3ISZA

Crystal structure of mono-zinc form of succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
376
structure length
369
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 122
structure length 369
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iszA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iszA01
3SI2A 4IK2A 2AFUA 1DTDA 4R6TA 3D66A 1ARLA 2RFHA 5LYIA 2EK9A 2PCUA 3FH4A 3TX8A 1IY7A 1RTQA 2AFSA 2PIZA 4A94A 2VL1A 3FMCA 4PXEA 4H2KA 2PJ9A 3BXMA 3PEIA 1JQGA 4ZYQA 3IIBA 2GU2A 4OC2A 6CPAA 4W9YA 2QJ8A 4FWUA 3GLJA 5K8OA 1ZG8A 1CPSA 4LQGA 2EK8A 3ISXA 3PB8X 1AMPA 2ZELA 1CX8A 3WC7A 3SI0A 3RZAA 2POKA 2PJ3A 1XMBA 3D67A 2AFOA 2J9AA 2Q4ZA 3D7DA 2PE3A 2JBJA 3NH4A 5HVFA 2F8HA 3BI0A 2PJ4A 5J1QA 1KWMA 5IB9A 4P45A 3PRTA 5LRJA 3TC8A 5LYDA 4BD9A 4P10A 3D7GA 1Z5RA 2PJBA 1GYTA 7CPAA 4P4IA 1F57A 3B3TA 2WZNA 3B3VA 4X3RA 5JH9A 3B3CA 3FECA 3KL9A 1CBXA 4JYWA 2ZEOA 1TF9A 3H8GA 4Q7AA 3V38A 4UEEA 4KSIA 5JM6A 4WWVA 2C6GA 4YU9A 4NGRA 4ZX8A 2BCOA 2EWBA 5LYFA 1LANA 4A39A 3WC5A 1CG2A 4MMOA 4OP4A 2XEIA 1LAMA 2XEGA 4P6YA 4PPZA 2GLJA 4A38A 2HC9A 3DGVA 5K8NA 3KASA 3B35A 3B3WA 1VGYA 4TWEA 1ZLIA 3PFEA 4YWYA 4P4DA 1ARMA 4G1PA 4TNUA 1Y0RA 2ZOGA 2C6CA 2FVGA 3KGQA 3KR5A 1YW6A 1LOKA 4GM5A 1QMUA 2CTBA 4MCSA 3S9LA 3SI1A 3WABA 2PVVA 1TKFA 2WYRA 3KHXA 4OC4A 4ONWA 2XEJA 1UWYA 1Y7EA 3D4UA 4EWTA 3H8EA 3FF3A 1HDUA 5THWA 1F2PA 4DYOA 2CTCA 2PIYA 3K9TA 3KQXA 4MCPA 4RUHA 1TF8A 5DS0A 3CT9A 3D7HA 2ZEHA 2PJ7A 1ZG7A 3NFZA 3KZWA 1ELMP 4DJLA 2PJ2A 3KHZA 2ZENA 1LCPA 2Q43A 1EE3P 2F7VA 2ZOFA 1AYEA 3FEDA 4MHPA 4OIWA 3MN8A 1XBUA 2V8GA 4MCRA 2PJ6A 4P4JA 1R43A 5F09A 1LAPA 2PJ5A 3RAMA 3PFOA 3FX6A 3S9MA 4NJRA 4B6ZA 4MRIA 1OBRA 3VARA 4EFDA 3HUVA 2V8DA 1BPNA 4IHMA 3N5FA 1XJOA 2CF4A 3WT4A 3VH9A 4ZX9A 4ZY2A 5CBMA 1BLLE 