3ISZA

Crystal structure of mono-zinc form of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
376
structure length
369
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 122
structure length 369
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iszA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iszA01
3FF3A 3KQZA 3VARA 1TF8A 2PJ2A 2GU2A 2ANPA 2CTBA 2ZEDA 3T8WA 5I4MA 2ZEEA 5THWA 1ARMA 4NGMA 4ZY2A 2PVVA 3B3TA 1LAMA 5J1QA 1AMPA 1QMUA 2OOTA 2JEWA 3D68A 4R8FA 2BCOA 2PIZA 3D7DA 3IO1A 3H8EA 2JBJA 5JGFA 3D7HA 3NH8A 2AFZA 3SJEA 1ELLP 4OC5A 2AFSA 1XRYA 2ZEHA 3KHXA 1YLOA 1DTDA 4Q7AA 1DE4C 3K9TA 2NYQA 3PB8X 2IMOA 3TX8A 2ZEGA 3IFEA 4H2KA 4K3NA 2C6GA 1YMEA 4MXUA 2J9AA 4P10A 3LWUA 2AFXA 4FBEA 3IWWA 4OC0A 4NGTA 5K8OA 1PCAA 1H8LA 3WC6A 4PXCA 1ZLIA 1ZG9A 1VIXA 3B35A 2CIJA 4WJBA 1KWMA 4OC3A 4OC2A 5LRJA 3RBUA 3H8GA 4MCRA 1F2OA 3FMCA 4MCPA 1R3NA 1CBXA 3KZWA 3SJXA 4MHPA 3DLJA 3TC8A 3PBBA 3IEHA 4Z65A 4DYOA 4OMEA 4P44A 4DUKA 1IY7A 3IJ3A 1VHOA 4MHNA 3CPXA 2FVGA 4P4JA 4NJRA 3SI1A 1CG2A 4R76A 4GM5A 4EWTA 2PJ9A 3PFEA 3PB4X 4ZX8A 2WYRA 1CP7A 3FEDA 2CF4A 2AFOA 2XEGA 3S9LA 3B3SA 2PJ8A 4R7MA 4X3RA 1Y0YA 2XEIA 4G1PA 5ELYA 3D66A 4MCQA 3KHZA 2ABZA 4IHMA 1BPMA 4UEZA 1HDQA 2HC9A 4P4DA 4OP4A 1FNOA 3NA6A 1AYEA 1XBUA 5CPAA 4O23A 4MHZA 2AFUA 3CPAA 5IB9A 2G9DA 3PBEA 3BI1A 4NGSA 4OC4A 3VATA 5LRKA 3BI0A 2C6PA 3VH9A 1QQ9A 7CPAA 4DJLA 3FECA 2CTCA 5D8NA 4FAIA 4KSIA 1JQGA 4F9UA 4OC1A 3SI2A 2QJ8A 3FEEA 4NGQA 2RFHA 1VGYA 4NGPA 2F8HA 3PB9X 2OR4A 5LYLA 1Q7LA 1Z8LA 2PJCA 3JRUA 1ARLA 4PPZA 4JYWA 3WT4A 2PJBA 3KQXA 3DGVA 3KL9A 2ZEPA 1CPXA 3K2KA 3N5FA 3PFOA 2RB7A 3FVLA 3B3CA 3S9NA 4OIDA 1YSJA 5LYFA 4PQAA 2PJ0A 3NH4A 2Q4ZA 2WZNA 1YW6A 1RTQA 1Z5RA 4W9YA 1TXRA 1LAPA 1BPNA 2EWBA 4FWUA 3RZAA 2AFMA 2GLFA 2PJ5A 5D29A 1Y7EA 3SI0A 3V38A 4LQGA 2POKA 4UEEA 3GUXA 4X2TA 1Z2LA 5K8MA 4CPAA 4UIBA 4MRIA 2PJAA 4F8ZA 3ISZA 1PYTB 5F09A 2QYVA 1BAVA 5LRGA 4A38A 2V8GA 4ZY1A 5CBMA 4UIAA 3FJUA 1BLLE 4UEFA 4NGNA 2AFWA 3KGQA 4BD9A 2C6CA 3IC1A 4EMEA 2PCUA 3PB6X 4MCSA 3ISXA 1CPSA 5HVHA 4X8IA 1TKHA 3B3VA 3I1UA 3D4UA 4B6ZA 1F2PA 2V77A 4NJQA 2Q51A 2PJ4A 4P4IA 2XEJA 4P4BA 4MMOA 2PRQA 1LOKA 3S9MA 4ZX9A 2QVPA 2PJ1A 1GYTA 4A94A 4ZY0A 2JBKA 2IQ6A 4NGRA 3H8FA 1F57A 2ZOFA 3MN8A 3NH5A 1ZG7A 4WWVA 4MHYA 1LCPA 1TKFA 4TWEA 4OKOA 1FT7A 2Q43A 2NSMA 3SJFA 4FUUA 3PB7X 1VHEA 3CT9A 3NFZA 3BXMA 4P4EA 2O4HA 1XJOA 4YU9A 1LANA 4TNUA 4R6TA 2XEFA 5K8NA 2PIYA 1Y0RA 5HVFA 1EE3P 1IGBA 3D67A 1ELMP 2ZEMA 1UWYA 1XFOA 3B7IA 5DS0A 3KASA 1ZLHA 2BOAA 4JZ0A 2V8VA 3WC7A 1ZG8A 4RUHA 2EK9A 3WC5A 4ZI6A 3FH4A 4P4FA 3CDXA 3IIBA 2GREA 4ONWA 1CP6A 3V7ZA 2I3CA 3KR5A 3BHXA 3HLPA 3RAMA 3SJGA 4IK2A 4P45A 2PVWA 2ZEFA 2VL1A 4A37A 1LFWA 2DEAA 2GLJA 1HDUA 2PJ3A 1OBRA 5K8PA 2HB6A 4NFRA 4PXBA 1HEEA 3QNVA 4P6YA 3D7GA 5JH9A 4OIWA 1M4LA 4PXEA 1CX8A 4YWYA 2ZELA 4UF4A 3KR4A 5HVGA 4PXDA 2V8HA 2BO9A 2F7VA 3GB0A 3D7FA 1TF9A 3B3WA 3B2YA 3PEIA 5LYIA 2IJZA 3PRTA 1YW4A 4IAVA 8CPAA 3HUVA 1XMBA 4ZYQA 4A39A 2PE3A 2PJ6A 3KI9A 4AXVA 2V8DA 3WABA 3MRUA 3LMSA 2ZEOA 1TKJA 3L2NA 5HXDA 3GLJA 2ZOGA 2EK8A 2O53A 5LYDA 5JM6A 2C1CA 2PJ7A 1R43A 4F9VA 3FX6A 2ZENA 4EFDA 6CPAA 1NSAA
chains in the Genus database with same CATH superfamily
3J7YI 1RHMB 2ODFA 4CYOA 3LPYA 4OJGA 3VGUA 1EIYB 3H59A 4LSNB 2KU7A 3AD9C 1TIQA 1T3NA 1QMUA 2R8JA 5GCNA 1RXOB 2VFVA 5IC4B 5KT5A 2BL1A 2H9ZA 4ZPAA 1U8WA 3EZOA 3MM9B 4RUBA 2ZC4A 1FRIA 3W2VA 1YIJS 4PK2A 5GMKa 3IR6B 4DSEA 3K9TA 3RB6A 2PDAA 1IICA 5HROB 2MGZA 3DDDA 3OFHA 2VJUA 4H2KA 3FQLA 1R8AA 2VQFF 2GC8A 3SHPA 1H72C 1URNA 1Z9UA 5CCMA 2NYIA 5DETA 1TP7A 1NJIT 2F5GA 4R3LA 2FHKA 2OMOA 1MJAA 4OI4A 3RBUA 4MCRA 4PV6A 1CBXA 1LFPA 1SB6A 2J0QD 2J6SA 3Q8QB 2ZH6A 2XI2A 3A1YG 1N6QA 3IEHA 1RT6B 3R5CA 2IC3B 4KGZB 4AG7A 3QGHA 2L08A 2CG4A 4KE5A 2DY1A 3TJ8A 4AYBD 3SI1A 3Q8RB 1RT2B 1D9DA 4DR3J 4NEXA 1RWOB 5IFMA 3JAMY 2UXCJ 3CJ0A 2GMLA 3V6DA 4M63A 2R98A 2R9LA 5HJXA 3CE8A 1HI8A 5CAAA 1KLMA 5HP1A 1F0XA 2KT2A 2MTLA 2ASYA 1HI0P 2MY7A 4W90B 2D4OA 3DM2A 3N7ZA 2BV3A 4MTPA 3RB0A 4OLPA 4PAAA 3AD7C 1RI7A 1IQZA 1D09B 3M8PB 1SL2A 2AIRB 4QWBA 3GR0A 4DV3F 2UP1A 1UFHA 3KLHA 4F9UA 1U2RA 1MWQA 5C42A 1YVFA 2A18A 2RJZA 3TZXA 2OR4A 4ED5A 4KO0B 2BUNA 2HFSA 3LGNA 3AFGA 1N5YB 3RRHA 3FZBA 1AZSA 4D3GA 2XSJA 4UQGA 3FVYA 1OYDA 2DT9A 2CPXA 1TL7B 2ADCA 4YMEA 5ETOA 4PSWA 1XIQA 3I5CA 4CAVA 4QIEA 2N82B 2R7HA 1PILA 1SL1A 1S3ZA 5GADI 4JI8J 1GQEA 1LRZA 4B5OA 2BKNA 4NXNF 1FEHA 1RHQB 2J9DE 3JTOA 5AGEA 2ADBA 3PYDA 3K5MA 4H4KA 2FS5A 3AQOA 4B9TA 3ISND 3W63A 4B3SJ 3DN9A 3BQ0A 2FGOA 2VEZA 4B9UA 4PQUB 2QLWA 1WC5A 1OY8A 1CPSA 2ZBCA 5KG1A 1R31A 3H5ZA 1IM6A 2KFNA 2WK4A 2OPQB 4L3NA 4CYNA 4B3RF 1WTBA 4ILMA 1IKVA 3TO9A 2OH1A 1UEVA 3W8GA 4I2QB 4MHYA 1R0CB 1UETA 3UCGA 4WYWA 4OKOA 2QN6B 2HVEA 1FNMA 2HAIA 4ECQA 3AXMA 3KJFB 1XJOA 3EZUA 4CYUB 2E5HA 3C14A 2RS2A 4ECXA 1VC0A 2Y0BB 3EVOA 1EJ7L 4A95A 4WP9A 4NF1A 1WACA 5D4LA 4ZK7M 4CLPA 4O3OA 1WEYA 4ICLA 1IXKA 2NXJA 4J7CA 4EBCA 1VHFA 2LU2A 2PVWA 4CO0A 4JD6A 5AJ3J 3HHLA 1QVFR 3UPFA 1C0UA 1CVJA 1RTDB 1KUYA 4LRBA 2ZOMA 4K4VA 3NS5A 5JH9A 2FPHX 1FXRA 2J9CA 