7VA 3ILJA 4OI4A 3RBEA 3RR8A 4QYRA 3DFEA 3EICA 2XI2A 1N4LA 2YX7A 4X4RA 3B78A 2DNHA 4ONWA 2JEIA 4II9A 4OX6A 2IJFA 2CPJA 1LOUA 1Z8LA 1XJWB 3KZWA 3WDOA 3EJMA 4KPYA 1VHSA 3GR0A 4Y49B 3GSDA 4FF4A 2GAHC 2HFUA 4BCAA 2GJFA 1KQFB 4X4QA 1IBCB 1N54B 4XK8C 2FY8A 3CT9A 2ZHAA 5DGBA 4ZKAA 1S6QA 3K5NA 1TL3A 3P2HA 1YSJA 1AROP 5IC6B 3N6MA 2N3OA 1JXVA 1BGXT 1PO6A 2G0BA 2IL4A 1X4GA 1TL4A 3BS9A 4FDFA 2JDJA 4I6WA 4P6YA 1SJ1A 4NLUA 3UN5A 3PW7A 4MCQA 3T6BA 4A8WA 1ZZFA 4TYAA 5IS2A 2MSTA 4B9TA 2J8RA 2PMZD 3IBCB 3BGOP 3C15B 5B08A 1BY9A 4RNFA 1ELLP 5KFEA 1FXDA 4B3SF 1UAWA 4NCZA 1FNOA 1KVIA 1A0OB 4QIFA 4K4XA 2BSWA 4EYIB 1U0SA 4MYUA 4FYYB 3KHZA 4ZJLA 2FJDB 1MN9A 4QZVB 2ZNZA 2HS3A 4FPRA 2I8EA 4I2PA 3IBWA 2O3DA 4IOBA 1TF8A 4IRDA 1BWVA 4C8NA 2UUAJ 3AOCA 4RI1A 4CYUA 4JI3J 4ECUA 4HI2A 5HMNA 4PG8A 1V3ZA 4ZPDA 2GMJA 1ELMP 4X66F 4UOHA 3KK2A 3THTA 4XNHC 1P4NA 2BBEA 3LGNA 4C8ZA 2JOQA 2HHPA 5FDLA 4N77A 2HMIB 4F8RA 2YKMA 5F9NA 3W8GA 1Y9WA 1UWBB 1OY8A 2LU1A 5BYRA 2RILA 1VQ9S 2QLXA 1Y9KA 1NNDA 3UW1A 2VJVA 2MLYA 4ECRA 1NSKL 4E8UA 1ZS6A 4I67A 4YU9A 1MJBA 3L95X 2ALZA 2BQ3A 2E9RX 2PVVA 4CO1A 2V8PA 4BDPA 1Q0NA 1YLOA 1WEXA 2WBMA 4DR2J 4MBUA 2VFTA 4NGRA 4DV0J 3PB7X 2OFHX 1GMVA 2P0WA 1X5OA 2V34A 3US5A 3V6JA 1RAAB 3HHEA 1WTFA 1X4BA 1AA1B 5D78A 3BBCA 2HFVA 4J9MA 2DXEA 2XBPA 1FFWB 2VJUA 1HNVA 4WFYA 1I5OB 2F7VA 3QSIA 1D9FA 1YHQS 5D8NA 2XS2A 3C3LA 5ISVA 4JI6J 4F50A 3MD3A 1RT4B 1SVDA 3R3TA 2B4DA 4YB5A 3IN5A 1DURA 1HBOA 2R8KA 4LF8J 2A6MA 3M8QB 4DNCA 5L46A 2HVDA 3FMCA 2MLZA 4ENOA 2Z3OA 3FSYA 1NSQA 2V68A 4ZHRA 4UFWA 1NUEA 2JDCA 2CRLA 1WOPA 2J76E 2OKQA 3K58A 4KKOB 5ETOA 3CD6S 2DJWA 1NSAA 4GKJF 1ON0A 3AODA 3SQOP 1FTRA 2DHXA 4OIDA 2EK1A 2IRYA 1I6JA 2NREA 4C2XA 1LANA 5A2QY 5CD4A 1NDKA 2R2SA 4L72B 1F3VA 1NJWA 2UXDF 4NLQA 2GC8A 3FCHA 4NYOA 2BOPA 2D3UA 4RX6A 4DR5F 5AE1A 1SUQB 2DH7A 2XGQA 1YREA 3VARA 2BANB 4DR6J 4FBUA 2A6OA 3DYAB 4A8YA 1TP7A 4I49A 2CJBA 3P49B 2EWBA 2OZGA 3DMJA 2FB0A 1X7VA 4IQMA 4OL8A 1H7WA 4USWA 4QWBA 3DRPA 4KO0A 2Y8YA 4AVAA 3I4HX 4ICLA 3IWWA 4MJ8A 1IBMJ 3IG1A 1TVRB 5A8KA 3CC7S 4YFJA 3WBZA 2KN4A 2C3MA 2HIYA 3L4BC 1HBNB 3G4SS 5LXYA 3CNQP 2CQBA 4KUAA 3FDSA 1ZG7A 5IT0A 4ELVA 3LPEA 1H73A 4TY8A 1S6PA 2GFQA 5LRGA 3TO7A 4HH1A 2G2OA 3BXMA 2Q6BA 2UXBF 4N41A 2QO3A 5E96A 2HRYA 4ZPAA 2P6TA 2Q1LA 2F8EX 2EG2A 2WOMB 1Y0YA 1S6OA 4IF5A 1S1TA 4I64A 4Z7CA 3M9MB 2AGQA 3PKMA 3VVUA 4OYWA 3T8WA 2FVPA 2I79A 2M4MA 4PEOA 4C0BA 3HZGA 2H9ZA 1SH2A 4M63A 1FWKA 3TNVA 4DV1F 2J0WA 3H5UA 2UU9J 2PJ4A 5K14B 2KZZA 1YBTA 5A8WA 3TCVA 3DOLA 4ZX9A 3EDQB 4X4PA 1B4SA 3IIBA 3ET6A 4P2SA 1VQ5S 3HI9A 1D9AA 1S1WB 4OYMA 1UZDA 2MKYA 3I5CA 3A9LA 2BRKA 2W1BA 1FNMA 1QE1B 4XAKA 1CP6A 5J8FA 1N48A 4JV1A 2VG5B 3M2VA 1HMVA 1U25A 3CEDA 3N28A 2IVMA 3I3GA 2MKSA 1U47A 5FLXY 2B4PA 3QRRA 1CC7A 2O66A 4W98A 3W7BA 1UVIA 2R7RA 5LMNF 2HQYA 4G1QB 4CIOA 1VQLS 1S72S 1F6TA 3SI0A 1N56A 2OPRA 1PAUB 1PJ5A 4O44B 2J7KA 2J5AA 2CG8A 4ECZA 4QWCA 2FZCB 1U2RA 2FC9A 1VRQC 4N8OA 2OHDA 1GMWD 2XMKA 1DLOB 3WX4A 1XBWA 1IKYA 2UUCJ 5HJYA 3D67A 2RT3A 2Q6CA 3V6KA 4UIBA 1ELOA 2NXNA 1TL7A 3X3UA 1S1XA 3WIUA 2NMTA 4QR0A 3P45B 5KG3A 2BOAA 2GJ2A 2Q04A 5LMUF 3CVKA 1H74A 3I96A 4WIIA 1TAQA 2IHR1 3MMCB 2YWFA 1Y9OA 3IM8A 4UY8T 2K8GA 1CS4B 2AMCB 1GT8A 2IJZA 2CNKB 1ZETA 4DR4F 1KLMA 3NS7B 4OI2A 3MECB 1REVA 3EVMA 4H4OB 1Y7EA 2PDAA 1JLCB 3LP1B 2AWZA 4LBHA 2MZJA 4RW9A 4RNNA 4CCHA 3THPA 1TL1B 2NXEA 3SHPA 1LKZA 2F5GA 3VTIA 2GJIA 2W25A 2KXHA 3R1KA 1CJVB 1MJAA 1J27A 3UPFA 4QIGA 