2BOAA 1PCAA 3KI9A 3VATA 2V8HA 1TXRA 3ISZA 1Y0YA 3PBBA 5LRGA 1R3NA 1M4LA 2CIJA 2GREA 1YLOA 2ZEGA 3WC6A 4R8FA 3DLJA 2PJ1A 4CPAA 1IGBA 4Z65A 3KQZA 3KR4A 3PB4X 2V77A 2ZEPA 4IAVA 3RBUA 1ZG9A 5HXDA 1XFOA 3B3SA 1H8LA 3NA6A 3CDXA 3SJFA 2IQ6A 3IJ3A 2C6PA 3D68A 2JEWA 4R7MA 4UF4A 2OR4A 4WJBA 2OOTA 1ELLP 4NGNA 2DEAA 4F9VA 1TKJA 3FEEA 4NJQA 2ZEMA 1BAVA 2PVWA 3SJXA 3IEHA 2ANPA 4UIBA 3T8WA 4MHNA 4P44A 5CPAA 8CPAA 4K3NA 1FT7A 4P4EA 2Q51A 2NSMA 1NSAA 1HDQA 4PQAA 4X2TA 2JBKA 5JGFA 4OC1A 4AXVA 3H8FA 3MRUA 5D29A 1Q7LA 3QNVA 2ZEFA 1YSJA 1CP6A 4F8ZA 2AFXA 4OMEA 3PB7X 1CP7A 3NH8A 3B2YA 1HEEA 4ZI6A 5LYLA 4EMEA 2GLFA 4UIAA 2ZEDA 2V8VA 2NYQA 3FVLA 2AFMA 4A37A 3D7FA 4MXUA 4NGPA 3GUXA 4PXBA 4NGTA 2IMOA 1YMEA 2I3CA 1VHEA 2PJ8A 4PXDA 1XRYA 2C1CA 5K8MA 4NGMA 3HLPA 4OC3A 5HVHA 1Z2LA 3IC1A 4FAIA 5I4MA 4FUUA 4PXCA 2QYVA 4MCQA 3CPXA 3FJUA 1TKHA 4DUKA 4ZY1A 1LFWA 5K8PA 4MHZA 4OC5A 2AFWA 5D8NA 5LRKA 4UEFA 1BPMA 2PJ0A 2G9DA 4MHYA 2PJAA 3PB6X 2RB7A 5HVGA 1PYTB 2O4HA 4R76A 3SJGA 3IO1A 3LMSA 3NH5A 4JZ0A 4NFRA 1CPXA 2PJCA 3GB0A 2ABZA 3BHXA 3LWUA 1VIXA 5ELYA 2ZEEA 4P4FA 3PB9X 2QVPA 4X8IA 3CPAA 4NGQA 3B7IA 4OKOA 1Z8LA 4O23A 1VHOA 3IFEA 3IWWA 3JRUA 1FNOA 1DE4C 1ZLHA 4ZY0A 3S9NA 4OIDA 2AFZA 4OC0A 1QQ9A 4UEZA 2O53A 2PRQA 1YW4A 4NGSA 3PBEA 4FBEA 3L2NA 1F2OA 4P4BA 3K2KA 2BO9A 3SJEA 3BI1A 2IJZA 3V7ZA 3I1UA 2HB6A 2XEFA 4F9UA
chains in the Genus database with same CATH superfamily
1Q2DA 3ZZPA 2EUIA 4DU8A 5BYRA 4Q2LA 5KFGA 1VJWA 3MAAA 1RTQA 5AE1A 3PEHA 1UVMA 2MQNA 2PIZA 2P6TA 3CXSA 3G4SS 4WPAA 4YGOA 1SKSA 3TE4A 1RU1A 2Y1RI 4ITSA 2GJIA 4Q43A 3M2RA 1JLFB 4W9YA 2HNYA 3GLJA 4AFFA 3HVTA 2AYGA 4F02A 5DZ6A 1X4EA 5DDQC 2DO4A 3SSRA 2MXYA 2O5DA 2POKA 3FRMA 2MTLA 4MKYA 1YLEA 5HVFA 1KNZA 4R0JA 2WOMA 4OI2A 3I96A 4D3HA 1TVRA 