5H9FJ 1LNQA 3FZ2A 4IFVA 3QAHA 2GIVA 3OVSA 4ZIWA 2BA9A 1AUSL 3M32A 2IM1A 3HPOA 4RW8B 1TUVA 4DSFA 5D6GA 1PAEX 4PWDA 3CCWA 2IDEA 2HV2A 3A8EA 3CCZA 1KR4A 3PEJA 4IO1A 3TA2A 1FT8A 4MKVA 3DGPA 3EE3A 2AJFE 1YJUA 1RT4A 2W7AA 4Y6IA 1KUXA 3IWGA 4K4WA 2HS0A 2JDDA 3EM1A 1SCJB 3FJ2A 3DYAB 5J2QA 2UVWA 4KB7A 1MMDA 4LRAA 1I21A 2XHCA 4ZVQB 5HAOA 2G0IA 4LF6J 4LFAF 1T05A 4OHYA 1UMJA 2ZNYA 4R8FA 1K44A 3H8EA 2JBJA 2DR5A 5KFAA 2NXCA 2W9BA 2AYGA 4K50A 1YX2A 3T6JA 4ECRA 4AL7A 3KHXA 1YZ6A 2DH7A 3QSIA 3R5GA 4F36A 3UQSA 4K59A 1LW2B 2W8KA 4ES3A 2WCXA 4DV5F 3LGMA 3RAQA 3WX4A 1JB0C 3NRBA 4XDCA 2Z2LA 2YNHB 2EPIA 4OC0A 1LWCB 1CJTA 3KKWA 3I31A 5FIIA 2VHGA 4LJMA 1BQNA 3MAAB 4R57A 1DHMA 4YB5A 3TAPA 2LQ8A 4H4KC 4CO1A 4X4VA 2QLBB 1UKUA 1GXLA 2R7TA 2WSFC 3ZTOA 2K06A 2FQQB 1KC8T 1O0PA 4OMEA 4CT9A 4TQRA 2HFNA 1T03A 4K30A 1FD8A 3OR1A 5AXLA 1AFIA 2ASJA 3CPXA 6AT1B 3CDUA 1QAYA 2WHOA 4ZVTB 1YRUA 3DI6B 1IOIA 1FXDA 2Z3NA 4F67A 5DG7A 3QATA 1NM2A 2OU2A 4J9KA 1KQFB 1LV5A 2IVYA 1QUPA 3B3SA 3OVBA 3CO0P 2Y1IA 3D66A 2EG2A 3IMQJ 3TR5A 2P8IA 4C0OC 2DHGA 2LYVA 2OEJA 2IRYA 2PFFB 1GHEA 2MKYA 1HDQA 2V9WA 1RWWB 2RHQB 3MCOA 1TV6A 1SKSA 4OYZA 2OB0A 4I4BA 4FKXA 3G6YA 5EX0A 1JLFB 4ZVPB 1NKBA 1FX4A 2R7RA 1YLXA 4MFPA 1U1MA 4CI0B 3LP1B 1U1KA 3QRPA 2ZH8A 5HI7A 1JQGA 2ZE2A 2B4UA 2B43A 1QE1A 3SI2A 2BW7A 3DDNA 3IM8A 4NLYA 4TN2A 3B82A 2I1RA 2O67A 1SJ4P 2YKPA 3BEGB 3HHLC 3EX7B 2CJQA 5C24B 1N5TA 4QR0A 2YBVA 2ZEPA 2MKIA 4JOUA 5LSRA 5HBMA 2KT5A 1UVKA 3F56A 1NJXA 4WK1A 4ZP9A 4MYTA 5F9LA 1TL1A 3W7BA 1M4IA 3T5KA 1KP6A 4LF2A 3QO9A 3R2DJ 2HSEB 2MZJA 3HF5A 1RWMB 5L39A 3ZO7A 3K5NA 2OAUA 4XTTA 4X4RA 3VZIA 1IJEB 2CNKB 3R7BB 5A8RA 3W6SA 2CZ9A 4CPAA 3MZIA 4LF1A 4ZDNA 3KLEA 1YJNS 2AW0A 5C7PA 3E0KA 2L9NA 1RTIB 2MZRA 2DNNA 1C2PA 4F4XA 3IRXB 1HNWJ 3CO9A 3NS7B 4JWPA 2GVZB 3PB6X 1HBUB 3A13A 2L9DA 3HZEA 1TKHA 3B3VA 1WJ9A 4BWJA 1OIAA 4DX5A 2PJ4A 3OL9A 3W64A 1X4CA 2DHXA 3UVJB 2PE8A 1LW0A 1SV5B 1RAEB 2EVNA 2LMIA 1UFLA 2YH0A 3MEKA 1FY7A 1S9FA 3H90A 4A48A 4QWDA 2U2FA 1S6UA 2D7SA 5JPHA 2CPHA 2AU0A 2NSMA 2AYMA 4A8MP 4FUUA 1VHEA 3EXYA 2DH8A 2ZBPA 1X5SA 5ETMA 4TNUA 2DGUA 2QLFB 2J0XA 1AROP 2IM2A 1ELMP 5G20A 2GIQA 2AP6A 2W7OA 1VQLS 2GAGC 1MWYA 2BE2A 4PYDA 1R8BA 2O1PA 3V81B 3FH4A 5T7LB 1VRUB 4DG1A 3GYNA 2CQBA 4ED7A 3DRSB 4JUZA 2DB1A 1CP6A 4IOBA 3V7ZA 3KR5A 1XN9A 4QU6A 4U9ZA 1REGX 3LAMA 4QJVA 1S9GA 3POTA 3KK2B 3UDLA 5JUMA 3RBDA 2VXKA 3MMBB 1WWHA 1HDUA 2FLLA 4A32A 2HURA 2DGTA 1HA1A 1RAHB 2DK2A 1HW9A 4TU7A 4OIWA 2IVMA 2IL4A 2QMLA 3H4QA 5HVGA 2BJ1A 2CUYA 3BKFA 3R9EA 4BDPA 3KOAA 2WPXA 2QX0A 1R8CA 2HHUA 3OL7A 5LYIA 2FVCA 1QAIA 3SXNA 1F3FA 3TZZA 1JLEA 1C1CA 4DV0J 1SC3B 4U5YA 1RADB 4CLTA 3Q86A 5CXTA 1Q2YA 4AXVA 3FRZA 2BQRA 2DR8A 1G4CA 4GKKF 1N56A 2CPEA 4NXYA 4OHWA 1RWUA 3VHQA 3E51A 3LPEA 2Z2YB 3Q22A 4ZVUB 4CLWA 2PJ2A 5CA5A 2KYXA 1UFKA 3GYXB 2X7BA 2YKMA 4JI3J 5CNPA 5KT4A 4B5PB 3B3TA 3OVAA 2PT0A 1PC4A 1BGXT 5J1PA 3D68A 3BQ2A 3MEDA 4CGLA 2B9EA 4OQJA 5IWAJ 2VFRA 2OTJS 3O5TB 5AG6A 2VG7A 2Z3OA 4M6HA 3Q2SC 1DE4C 5DDPC 4UFVA 1GEHA 4PK3A 1G2EA 1YJVA 4CH7A 1DTTB 2MKKA 3DC2A 4DNCA 1HR0F 5KFKA 2GX8A 4IH5A 3JQMA 1HMVB 4X64F 5HMZA 3EUNA 1IKYB 5K8OA 2JFKA 4ZPDA 5D0EA 5FJ4A 4W4MA 1U26A 4A8FA 1Y11A 2E29A 4C0HA 2Q6CA 3QYYA 5GVQA 4C8MA 3R6GB 3I0SB 1IKXB 4OJ1A 2GO9A 3OWCA 3Q8SB 3T41A 4Z7YA 3SJXA 1N34F 3MM8A 2XZDB 3H4BA 4R3KA 1N0UA 1Q7YT 2WB1D 2J7KA 4JV2A 5DG8A 4B3MJ 3IJ3A 1I5OB 4N8NA 4KFBA 1L3KA 5IT4A 4EWTA 4U95A 5FLXY 1LK7A 3HVAA 1NB7A 4UOHA 4N77A 4FVMA 2ZHBA 2NXNA 1Y0HA 2B7CB 3S6FA 4F4YA 1B0TA 5HQ8A 3ULHA 1RTJB 3AXKA 4QWCA 3AJ2A 4F0MA 2PI4A 2N3LA 1CJKB 5F49A 5LSOA 1BPMA 3DFEA 3PW2A 2VG6A 2YH1A 4XPDC 3OLAA 4OP4A 1FCAA 2RQKA 4JP8A 4RZRA 1PYTA 1RA7A 2IHR1 3W1YC 4IRCA 4NMXA 3BO2A 2YNGA 4NYPA 1Z1ZA 2MB0B 2KHCA 3MM5A 1XWLA 3PP9A 2FIWA 4HPSA 2ATLA 5L9XA 1VC5A 3JUWA 2VKZG 5KG7A 1PYSB 4QU7A 2J9DA 2ZKUA 5J1EB 1FHTA 1QAJA 3JRUA 3CJSA 2F4VJ 3DGVA 3KL9A 1QM9A 3FUYA 4X4PA 3C46A 3EY5A 1S1XA 2B4PA 2Z58B 4M5LA 3DLLQ 1HBNA 2KRRA 3QT5A 2QA4S 3V4MA 1XK8A 2AGOA 4URQU 1CJUA 5KFWA 5D0HA 3CCLS 4ID5A 1MN9A 4B9NA 4FBTA 1HWKA 4DR1J 3IG1B 4W9YA 2W9CA 4M1KA 3SIPB 2M88A 3GONA 2AFMA 4RW6A 4ELVA 5BYSA 1W2IA 2DGVA 2OD6A 3C16B 2QIRA 3PX4A 2V2ZA 5F3TA 1L3VA 1BAVA 4WIIA 3VF0B 4N41A 1NPPA 3TAMB 2BMBA 2KH9A 3FJUA 2HK2A 2XY6A 2X1BA 1Z4UA 3BDEA 1M90T 5AE2A 2BABA 2VG5A 2C6CA 3PIPQ 3W2VB 4MCSA 3EC4A 2QA2A 4AG9A 4G6VB 5IV0A 2MGZB 3W6XA 4XPEA 2V34A 1S1UB 1D8ZA 3ILLA 2B3VA 3RO0A 5KFHA 2FJXA 1HNIB 3GIMA 4FS1A 3IGNA 4J9SA 4RW7B 3OL8A 3FK4A 4CNZA 3V6KA 3E01B 4DLEA 3AJDA 2HHWA 3AOAA 1FT7A 2HHPA 4M6GA 2GIFA 2NS1B 2C3UA 3SJFA 4ZPVR 4USMA 1MNEA 1R57A 5BYQA 4PPDA 1C4CA 5D15A 4QC6A 2J8MA 1D9FA 2R4FA 3H2LA 3NE8A 3PR5B 1VQ6S 2CNOB 1NH7A 1UJ6A 5J2PB 1U0HA 3SMZA 1U6ZA 4DEZA 4L6V3 3H5SA 2F8MA 4Q8EA 2REEA 1XF8A 1WF2A 1S4FA 3WC5A 2KHDA 1UW4A 1DY3A 3T5JA 3RRKA 4NA2A 1UVMA 3KLGB 3KNGA 6FDRA 4X4UA 4KR0B 1FFWB 2FC8A 4C3MA 2LLZA 4E0AA 3B4DA 2MLZA 1QD1A 1S9EA 1LFWA 4OIXA 2ZPAA 3WR7A 4FF3A 4U9RA 4LF8J 2BXJA 3M8QA 5H9EJ 4B3SF 3DM2B 1E6YB 1M1DA 4YWYA 2DEJA 2ZELA 2Z3KA 1FJGF 1TUWA 2F7VA 4O0NA 