1SIZA 4NZ0A 2V6AA 2M5YA 4MKYA 3VAHA 1NK7A 3CXPA 2BJ7A 4G65A 3AA9A 1S79A 2BZ2A 2HQCA 2QFJA 4ILLA 1RAJA 3K89A 1ARLA 3UDLA 2MSSA 1RYRA 4B9VA 1Y7RA 2I0XA 1NDCA 1QSRA 3QAEA 3LAKA 4U67Q 4B3SJ 1FK9B 5A8RB 2B4OA 4V1Ak 4ECYA 2H3EB 2XMTA 4OZLA 2L3MA 1T03B 4MFBB 3HF5A 2BE9B 2OH1A 4ZIVA 3WZ0A 2JWNA 5FD1A 4B02A 5E33A 1RT5B 2K3IA 3C6TA 5CZXA 2HFOA 2LA4A 3PACA 4GO7X 1FD2A 2VQFF 2XLKA 3EYZA 4C8MA 4RKUC 2Y9HA 2GFFA 2QMWA 1SBRA 1H2UX 4X66J 3U27A 4CLWA 4OZ2A 5C24A 3E01B 2BUEA 3NBPB 3TOBA 1N5YA 2M88A 2VBQA 3EUNA 2Y1JA 5IT9U 1LW0B 3MFHA 1VQ8S 4U8YA 1CG2A 4ID8A 4U7CA 2VPXB 2E66A 1HPZA 3NGDA 4C4WA 4RUBA 4JBCA 3NA6A 2BCOA 3Q8SB 3SI2A 1LWCB 3QZ8A 3DLLQ 4UOGA 1Q2DA 2VG6B 4I1TA 3IAM9 1LXJA 3CUNA 1P6TA 3W5XA 3Q8PB 3MCMA 1FE4A 5J2QA 5DETA 4Y6IA 2ZH2A 2WTFA 4LUAA 2AJ4A 2J9EA 2ZFHA 2FVRA 4B3TF 3HMJG 3FFIA 2AJ6A 1NMEB 2ANPA 1TXRA 4YY3F 3OQ2A 4ID5B 2YWWA 3G3SA 4MHDA 2IM3A 4ZOSA 4L74A 4WK1A 1M0SA 3S7RA 1PCAA 1Y11A 2HFSA 1QJHA 4EBEA 3OWCA 1S1VB 1XE4A 4X5KA 1WKJA 2RF2B 4ILRA 2KFZA 3BSCA 5LT5A 4UQGA 2RDJA 4CGMA 1O5JA 2Q44A 4K30A 1JLBA 1T9YA 3M8YA 2K2PA 3JSYA 3BI1A 2NCKL 4UFVA 1YI2S 5KFDA 4FS2A 5CD4H 2DR8A 3BQ0A 3FBFA 2G0JA 4K5SA 2ZM6F 4P74A 3CCQS 2RVJA 2KO1A 3PFOA 4DBQA 3LODA 3CXCR 4H4MB 3RJMB 2NYHA 4HTIA 1HI0P 4GKJJ 4IFVA 3KTQA 2MJUA 2XTJP 2PJ9A 3QFHA 2GHWA 4XPDC 1DTTB 3UD3P 3QFWA 3CZXA 1OO0B 4UUXA 2UXDJ 1YBUA 3RW6A 5ETPA 4EFAC 1SJRA 1IJFB 1PG5B 1RAFB 2R3VA 5IZHA 4W90B 1U4BA 3RB3A 1T94A 2YX4A 4AVBA 2DRDA 4YP3A 4DR5J 2DF5A 3FEDA 1HI1A 4UUWA 4PXBA 3KMQA 4LF2A 2FHJA 2CY2A 1X4FA 3IRXA 2IBOA 4HI1A 2Q4YA 4P10A 2ZW6A 2MEWA 1XR6A 4I4BA 4P7VA 4H54A 1VS3A 4WFNQ 4OYBA 4TQRA 5AXLA 2ZH5A 1NPKA 4KOWA 2BE7D 4G3IA 4YGOA 4NCAA 5E7OB 1CJWA 3LACA 4MHNA 1VBKA 5I42B 2JC1A 4DUYF 2CQIA 4Y2CA 1FXLA 2QSFA 2DRAA 2YNGA 3OL9A 1UMJA 3NWGA 2BEFA 4HACA 4CP5A 3PBEA 3KUGA 1NCLA 5KFKA 2C2RA 1IXKA 3KLFA 2UXBJ 2Q79A 3EWGA 5CQGA 3NXZA 3RZAA 1H7XA 1XMOF 4URSA 1U26A 4HNWB 3G87A 3BKFA 2CXEA 4NGTA 4ETXA 4CAWA 4DV1J 1FTCA 1YJ9S 1E6VA 1PGZA 2YTCA 2OPSB 3JAMY 4K4UA 1UEUA 2EBJA 4FVMA 2X51A 2H5IB 2KH9A 4LR7A 4K59A 1BQNB 4C7IA 1UWYA 2HNZB 4YB1P 3DNCA 3RB4A 2B3VA 1FKPA 3GG0A 2B3TB 3IO1A 1VLYA 4TNOA 3TX0A 2IC3A 4MKVA 3FZ2A 5LMNJ 1QUVA 3DI6A 1N32F 1RTZA 1M1DA 1U8WA 3KHHA 3BHXA 3GONA 1YJRA 2FY1A 3JRUA 4R3KA 4MMOA 3CMES 2I3CA 4K2JA 3PW5A 1ZA1B 4WIQA 2IAJA 2PJ5A 3D9BA 5F3ZA 4J9SA 4KSFA 1VYAA 3A8JA 1NM2A 2V4JA 2VKZG 2OTLS 1WF2A 5C2CA 5DLFA 3CO0P 3QT6A 3MPYA 1D09B 2B5GA 1FNXH 2W2MP 5JUMA 2BA9A 3VAKA 2YNDA 4UCNA 3IS9A 1TKZA 3HFZB 4P6QA 3CC2S 3PZPA 1EKRA 4LIWA 4EK2A 2RH3A 4L76A 2QLJB 3H4BA 2PJ1A 4XPLA 1N36F 2YKAA 3H90A 2DR9A 1T9VA 4I2PB 2K06A 1SC3B 2W7OA 4B9UA 2ZW5A 1I12A 1UEKA 4KH0B 1EB0A 1HIYA 1JWWA 1QSYA 1MSWD 5MLCV 3WR7A 4A94A 3G2XA 3E0KA 1DY3A 3KK2B 3TWZA 2XEFA 2CG4A 2KFNA 3OR1A 1FFGB 3MXHP 4JWPA 1RHQB 4ZJOA 2YKMB 4ZVGA 3U1LA 3HHNB 1Y0RA 2ZEPA 3TAMA 5GAHI 3EE3A 2KXNB 3CDBA 2RHSB 3ENAA 1R8BA 4ZLLA 3PJWA 1DZ5A 2BABA 3D7FA 3VR1A 3DLKA 4F4WA 3G86A 1CQMA 3S6KA 5KTCA 4LT6A 1B6BA 4DL5A 3O8WA 3FMBA 4GRSA 4GC7A 1VISA 2EPIA 1OYDA 1S1UB 1RWXB 1N0VC 1U2FA 5CYMA 1FX2A 5I3UA 3M6VA 2RNEA 4WE1B 2ZBQA 1VKCA 1K0VA 4KS9A 4PKDB 1QAIA 4PK3A 4JB8B 4Y2IA 3GJQB 2PA8D 3K8WA 3ISXA 2DYAA 4X62F 2XC9A 1URRA 1VQOS 3MCOA 1LXNA 1WDDA 3BR8A 1VFJA 1X10A 4ZK7M 3M8ZA 1HNVB 2RKIA 2KL8A 1S7KA 3KI9A 4B9NA 1LEOA 4LQ9A 5CNPA 4ECXA 1I51B 4M8LA 2ROGA 3VVTA 2I00A 1HQUB 1X4DA 2VQFJ 1N6QB 1GHEA 2AU0A 3CJTA 4IOAQ 3QIPA 4CRZB 1P1LA 3O44A 4H4KA 