4Q0BB 3FXTA 4Z7YA 1U1LA 3R5AA 3T1YF 2KZZA 3CCQS 4IG0B 3TOBA 1M4IA 4Q7AA 3M1VA 4CYUA 1JXLA 4JB8B 1MSWD 2DXEA 1BOBA 1TL3B 4DDFA 4I68A 4GS4A 1R0AB 4YB5A 4A39A 3A3NB 1WEYA 3OTCA 3W9JA 1VQKS 1X4GA 4MMOA 1QLNA 2FY1A 1JLAB 4WCEQ 4IUFA 3ILOA 3CXQA 4URSA 3G8WA 5GMKa 2EBGA 2AJ6A 2C28A 3J7YU 2VZ9A 3DU6A 4UQGA 4ZVPB 3WABA 1M90T 4DPXA 2D3ZA 4B3RF 3MUMP 4GXHA 3DRPA 3SQGB 2I0XA 1GHEA 3PX4A 3PZJA 4DR4J 4EWTA 4FXDA 3UWTA 3QLHB 1VFJA 5G22A 5DM7Q 4RUHA 5ETKA 1EQMA 4FYXB 1GXUA 4E0AA 5M2RA 4KO0A 1ELMP 3AH6A 3TJ9A 4MFJA 1CJTB 1QAIA 2AYEA 3FMBA 2XSJB 3BKUA 4L73A 5E41A 2J6UA 2DNLA 4FDFA 4L76A 1UWBA 3IS9A 2X3GA 3GSDA 1FDAA 4XPEA 4ED8A 5F0WA 4EFDA 4YUDA 2HQGA 5ITHA 2FJWA 4KFBB 1RHMB 3CVKA 3KI9A 4WIIA 1S59A 5A2QY 1PAUB 2K7JA 1H7WA 1SUQB 4OYMA 1LWCA 1IGBA 3FQKA 1DTTB 2WW4A 2UXBF 1C0TA 1E6YA 4ELTA 4LF2A 1XFOA 4JOUA 2PN6A 3GG1A 3B3SA 2J9EA 3SFGA 1HW8A 3HM9A 1NUEA 1WC3A 2ZBPA 1RLDA 4M5DA 1GX6A 1K1QA 2PSWA 2VA3A 4QR1A 3O2IA 1REGX 4M95A 5IT9U 2YKNB 2CVIA 3SI8A 2XYPB 5DM6Q 1D09B 5D4OA 3UDCA 2HNZB 4R25A 3F8KA 5B0BA 2CRLA 4MHNA 3BB5A 2FVCA 2RRNA 4NXMF 4MH8A 2Y0BB 4P4EA 4IR9A 1BE4A 2GMLA 3KLHB 1UCNA 3MCNA 2JEFA 1FDNA 1RLCL 4IO9Q 2ASDA 5D29A 2V34A 4R3LA 5RUBA 4OHYA 4ZJOA 2DTJA 5EWEA 5IM0B 4FD5A 5LMUF 2DR7A 4LX9A 4TLQA 4EO8A 3GIIA 3EXCX 1D9AA 1U1KA 2XBPA 4YY3J 2ARHA 1GEHA 3I5CA 2FLLA 4X4VA 1VHEA 3SXNA 4CQ1A 1WORA 2VOOA 2U2FA 3D6MB 2V4QA 5L1IA 2W4CA 3DRSB 2BANB 3LODA 5KOXA 5IV0A 1LWXA 1JIHA 3R9FA 2KG0A 4DUKA 1VQNS 4MHZA 3N0VA 1HA1A 5LRKA 2DRBA 1RTJB 3IN5A 3JSMA 4MHYA 1REVA 3PB6X 4M5GA 1RAHB 3K5NA 1RAFB 2DGQA 4RW8A 4ED1A 3BN7A 3DSBA 4I6AA 4CT9A 2YNCA 5J2PB 4M1KA 4FPRA 2Y0SD 7FDRA 3I5BA 1ZLHA 1EARA 3M2VB 4FBUA 4HH0A 2I9SA 2QL9B 2HS0A 3MCSA 5DQGA 5B09A 3M6VA 1SB6A 4ZN3A 1YW4A 2D9OA 4U9YA 1SJQA 1Q81T 3S8SA 