5EWEA 3D7FA 4KGXB 5AT1B 2B9XA 2WRMA 4RWWA 4BWMA 2MHNA 3H5YA 1TK5A 1JJCB 4IAVA 4OL8A 4ZYQA 4A8SA 1I94J 3QRQA 3KWMA 5IX3A 2JZ5A 1UJ5A 4HDHA 3GWCA 3JTNA 2QLXA 2V8DA 4ZCKA 4Q2LA 2ZEOA 1UVNA 3L2NA 5HXDA 1NSKL 2ZOGA 3GLJA 4J9PA 2NPIA 5JM6A 3AB4B 2A0FB 4J9LA 3A9LA 4DFPA 4EFDA 5DM7Q 4OZ3A 1U09A 2E1AA 3UN3A 1E6VA 4ZLLA 2CQ1A 2OFGX 5CHCB 4H4OA 1UW9A 3K5OA 1KFSA 3G71S 1BUXA 2RSQA 2ZJRQ 4UCPA 3KMQA 4CGMA 3N6MA 1ZETA 3Q89A 3D7DA 3FBFA 4UOFA 2OZUA 4EYIB 3MR2A 2DGWA 4IOAQ 3R9FA 3PHEA 5K9FA 1Y9WA 4DR6J 2AD9A 3V6HA 4DV4J 2XGQA 3QFWA 2X1AA 2FGCA 2DGSA 1B0PA 1KEKA 3R9GA 2R7WA 2ZW4A 1NO8A 4WE1B 5AJ3F 4NGTA 2V63A 1IR0A 4C7QA 3R97A 4KOYA 4CRJA 4QBUA 1X7VA 4PXCA 1S72S 4YB6A 3DRXA 1TK8A 3HHLD 4MFBA 2XLJA 1GH8A 1HYSA 2E7VA 1KWMA 1YX0A 2VASA 2OJ3A 3T5LA 4IRKA 9RUBA 2YQ1A 4GC6A 5LXRA 3PBBA 2EFPA 4RNNA 2HBYB 3PY8A 3P3DA 2ZITA 3E2EA 2KCWA 4Q8FA 1N33J 1FRXA 2EKNA 2JL9A 3TA1A 4DR5J 3RYOA 1NAQA 3SSRA 3BN4A 3M2RA 1RYSA 4C0BA 1KSPA 1Y5LB 1SKWA 5FD1A 3C14B 4A46A 3KK3B 2HQCA 1FWLA 2OPSA 1ZAWA 1N32J 3MPVA 4DPOA 4W98A 1S7FA 3NNCA 3K2YA 4MK7A 4ONUA 1ZM3A 2XZTB 5D3GB 4KOVA 1MLAA 1YREA 2AF6A 2GCFA 4ECZA 2DNGA 3KFWX 4O23A 2ZH7A 4DXLA 2AJ4A 2VICA 4B10A 3THVA 4YHHF 2XM3A 2DO4A 2PR8A 2KJWA 4EZ6A 1WHWA 4OZLA 3DOLB 5CZXA 3EO4A 2BJ9A 4LVNP 3BJ8A 3MM6A 4LUAA 2KG1A 4CAEA 4RW4A 4KSIA 1R27B 4OC1A 3LALA 2FZKB 3JTKA 4IFVB 4OZ5A 2DIUA 4JYWA 4CLYA 2RH3A 2P6FA 1LK5A 1AB8A 1S57A 2UXBJ 3M32B 3C8YA 1JXLA 2WONA 1VIOA 2BVZA 4L8AA 1RTHA 5E33A 4A2ZA 3IS9B 3ZZUA 2F5IA 1KD1T 1YW6A 2HWIA 2B5GB 3KKFA 5AG5A 3NGSA 5EGYA 1HKAA 4Y65A 3RBXA 3QLHB 1K47A 3QIDA 6FD1A 1NSLA 4FXWA 3HT0A 1VHIA 2UUCF 4UWJA 4KRWA 3G96A 4F8ZA 3WC2A 8AT1B 4A38A 2ZBIA 1VQPS 4WCEQ 1X9MA 2XLIA 1VOMA 1XJWB 2DTJA 3HK2A 5DLFA 1S12A 5H9FK 3O6QA 1RTZA 3FKBA 5D4PA 1IYKA 5DZ7A 4C7IA 3BO3A 4NI2A 3HKZD 4QYZJ 2V2QA 2VBXA 3SCIE 4DFJA 1HWJA 3H8FA 2ILZA 2BE7D 4DOZA 4HL9A 3BZQA 1YVOA 1EP4A 3CC2S 4C98A 2WAQD 2P2CB 1Q8IA 1HNVB 1WHVA 4EK2A 2NMTA 2IM3A 2JEJA 4BC9A 2Y8WA 4R6TA 1SL0A 3HT3A 5HVFA 2FIUA 1IGBA 2PMZD 2R7OA 4ZBGA 3G8TA 2VPYB 2DVIA 3MR7A 2CWKA 3CJ4A 3NGKA 4NPOA 2Q7BA 4MBUA 3NE7A 3NLCA 3ZTRA 2C1EB 2DNRA 4PUOA 3PRDA 4F02A 3OLBA 3PRVA 3OR2B 2RAQA 4B9LA 1OY6A 4P7TA 1TV6B 2JC0A 1TVRB 2Z56B 1N5QA 4JV5F 1ZTWA 1IBCB 1HNWF 1J5EF 2Q0YA 4LFBJ 1L0CA 3ITHA 2MSSA 4Y49C 2MKCA 2BANA 2IPOB 2HG4A 4OYMA 3PX6A 3W2WA 2PA3A 1SQHA 2A1BA 3OV7A 4JI7J 3I5AA 2V68A 2F9DA 4NCBA 2EC0A 2VA2A 5LXYA 3BKUA 4UT4A 5HBMB 2DNKA 5KFSA 4MY0A 1NSAA 3FF3A 3LF0A 2GU2A 4RN7A 2X1FA 4K4SA 3R96A 2BYCA 5I4MA 3K7RA 1QSRA 2XMAA 4NGMA 1F5CA 3S7RA 1LAMA 3DLGA 2QG9B 1IBMF 3TFYA 2NZCA 4ALZA 3CGIA 1VQNS 4MHDA 4OC5A 5C25A 2OGUA 3AOCA 2YXLA 3KLEB 2VZYA 2NYQA 1WTFA 1SXLA 4DZDA 5IS2A 3HKWA 2RS8A 1TKXB 1FKAF 2D3ZA 3CULA 2ZEJA 2XNQA 1S6PA 1KZFA 4OX7A 4P10A 2MY8A 1PJ5A 2IBKA 3TWZA 2PI5A 1ZLIA 2IFXA 2CAJA 3OJUA 2APOA 1EETB 1VIXA 4ECTA 4M5NA 4OC2A 5LRJA 1K73T 1R3NA 4CS0B 1LW0B 3KZWA 4U7UD 4Q45A 1S1WA 2C2DA 3NOGA 3QJLA 4NZ6A 1XC9A 1Q78A 4K4UA 4DV0F 3H98A 3UFCX 3BR9A 1CG2A 4R76A 3IWEA 3H42A 4YFUA 3EVMA 1MU2A 1H3DA 1CS4B 3D0GE 5EHHA 2GO8A 1RBLA 4FPRA 1D9AA 4X3RA 1Y0YA 1RISA 2UUAJ 4OAEA 3N28A 2CPYA 4L89A 1WF0A 3LH2S 4JI3F 3QT8A 1T02A 3TJ9A 4F0YA 4F0KA 3GU0A 3SSSA 4DG1B 3C6TB 3MMAA 1LQ9A 2QA1A 2LQJA 5IWAF 4I69A 1FDNA 2AFUA 3H0PA 1S9GB 3POTB 2R3VA 1MJ9A 2LCWA 1ITPA 2MPUA 1QQ9A 2K7JA 5DLGA 2YWKA 1F9FA 1T9TA 2RF2A 1SKRA 2OZGA 1Q0NA 3EGWB 2R8GA 2RFHA 1RT7A 3TO8A 1Z8LA 1IKWA 3SDEA 1FRKA 4O4GA 2COLA 4CO2A 3G2XA 2E1CA 2VOOA 1EQMA 3G82B 2LQ5A 1I1DA 3R5AA 5ETVA 2ASLA 1DRZA 3D1OA 3IAS9 2EBEA 3MEEB 4OX9F 2JEFA 4WU3A 4YEAA 2C27A 1H7XA 3MM7A 4MH8A 4B14A 1TXRA 2H5IB 5E3QA 4PCQA 3T1HJ 3GILA 2GFQA 4LFCF 1YDLA 4M5IA 4GVBB 4UIBA 2PJAA 4IG0A 1MK4A 1S76D 4ED4A 1WG1A 2HIQA 1HQEA 3B54A 4LUBA 3JYTB 3VAJA 1RCOB 3TAQA 4ZY1A 3MEDB 3D1QA 1FX2A 3M2VB 4YY3F 5HH1A 5J8FA 1HNZJ 2VG7B 4KLVA 2ZW6A 3PW0A 2BE9B 1CSJA 2QTWA 2OD4A 2XEJA 2PRQA 1I1GA 1B64A 3ZZIA 2GQ2A 4OZNA 3RW7A 4B08A 3QIPA 4LVOP 2BJDA 1VYAA 4FZVA 1G7CB 2ZZMA 1U0SA 5KG0A 1F9EB 1PAUB 4J90A 4EYHB 1VRTB 2D3UA 4AVBA 3BBFA 4LBIA 3DLKA 4DU8A 2LKZA 2B4DA 4UTGA 1JLGA 4GO7X 4FXVA 1ZS6A 3ETMA 3NS6A 2G0BA 4HNXB 2CJ9A 1IWAA 3J81U 1Y0RA 3PNIA 3P5TL 5E0OA 2DGXA 2P6GA 1YBAA 4G3IA 3CCRS 3B7IA 3C15A 3PJWA 4URSA 1NKEA 2KN4A 1M1GA 4C2XA 3CDXA 1TFYA 2Q3PA 2O28A 2RU9A 1S0VA 2JOQA 1H73A 2Z3PA 4JXQA 4FDFA 4U8VA 2G3TA 3OTCA 4P45A 1CM0A 2B3TB 2E7XA 2GLJA 5K8PA 4QQBA 4DUTA 4JI2F 4I2PB 2X3DA 1MROB 1YRXA 2FL4A 4PYAA 1MMLA 4A8KA 4TY9A 1M4LA 4NXMF 4DX7A 4PRFA 2IJFA 1GMWA 2YNGB 3C26A 3FFIB 4DLGA 2IDLA 2ROEA 3M8WA 1OMSA 4O3RA 4L76A 5KFTA 3O1LA 2W2NP 2YY3A 4J9UE 3DLEA 3SEOA 2BBEA 3QAEA 2OSRA 3QFHA 8CPAA 1LWFB 1H74A 3M2UA 3M8YA 3MRUA 4XO0A 5JMNA 4R8UA 1FK9B 2EK8A 3MPWA 3O44A 2K2PA 1X31C 3JSYA 4WKRA 4F9VA 1N36J 3DNCA 2HYIB 5AG4A 5LSLA 1S1XB 1J4JA 4XAKA 2GJ2A 4RNFA 4LF5F 3FCVA 5IB0A 3BGRB 1CJUB 1ZYQA 4G1QA 1Z8TA 4ID5B 5KFRA 2V67A 4Q0BA 1FI4A 2PIZA 1U47A 2XYPB 4YGOA 4KGMA 1DLOA 4RW6B 3NAIA 4YS2A 2AFSA 4RU2A 3WC0A 1X4GA 5GMEA 1YLOA 4Q44A 2QL7B 2LP4A 2VZ9A 1R6YA 5IQ6A 3MECA 4BBYA 