5ETKA 1UL3A 4KTQA 3DRSB 3ULHA 2JEGA 4YB7A 1TQLA 2FHKA 2JC0A 2DHAA 3TEHB 4PSWA 3F44A 4DV7F 1YLEA 1P27B 3BSNA 5EBVA 1PJ6A 1GTEA 5J2MA 4RW4A 1C0TB 1OMSA 1HDQA 2YGWA 3PNIA 2DGXA 2B56A 5F8JA 2V2QA 2ZVIA 3CJSA 2CPYA 5ITHA 2HZVA 2VOPA 1HWJA 2PC6A 4NYPA 1R8AA 5C25B 1JLAA 2BKOA 4K7QA 2XSFA 2HQFA 4DU7A 2J0XA 2YWHA 1VBYA 2HQGA 3MM8A 3EGVA 1S7IA 4PG4A 3TA1A 1SKRA 1R3NA 3BB5A 4RL1A 3HJFA 3M8SA 3MEGA 2ROPA 4A8SA 4NCBA 3SSRA 2BXJA 5EUHA 4OC0A 2E1MC 1U1RA 3VGUA 4EGLA 3M1VA 3LQVA 3DMJB 1DTQA 4GVLA 3R2CJ 3HKWA 3H5XA 4TVAB 1UJ4A 4DR7F 4B3TJ 3E2EA 3DRPB 4KO0B 2LCWA 2ZC3A 3IG1B 1SIWB 1QAJA 2L9NA 4YY3J 4QBUA 4I2QB 2YQ3A 3B3TA 2HWIA 2O5DA 4RNOA 3QLHB 4TY8B 2QYVA 2UP1A 1M90T 1UEVA 3BJYA 3O1LA 4I69A 1RWWB 1H3DA 2ZOFA 2CUYA 2OU2A 2BJ3A 3K17A 2DIUA 5EMIA 1J4JA 1S1TB 1OSDA 2AJQA 2ZM6J 3KLGB 2ADCA 1W2BR 5F8LA 2O4HA 1ZOTA 4MK9A 3PG9A 2V94A 2H4WB 2YPZA 1K47A 3DOLB 2ZEFA 3GV8B 3B3SA 2B51A 3C8YA 4Q43A 3R5GA 7AT1B 3L7PA 3CJ4A 1GX5A 2G13A 3HUVA 1FERA 2UVVA 2SXLA 3DM2A 5G1ZA 2L9WA 1JXLA 1S60A 2XNQA 4KJIA 4Q0BB 3M8WA 3OFFA 1AUGA 1Z2ZA 3KR5A 1DAXA 4FWUA 1BD6A 4ZN1A 2XZWA 1MU2A 3OVSA 4ED0A 1KUYA 5IFMA 1ZTWA 2MKIA 1SKUB 3ENQA 1U2CA 2J6SA 1YGHA 3FCVA 3C66A 1GAOA 9RUBA 1SL0A 2OPRB 3MMJA 5D6GA 2HHWA 1M4GA 1PSDA 5GAGI 3G82A 4M85A 4ELUA 5J1EA 4DJBA 1KSPA 3PW0A 5A0YB 2HRTA 4DUYJ 3BI0A 6CPAA 3ZZPA 2R7QA 2GLJA 2CNOB 1DRZA 3OXGA 3RRGA 2APOA 3K9UA 1IKYB 4Q8FA 4NZ6A 4TQSA 3BDPA 1WSVA 5KFZA 5L9NA 1FFSB 2ASJA 1XR5A 1H72C 3ISND 1PYSB 1FRKA 3OV7A 2R98A 3LGMA 2EK9A 1L0CA 2G2ZA 1Z5RA 4JI2F 4DL7A 4YFUA 2ZWPA 2CQPA 3D4UA 3U7JA 1XMOJ 2ZW4A 2WVEA 3L9ZA 2HRUA 1UA1A 1NPRA 4X2TA 1M5PC 2XHCA 1S6UA 1XNQF 5GAEU 4DPTA 4KSAA 3SFUA 1LFPA 2OFGX 4PWWA 4OKOA 4Y28C 5CABA 2Z2MA 1J5OA 4C11A 3PB8X 1REVB 5EWFA 4OI1A 1H6KX 5LYDA 2I9SA 1J5EJ 4KZTA 4OJHA 1C4CA 1QUPA 1BPMA 1R31A 3OFGA 2IYGA 5IXUA 4AB7A 1X5TA 3R5AA 1R6YA 5HP1B 4K2XA 4O0IA 2XCPA 4A8XA 3VQTA 4H2KA 1CJTA 3BM7A 2IA6A 3KXDA 2Y0MA 4FBTA 1F2OA 3SMZA 1S9GA 2C27A 3TW0A 5K9FA 3JTPA 5LYLA 4A8FA 5JGFA 2U1AA 4RUHA 2ATCB 1N5SA 3PO4A 3D4JA 1S12A 2DGSA 1AFIA 3SCLE 4KVXA 3BGFA 2B9EA 3NS5A 3FBCA 2XYHB 4P4EA 2HHXA 1N32J 1E6YA 1JLEA 1KRPA 1VJWA 1IIDA 4B9LA 3IEHA 2FJWA 3GB0A 1NU4A 3K8VA 1BLUA 3EO4A 2AEFA 4A31A 4FF1A 4JYWA 1X8DA 4M5NA 4U7UK 3JTNA 3D1OA 2AGOA 2O67A 1HI8A 4UZBA 2IDLA 4DV6F 4P4JA 2AF6A 2Q7SA 1T3NA 5HATA 3VH9A 3HSGA 3MEDB 3QAYA 4OMEA 5G0RA 3ISNC 3RB0A 4UEZA 4N8NA 1YG0A 1YLXA 3J81j 1K1SA 1N36J 1KTVA 5K8PA 4J3GA 2FT0A 4YRHA 1AT1B 1HNIB 4KSEB 4LBIA 3ZXWA 3VGSA 3GFHA 3VF0B 4UA3A 4JI1F 5DGAA 4ZVEA 3TQEA 2MZTA 2P9CA 1FD8A 4R87A 3E3XA 1EKSA 4P73A 6FD1A 2HIQA 5C24B 2DB1A 3DDNA 2FQQB 3FF3A 4A37A 1C1CB 2FJEB 2LEBA 1KDNA 1VR6A 2CDQA 4P75A 1N5YB 1TKHA 2FC8A 3GSIA 3K9TA 3G8QA 2AFWA 1Q8IA 3NMRA 1RAHB 4F02A 1LOKA 1KZFA 2NZCA 4TLRA 3HM9A 3LPYA 1F3FA 4MIBA 4KHPF 1RACB 1IKXA 1HPZB 3OL7A 4N56A 2UV8A 3DXSX 2C1EB 4RO0A 4CI0B 2UUBF 5KFTA 2B58A 4CNZA 2CJ9A 4DX7A 4WYWA 3JTOA 4DLEA 2FLLA 2P8IA 1S9FA 2LXIA 2XMVA 5J2QB 1S9EB 2ZH1A 2DXDA 2E1PA 4RWWA 2N4CA 4X62J 4LX9A 3TR5A 2FL4A 3FFIB 5ETRA 4Q5VA 3NRBA 2KM8C 2PVWA 2LKZA 4DG1B 4ZP6A 1IKVB 2D3O1 1VBZA 3KK3B 4WU3A 1HNXF 1LWFB 3D2PA 1RBOB 4B9MA 1QSTA 2HGMA 2PSZA 2DGQA 4OX9F 4WP3A 3VCDA 4UWJA 2IM1A 4CYQA 1C0UB 2WBRA 2PRBA 1MROA 3EVOA 1JLBB 5KFSA 2M3DA 2CJYB 1HWKA 2I5JB 4ANEA 5G4DA 4RWXA 3BF4A 2MKHA 3M32B 3OL8A 1XWLA 1TL5A 2AFUA 5F8MA 3B8GA 3FRZA 4DV7J 3FH4A 3NCQA 2IVFB 3VAJA 5HJXA 1MWYA 4IFVB 2XO7A 4AQYF 2VFVA 3A4TA 2JHEA 