1Y5LB 2CZ4A 4K5SA 1RT1B 1N34F 1IIDA 2IJZA 3ADAC 1Y3KA 3SMZA 4B3TF 2YPZA 3DOMB 2HPUA 2B56A 3FH4A 1CS4A 3BREA 1KUXA 4QZVB 3GIMA 1REVB 1AZSB 2W2PP 2WTFA 4H2KA 3NE7A 1RGVA 5BR8J 4TYBA 1P1TA 4CGPA 3B8GA 2JOQA 1IQZA 4ILLA 2PI5A 4ECQA 3ISXA 4C11A 3GIRA 3PX0A 3N6LA 1T7PA 5BYSA 4PR6A 3RBDA 1H2VZ 2ZD1B 1KP6A 5M2UA 2H3EB 5KFTA 1KKHA 1PIEA 4I6WA 5I3UA 4ZITA 3PDNA 3HULA 4XO0A 3NH4A 3HF5A 2KJWA 2XSFA 3IM8A 3ET6A 2FC8A 1C0UB 3K5OA 1RHQB 4BD9A 3R5GA 5IWAF 2MJNA 1FWPA 2B5JA 4AUKA 1IYLA 1Q79A 3IWLA 4NCAA 3NNHA 1DBDA 4C9DA 4CGMA 2WVBA 3EX7B 1F9FA 3H5XA 2KN4A 4CDIA 2J76E 4DL0C 2ACMA 3UCUP 4F4XA 2C2OB 1WOOA 2Q7SA 1T9YA 2BW2A 4LRFA 4ZVSB 4LSLB 1XIXA 3N6NA 2V5HG 2QG9B 2Z3OA 4HYKA 4O4GA 3AA8A 3GYXB 3RBZA 5E0OA 4QBUA 4LFAF 5J2NB 3SSSA 1CLFA 4X4OA 2YH1A 1RTHA 2H4YB 4C2MA 1TFWA 2XEIA 1I1DA 3MPYA 5C25B 2VQYA 3R9LA 1NK4A 4PPZA 2G0IA 3VQSA 1G7CB 2YKNA 2XHWA 2KYXA 3DGVA 5J2MA 3QIPB 2VZZA 1YTYA 4UY85 2JWNA 4USTA 3MF5A 3OTOJ 4EBDA 2ZDOA 1MJAA 4J9UE 1HNWF 4EZ6A 2DHAA 4JV2A 3QRRA 1EKSA 1JKHA 2O66A 2IVMA 3QGPA 3KK2B 2XEJA 1R8AA 5D4NA 4LQ6A 2A0FB 3B82A 2LDIA 1HDUA 4PV6A 2D1CA 2A4NA 4KH0B 2FGCA 4CO5A 1S6PB 4RX6A 1PYSB 2HMIB 4CAVA 1QJHA 3T9YA 3SV4A 2JEJA 1YJTA 5F8MA 2F7VA 4CAXA 5EUHA 4YB7A 2XQCA 3IBCB 2BANA 2XB2D 4OQJA 2P2CB 4RNNA 2LXUA 1HQUA 4B13A 3W63A 3P5TL 1OQ6A 1ZAXA 3PFOA 4UFWA 3IAS9 3PG9A 4ZLNA 1FY7A 4UFVA 2PC6A 3S6KA 1EIYB 3QFWA 4UUXA 3GILA 1FNXH 4B9SA 4DV1J 4LSNA 2Y3YA 1YVKA 2BOAA 1HHSA 1P9YA 2VFVA 1LQ9A 4F26A 4MFLA 3PYEA 2XHCA 5GAEU 1Y0YA 4P52A 4DR2F 1Z1ZA 1Z2ZA 3Q8SB 4R8UB 3V6DA 4CPAA 1TK0A 1JXVA 1TELA 3N9UC 2I38A 3TRGA 4LFBJ 3BH7B 4X65F 1TL4A 4XIUA 4H6UA 6FDRA 1Q95G 1TKZB 3GU0A 2BJ1A 5GMEA 4KR0B 2ASJA 2C2RA 2A18A 1P9QC 3SHPA 3CJTA 1XNRJ 3H5UA 3C19A 1X31C 5B0EA 4RJVA 5H86A 4NJQA 1HBNB 2PVWA 