5HMWA 1B0VA 4BCAA 2KVQE 2J9AA 3NBPA 2OELA 3QT7A 4LF8F 1B70B 4AB7A 3PR4A 1X5TA 5KTAA 2CIJA 1VBZA 2Q7SA 5B0FA 2V4RA 4DUYF 3H5XA 4HNWB 4RBUA 4WYLA 1XERA 1PG5B 1N71A 3F0NA 1I94F 4DL6A 4IDKA 4QZVB 3WQPA 2OHDA 4ZHRA 3ENVA 2HZCA 1NE9A 1TKZB 4L72B 3BO4A 3PB4X 2HQIA 2CF4A 1M5VC 1G6BA 3C6UB 1BO4A 4LX9A 1WG4A 4FPIA 2ZH3A 3GJQB 4YP3A 4UA3A 3L95X 2XMMA 1Z4RA 4X62F 4TYBA 2I8EA 2CQ0A 2XI3A 1RU2A 2GQQA 5D4NA 3NA6A 1AYEA 4MHZA 3CPAA 4UZBA 3PZPA 3M4XA 1XMQJ 1NK4A 4V19X 4TYAA 4DR6F 2CPFA 3QGPA 1DJ0A 5DWNA 5IT0A 3EGZA 2AYEA 3ET6A 4WFNQ 5A8WB 5D4OA 1RAJA 2IRXA 2HHSA 2QJ8A 3CJ5A 2ZD1B 2BRKA 1XNRJ 2CJKA 2CJBA 5LYLA 3NGRA 4USUA 1B6BA 1N4LA 4P74A 4E8UA 3ZFVA 4DV1J 1FRJA 4DL4A 4TY8A 4NCAA 4HT7A 4J9VA 1CPXA 1IJFB 4EVYA 3GFYA 2QFJA 3PV8A 5J2MA 2Y0SD 4Y2IA 2RNEA 1JXEA 2H51B 2LA4A 3MWBA 1Z5RA 2XEXA 4ZVRB 4CIOA 2EWBA 4P2SA 3RZAA 2GLFA 3HHNB 3SI0A 1E6VB 1X0FA 3ISNC 3DHXA 2QV6A 5F8GA 2ROGA 3C2PA 1JNRB 1H7WA 4QIWD 4DQPA 3PHTA 2F9JA 2M9KA 2VPWB 1AT1B 1JLBA 3ZZTA 1FERA 1NRKA 2M7SA 4BD9A 3IC1A 5F0WA 4CAWA 2MHEA 1EKRA 3CPWR 2DIVA 4HH0A 3K9UA 5F8HA 2EK1A 1TELA 1NDCA 3CCSS 2RRBA 1WSVA 4TU9A 5FDLA 4KVME 4ZLPA 1Y00A 1S1TA 2EK6A 1YJRA 2FE7A 3J80U 3B4MA 3M30A 4USTA 5AG7A 4B9VA 2CQCA 2Q6BA 3OD2A 2YKNA 4CLKA 3JTPA 3CCJS 3VAGA 5AXNA 4L73A 4RWXA 3I0RA 3NFZA 2V4QA 4LR9A 3JVNA 1ON0A 3KUGA 2XEFA 1VRQC 3WDOA 1S6QA 4C11A 3RR8A 3M2RB 2M5YA 4DR4F 1V3RA 2OH2A 2MXYA 4M8LA 5KFBA 4ZI6A 1XQIA 4X4QA 3VVUA 2ZZTA 3IIBA 4KSFA 1OWXA 3CJKA 4CNYA 4Q38A 2LA6A 1KNZA 1HHTP 2OPSB 2V2VA 1IBKF 1TMJA 1B87A 2IJNA 4Y49B 1SIZA 2VL1A 4LRDA 4F3QA 1RHRB 1OBRA 4B9SA 2CQIA 3AJ1A 3DRRB 3OTOJ 1HEEA 3UE2A 2PR1A 3A12A 4LQ9A 2CNMA 1JLAA 3OUYB 2AE6A 1N52B 4A31A 2MQLA 2AGQA 1T95A 3R5JB 2JLFA 4X65F 2ZH4A 2F4FA 2EXUA 2J9EA 3MM6B 2QC3A 2KZMA 1S7HA 2C2ZB 2ZHAA 3WHIA 1HPZA 2DNQA 5A6PA 1GMVA 1BY9A 4NLDA 3IU2A 3B8GA 2OPRA 4M5DA 1NDLA 3SQGA 4B3OB 2AZ3A 3MGDA 2FLPA 4NLRA 1HBOA 4EO8A 4J37A 1BE4A 4MKYA 2HHTA 1S4EA 3IGVA 4QR1A 3GTYX 2C3OA 4WKYA 5EC4A 3TYTA 1REVB 3HSGA 2ZEDA 4IO9Q 4IOCQ 3R1HA 4ILRA 4JV1A 2ZH2A 2ZKTA 4HACB 1KVJA 4NSQA 3P2FA 2ZJPQ 3GSIA 4NWBA 1UZDA 5ETPA 4QCLA 4K5RA 5IQQA 2BM1A 1NH8A 3D7HA 2AFZA 1IWGA 1MN7A 1YI2S 1DTQA 4E2AA 1Q95G 3CCES 4ES2A 1CBKA 3NL0A 2LFVA 1RT3B 5DQIA 2IMOA 3TX8A 3I9SA 3TQ1A 4MIAA 2OIHA 3Q0AA 1M5SA 1X8DA 2DRDA 3PTWA 1OPIA 3PZJA 4KV8B 3VAKA 2LQ9A 2WVDA 2HBZB 3TOAA 3K58A 4B12A 2KO1A 4NI2B 1FE0A 4L75A 2CQ2A 3A8KA 1WC0A 3L4BC 3HD1A 4O44B 4R5PB 1VJWA 1R7IA 3ZZZA 3NNHA 4RNHA 3H40A 4CO4A 5GAEU 4Z65A 4GS4A 1VDHA 1DAXA 2HFVA 3MAQA 4NYOA 2BDPA 1H2VZ 1YQEA 4V1Ak 5LMUJ 4C8YA 4KHPJ 4P44A 4JV0A 3ZZOA 2G1HA 1EP4B 1VK3A 2VFSA 1EB0A 2HHHF 1NK6A 4MYUA 2V69A 3K0JA 2PJ9A 3D28A 1K1QA 3IA0A 1BWVA 2UZAA 5ADZA 3GCWP 4IH7A 4OV1A 3M6VA 2G0JA 1FRLA 3VCDA 4G65A 5C5JA 1N0VC 1S5ZA 3J7AN 2V9KA 2VPXB 1Q4RA 2VQEJ 3BQ1A 5J2NB 2WOMA 3CJ8A 3KJNB 1H0HB 4ZITA 1Q82T 2AJ1A 1ZM4A 4WXOA 2V0NA 1CC7A 4KTQA 4KAIA 2XYGB 3MUTP 5HQLA 1Y5IB 4PUOB 1WF1A 4E8OA 1WHYA 2FZGB 1DQ9A 2C3PA 3PBEA 1L3UA 2UUBJ 1HHQA 5KT2A 1NSQA 4JI1J 4OI0A 3G87A 4C3KA 2EFNA 3ZTQA 2LQBA 1YGHA 1QSMA 4NGPA 3TQEA 3BH6B 4CRYB 2NREA 2H5MA 2QL5B 3CDAA 5E96A 2PJBA 1IOFA 3FEZA 2B6AB 3AAWB 1I3OB 3F0AA 2XTJP 3Q8VA 4RW9B 1Q2DA 1RAOA 5IM0A 3GQCA 3V6JA 1M1HA 1T8EA 3PYFA 1VR6A 3NOCA 4AD6A 2Z8QA 1RKIA 4DS5A 3D3SA 4J9NA 2POKA 4KGKA 3NMAA 4KKOB 2HLTA 3UD5A 3D3BJ 4DS4A 4QBJA 3GZ7A 5LRGA 3DLGB 2HHXA 2ZBRA 2I00A 2UUAF 4IRDA 5A76A 3AD8C 2A6OA 2RE1A 5KFUA 1UWAA 3RRGA 4RX6A 3PRBA 3D4UA 1KBRA 5J8CA 4CAXA 4BC7A 3MR6A 2EG1A 3P2HA 5G1ZA 2V2KA 4DF4A 4DN9A 2NQPA 3TOBA 2L3MA 1OSDA 1NJWA 3MOZA 2JBKA 3VWDA 5A0YB 1WWZA 3CCQS 3M7VA 3DOKA 4JI5F 4GKJJ 1IYLA 4WWVA 1UA1A 3EYZA 4KT0C 1T94A 1N5SA 2HWHA 4C9DA 1I6JA 2G9OA 2UV8A 4MKAA 1SJRA 3MI7X 2ZWPA 3PB7X 4IFYA 2W25A 2M52A 2MZQA 1WI6A 2FJBB 5K8NA 2HS3A 1EE3P 4DDFA 2CNNB 3D2WA 1OSCA 3QT6A 1XNQJ 1XOVA 2K5TA 2W1BA 3KG1A 4W92B 1FWKA 4A8OA 1X4FA 4MY3A 1LWEB 2UVVA 2DBBA 2MQQA 3HHDA 1HFEL 4YR0A 4LSNA 4TVAB 5DZ6A 4DU7A 1BOBA 3HLPA 4IK2A 4YQWA 1GX6A 3EXNA 1RAGB 3VTIA 1RHKB 4KOXA 2DPSA 1SJ3P 5CZVA 2PJ3A 1U2FA 1R8PA 3MMAB 1J27A 2C2MB 2N4CA 1ZTTA 1SVDA 3S6EA 1X5PA 3VQTA 2MQNA 1V3ZA 2YVSA 1URRA 3BBBA 4NEYA 2F40A 3HLUA 1YRTA 4NA1A 5HSPA 1T11A 1HQUB 1RT7B 4L74A 2YNDA 1QAXA 1XMOF 2FVRA 4IF5A 2VUGA 4O4GB 5LYDA 2WW8A 4MT1A 4ANCA 4FD5A 4DBQA 1O8BA 2CZ4A 2N7YA 3KDOA 1TF8A 1RT6A 1Y10A 3R7SB 4ZVSB 3QJPA 3T8WA 1KQGB 3GIJA 5KFNA 4DCOB 4QOTA 3PEHA 4ZY2A 1Q8LA 4RPFA 4P72A 3T1YJ 4CRZB 2FVPA 4N5SA 1RT2A 1HBMB 1KDNA 2BCOA 3DNSA 1RB0A 1R0AA 5LMNJ 2JDCA 2IIHA 3H5UA 2H65B 4A8XA 3UR0A 1ZPVA 4ZJLA 1S6OA 3V4IB 2B5JA 3FSIA 3G86A 3IM9A 3RTVA 3KHHA 3EWGA 4UWIA 2SXLA 3L9ZA 1S49A 4C6AA 4F0XA 1TZ0A 3Q8UA 2FVQA 3MGJA 5HN0A 2DJWA 2PC1A 2VQFJ 3GY9A 2AKWB 4TQSA 4O3QA 3N6NA 2CA9A 1SQGA 4OI1A 4KLWA 1X4EA 4OC3A 4PEOA 5K14B 4M5KA 1PU9A 5E5NA 1GMWD 3TC8A 4ZN3A 1YVKA 4KO0A 2I79A 3J7ZT 5I3PA 3DLKB 3LD2A 1D0EA 5KFXA 2B4DB 4AVCA 3KJVA 3OHAA 4ATNA 4M5MA 4O3PA 5K5MA 3IN5A 5CABA 4MIWA 3CD6S 3QB8A 1Y7RA 1FO1A 5L8RC 2AFOA 1TL7A 1N36F 5AXMA 2KB2A 1FDAA 3G8WA 4DI6A 1YJWS 2FY1A 4J9OA 