2BMBA 2GVDA 1SQHA 1K73T 3LP2A 3DKDA 4IG0A 4WXWA 1RT6A 2W8KA 3BJ8A 4KC5A 1IWGA 2Z10A 1S99A 3CULA 3R9GA 4GXHA 2OPQA 2DH8A 1RDRA 5EHHA 4F25A 1A9NB 3JUWA 5DWNA 4NJRA 1KS2A 5GADU 2ZH3A 4NX9A 2AFOA 1R0CB 1OWXA 2AJ2A 4NZ7A 4IH6A 4FKXA 3POTA 4RJVA 1C2PA 1OQ6A 2B9XA 4FBEA 4HHUA 2VUGA 3QQCD 4MFKA 1U1MA 1ACMB 1FT8A 5DRKA 2LEAA 4DR7J 3B3WA 2IA0A 1WOSA 1MG7A 2CQ1A 5K5MA 4NXNF 3KK1B 4A8QA 5J1PA 1IOFA 2JNJA 2YNGB 1RLDA 3C15A 4M5KA 1UA0A 4ZI6A 3I6PA 4Y2MA 4HACB 4CLUA 1HYSB 1SL1A 2JEWA 3L7OA 3OTOF 4JYAJ 3HDSA 2CDRB 3GZ7A 4IO9Q 1Y5LB 2CQ0A 2E7VA 3SIPB 2E1CA 2PIYA 2HLTA 4R5PB 4FZVA 2M8HA 5D0HA 1MNEA 2GW8A 2CQ3A 3OL6A 1HKAA 3B54A 3P5TL 2HC9A 2B5JB 1CEZA 4KGMA 3HD2A 2DNNA 3VAFA 3FSIA 3DSBA 1U6MA 1U09A 1TUGB 3DOMA 1MWZA 4DEZA 4HTJA 1PYTA 5CYJA 2ZZNA 4ZS6A 1NO8A 5DM7Q 5IM0A 4DUKA 4LF6F 4NXYA 4RZRA 2BJDA 6AT1B 1Q86T 1EP4B 5DO2A 1FKPB 1VQMS 3D3CJ 1YW6A 1ITPA 3F8KA 5CPAA 2GVZB 3UFCX 5E3CA 3RAMA 2QL5B 2OLWA 1HHTP 5L1JA 3DI6B 3MMBB 2J8MA 1YGYA 3MFIA 4C7QA 3UDCA 4O3QA 4EUVA 4J9QA 2IAJB 3LWMA 1R27B 4U9ZA 2QMLA 1N52B 2DRBA 3JS9A 2GV1A 2GMHA 1TFWA 3EC4A 4CGLA 2B5GB 4O3RA 4OZNA 2H48B 4PUOB 2GU2A 2AJFE 3J7YU 4DV4F 1RWUA 2ASLA 3CB4A 2NSMA 3D54A 3G96A 3RBUA 4JI2J 1W25A 2VBYA 4LF9F 1PBUA 1RT4A 2BO9A 3FSXA 3OXLA 3TUIC 5C82A 4L89A 5CCMA 3Q2TC 1XNQJ 4KY3A 5KFVA 4NLSA 3OVBA 5E41A 3FMWA 1IWAA 2FZGB 2H1YA 2P6GA 3M8QA 4FF2A 5F8NA 2VDHA 3I9ZA 2XEXA 3T19A 2HB6A 3UNYA 3GPAA 4UZCA 1XMTA 3RAQA 4DN0A 1C4AA 1SQEA 3GYGA 2ZEGA 2XYGB 3FEEA 3UVJA 1RUSA 3T5LA 4KKOA 2V77A 2GIQA 1KONA 1KOOA 3QGGA 4EEYA 3HHDA 4OV1A 2FYXA 5LYIA 1G3OA 3N01A 1FRXA 2QRRA 4M5LA 3H2LA 3D66A 2HPUA 5H9EJ 4QUSA 3DLKB 2F5IA 2KYXA 1RABB 2R2RA 4DSKA 2XG8A 4DV3F 5L1LA 3CJ3A 4M5GA 2ZH7A 3GYXB 1RT2A 3RGIA 3IWGA 4JI0F 3PHTA 5I3UB 2K1RB 3CD7A 5KFAA 2JX2A 4EYHB 4IRCA 1ZO0A 2WZNA 4N5SA 2YWGA 2N7YA 1DFDA 3D8PA 1NDPA 4JUZA 2FVSA 3LALA 1FESA 4JZ0A 4DV6J 1FHTA 2KDOA 1SQFA 3AAWB 3NNHA 3SV4A 4K4WA 1QM9A 2MGZB 3SJGA 2J8AA 1ZG8A 3KLHB 3FKBA 1TVRA 2FSRA 2LMIA 3CDWA 3H98A 2ADBA 3D2MA 4RW6B 3MUTP 4Q38A 4NEZA 1R43A 5KFUA 3SYZA 1VIOA 2DNZA 4JI1J 1FVQA 2R8JA 1FEHA 3BSOA 3PRDA 1CP7A 3JSMB 1O51A 4EVYA 1FRLA 2ZHBA 5G20A 2EC0A 2WOMA 5H86A 4BLGA 2VFSA 1U1QA 3RO0A 4FP9A 2FIUA 3NMAA 4DFPA 5DLGA 2L9DA 2A2DA 3AQOA 4RW4B 1Z2LA 1TUVA 3B4DA 1V5VA 1ZZNA 4CDIA 3LTOA 4NFRA 1RCXB 5MAOA 1U1OA 4YWYA 3KUEA 4N7TA 4CRJA 3M4XA 2HBQB 3FC9A 3GG1A 3T1AA 2HHQA 2ZBPA 4KHPJ 4CT9A 1A2ZA 3BKUA 2HFZA 4QB9A 1GXTA 3HJVA 3ILIA 1IM4A 2N4DA 4EI2A 3VAGA 3P6YC 2ILYA 3MR5A 4ZYQA 2VG5A 2LLZA 4DOZA 5D15A 3R7NB 2DISA 2R2TA 3W9JA 3P4UB 1A7GE 4A38A 1CM0A 3KG4A 5KFRA 1BQXA 1JWQA 1DTQB 4F3QA 4NA2A 3DRRA 3DRYA 1TTHB 2CA9A 4R0JA 4UOCA 3PXGa 3IJ3A 4RS2A 1RB0A 2DNOA 4FS1A 3D5MA 3R6LB 2CQHA 2AEMA 3CCJS 3PIPQ 2D7SA 5B0EA 4I6YA 4NWBA 1DLOA 4TNUA 1HNXJ 2Z3LA 1WI8A 4OX9J 2D3OR 2WK4A 1U1LA 2CJKA 4IAVA 1PC5A 2BEIA 1QSMA 3PB9X 2MQ8A 1JK9B 1ZG9A 3D0IE 4DFMA 1VCTA 4OHXA 4BINA 3MM7B 4C2YA 1ZAVA 1NPPA 3M6WA 2UUAF 4ZVRB 3MMCA 1RJJA 5LL6d 1MMNA 2VC0A 5KFIA 5T14A 2QIFA 3QIDA 3PKYA 4RPFA 4K4SA 4KHRA 6FDRA 4AQYJ 2QYGA 2ZW7A 4CYOA 2DGOA 3MECA 4D3GA 2C2OB 4O3PA 3OJSA 1VDHA 4DQRA 1HA1A 5EGYA 2ATLA 3TQ1A 3GFZA 1TL1A 2FJVA 3AY0A 1T0TV 4OV6A 4P2MA 5D3GA 1JNZB 2VPZB 3MN8A 2NSCA 1V5IB 7FD1A 3NOGA 2ZEHA 1REGX 1NE9A 4ZN3A 1HEEA 1ZM4A 1RLCL 3SQGB 4B3OA 3KHGA 2IDEA 3BGLA 3EXYA 2IMOA 1H2VZ 1ROFA 3IWXA 3R1LA 1B3TA 4DR2F 1VK8A 1UJ6A 4E0AA 4LSLA 3KHRA 1X9SA 4Y34A 4A4JA 1VHEA 3NE7A 3PX6A 4NXNJ 5D4NA 