2RS2A 2NQPA 5DLFA 4DUZJ 1D9FA 4LF4J 2XMWA 3T8WA 2F4FA 1VQ7S 3N7ZA 2YNGA 1U1PA 4Y28C 5IT9Y 1T9TA 4G65A 1NSAA 3T9ZA 5K14A 1WC1A 4BBHA 5DG9A 1NBEB 2JEGA 2JBKA 2R4FA 5IFMA 1UA1A 1X12A 3MRUA 4RZRA 4YDXA 3AXMA 5EWFA 3Q89A 3U1NA 5KTDA 3EGNA 4Y2CA 1FK9A 3NH8A 5DG7A 4ZI6A 1R0BG 1U1NA 1IJEB 4M6IA 1PSDA 3Q8RB 2NYQA 2P8IA 1Y4ZB 4CTAB 5A6WA 3FGVA 1FHTA 1QVGR 5K8MA 3R7NB 4I1TA 1V6HA 1SJFA 4LMZA 1WK4A 3DFEA 3FEYB 1S0MA 1U0HB 3UDVA 1VBYA 5T7LA 2BKOA 2B51A 1K0TA 3HVTB 4J9QA 1TKHA 2ZHBA 4EU0A 1YITS 5KFUA 3O8WA 2OMLA 3MUVP 2BKPA 2RB7A 1N32J 5D8HB 5G21A 3OD2A 1IWAA 1NPPA 1FERA 4AXJA 1UW4A 3WQPA 3JTOA 2L9DA 2MB0B 4ZCLA 2MQMA 3NH5A 1Y9WA 4B08A 1X5SA 4G3IA 2FSRA 4ZVTB 3PO4A 3DRPB 1P4NA 5GVQA 2XGPA 4HR2A 2RQCA 1T9VA 2FZKB 2LU1A 2Y1IA 3CCLS 3GP9A 4USMA 5HATA 2FIWA 3I0RB 1TK5A 3TT2A 3C6UB 9RUBA 3IRWP 5JPHA 4DR1J 1HQ2A 5H9EJ 2PRQA 5EHHA 3M8SA 1F2OA 2C2ZB 1X5PA 2DBBA 1S3ZA 1SH0A 3IR6B 2EC2A 2B5GB 1TIQA 5F49A 3V7ZA 1Q7LB 2H9ZA 1YJWS 5B0FA 3RBXA 3OFEA 1BMQB 3KKFA 1VQOS 2PCUA 4K4VA 2RQMA 3AY0A 1N5YB 2KI2A 3TANA 1I94F 2ATRA 1RO5A 3A4TA 2VDIA 4WBFA 2RS8A 5KFVA 3FBEA 3THTA 3C6TB 2ZD1A 1C4AA 5T41A 2XLJA 1PYTA 1NK9A 3GCXP 1S9GA 5HBMB 2IJRA 1RTHB 4B3RJ 3HHNB 2D3OR 3EPIA 4XK8C 1XEBA 2HLTA 3M9OB 2PJBA 1MN7A 1MWQA 4H54A 2ZZTA 4U96A 1ZM4A 1FD2A 3QWPA 4LUAA 3I0SA 1HIYA 4DV1F 3V38A 4UEEA 1Q82T 4WWVA 2VBYA 4YU9A 4NGRA 2VC0A 2VPWB 2Q6CA 4PK2A 1F3FA 1RAJA 3DR6A 2QV6A 2CNLB 4LBIA 2B8PA 4WKRA 3FBBA 3RBEA 2MZRA 1D3WA 4JI0J 3B35A 4KLWA 4FF4A 2YWWA 2VG7A 1DHMA 3M8PA 4HKFA 4G1PA 3MMCA 4ZMMA 3C46A 1V9OA 3WDOA 1FTRA 3UVJB 4QYRA 4MFQA 4UWIA 3CDWA 2Z3NA 3PV8A 1TKFA 3CCWA 3PP9A 1RT7B 2QLFB 2VD3A 4KIAA 3TOAA 3AXKA 2HURA 2O28A 4U5YA 2HFSA 2O01C 2R8VA 3P8BB 4DUTA 3IU1A 1S6QA 5H9EK 1KR4A 3KLEA 2OB0A 2C2NA 2UXDJ 3M8PB 3PCOB 