1IIDA 3PKYA 3QPIA 3CD7A 3T19A 2ZDPA 1QSOA 1KOOA 3FGVA 1YJ9S 2E66A 4YR2A 1FNOA 3IBWA 2WSAA 1XBUA 2GQCA 3RR7A 3N6LA 2V4JB 3QQCD 4A8YA 1F5AA 1RBOB 2H5JB 5A8KA 5LRKA 2GAHC 4I64A 2M8DB 4NASA 1VCTA 5A6WA 2MZTA 4PQUA 2CTCA 4FAIA 2RU3A 4KVOE 2OKQA 4FVCA 2CQHA 1CLFA 2Z3LA 4DV3J 1VC6A 1A7GE 3OHBA 1BMQB 2UUTA 1T9WA 2M3DA 4I49A 2XMKA 3AB2B 1O51A 3K17A 3WT4A 2DD8S 2OPQA 2BJEA 3BR8A 1IU8A 2C2NA 4NZ7A 4CAFA 3PFOA 2JVOA 3FVLA 3BV8A 2DGOA 2PJ0A 2QMUB 2N7CA 3T9NA 3NH4A 1W7WA 2P9EA 1BPNA 1TAUA 4FWUA 1FFSB 2G3AA 3W8PA 4B13A 3EICA 3FBCA 1GK8A 5T41A 1Y7EA 4M6IA 4LQGA 5EN1A 2BEFA 4DR2F 2LDIA 4JI6F 1ZOTA 5K8MA 4QWEA 3CDBA 3M8ZA 4G1QB 1C0TB 4Q0BB 4NLGA 2VF3A 1RBAA 3OBIA 1UAWA 3MR3A 4FYWB 3ELHA 1WELA 2RRNA 3FNNA 3SCLE 2MKJA 4H4MB 3NP5A 3KGQA 2HNYB 4TNOA 3TNVA 2RMLA 4EMEA 3TUJC 1CJVA 4DL7A 1T7PA 3BPDA 4MFQA 2NUUG 1R6VA 1UEKA 4P4IA 1HNXJ 3MECB 4P4BA 3HJFA 1TAQA 1ZBTA 2FJEB 1RTDA 2KRBA 8RUCA 3TEGA 2D3O1 1XMQF 2AEJA 4CGPA 2A3JA 1FJCA 4DL3A 5HANA 2LEPA 4I7FB 4ANEA 2IAJB 2ZOFA 3LQVA 2CPZA 4B3RJ 3HXMA 3NCQA 2J0WA 5IZHA 1HQ2A 4ED2A 2KYZA 2YGWA 3MD1A 1VLOA 4RW8A 1RT5B 4R0EA 3BXMA 3BF4A 3SXLA 1SC4B 3M8SA 3TZYA 2AWZA 3TT2A 3BB5A 3D67A 2UV8G 1SQFA 2H1YA 4HT5A 1XFOA 1DFDA 4FF2A 2J6UA 2XLKA 1XIXA 1RCXB 1PIEA 3MCSA 2EK9A 3DYAA 2Q4VA 5G4DA 2XO6A 2V94A 1UPMB 3TZWA 1S99A 5C82A 4KIAA 3JB9k 4QIVA 5B09A 1G1XA 4ERDA 3HZGA 2DKOB 3T90A 1DBDA 2AV5A 1U02A 2ARHA 2DPIA 3TE4A 4N8OA 2QL9B 1VI7A 2F3JA 2IRUA 3M9NB 1NK0A 2Q4YA 4WP3A 7FD1A 1VISA 4PXEA 4DL0C 1CX8A 2W2OP 4RUAA 3CXSA 4EUVA 5JVGQ 4ES1A 4X4SA 4P75A 4TXSA 4OI3A 3PEIA 3CTRA 3LANA 3DXSX 3T9ZA 4CGOA 4LBPA 4A39A 3MEGB 3JS9A 3DLBA 3IXQA 3W9IA 4CO5A 1VQ8S 4CWBA 2O53A 4TY8B 3TO6A 2Y8YA 4IYQA 4HHUA 3EGVA 2RRAA 3UO0A 2ZENA 5KFDA 1BC6A 3OTDA 3RUBL 2ANPA 3BS9A 1IR1A 4USKA 3NY0A 2ZEEA 1WG5A 2PVVA 2PIIA 3R7NB 2WBRA 3DI6A 2G13A 3LTOA 3OFFA 4F8RA 3LP2A 2IYIA 1TKDA 2XB2D 1VQYA 2JRSA 4P6QA 4EMDA 2VFUA 4N47A 4ZA1A 2ZZNA 1FD2A 5HMXA 4KOSA 3K8VA 5B0GA 1DTDA 3UWTA 1YWXA 1P4NA 2RIJA 3CNQP 4U8YA 3LOUA 3PB8X 4K3NA 3CEDA 2VBZA 4H89A 4WFYA 1JLBB 1U1OA 5B7WA 1MWZA 4FP9A 3R3TA 4DV5J 2DISA 3UI3A 3OTOF 2V5HG 3KG0A 4Y00A 3EJMA 2UXDJ 2FIAA 4CLFA 4ZVOB 4XK8C 1KLNA 5EWFA 1RWNB 2XMJA 3B35A 4QIFA 4BBHA 3JSBA 4WJBA 3SBMA 5FDLB 1N5VA 4N56A 1F2OA 4MCPA 1S1TB 1PC5A 2FTRA 3U1NA 4MHPA 1OO0B 1GTHA 3GIRA 3M30B 1ZH5A 3CXQA 1DARA 3D7SB 1SQEA 3KLIB 2YKNB 3Q24A 5C24A 4USJC 1U25A 1PO6A 2FVGA 1UVJA 2P9CA 2FJWA 2HGMA 2ZH1A 2B9WA 4UFWA 4LF4F 2CQDA 5EDWA 4Z7CA 1F2HA 1ROFA 2Q04A 2HRTA 3S9LA 3KG4A 1TFWA 2BSWA 3PGPA 2XSFA 1YKWA 2MZ1A 5H1SV 1NXIA 4MK8A 3S6KA 4WF9Q 1NMEB 2ABZA 4MJ8A 2UU9F 1S77D 4DV2J 2KZZA 3L7UA 2B56A 2QO3A 2XMUA 4TLRA 3OT9A 3DRPB 3CJKB 5CPAA 3ZNJ1 2XYHB 4DQRA 2FB0A 4UQTA 3VATA 2CDRB 1RO5A 1LOUA 2OEKA 3W66A 2B4OA 3BSNA 2GVZA 1OS5A 1HBUA 4II9A 4I67A 3CMES 1VGYA 5KT7A 2HQDA 2HPUA 1NDKA 5MLCV 4WTOB 4DSLA 3CJ3A 3Q2TC 4CO3A 4ZP6A 4DSKA 3UVJA 3LODA 1OZPA 1SI9A 5GAHI 3OPKA 3HFVA 2CWXA 5BXIA 2AZ1A 1TUGB 4B3TJ 4HKQA 2OPRB 3SQGB 3QMQA 4FD6A 2ZW7A 2CPJA 1L3SA 1U45A 1AW0A 3BSCA 5LMUF 2DNYA 5L38A 4DQIA 1S7KA 2JLMA 5F48A 1S0NA 4F6AA 3PX0A 1WOOA 2XCPA 4ZIVA 4J5OA 1FFGB 4LQ3A 2DXDA 2GV1A 5CD4H 2EW9A 3E3XA 1S7NA 1K8AT 4NA3A 1NBEB 5C2GA 3C3LA 4UIAA 2VFTA 2W7PA 3CZXA 3V81A 2WVCA 1P1LA 2JHEA 5CYMA 2R8HA 2FT0A 3MUVP 2VQEF 5T7LA 1VRUA 3QAYA 2MSTA 4DMZA 1BLLE 2J5AA 3DRSA 4HVZA 3HD2A 2HQYA 1X12A 2EI5A 2M2BA 5HVHA 2RD5C 3I1UA 3KK2A 2V77A 3GG0A 1XR5A 4DHVA 5KOWA 2L48A 3MMBA 2HQ3A 3H2UB 3LWMA 3AT1B 1LWXA 4UCMA 2ALYB 3A8JA 1AUDA 2HNDB 2R42A 5A2QU 3LP0B 1Q5VA 1PYOB 2UUBF 4ZY0A 1SKUB 1NZ8A 2JLGA 4JI1F 1M0SA 3MN8A 3M8RA 1Q5YA 4OV6A 3HSZA 2RUGA 2VIHA 4QPTA 2CRLA 2NSCA 1FKOB 4P4EA 1DQAA 1YK3A 1AA1B 5SUHA 3L09A 2ZEMA 1C1BB 2O5DA 2N4DA 5DS0A 2EUIA 1ZLHA 2IVFB 1X0PA 3EDRB 3UNGC 3TANA 2CQGA 2PO4A 4IQMA 1IQTA 1NU4A 2CJAA 1WD6A 4DPTA 1TL3B 2C42A 2ZWOA 1WSRA 4DUZF 4J9MA 2GREA 4B5PA 5DWMA 2H48B 3BKTA 2XY5A 2B51A 5GAGU 3FSYA 1GFWB 2WOMB 2FHOB 2ZEFA 4H6UA 2HZAA 1FF2A 4HR2A 4O3NA 1DURA 1KQKA 4QUSA 4ZVGA 4AQYJ 2A4NA 1RXTA 5L1KA 2I38A 1DTTA 1PSDA 5I42B 2BKPA 4QR2A 1VQMS 2YX1A 4KVXA 4YB7A 2DYAA 5RUBA 4E98A 1Q53A 2AEMA 4R25A 5B0AA 5KFLA 3GG1A 1TF9A 4X4OA 2YWGA 4YB1P 1HMVA 3CDWA 3R27A 1IKYA 1VMBA 2D9PA 3DOMA 2BZ2A 4TKTA 4GRSA 2GVDA 1RP5A 3CUNA 3NGTA 1RT1B 3W65A 2AEFA 3K57A 3KI9A 3EPGA 2R7VA 1TKJA 2ZM6F 3JQKA 1IBLF 1IKXA 2WW4A 4GKJF 3OSNA 4C4WA 2PJ7A 1Z8WA 5LM7E 4ZPTR 3FX6A 2YPYA 2F65A 4GKKJ 5T14A 1O5JA 5F9NA 4LRCA 2VC1A 5KFMA 2AT1B 2YWWA 3DLHA 3VAFA 4GC7A 4KPYA 5J1QA 1AMPA 3FDSA 3CF5Q 2BRLA 1HWIA 1XNQF 1P6TA 5DDRC 4P71A 2QRRA 2ZEHA 4K2JA 5BJRA 4DV6J 1F1BB 1HW8A 4IUFA 2ZNZA 1D3WA 2HWTA 4F3OA 1GX5A 1CJKA 5KFVA 2X7IA 1YMEA 3A3NB 1FVSA 2CVIA 3LWUA 4MK9A 1DZ5A 4HI1A 4UY8T 3D6TB 1H8LA 4QWAA 1RABB 4X64J 1SC6A 3TO7A 4Z37A 5F8MA 3TTHA 1HD0A 3BSOA 4AUKA 4DWIA 3VALA 3HVTA 3PO5A 2B4BA 1JLQB 4ZVFA 2DPTA 1EZZB 4Y2CA 2ZBQA 3CJRA 2K7KA 3KNAA 2B58A 3I9ZA 4YDDB 1YBTA 2R2RA 5C88A 2KFYA 4DR3F 2E7WA 3HVWA 1N34J 4AE5A 1U6BA 1UTAA 4P4JA 1T0TV 2VH7A 2D69A 4GM5A 3VAMA 2UXCF 2X51A 4LQ6A 3RB3A 2W8LA 4P52A 