2AFMA 4NF1A 3DOKA 5F47A 3RNZA 1FK9A 5A8RA 4HHJA 3B4MA 3EGWB 1JJCB 3A8EA 3N5FA 3Q8VA 2FIWA 2GA7A 1VHFA 3MAAB 3OTOJ 2HQ3A 3OHAA 1T03A 3BLNA 4F3OA 2B0GA 4MFBA 2KXFA 2MZQA 1X9WA 4KE5A 1VJQA 1UZHA 3M2UA 4R0EA 1VQNS 1TELA 1RT5A 3Q23A 2DVIA 4DL2A 3KLEA 4DSFA 1UCNA 3OVAA 2VG7A 3HHKA 4Q36A 4Q7AA 4ECQA 1XEZA 2J7WA 2HVHA 3F0NA 2G2YA 4CWBA 1N0UA 2CTBA 2V9KA 4F26A 2X3DA 1IVZA 4DL6A 3C14B 2OH2A 5KG5A 4USMA 4PR6A 4C97A 4C3LA 3SSQA 1QVFR 4DU8A 2WONB 2RHQB 4LF6J 4LRCA 5CYQB 4GS4A 4PQAA 1CJTB 4OIWA 1GXUA 2HNYA 1LAMA 4NLGA 4HKQA 2EO8A 2VICA 1YWXA 4F4YA 5KFXA 4FYWB 2DHHA 3QMQA 3AFGA 4I7FA 2AZ3A 4R76A 2Z2LA 3ONQA 1AUDA 1E6YB 3DLBA 2XNRA 2DNLA 2EWHA 1JLEB 5HMZA 2Q4VA 1F5CA 1PC4A 4USTA 1LWCA 4E0DA 4TU7A 1TV6B 5KFJA 1AYEA 2PJCA 4WFXA 1R0AB 2JL9A 3IWNC 2OPPB 1A6LA 4G1IA 3GV7B 2QC3A 4CAXA 4OHVA 2YNHA 2X7IA 1YX0A 5ADZA 4MFQA 1IR2A 2MHEA 3B35A 5KFGA 4M95A 1N8RT 1XIQA 4RW7B 4DV4J 1H8LA 2BYCA 3O6QA 3QAHA 5IB9A 1VQ6S 3I9SA 4LF9J 3PJ9A 2C2EA 2R8HA 4B17A 3SCJE 5LYFA 5F8IA 3KKFA 4MY3A 3Q8UA 3W65A 4USVA 2ZITA 2FDNA 1IUJA 1SJ4P 2YNIB 4PK2A 3WQPA 3SCKE 2F8MA 2Z11A 5F3TA 1YK3A 2VZ9A 2MQPA 3IP0A 2FVCA 1IQZA 1S77D 5DZ7A 2CZVC 1RA6A 3IM9A 4MI4A 3G6VA 2AFSA 1F1BB 2RS2A 2RDIA 4H4MA 4ZP7A 5LOQA 5DDPC 2UU9F 2FD2A 1RWKB 2QECA 3H2VE 2XM3A 1RTDA 1TFYA 3S8SA 4RBUA 2BM1A 1IKXB 1TIQA 3HSDA 3KMSA 2OR4A 4DV3J 4DSEA 4C2MA 4RU2A 3FJ2A 4JI0J 2VBWA 4AL7A 3L2NA 4RNMA 4M5MA 1VQ4S 5HMXA 3TANA 5BYQA 1KBRA 1LFWA 3MOJB 5G22A 4PG6A 3QT8A 3Q2SC 2DKOB 1NLKL 2N82B 1D8ZA 1Z8WA 1SH0A 5F46A 4XPKA 2V67A 3G6ES 4N47A 4F9UA 3WABA 4B3RF 1BXNA 4IG3A 3LAMA 2DGTA 3DR8A 5L39A 5DDOC 5CBMA 3MZIA 4KGZB 1U8SA 1Y5NB 5JM6A 4A95A 3NH8A 1R89A 1R6VA 1VC6A 2WPXA 2GIRA 3M05A 1NJIT 4CRYB 3R96A 9ATCB 3H40A 3I82A 4DV5F 2OJ3A 1JQGA 4NLYA 4PYAA 2UVWA 3MM5B 1XRYA 5E3QA 1KD1T 5DDQC 5HL7Q 2UZAA 1BC6A 4AXVA 2BVZA 3HX9A 2GVDB 2XEJA 1FRHA 1NZ8A 2NLWA 1RK8A 3F5BA 3LP2B 4NLRA 4IG0B 5D29A 2OPSA 1RT6B 3W2VB 1WWZA 5B0CA 1I1DA 2QLFB 1G2EA 4EMEA 2D41A 2FLOA 4ECSA 4DUTA 1ZTTA 1BQNA 2OPQB 3GYNA 2HNZA 4X3RA 4MRIA 1YK9A 3KFWX 3F73A 1OIAA 1S7LA 2HVEA 4CH1A 2W8LA 2JDDA 4ZP9A 3POTB 2MY7A 2GANA 2ZE2A 3SEOA 4DQIA 1QSOA 3N6LA 2AKWB 4ED4A 4F4AA 3KHLA 1LQ9A 5KFBA 1GEHA 3DLHA 1EETB 2EFQA 1M4DA 3NP5A 3FZBA 1YW4A 1M5HA 1M5KC 4B11A 2DXFA 2AEJA 4NL5A 4AL5A 3ADAC 3S9LA 2KG1A 2JEJA 1SCJB 3J80U 2EVZA 4J9NA 4ZCIA 2GX8A 5JQ4A 3AA8A 2J6UA 1ZAWA 4XDDA 3DU5A 4ZVQB 4XPDB 3QRQA 1S5KA 1UW4A 2DITA 2KJVA 4ELTA 1BO4A 2LQ8A 2NS1B 1R8PA 1PYOB 2HGLA 3HFKA 4CGOA 3BQ1A 4M1KA 1YRXA 2YVSA 3OUYB 3C6UB 4PWUA 3QB8A 3LOUA 5L1KA 1CJUB 2PE3A 2M52A 1RO5A 5H1SV 3NE8A 1NHUA 3HPOA 3DLGA 2FPHX 2MQQA 2PQ8A 1HBMB 2GQCA 3DOMB 1UTAA 2DY9A 1PYTB 3QNWB 1HLWA 4URGA 4DX6A 2XLJA 1RAEB 3DLEB 3CF5Q 5IM0B 2OUGA 3OPKA 2GQQA 2PN6A 1V3SA 3NGKA 5L9XA 3R5JB 3U1MA 2QA1A 2ZC4A 1L5UA 4S0MA 2EXUA 3OD2A 4WFAQ 1VRUA 4OX7A 2CFXA 1EX8A 2FHMA 1B7FA 2B4BA 1IKWB 4ZP8A 1L3TA 5B0GA 1P8GA 4O0NA 3NH5A 5AE3A 5D0RA 4D3HA 4L3KA 3SJXA 1CC8A 1S1UA 4YOEA 3AQPA 2OMLA 3AB2B 3TJAA 5KOWA 4DSJA 4HLBA 4WE1A 1OJ4A 2DNYA 1Q8LA 4NMLA 2E5LF 2IVYA 3MWBA 2V2VA 1HBUB 1UKUA 3R8YA 2ZUAA 3BH6B 2J9CA 2R4FA 4PG7A 4B14A 4GKKF 2YNFA 2E7XA 3CJ8A 5M2RA 2OZHA 2W9AA 1RU1A 2MZSA 1S76D 1NHKL 4NLXA 4OLOA 3K2KA 2OAUA 1RQ0A 3HVRA 1HQUA 1N6QA 1UVKA 2HZCA 2YY3A 2EG1A 2FVGA 1Q81T 3ZZZA 4X4NA 4LVOP 4NA3A 3D7GA 1WTBA 3R27A 3DRSA 2B8QA 1H98A 2BUNA 2QLBB 3W64A 2DPSA 3R9FA 1JJ2R 3TC8A 5H9EK 3UVJB 3NAIA 3QGIA 2AQ4A 4MFZA 3BDEA 5FIIA 2BR0A 4TWEA 