2BOPA 1U2RA 2WZ1A 2YNFA 3H5YA 3BN4A 4CTAA 1VK3A 2PJ7A 2KDOA 3BYPA 1SQEA 1I94J 1PC5A 5HJXA 4ECSA 1YJ9S 1S77D 2HWIA 4HHHA 3KHZA 3WIVA 2Q43A 2ERRA 1NH7A 2DR6A 2ALYB 2V8GA 6FD1A 2ROGA 4QR2A 1VDHA 4M94A 2CPHA 2MZ1A 5GAGI 1Z4RA 3TUJC 3L7OA 2ILZA 1BY9A 2Q04A 2LA4A 1W2IA 3C15B 1N5TA 2ODFA 2FCKA 3I9V9 5CBMA 4AL6A 2J9CA 1PCAA 2W2MP 1T8EA 4RPFA 3C14A 4PCQA 1WF0A 4LSLA 3PBBA 1CS4B 3EGWB 1AFJA 3IM9A 1IKYA 1C2PA 3HKZD 4IAVA 2RUSA 3G71S 3CDXA 2F3JA 4WXWA 4MIAA 4MK7A 1KHVA 4R7MA 2KT2A 5EX3A 5JVGQ 3PO5A 3EVWA 2KG1A 3TCVA 2WVDA 1E6YB 2AZ3A 4KOSA 4PKDB 2CXEA 1FT7A 1SH2A 2F4VJ 1TAUA 3CJ5A 2OU2A 4ZLLA 3IWGA 2Z2MA 1ITPA 2AX1A 2I2YA 1Q7LA 2FLPA 4J9PA 3QNVA 3OUYA 2ZEFA 4MK8A 3KTQA 4ECTA 1SH3A 2F5GA 2QLBB 2W01A 4A48A 4H89A 2V8VA 1NDKA 1NH8A 4UOCA 3CCVS 3I0RA 4ID5A 2VC1A 2ZH6A 4YDDB 2I3CA 2NPIA 3LP0A 2Z2YB 1YZ6A 1FFSB 1B0TA 3WBZA 2V0NA 1IKVB 2W9CA 1N33J 3GJSB 1YJUA 2CFXA 3IC1A 4OYAA 4HI2A 1UPPA 2YWFA 4DFMA 2I5JA 3H7HB 2M70A 2Z3LA 2OZGA 1S5KA 1WWZA 2AFWA 3J7Z5 2VBWA 2F65A 4QIWD 4PYAA 3BBCA 1A0OB 2G9DA 3H40A 1JB0C 1RYSA 3I6PA 5KFCA 3ZC4A 2ACYA 1QE1A 2ATLA 5E3CA 1FRXA 1VJQA 2M0GB 2J0SD 2RDJA 4OX9F 3FB3A 3LMSA 1CPXA 3KWMA 2VIHA 4DEZA 4I2QA 3CW2C 1ZYQA 4C8ZA 1QAYA 1TUGB 5ETMA 3M8WA 4ZHRB 3LD2A 1IBKJ 1QSSA 4KB7A 4D3GA 1K4JA 1R8PA 4NEZA 1S1XB 3TNVA 4QC6A 3CMQA 1B64A 1DZ5A 2GE3A 2RKIB 1VBKA 2DHXA 5J8CA 3IGVA 1QSTA 1N36F 2H5EA 2VG7B 5J1PA 2HGMA 1DTTA 1BQMA 1DLOB 3QGIA 1U26A 5CXTA 2BM0A 4AVAA 2F1FA 1WEXA 2X51A 3PRVA 1CC7A 1Q5VA 3UNYA 2KT3A 5SUHA 3BGFA 1Y9KA 1T9UA 1TMMA 2QJ8A 5DGAA 2MQQA 2HNDB 1NJYA 2MQOA 1SIZA 3PW2A 2EFOA 3M30B 4ZP8A 3LOUA 1SI9A 2ZWPA 1RACB 4OHZA 4QBJA 1S0NA 4OJHA 4HHUA 3D1HA 4DSKA 1T02A 1YKWA 1AT1B 2PR8A 5J1QA 2HVZA 4WU2A 1Q5YA 2C1EB 3F73A 3QZ7A 5LYDA 2CJ9A 3UQSA 4WFNQ 4MKVA 