4RJVA 1ZM2A 2ZJQQ 4CLLA 2AJ2A 5GAEI 1SUQA 1S59A 1WNEA 4OYXA 4EO6A 3IG1A 4MCQA 4JJXA 3CCUS 2XC9A 3T1YF 1PBAA 3C16A 1RWKB 4K2XA 4F4KA 4AVAA 3CD0A 3FBUA 2HC9A 1QJHA 4LIRA 2ATCB 4CH0S 5LMNF 2LEBA 4OZ0A 3R8YA 3TAMA 2ZDOA 5ETTA 1QTNB 4NGSA 2MQMA 4HYKA 2EWHA 3BI0A 4KH1B 2FDNA 2C2RA 4ZVEA 5IT9U 2K3IA 1Q2CA 7AT1B 2PGCA 7FDRA 3MUMP 1N6QB 3QRRA 2A10A 1S1UA 2LXIA 3BJ7A 3I32A 1N48A 3DHWC 1RZMA 1HNIA 4NL5A 4RW7A 2QGFB 4K7QA 2VQYA 1YSJA 4PQAA 1ZO0A 3BN7A 1XE4A 3E01A 5KFYA 1NK9A 2W4PA 2WZNA 3V6DB 4ECUA 3DRYA 4JI8F 3J80Y 2G2ZA 5DJBA 3AY0A 1LAPA 1KLMB 2ZC3A 5D29A 2CVEA 3BREA 5HP1B 3IBCB 3GUXA 1PJ7A 2NZ4A 2ABYA 4G1IA 3OL6A 2JEVA 5J2PA 3D0IE 5KT6A 4A30A 1V5IB 5CBMA 4A4JA 3MTKA 1R0AB 4HEA9 4AXJA 1BLUA 3BLNA 2OFHX 3KLGA 4UEFA 1GAOA 2OO4A 2I9SA 2B5JB 1ZZFA 3KLHB 3EZ5A 5C42B 4ILLA 4FKYA 1F2PA 4NJQA 1WKLA 4OJHA 1X4HA 1QSTA 2C3MA 4RBTA 2Y1RI 4NRUA 1AZSB 4LSZB 3BYRA 4LF7J 3DSBA 2XSJB 3PW5A 1E6YA 3CCTA 4NGRA 2GFFA 3NG8A 4F7VA 2E1PA 2RILA 2YQ0A 3EGNA 4PWWA 1S97A 3SYZA 4CYQA 1WC6A 2E1RA 4P9SA 1LANA 3FQKA 3HHEA 4OJ3A 4MFLA 1KS2A 2EKYA 1QVGR 4XDDA 5U47A 1F60B 3KJVB 3FRYA 1B7YB 3KASA 1CULA 4OMFG 1VS3A 3FIXA 3ETOA 4JB8B 3MCMA 4ID8A 3TEHB 5HJYA 2G2YA 2HBQB 3AODA 4KHMA 3W5YA 2KFZA 2DGQA 2Q66A 5DQHA 3D54A 5E3CA 2XS7A 2QJ3A 5E3PA 2MQPA 2EO8A 1TQLA 3QNVA 4NCZA 1XBWA 3TVZA 3QNWB 1IKVB 2OI2A 2XMWA 2IYGA 5A8KB 3B2YA 4DPXA 4WE1A 1NB2A 2HGNA 1FJGJ 1HNXF 3UN5A 2G2OA 4LR8A 2BEIA 2B4VA 2K8GA 2PJ6A 4OI2A 2CKWA 3MFIA 3OXGA 4CGNA 3MD3A 3I82A 2CQ3A 2E9ZA 4LF9J 2DNOA 5ETNA 3GV7B 2DRBA 3V5RA 2Y1JA 2H54B 4RO0A 2GA7A 2ZH9A 4LF6F 1VKCA 1UVIA 4ICLB 5GMDA 4Y34A 4OFZA 2CXEA 4P7VA 2YX4A 1X5OA 4QIGA 5L1JA 1WI8A 5JGFA 2VDHA 3HHLB 1C0UB 3KK3A 2BQUA 3V2UC 3L7PA 4ZLJA 5I3QA 2JWNA 3PXGa 2ALZA 3K8WA 2R7XA 3RBEA 1QLNA 4FD7A 1S48A 3PYEA 4PG6A 4NLOA 3MR5A 2K1RA 5D3GA 5C2CA 1HWUA 3N79A 2BQ3A 2J0SD 4QW8A 3IWWA 1HARA 3RB4A 4AXIA 4ZPWR 1CJVB 3IR7B 4Y2MA 3WC6A 4WWSA 3SZ2A 1JLCA 4PWDB 2HGLA 3SV4A 3DOLA 3G6ES 2WUUA 1ZG9A 1BWEA 2BACA 4U7CA 4KORA 4Q5VA 3DGPB 3H8GA 3RNZA 5KFJA 3AQPA 1RT4B 3W62A 3WBZA 5EBVA 1SH3A 4OX8A 3N4WA 5BYRA 4DYOA 2LVWA 5J2QB 3GV5B 3CB4A 3IR5B 5G0RA 5I3UA 2I5JA 3X3UA 1FTRA 1S1VA 1T05B 2O3DA 2EC2A 1CP7A 3IS9A 2YWEA 5JXSA 2W9BB 1NK5A 1RAFB 4ZS6A 2PJ8A 4KZTA 4R7MA 4Y2KA 2B5GA 3UD3P 4AFFA 3QLHA 4EBEA 2DNZA 4FBUA 3D6FB 4ED1A 4RKUC 2AYBA 1AFJA 2QSFA 4UEZA 2HQFA 1H38A 4UUXA 1F9HA 1GTEA 1CJTB 1RAAB 3AA9A 2G9DA 5F8LA 1BQNB 2IA0A 2MKSA 5DS7A 5JQ4A 4O3SA 4YHHJ 2M0GB 5ETKA 5LJ5Y 2MEWA 4YN3B 2CADA 3HHKA 4ORFA 3DU6A 4HTIA 3I5BA 3IU1A 3PW7A 1X9WA 1ARLA 1T03B 2GMJA 3OR1B 2E5LJ 2UXDF 1K0TA 1JWQA 3KQXA 4UBRA 3PJ9A 2HMIA 2RB7A 4M85A 1WKJA 1WORA 3TUPA 3F8KA 1NLKL 4USWA 2HRYA 1P0HA 1TR0A 1RTQA 4JBCA 2KJVA 4D3HA 2DHAA 2O01C 3GFZA 1HNVA 1YZ7A 2IJRA 1U2CA 2WBMA 4UEEA 5DM6Q 1Z2LA 3I96A 4MRIA 1ULRA 3M1VA 2V8GA 2UUCJ 1FE4A 3MFHA 3R1LA 3LP2B 3CJ2A 2WB4A 3K5LA 2GHVC 3ZZYA 3VZHA 8ATCB 4NRTA 3THTA 3G4SS 4IR1A 1RHJB 3W9JA 4BS2A 4DV2F 3HMJG 3T3FA 2ZE2B 1QE1B 5CD4A 3EPIA 2QMXA 2ZUAA 1V9OA 3OR2A 2B3UA 1VQOS 4I1TA 4I6AA 4TU8A 1LOKA 3HFKA 1TVRA 2R2SA 1U48A 3KLFA 1QY7A 1Q16B 2CQ4A 2IQ6A 2XO7A 3J7Z5 1XTZA 4PG4A 3KTQA 4B9MA 3NH5A 3OSPA 1TL1B 1LCPA 1TKFA 4TWEA 3QO9B 1WEXA 4UCNA 2MQOA 4XNHC 1QUVA 2CJXB 9ATCB 2DR9A 1ELOA 5A8RB 1T9XA 4B3TF 1U6MA 2XBPA 4JLYA 4LR7A 4QW9A 4WZQA 4O0IA 3H2VE 4MJKA 4WP8A 1W26A 1R8HA 2HHQA 1U49A 1ZG8A 1A0OB 4Q36A 3DXBA 2VB6A 5H84A 2A6MA 3US5A 5LJ3Y 1L3TA 1OPZA 1WOSA 2YNIA 1GXTA 2VODA 4A37A 1K4JA 3U02A 5DO2A 2HZVA 3GJSB 3T6BA 1TKTA 2HB6A 5DRKA 1IR2A 3CSKA 4HHHA 4K0KJ 1U1PA 3RG6A 5JVHQ 1VHSA 2QYGA 3KHRA 5ISVA 3ENWA 4CTAA 2IBOA 3IWXA 5F3ZA 2FC9A 2J7WA 3U1MA 5B0CA 4PXDA 1TKXA 2H4YB 4JV5J 3Q8YA 2BO9A 4A33A 3RYLA 1J5EJ 2VC0A 2Z3MA 2OSQA 2IJZA 3I4PA 4K4XA 4EZ9A 1UWBA 1OQ6A 2NR0A 2W2PP 2RDJA 4ETXA 2W2MP 3MTJA 4NE9C 3O3LA 5HMYA 4XPDB 4RU9A 1EETA 3G8SA 2IY5B 1XMTA 2C1CA 2QT7A 5LT5A 2NPFA 2OEMA 6CPAA 1M5PC 1TL4A 2NXEA 2XULA 2BE2B 4DSIA 2KXHA 4P73A 1XEZA 4ZPCA 3W5XA 4PSXA 2HNZA 2WPWA 1EHWA 2H3EB 2XHWA 1KUVA 4DR7J 3TJAA 1FDBA 3G3SA 3FMWA 1RWXB 3IO1A 5ITHA 2D74B 3FEXB 2XCAA 2CPDA 3TI0A 4EEYA 1CS4A 1KVIA 1WDDA 1ELLP 5HLFA 1T9YA 2KG0A 4XPKA 2FHMA 3KMSA 1IBMJ 1T9UA 3AHPA 1JKHA 3MPYA 4ZCLA 4ZKAA 5CYMB 2ZEGA 5B0BA 4YDXA 5KFCA 3I3GA 3BM7A 5KTQA 3C6TA 2XNRA 4M3SA 4ELUA 3UDVA 3ZTSA 4KS9A 4YUDA 4RI1A 1I12A 1JLEB 2ZW5A 1NKCA 4DL2A 1C1CB 3R5BA 4AQYF 1T9VA 1XR7A 1JIHA 4NLQA 2D1CA 2XY7A 2ACMA 4F4AA 4H6ZA 2W24A 4B3MF 4EFAC 2D4PA 3TCVA 1WOPA 2BJ7A 1VBXA 4ZJOA 3PIOQ 4X66J 2I6WA 1KTVA 2GE3A 2YKMB 4URGA 1FDDA 3OTEA 3FBBA 1VHOA 3G82A 3PM9A 1ICEB 3JSRA 1U1QA 3NKYA 5H86A 4DSJA 1TL5A 3MEEA 4C68A 3R2CJ 3HM9A 3EFAA 2VDIA 1YTYA 2CJYB 2X3GA 2FVSA 1KHVA 3FCWA 4C3LA 4MFZA 4P4DA 4GVBA 3VR1A 3KDNA 4ITSA 3JYTA 3TARA 4FNHA 4ZCMA 4DV6F 1FKPA 2VKRA 3OW2R 2JLEA 3ZZPA 3M2VA 2FD2A 2CG8A 2IM0A 4KOTA 3QWUA 1F3VA 3FECA 2BX6A 1QSLA 2F4VF 3SQOP 3FEEA 1X9SA 3MM8B 3PB9X 4C48A 2YPZA 3TVYA 2Z11A 1VQ9S 2PA8D 3KHGA 2KTQA 2YNFA 1X4BA 1EQ0A 1IM4A 3P45B 3FB3A 2EEYA 4KFBB 2WSEC 3DOMB 1NNDA 2MMYA 2GVDB 3FBEA 3GIIA 3R6LB 3B3CA 3S9NA 