2WW8A 3T5HA 1ZAXA 1C0TA 5KFOA 2W9BA 4QR2A 4NCGA 3M6UA 2RDDA 1QD1A 1N33F 2EBEA 2L48A 5AG4A 5KG4A 2G1DA 1RE1B 3JYTB 3HHLA 3AB4B 5C25A 1FEEA 3NGSA 3FNNA 4ZBGA 2QVPA 1RT2B 3RW7A 2CZ4A 2NXCA 2D74B 2W2NP 3NWRA 2ASDA 3MAQA 2W4DA 1UVLA 3ZFVA 4L6V3 4ITSA 4FF3A 5IB0A 4K0KJ 3I1UA 4K4ZA 1D9DA 3ZTSA 2NR0A 1O6XA 1CSJA 2D4PA 4JV0A 3PYEA 2QA4G 2QMXA 4JI7F 1FWLA 3WC2A 3GILA 4CO5A 3MI7X 1XQIA 3TO6A 2OO4A 4I2QA 1X60A 4NEXA 3J81Y 4HEA9 1JMTA 3PIOQ 4ED7A 1WHWA 5EWGA 2QIRA 1S49A 4QU6A 4ZVUB 1CVJA 1IQTA 3QLHA 3EX7B 2QSWA 2MHNA 1Y3JA 3WHIA 2ZEMA 2XMJA 2BV3A 4UWIA 2DTJA 1S7HA 3AD9C 2O53A 3MGDA 3QSYB 4PXEA 1B87A 2AE6A 3T9ZA 3GIJA 2MTLA 2BACA 3P5BP 1TMMA 2L08A 2WSAA 2K5TA 3KLGA 3FVLA 1EQ0A 3L3CA 4PPZA 2LXFA 4E98A 3IR6B 5A2QU 2I2YA 2G3TA 4KPCA 2NXJA 2M8DB 1OSCA 4KT0C 3CCSS 3ZNJ1 1U0HB 2I6WA 1T3OA 2GNKA 3DN9A 4CAFA 1KNZA 1KQKA 5GMEA 1UVNA 2ZVSA 2UUTA 1JX4A 1OY9A 4Q0BA 4FYDA 2ODFA 1DARA 3QGHA 2FJAB 2M70A 3OHBA 3D0GE 1RWVB 4QJVA 4C0HA 2Z30B 4Y2KA 3UDEA 3VZIA 3DRRB 2YQ1A 5AJ3J 5LXRA 3BGUA 3ZC4A 4KVME 3AH6A 5D0GA 2YH0A 2OEJA 4BWJA 4PV6A 4B3RJ 5KTQA 1FE0A 5A0YA 4M6IA 2AGPA 1Y3KA 1YKWA 1LW2B 3AOBA 2EFVA 3I0SA 2QEXS 4NLOA 1S97A 1RWNB 2CNTA 1KVKA 4U8VA 4K5RA 4F0MA 3VGVA 1QSSA 3VHQA 2HZAA 1BPNA 2Z4PA 4AL6A 5EC4A 2CPEA 2JBJA 2JSXA 3NS6A 3RRKA 2EFNA 2VBXA 4F0XA 1VQSA 2EFPA 4LRBA 3DDKA 4RUCA 2C2MB 2CPIA 4DV5J 2DBBA 4AFFA 2EK8A 4USKA 3L7UA 1RKIA 1NK0A 4L75A 4W4MA 2GREA 1QAYA 4J9UE 1M1GA 4FUUA 1JLQA 3LWLA 2RQKA 4TY9A 3V38A 2F8HA 3ZZOA 4V19X 3DCAA 1RTQA 1TKDA 2G9DA 2XY6A 1WC6A 5DG7A 5D3GB 4A8OA 5RUBA 5HP1A 2UVUA 1DQ9A 4EU0A 3K57A 3DDDA 2HK2A 2XWYA 1KEKA 5FLXU 2Y0SD 2RD5C 3H8EA 4B3OB 3H59A 3X1LB 1XC9A 4KFBB 4NRTA 2G1HA 2UUWA 5D4OA 4C8KA 4KBIA 2M9KA 4LSLB 1NDLA 3HO1A 4NA1A 3KJVB 1XN9A 3LGHA 3NGUA 2FHOB 3WC6A 1B7YB 3DOKB 5FJ4A 4CH7A 5LRJA 3W9HA 4F2SA 1VC0A 4PRFA 5KFHA 4ECWA 2J9AA 1Z4EA 4B9SA 3GY9A 4X64F 4MIAA 2HHVA 1H2TZ 1EARA 8CPAA 4B5PA 1WACA 4NEYA 2QJ3A 3O2IA 4NLDA 1RKJA 4DR1F 1TKTB 4G1PA 3MEDA 3H5YA 3MAHA 3ZZUA 4CS0B 3EPIA 3M2UB 1RBAA 1D1UA 1VRTB 2XMWA 4P2FA 5F0WA 2VFRA 1MK4A 3KLEB 1HNIA 3V4IB 2VD3A 1WNEA 1IY7A 3K5PA 2VG7B 4NI2A 3BO3A 2QMUB 2YNCA 4J5OA 8ATCB 4P72A 5KG0A 2E5IA 2J0SD 3KKWA 2AHOB 5DM6Q 3GTYX 1XF8A 5HROB 1C1CA 3ILLA 4KV8B 2MQOA 2E5HA 4J9VA 2VL1A 1FRMA 3C16B 4NGNA 3CJKA 5KT6A 1P9QC 3M2RB 2H4YB 5GMKa 1IU8A 3EMTA 1WOOA 2HNYB 1O0PA 2DEIA 2C3PA 3ETOA 3TO9A 3JQJA 3WC5A 3B7IA 4HVZA 2ABYA 4NLTA 3TOQA 2CWXA 2ZH8A 4I7FB 4HT7A 3MPUB 4DI6A 3O5TB 1LNQA 2ZEJA 3LW5C 4KOUA 2J9DA 2NSBA 2VPYB 2GAGC 2M7SA 1FY7A 2E5LJ 3SI8A 5KFFA 2YKPA 3NCRA 3OXFA 1S9EA 3BGRB 1AZSA 1ZH5A 1RYSA 2YXLA 2YNHB 1SC6A 1XERA 2FHJD 4GKKJ 2KFYA 3K7RA 3OR2B 1LV5A 3ISZA 4U95A 2Q51A 1RWPB 2KTQA 3W8PA 4DG1A 2KVQE 1IKVA 2ARHA 1BAVA 3KK3A 4B08A 1LWFA 4CT8A 4LVNP 5L1IA 1T02A 4ZVOB 2C28A 1WHYA 2HQIA 2QJ8A 1C0UA 2IBKA 2K7JA 3DNSA 2YWKA 2I5JA 4ZVFA 2LFVA 3M32A 3SZ2A 2NQPA 3OT9A 3E8OA 2ZH4A 4CGNA 3HXMA 1X9MA 1R8CA 4J9KA 1C1BB 2RB7A 3DGPA 3OTEA 1K44A 3TRGA 1N33J 1RTDB 4RBTA 4O3NA 3VAMA 2DNQA 1HARA 3PX0A 1TK0A 2OGUA 3H20A 3VWDA 5I0CA 3BPDA 4C68A 1JKHB 3PBBA 4NGMA 3E51A 4NOHA 3BYPA 3P8BB 4KQZA 4P71A 3GJTB 5ETQA 3LA0A 2EVNA 1RHRB 2J8SA 3I0RA 3A13A 3KJQB 1XNRF 2PMWA 2JVRA 3V6HA 4U6PA 4A33A 3UE2A 4JI7J 3PEHA 3IGRA 2O28A 2C2NA 4FPIA 4IG3B 1AW0A 3RB6A 3KK1A 4WZMA 4MYTA 4GMKA 1U24A 5AXNA 3IGNA 4MFPA 2BX6A 1HYSA 1FVSA 4DV2F 2HK3A 1I94F 3TYTA 3EFAA 2A4NA 4UCMA 4DF8A 3MEKA 4MY0A 3QJJA 2R7SA 2HWTA 4DL0C 3HCXA 