3BYPA 4OIDA 1VRTA 4DR1F 4HNYB 2XGPA 1UPPA 3IRWP 4B11A 2LXUA 1VQSA 1GNKA 3ONQA 3P6YC 1ZAXA 2FZCB 1NUEA 4CLUA 4OX9J 4C8KA 4CP5A 4U6PA 3S01A 2E1MC 2PRBA 5B08A 2FY8A 4YR3A 2VG6B 4DJBA 2BOPA 3UDCA 4Y3CA 3GIKA 1PYTB 2LU1A 3G6VA 4LSLA 4Y2AA 4LFCJ 2NSBA 3GJRB 2PEHA 4N76A 2R2TA 3MM5B 2W4DA 5IXUA 4NLUA 5CCLA 2DXEA 2NCKL 1YGYA 1BQXA 4DPUA 3ISXA 3THPA 4XPLA 4YY3J 2L41A 1UP1A 1RJJA 2M70A 5JJBA 2HVDA 3Q83A 4I2PA 3S9MA 4R87A 3CDEA 1MROA 3H20A 4RNOA 3D3CJ 2QVPA 2VA3A 5EUHA 1HIYA 4JI0J 1HBNB 3FFIA 2VD3A 3F5BA 2KVIA 2Z2ZA 1RACB 4QVTA 2R7QA 2B9YA 4ED3A 4CLSA 4MKBA 3CXPA 2EFVA 4AL6A 3HVTB 1LWFA 1PKUA 2W9CB 3S6HA 3P49B 2WVBA 3E8OA 4YU9A 1KTQA 4C2YA 1FK9A 3VV2B 1N54B 1P1TA 4ENOA 3TP2A 4DV7J 3DCAA 3OFGA 2V8VA 1S79A 1WHXA 2HBRB 2ERRA 3VGSA 3BGRA 1VFJA 2PQ8A 1HLWA 5G21A 4ONWA 2VG5B 4LMZA 1SUQB 3BH7B 4KBIA 5AXKA 2ZXVA 2I3CA 2MYFA 2GHPA 1I51B 3BGLA 2HUZA 1KOHA 5L1IA 5IC6B 4GO5X 4Q2MA 2ZHOA 4KSEB 3D1HA 5F41A 1T3OA 1M44A 3DR8A 2NYHA 4F50A 3TUZC 5DDOC 4JI2J 2CXAA 5CYQA 2HIYA 1ZM9A 1FEEA 4CH1A 4NLVA 3F41A 5GAGI 4NXMJ 5K20B 1S60A 4WFBQ 3T5HA 2ZUGA 1HD1A 4F26A 5EMIA 1JMTA 2GJIA 3OXFA 2I2YA 3RW6A 4F04B 3ZNUA 1UEUA 4LF7F 4WZMA 2YNCA 1NJZA 4FYXB 3VWSA 3RU0A 1U0HB 1A2ZA 1YK9A 2CZVC 3PYGA 4ZP8A 4J9QA 3KQZA 1FRHA 2FJVA 2E9RX 1U1LA 4OHVA 4CDIA 4X84A 3W91A 1UA0A 1VBKA 4WFAQ 4TLQA 4RL1A 1P27B 2MKHA 4B02A 4LF5J 4NLWA 2ACYA 1TKZA 4ZJQA 2JSXA 4M95A 2OUGA 1S9EB 1TMMA 4E2FB 5GAHU 2PMWA 1X4AA 3C6UA 3SJEA 3ILOA 4DV4F 4N7TA 1JX4A 3M8QB 1XRYA 3NNAA 2XWYA 5KG2A 2W2QP 4DL5A 1RDRA 2QZ8A 3HVRA 5D0GA 4U9YA 2JH3A 2XQCA 5KFOA 3KK1A 2QIFA 2E5JA 1H2UX 1U24A 2AFXA 2GZOA 3CCMS 3MHYA 4K4YA 1PCAA 5HQMA 2YKQA 3GV8B 3WIVA 4XPCA 3D9BA 4OHZA 1BXNA 2YNEA 2U1AA 3DDKA 1RK8A 1VQ4S 2C2KB 4NMLA 5E3AA 5A8WA 1Q1KA 3FMCA 3X1LB 1VK8A 1N33F 2ZD1A 2J8NA 2BM0A 4DR5F 4I68A 4DUYJ 1RA6A 2AMCB 4H4OB 1SJ1A 4DUKA 1EX8A 4EI2A 4MHNA 4X4TA 4H54A 1L5UA 3M6XA 5KFPA 3AA8A 5KTDA 5HL7Q 4ZX8A 2WYRA 5H9EK 2OMLA 4LF9F 2AQ4A 1N32F 2GS8A 2JEIA 4LRFA 2J76E 2E5IA 4KY3A 1YITS 1SBRA 4CQ1A 2XEIA 3L3CA 1CJWA 3H7HB 1SIWB 3W61A 1AXQA 4RUCA 1S10A 1CULB 2W9AA 3M05A 1XR6A 4C8NA 4X62J 2OPPA 3VAHA 4WIQA 5HO4A 3WZ0A 1JJ4A 2NUHA 3NWRA 4C2ZA 5KTCA 2RQMA 4F4WA 2KI2A 2V8PA 4OYOA 4MFBB 4ED0A 1HYSB 7CPAA 4DJLA 1YJ7A 2FJAB 1VQ5S 2HVZA 3JSMA 1YBUA 4ZN1A 2UXBF 1VQKS 4FYVB 3PACA 1Q7LA 2ILYA 3KXDA 2WZ1A 3CW2C 4NYZA 1VQ7S 3JAMU 5D0RA 4M94A 3W60A 3N5FA 2HAFA 3C66A 2Z30B 2HFZA 2HRUA 1NDPA 1JNZB 5KFGA 3F44A 5A2QY 1A6LA 4I6WA 2YTCA 1RLDA 2YQ3A 3DU5A 4JI4J 3FMBA 1NCLA 2Y3YA 2PFDA 4WK3A 3PKMA 5DG9A 2C2OB 3SFGA 3ZZ0A 3FC9A 2RKIA 2YNCC 1YJTA 2REFA 4NZ0A 1KONA 1MMNA 4PG5A 4NOHA 2KM8C 2CFXA 2DR7A 3KHLA 1RQ0A 3CIZA 4FF4A 3DMJA 3SCKE 1X60A 4U7UK 2MLXA 5EX3A 4IKAA 4UY85 4RW4B 4I56A 3UNYA 2Y9HA 2P0WA 4B6ZA 2Q51A 1U4BA 2K1RB 3A4TA 3OXLA 3DRRA 3ILIA 2QE5A 4ZX9A 2NLWA 1H6KX 2PJ1A 2WONB 4C8ZA 4XNHB 3P96A 4IR9A 1RTHB 4BMHA 1JLCB 3FXTA 2QFIA 4HDGA 3OUYA 4F0HA 1SPBP 5BR8J 1MJBA 3GMGA 5DDQC 1MG7A 3CT9A 1D8YA 1CEZA 4RNMA 2E5LF 2RDIA 1KHWA 4B3OA 1K0VA 2R1IA 1KVKA 3EDQB 2HW3A 5G0RB 5IV4A 2I5JB 3CVKA 5I3UB 2VONA 3EXCX 4YOEA 1S1VB 1J5OA 1NSPA 1REVA 4RUHA 2IA6A 1EARA 2VJVA 4K4TA 2Q44A 4DR4J 4ER8A 4OYBA 4HHJA 4QYRA 3H25A 3MOJB 4HACA 1VBYA 3D6MB 2RDDA 3WIUA 1IBKJ 4V19J 1WC1A 4OYAA 4LFBF 4NFRA 3M9OB 1RT3A 3R1KA 4HI2A 4UF4A 3KR4A 2VPZB 3GB0A 5KAKA 4UUWA 2CIMA 4JI7F 1O6XA 2W4CA 3J7YU 2WVEA 2J8SA 3GR1A 3PCOB 3ZXWA 4KV8A 3HUVA 2DPJA 4MIBA 4X65J 4OYWA 1GMUA 4WFZA 4L3KA 3N5BA 4KJIA 2RVJA 4HLBA 4O44A 4R5PA 3B6BA 3UCZP 5ETQA 4PG8A 1P9YA 2HMIB 5D8NA 2GGPA 2XMTA 1J2VA 5KOXA 5ETRA 1PGZA 3HJVA 2HVIA 4Y28C 2OOTA 2OLWA 2JEWA 4QYZK 1SC1B 4ED8A 1Q8BA 4FF1A 1ZA1B 4MFJA 2B8QA 2VBYA 3MMCA 1IN0A 3M1VB 3EMTA 5J2NA 1D1UA 4IG3A 4DCJB 2E5GA 4Q43A 3ITHB 1FA0A 5CYJA 2QSWA 2C6GA 2BANB 4C8LA 3KLVA 3G9CA 2XWXA 3MAHA 2FHJA 3W2WB 5LL6d 3TW0A 2BKOA 4JYAJ 4NCGA 1WEZA 4K0KF 4CCHA 4MI4A 2B8PA 3D2PA 2D9OA 2AHOB 2DO0A 3SSQA 1FTCA 3KLFB 2EFQA 2JJ4D 3DLJA 3GYGA 2XG8A 1WUUA 5IT9Y 3HP6A 2BUEA 5F8JA 3CIMA 2H5EA 4ZMMA 2C22A 2B6AA 3IWLA 1UZHA 2KDOA 2XMVA 2BJ8A 1BQMA 4RW9A 4ZLNA 2XEGA 1N8RT 2HHHJ 5C25B 3HDSA 4ANDA 2KL8A 4FD4A 1NK8A 4FYDA 1TU0B 5ETLA 3K59A 2C28A 4DR7F 3VWEA 1PBUA 3TOQA 1R0BG 5IV3A 4ZVHA 2EFGA 1S6PB 4P2MA 3CMAS 4KKOA 3W3SA 1AUGA 4OLOA 5LOQA 3GJTB 3ILJA 4PZVA 4FS2A 4C8OA 1RWPB 2YNIB 5DGBA 4OI6A 5IB9A 2ZFHA 3LACA 1IB1E 2OTLS 2P6SA 3CD5A 4PABA 4KUBA 1TKTB 2V6AA 4F2RA 1RKJA 2J6TA 2P6EA 5EWGA 3HFZB 4X5KA 1S1WB 4NGQA 4CTAB 1N88A 3FYNA 4KGVB 2PJCA 5KG5A 3Q23A 3G8QA 1OYEA 4PR6A 3T1AA 3I9V9 2JEGA 2VI7A 4OZ2A 5GADU 1UWBB 4K8RA 1M4GA 3ZC4A 2KXNB 5A0YA 5M2RA 1JJHA 4LREA 4FNIA 2J8RA 3SCJE 1MU2B 1Z4EA 1ZPWX 4OZJA 1RLCL 3MPUB 2Q4ZA 4ED6A 3QZ8A 2DXFA 3T1HF 1Y3JA 1Z2ZA 4X66F 2MJNA 2B0GA 2HS4A 2PN6A 1S0MA 4F2SA 2HVHA 3HSJA 1Y4ZB 4X2TA 2GW8A 2HNZB 3MM9A 2HFOA 1RSCA 3ISZA 5F09A 4UOGA 3GFXA 4OLLA 5L9NA 5HROA 1HNZF 1LWEA 4USIA 5KT3A 2AJ0A 4DQSA 2DRAA 1Y9KA 1BD6A 2DNPA 4LBHA 5HLFB 4NGNA 3UCUP 1SH2A 4NEZA 2JC1A 1NJYA 2AFWA 2RF2B 2AJ6A 4DCPB 4X8IA 4CM2A 1JKHB 5CH7B 1VJQA 3BDPA 1IKWB 3SDEB 3TA0A 2HEKA 4J3GA 2HLUA 4YFJA 1W2BR 3LA0A 3UD4P 4K4ZA 2VOPA 1IVZA 1GYTA 3D2MA 2O66A 5L46A 3QGIA 3DDIA 2IC3A 1ZG7A 4USVA 1KKHA 1P9QC 4KHRA 3MM7B 4JI5J 1WDTA 3L7OA 3NAHA 2MZSA 3S6GA 1HQUA 5M2UA 3CWJA 2CPIA 2PSWA 4KOWA 3NXZA 3RJMB 2EFOA 3SXOA 5AE1A 4X4NA 4A47A 4IG0B 3QGGA 1HQEB 5HATA 1A9NB 1Y3KA 2BOAA 3PVXA 1FWPA 2GIRA 3WC7A 5BWAB 3UW1A 3RAXA 1FJ7A 4EU0A 4RR5A 4FN5A 2MLYA 3NEKA 3ICLA 2DNLA 4GXHA 1NHUA 2F1FA 2YWFA 4NLTA 1HBMA 4DX8H 1X10A 4R9MA 2CY2A 2RQ4A 5KFIA 3M8PA 4OZ1A 5HK4A 2KKHA 1YQHA 3OQ2A 3TVKA 3R95A 1Y7PA 2OP5A 5B0DA 4OYPA 3V4IA 3QIPB 2BR0A 5CQGA 3UN2A 1RWVB 1WKKA 4RLEA 1FKPB 2V8HA 1N5YA 1BHNA 1M4DA 1JLGB 2AX0A 2FCKA 3PRTA 1XMBA 1B3TA 1QDUB 4ZCIA 3Q8PB 3A3OB 5J1NA 5B0EA 1Q79A 3WABA 3LMSA 1OJ4A 1CPZA 3QWPA 3PO4A 4JI0F 4DQQA 2YNFB 1QTMA 3IWNC 2YWHA 1GXUA 5K14A 2R7UA 1XMOJ 1HI1A 3C15B 3CC7S 3GE9A 4KOUA 2CTBA 1CQMA 2R8KA 2Z0ZA 3J81j 5THWA 1PUAA 3BBCA 2KT3A 3GPAA 3IAM9 3K89A 3D6HB 2AJQA 2CNSA 2HK3A 4DV7F 1RU1A 1SJFA 3RGIA 2MQ8A 2DITA 3I6PA 4ETZA 1DQ8A 4Q7AA 3CJQA 4HKFA 5I0CA 4LSLB 3H8YA 1TK0A 2V50A 2MDAA 3IBFB 1SH0A 3H4DA 3N01A 2P5VA 3IFEA 1HWLA 5E7OB 3GP9A 4USHA 4WTYA 3IGRA 1VLYA 3DLEB 2GMHA 3F73A 3M2UB 3ENAA 4B17A 2V4JA 2DNHA 3AOBA 4I2QA 1RYRA 4ZGYB 4R8UB 3J7A1 1LXJA 3LW5C 4NX9A 1Y5NB 4ECVA 2PDOA 3DR6A 4WBFA 1FJEB 1LXNA 4CYUA 2JDJA 2PEBA 2JFDA 2RT3A 3QZ7A 1JJ2R 4NJRA 5SZTA 5F46A 2QYCA 3FRMA 4NXNJ 1M5OC 2P6TA 3FEDA 5HMNA 1DLOB 4IUSA 5L1LA 3S1TA 4P2XA 3BGUA 3TRGA 5ELYA 1KRPA 2Z0GA 2GANA 3JQJA 1RUSA 4DZ6A 5G22A 2FXFA 3LUYA 3D8PA 5AE3A 4IHMA 2Q1LA 5KG3A 5F8NA 5E41A 1C0TA 2AX1A 3NBPB 4DF8A 5A27A 3GCXP 3O2IA 1B4SA 3SV3A 4OC4A 2C6PA 4WU2A 2YX7A 4H4MA 1XNRF 1KQSR 2HNYA 5D77A 2QLJB 4DV1F 1F2GA 3JXOA 1NHVA 5CYQB 5FLXU 3TX0A 2E44A 1APSA 4IDKB 4ZHRB 2M8HA 5D8HB 2ZVSA 3K2KA 3RBZA 1WC4A 4I7FA 2IAJA 4GVLA 2Q79A 2DHHA 2CNTA 1Q86T 1ZA2B 2KM8B 4FYYB 1RT5A 4A8QA 1RAIB 3FCHA 3B78A 2G1DA 2XS2A 4KSAA 3HSDA 3NGUA 1JXVA 3MF5A 1NK7A 1MW7A 2QA4G 3UDEA 4LT6A 2Z2MA 1WC3A 4DR2J 2G0CA 4A8WA 4JI6J 1LW2A 5D78A 3VAIA 4KUAA 4OHXA 1HL6A 4WFXA 3C19A 2YNHA 3ET6B 2JX2A 1KFDA 2RC4A 2ROPA 3WX8A 1OQ3A 2Z57B 1LWCA 2N3OA 5KFEA 4CYPA 4GMKA 4KH0B 4KYZA 3MAAA 1RHUB 2VZZA 1KN6A 4MMOA 4HH1A 3NCRA 3KK1B 3CMQA 2HFUA 1RGVA 4C97A 3BJYA 2L9WA 3QAUA 3ZTPA 1YR0A 1FVQA 4A94A 4ZOSA 3MDFA 3ENQA 2DHSA 4DPYA 1F5BA 1QSSA 1P8GA 1F57A 2RUSA 5J2MB 1UCNA 2ZVIA 5E2QA 1M1KT 4PWUA 3N9UC 1QSYA 2DCLA 4K5SA 5DQGA 5KG4A 1XEBA 1B7FA 3MEGA 3SFUA 2O4HA 1V3SA 2XZWA 4LFAJ 1CQNA 2CQPA 2OZHA 2PIYA 1SJQA 2PMHA 1C4AA 3I56S 2W01A 4OYIA 4I0WA 2LDYA 4IH6A 2UVRA 4P4FA 4JI4F 4C7HA 3CC4S 2KXFA 1UVLA 2UVUA 1IUJA 3R5DA 1CC8A 3GSDA 3SJGA 3LO3A 3GFHA 1JLFA 4WXWA 4OX6A 5IOLA 3LP1A 1MSWD 1NPKA 3BPSP 3G6XA 5MAOA 4R0JA 2OPPB 5KFZA 2DH9A 3BSAA 2J8AA 1RE1B 1UJ4A 1WK4A 2R7SA 2R8VA 2K3KA 5M2PA 3B3WA 3SI8A 1NHKL 2F63A 3OFEA 5KG6A 2QECA 1S7LA 1R89A 1YW4A 3JSMB 3I0RB 3O8WA 2LECA 3AH6A 2RQCA 4NLXA 3BGOP 4JXRA 1Q7LB 3I87A 3HX9A 2DCUB 3R9LA 4UOCA 3HCXA 4O4RA 1S6QB 3T9YA 4C11B 2B7BB 1R43A 3IP0A 4CM0A 2IMWP 4EGLA 5FVJA 5BR8F 4ECWA 2JNJA 3MPDA 3VARA 1GT8A 2M4MA 2ATRA 3KLIA 1ZZNA 3MMJA 1ARMA 1B99A 1G3OA 3PG9A 3D0HE 1U1NA 4BLGA 2AGPA 1RTIA 4J91A 4DPWA 3UR3C 1K1SA 4UFXA 3NH8A 2Z4PA 1YHQS 3IRXA 5E3RA 4E0DA 2RKIB 2EBGA 2C2EA 1M5KC 1S0OA 1PJ6A 4RS2A 3PW4A 1Q81T 4WPAA 2I0XA 4KPCA 4DFMA 1JLAB 3P4UB 4J9RA 3DMJB 4NLPA 2WVFA 1F6TA 1FXLA 1U1RA 3BGFA 1UFWA 3M9MB 4UW2A 2ZH5A 4MXUA 4ZP7A 3DRPA 3D5MA 3VVTA 4ZPBA 4FBEA 1SV5A 4Y0FA 1HPZB 1NEEA 4ELTA 2CNLB 4ECYA 4M5DB 4P2FA 4BINA 4I6YA 4QB9A 1K9MT 1HBOB 3FNCA 3UY5A 1U6FA 4KHPF 4X2BA 1V0CA 4F4ZA 2FJDB 3I4HX 1FRMA 2XS5A 3EVWA 4CZCA 2VBWA 3MURP 1IY7A 3LGHA 2DXQA 2E9TA 3CJTA 1UL3A 3PFEA 3J81Y 2FLOA 2GHWA 1NZAA 4F25A 3QBCA 3ZJ0A 3D4JA 2QMWA 1DTQB 4G1PA 4LF4J 1FESA 1J5OB 3KHZA 4MAKA 2H4WB 2FUG9 2C3YA 2GJFA 1M5HA 2MJUA 4DN0A 5F0UA 1JWWA 3TUIC 4PKDB 3LAKA 4XIUA 2UU9J 1NPRA 3VGVA 2R2UA 1W25A 1HHSA 1QSNA 3KYLA 4LIWA 1JK9B 3QJJA 3BI1A 1NMTA 2WTFA 2BJ3A 3VH9A 1YLEA 3FSXA 1YG0A 2LEAA 1TTHB 2G4BA 1H98A 3VGTA 2BW2A 2D41A 2PSZA 1V6HA 3MCNA 1EAYC 3MXHP 2F8HA 3K5PA 1Q8KA 2EVZA 4PPZA 4JYAF 2HNDA 3LP0A 2FHJD 2R8IA 3P5BP 3PDNA 2RHSB 3LWLA 5LYFA 4YRHA 2CYYA 2HQGA 4CLZA 2Y1LB 2DY9A 2FLNA 4IQXA 2LXFA 1FKOA 4F3MA 2GGPB 2PJ5A 2CDQA 3V38A 3KJQB 2WSCC 4DX6A 1C1BA 2QYVA 2QEXS 3ADAC 4EBDA 4U96A 4BHQA 4CT8A 2DEIA 3U27A 1TL3A 3A3PB 2HHVA 1ZAVA 3MMCB 2Z10A 4FXDA 4HTJA 2VV5A 2PCUA 1X4DA 4RBVA 4IG3B 4M5JA 5KFQA 3OTBA 3NGDA 1Z8XA 3KUEA 3I0SA 3B8HA 1U8SA 3P8BB 5A28A 3U7JA 5I42A 4NCGB 3V8IA 2ASDA 5IM0B 2J7UA 5DGAA 2PC6A 4KQZA 4NLSA 4DFKA 4Z2XA 2Q43A 4C2MA 3PJXA 1ACMB 3I55S 1RT1A 1OY9A 1FNXH 2DF5A 2F8EX 5ETSA 5KFFA 2PD1A 2D3OR 3HO1A 1UWYA 4KC5A 3VQSA 3DKDA 3W9HA 2FYXA 1RTJA 3NMRA 4JZ0A 5F8IA 1S5KA 2YKAA 2NXUA 3NWGA 1BQMB 3W5ZA 3M6WA 2YKOA 3NCPA 2VBQA 4M5GA 3GIUA 2UUWA 1H2TZ 1HR0J 1U7LA 3BHXA 2GNKA 3RAMA 4S0MA 3CXCR 4M5HA 4DUZJ 2DEAA 4MFKA 4AT1B 3OJSA 4PXBA 3KUHA 4ECSA 3HULA 2JVRA 4P6YA 4UZCA 3D7GA 3A8IA 2DR6A 5J1EA 2A2CA 3DOKB 3FEYB 3GKRA 3M6UA 1EKSA 3S8SA 2Y0MA 5F47A 4AL5A 2P9GA 4QPXA 3N0VA 2FSRA 1S7IA 4PG7A 2EBJA 3QSYB