3CJRA 4R5PA 2X3GA 1WKKA 3VWEA 1DQ8A 3ENWA 3PRBA 1RCOB 4JI4F 2WSFC 3J7A1 1IR1A 1VQ7S 2B5JA 4HDGA 1WC1A 3D7SB 4NXMF 3FRMA 1YQHA 2V4RA 1J5EF 3UWTA 2R9LA 3VALA 3ZTRA 3OTCA 1YRUA 2F63A 4ZCMA 1B0VA 3GUXA 5KFWA 3PW4A 4DFKA 5D4PA 1EP4A 1BOBA 4ZLPA 2ZE2B 1NSPA 3GV5B 2GVZA 4ER8A 3ITHB 5M2PA 4C8LA 3MMBA 1CPSA 4CLLA 1K1QA 3R95A 4IQXA 1TR0A 4E8OA 2REEA 2X1BA 2W9CB 2IM2A 5HH1A 3TI0A 1YJNS 1SQGA 3NLCA 4R8UB 2OD6A 1S57A 3SSSA 3NCPA 3H2UB 2XS5A 3I87A 3HKZD 2R42A 4GVBA 4GO5X 2OEMA 3KASA 1QMUA 4PUOA 1K4JA 2IRXA 2FUG9 2BE2A 2PCUA 5DS0A 4AUKA 3MPVA 2NZ4A 3GWCA 2IYIA 2FE7A 3TUZC 1N71A 3NNCA 2F3JA 4J91A 3A8IA 2WUUA 4A48A 1N88A 5T7LA 4X8IA 3BQ2A 2Q0YA 3D2WA 4YMEA 3JQMA 3ETMA 3DLGB 2WHOA 4ZY2A 3TT2A 4CYNA 3H5SA 4WTOB 3I32A 3SXLA 4CLPA 2JZ5A 3JAMU 4CO4A 4YUDA 2H5JB 1JB0C 3D6HB 2A0FB 3HSZA 4JI8F 1SL2A 4OADA 3HFVA 5J1QA 4LRAA 1HQ2A 3HVTB 2FTRA 3I5AA 1GFWB 2LEPA 4RR5A 4Q2MA 3T3FA 3W6SA 3IA0A 2OTJS 1VRUB 1T95A 1RT1A 4B3MF 4Q2LA 1FRIA 2PIIA 2DNGA 5HANA 3GMGA 5KAKA 2KRBA 2B3UA 2PDOA 4FNIA 1OYEA 1DBDA 4YDDB 2LQBA 1KOHA 2PR1A 2K1RA 4ZY0A 5D4LA 1FRJA 4J9LA 2C2DA 3UN3A 4M3SA 1TMJA 4WPAA 4CLFA 2D1CA 2DGUA 4Q45A 4P4DA 3GCWP 3M7VA 1YR0A 2LA6A 2HSEB 4WFZA 1R57A 4X64J 1X4EA 1UPMB 2PEBA 2YNFB 1HNWF 1VMBA 3HZEA 1Q4RA 4F2RA 2AJ0A 1N5TA 2VF3A 5B0FA 1HHQA 1KR4A 1IBKF 3MEEA 3WIVA 3K2YA 4O3OA 4OLLA 4G6VB 4DR1J 2MGZA 3KLHA 3TZXA 1VK3A 3R6GB 3N79A 4WP9A 2JRSA 3D6FB 2FIAA 2PO4A 4RW6A 4AE5A 3KDOA 4J9OA 4YN3B 4OHYA 5KTDA 2HWHA 4R6TA 2CXAA 2PJ3A 2RQ4A 2DD8S 3R5DA 4ZDNA 5DZ6A 4DPOA 1ARMA 1IBLF 4J90A 3JSMA 4QC6A 3CO9A 3Q22A 1RTIA 1QVGR 3V5RA 3V6DB 4OAEA 4X4VA 5HXDA 2HKEA 4LFAJ 2G4BA 3MDFA 4QPXA 4DS4A 3NEKA 2XLIA 3DDIA 3R9EA 1AUSL 5K8MA 4DCOB 2MXYA 2ZEEA 4B6ZA 2W9BB 1V0CA 2HNDB 2HURA 2VI7A 4NCGB 1UVJA 4H4KC 2CNSA 2KG0A 3K59A 3R7BB 2N7CA 2IIHA 3HHLB 1TUWA 1AB8A 4QWEA 2V50A 1XTZA 2MJNA 2OP5A 1SC4B 1M5SA 1G4CA 4NMXA 5E2QA 4F8ZA 4QIEA 4I6AA 3KNGA 2ZD1A 3K5MA 1UP1A 3IR5B 1SJFA 4UEEA 2EFGA 5HSPA 3TVKA 1M4IA 2VOOA 1Q95G 2ZDPA 2BJ9A 1YX2A 2ILZA 3DR6A 1XMQJ 2WVCA 3DC2A 4KOTA 4J9RA 4U9RA 1AMPA 2ZOGA 5I3PA 4NSQA 2PI4A 2FXFA 7CPAA 3W2WA 3FCWA 1S7FA 1FJGJ 1FX4A 3W61A 2WVBA 2GGPA 4J37A 4HYKA 1YMEA 1EQMA 2J0QD 5M2UA 2XSJB 3C26A 5KG7A 4JYAF 3R5CA 2Y8WA 1D8YA 3GE9A 3HVWA 3EGZA 2O01C 2VHGA 3UR0A 4ETZA 1IYKA 3MM7A 1NJXA 1IR0A 1YJ7A 2D9PA 2P9GA 1XMBA 4WJBA 1TAUA 1WC0A 4X4SA 3CPAA 3ICLA 5IV3A 1MWQA 1OPZA 3FBBA 1VQKS 4ANCA 2Q66A 1CQNA 4NRUA 2PJ0A 2RMLA 2V8GA 2JBKA 2Y3YA 3GJRB 4FVCA 4KIAA 3PZJA 5JVGQ 4O4GB 1CLFA 1X0FA 1FO1A 1ZPVA 3WT4A 2RE1A 2AFXA 1GTHA 4X4UA 3TA0A 2W7AA 4YHHF 4A30A 2XZTB 4OZ1A 2XZDB 1GK8A 2ZJQQ 4WU2A 1WWHA 4KHMA 4MCPA 2I38A 2FZKB 1HD1A 3CMQA 4EZ9A 3SQGA 3PW2A 1XNRJ 2J9DE 5DQHA 2IM0A 2OZUA 1RT7B 5ETNA 4URQU 4EFDA 2C3UA 3B3VA 1ZM3A 3W5ZA 1WG5A 2VA2A 4CH0S 3ELHA 4NGPA 1PBAA 4MHZA 4F4KA 4IUSA 4HH0A 1Q82T 5A28A 3I0SB 1IN0A 1NK4A 2VB6A 1U6ZA 5CA5A 4DLGA 3H0PA 1VBXA 2W01A 3V2UC 3H8FA 5B0AA 2F65A 4IO1A 3PY8A 2OEKA 4YR0A 4DV2J 1RWOB 3ZO7A 2B9WA 3MAAA 2FVQA 3VATA 1B99A 1I94J 4C8OA 3T1YJ 2XGPA 3TOAA 2W24A 1Q7LB 4NLVA 3OSPA 3CDAA 1YZ6A 1HQEA 3BEGB 4N76A 3D28A 4DWIA 4Z2XA 1M44A 5BR8F 4GC6A 4JI4J 1WEYA 1NK9A 4P52A 2BKNA 1EE3P 1L3SA 2PSWA 1JLQB 5DS7A 2CPFA 3M9NB 4NXMJ 1RBLA 3D1HA 3C14A 1U6FA 2YWEA 2VEZA 3IBFB 2HGNA 4LREA 5J1NA 2WONA 2JFKA 2AYEA 1APSA 1FT7A 5CYQA 1DE4C 2EI5A 3MR2A 2OSQA 3W3SA 2WB1D 2X1FA 2BJ1A 4K8RA 5LSRA 5LJ3Y 2R7VA 3MPWA 1F2HA 3W60A 4P4IA 1IOIA 1URNA 2XI3A 5E3RA 1U45A 2GIFA 4R7MA 3PJXA 3WX8A 1LWXA 2POKA 3KG1A 1T9UA 2ZH9A 3TE4A 5A6PA 4A47A 3UCGA 2ZBRA 2OIHA 2BW2A 2ZZMA 3TZWA 1P1TA 2EFOA 1TV6A 2GHVC 1SPBP 2ACYA 3H4DA 1CJKB 2GO8A 1N34F 2C3YA 1R0AA 2LXUA 2OPPA 3AXMA 4KGKA 4K4YA 1RU2A 4TU8A 4B5PB 2HW3A 2YX1A 2ALYB 4ES1A 3PP9A 2WW4A 3MCNA 1PILA 5ELYA 4RW7A 4ZLNA 4DZ6A 3LH2S 4HNYB 1DTDA 2GIVA 5G21A 3QO9A 3DHXA 1T8EA 4U9YA 2Z2YB 4L3NA 3KYLA 1Q8BA 4NI2B 1YRTA 3OSNA 1MLAA 3FX6A 2PEHA 1SJ3P 3IC1A 3QYYA 2CVIA 1G1XA 2JEFA 3FRYA 4Q44A 4ZVSB 1QAXA 3R9LA 2YNIA 5KFCA 5DDRC 2AP6A 1Z8XA 1WI6A 1HNZF 2IJNA 2VODA 3ZJ0A 3WC0A 3I55S 2PC1A 4DR3F 4KAIA 4JI8J 3CJKB 5F48A 4DMZA 3CCES 1I1GA 2CYYA 2B9YA 2DIVA 5IT9Y 2RC4A 2C22A 5C88A 3UN2A 3A8KA 1WKLA 1RWMB 4U7UD 1RZMA 2DGWA 4DHVA 4B3MJ 3NAHA 2V69A 1YDLA 4PQUB 4IKAA 2E44A 4FD6A 1GMWA 3NL0A 1Z4UA 2DNKA 1NK5A 2CPHA 4X84A 2PJ6A 5LRKA 2QGFB 3H5ZA 3IGVA 5GAEI 4JV2A 3ZNUA 2Y0BB 2C6PA 3FVYA 1Q7YT 3MTJA 3GU0A 3NFZA 1NKCA 5HVGA 3HP6A 4YR2A 4RN7A 3IXQA 2BDPA 4CLSA 2WB4A 4IDKB 2ZNYA 3W66A 1HR0F 4DQSA 4OLPA 4CLTA 2PFFB 2RQMA 2HUZA 1AZSB 3TJ9A 3TO8A 1VGYA 4ZIWA 1R0BG 1HWLA 4AXJA 2ZEOA 1KHWA 4ZPVR 1HNWJ 3PYGA 2Y1IA 3GIMA 1IBKJ 5B0BA 1T7PA 4CTAA 2ZOMA 2EKYA 5EDWA 2NYQA 3CD0A 2DPTA 5C2GA 2YNEA 3BBFA 4JI5F 5J2PA 4C7HA 5GCNA 1T05A 2EBGA 2KRRA 3RYLA 3A3PB 3RRHA 4LSNA 2QLWA 4DPYA 1YITS 1JLFB 2PMHA 4P9SA 2VV5A 2W4PA 1LK5A 4OMFG 1TKXB 2PA3A 3NG8A 3IWLA 3CJQA 1IBLJ 2GQ2A 1IICA 3D3BJ 3GIUA 4YB6A 2H51B 3W1YC 2AIRB 3SDEA 4ZVHA 4F4XA 1J2VA 1FKOB 2V4QA 5KTAA 1RTJB 3CCRS 1RTHA 1Q53A 3MM5A 2VZYA 4EZ6A 3DGPB 4EBCA 1SV5A 4FAIA 1G6BA 1WG1A 2COLA 4FXVA 4E2AA 1IM6A 2MKKA 2VQEF 3H25A 2PJ8A 3UDVA 3W2VA 3J7ZT 1G7CB 1L3VA 3GLJA 3PB6X 1UVMA 2MKCA 4O4RA 4ES3A 3IU1A 4MHYA 2HBYB 3G6XA 1LWEB 2QN6B 7FDRA 2J7UA 1ZLHA 1K8AT 2WYRA 2U2FA 2VFUA 3PFEA 1B0TA 1CPXA 4KOVA 3GIRA 1NAQA 3QRPA 1CBKA 3BSAA 3I0RB 2CTCA 4Y49C 2ZDOA 2CKWA 3CIMA 4JOUA 3TVYA 4NASA 2F4VF 4Y3CA 3M8RA 4C0OC 1DJ0A 4UQTA 3ZZYA 4DFJA 2EEYA 1VLOA 5AGEA 1EETA 3BREA 3THVA 3IRWP 5E3AA 2F9JA 1HFEL 2G9OA 1SKWA 4OC3A 3FUYA 4OZ0A 5HMWA 3TX8A 3D0HE 3MTKA 3I9V9 5E0OA 4IOCQ 4I68A 3CPWR 4ED5A 1CX8A 3IAS9 5LSOA 1FDNA 1TKJA 5KT4A 4F36A 5B0DA 4ECVA 4RUAA 4I56A 3TAQA 5L38A 4DUZF 3CMAS 1MJ9A 4YEAA 2K3KA 3TFYA 4R3LA 5F09A 2BM0A 5AT1B 3VQSA 4Y0FA 4XPCA 4C2ZA 4EWTA 3OUYA 2GS8A 3C6UA 1CJUA 4UOFA 3PYFA 3FEZA 3C46A 3N7ZA 4BWMA 3QATA 4ED6A 2NXUA 2HFNA 1HBMA 4QIVA 3GQCA 3QNVA 4ZPCA 1JJ4A 1YVKA 5CCLA 3DLEA 4JLYA 3EXCX 3D3SA 4B10A 5DG8A 4JV5F 2N3LA 2QA4S 2ZBIA 2V5HG 3FECA 4YQWA 2LQ5A 4YHHJ 4TXSA 3KHXA 2V2ZA 5AG6A 4PXDA 2HS0A 1IKWA 1AFJA 4MIWA 2ROEA 1UFWA 2DT9A 2Y1LB 5HLFA 4FYVB 5CZVA 4M94A 1MMLA 2E9ZA 2B6AA 4WKRA 2ABZA 1B0PA 1RISA 1R8HA 1S4EA 1N5VA 4IFYB 4C3KA 4ED8A 3CDEA 4PWDA 3OLBA 2CQGA 2FGCA 2Q3PA 5GAHU 4OI3A 1CPZA 2V0NA 4BS2A 3NY0A 1HBUA 3Q24A 1D3WA 1JLGB 1WC4A 4FD7A 4KH1B 1Q1KA 3EPGA 4IR1A 4QW9A 2P6EA 3W5YA 3R1HA 4TLQA 4GVBB 3N4WA 4BMHA 1QDUB 3MRUA 5B09A 2OI2A 2KHCA 4DX8H 2LECA 4OC2A 2BE2B 1WC5A 1NJYA 3ZTPA 3G9CA 5HVHA 1Q5YA 5GADI 4C48A 1BLLE 3FEXB 1ZLIA 3T5JA 5CAAA 1BUXA 4QQBA 1K9MT 3OFEA 2DHGA 3PEIA 5T7LB 2PFDA 3M9OB 5BR8J 2QT7A 4DJLA 2UVRA 4AYBD 3IFEA 3R7SB 4EBDA 1U48A 2E9TA 5HO4A 1F5AA 2F1FA 4WF9Q 2ZENA 3I31A 4FKYA 3S6EA 3P2FA 1RGVA 1EHWA 2KT5A 3P3DA 4Q8EA 1X12A 3RBXA 2CVEA 1RAIB 3AOAA 3EZOA 5ETLA 1H0HB 3AJ1A 1UWAA 2XEGA 1RADB 4PYDA 3R2DJ 2V63A 4BC7A 2VH7A 2D69A 2XY7A 4F67A 3JQKA 2ERRA 1S6QB 1RT1B 3JB9k 2H54B 1TL3B 4RLEA 3JYTA 4AXIA 1QLNA 3MPDA 1WHVA 3W91A 5HVFA