2AP6A 4YOEA 1RT6B 2A10A 1M5SA 4R8UA 3TZZA 5CYQA 3G96A 1F57A 1R8BA 5JH9A 3MGDA 2FHKA 1VKCA 2NCKL 2ZW7A 3A8EA 1D9DA 1X4DA 3P45B 2HRYA 4HTIA 2BDPA 3C6TA 3QT7A 3SQGA 1HR0J 2BSWA 1V5IB 2W9BA 4DUYF 2GJ2A 3FVYA 2MZQA 3JXOA 3EY5A 2QZ8A 2BW7A 1WHVA 3EE3A 1RHJB 3LAKA 4BCAA 2G9OA 2XMKA 4QWEA 3GR1A 2H48B 2VZYA 1XTZA 5C42B 1F2HA 3DDIA 5B0CA 5K8NA 1XMTA 4KH1B 4TY8B 5D6GA 1ARMA 3T9NA 3V81B 3S01A 4NCGB 5CCMA 1Q7YT 4IRKA 1YK3A 3SDEA 2RRAA 1U2FA 4CH1A 2FB0A 1Y0HA 4B17A 1WC4A 2EWHA 1BQXA 4F0MA 3CPWR 3QLHA 3TTHA 1HBOA 1N33F 2CPJA 1PKUA 1Z8WA 2ZEHA 2BL1A 1QSNA 4HT7A 5K14B 1T11A 3M2UA 3RTVA 5IT0A 2PFFB 4OIXA 4Y65A 2ZENA 1TUWA 1Q86T 1EE3P 3HSDA 4MT1A 5IX3A 3MURP 3X3UA 4GVBA 3L4BC 4RW4A 3ITHA 5EC4A 1KFDA 4MK9A 3UW1A 4Q8EA 5K5MA 4F4ZA 2PR1A 4JV5F 2AJ4A 3QIDA 4KSFA 2GC8A 5FDLB 4LF8J 2HZAA 4LVOP 1UETA 2PDAA 2V8HA 1XMOJ 4ZPCA 4ECRA 3DM2A 4DL2A 3NL0A 2P9CA 2ROPA 4CT8A 2AJ2A 4NLOA 3HFVA 2JDJA 3S6HA 5JUMA 2ZBRA 1NAQA 4NXYA 4DCJB 2QX0A 2GCFA 2GFFA 4PQUB 3CXCR 2QE5A 5HLFA 4Q0BA 1UVLA 4CLSA 1WG4A 1FRLA 1R31A 3R97A 2E5GA 4M5NA 1HBMB 5ETNA 1BAVA 3FK4A 5KT5A 1ZAWA 4B5PB 3US5A 3IEHA 3KLIB 1GXTA 2U1AA 1IICA 3DMJA 4K3NA 5F0UA 2KHDA 2QIRA 4NLVA 4O0NA 3ZFVA 3R7SB 3M8QB 3G6XA 3FSYA 5JMNA 5A2QU 2UUAF 5FDLA 1WWHA 1VRTB 2NS1B 5KG5A 1U49A 3OQ2A 2MHEA 2X3DA 4DQPA 3TP2A 4I2PB 2VG5B 4M6HA 1N5SA 3QATA 2HHVA 4RW9A 4Y2KA 2V9KA 3PB7X 3IWXA 2R98A 3CJKB 2V69A 4X4TA 2NUUG 1TAQA 3O44A 1XF8A 3J80U 2ADBA 5G20A 4LR9A 3LH2S 2IMOA 4IFYA 2VKZG 2FZGB 2R7HA 3TI0A 1BLUA 2PJ8A 1S7IA 2VDHA 1TKTA 3NKYA 4NGMA 1KUVA 1B4SA 3D3CJ 2VASA 4F04B 4FAIA 1FXLA 3J80Y 1UKUA 1XIQA 2PMZD 3POTA 2WVFA 3KLFB 3V6JA 2JJ4D 4OC5A 5CCLA 4C8YA 3GFXA 1S0OA 1JLEB 2NLWA 1VQSA 4MFBB 4JI4F 2Z8QA 2J8SA 3D6TB 1XK8A 3W7BA 4GO7X 8AT1B 1SKRA 4U7CA 2CNSA 3VGSA 3IRXB 3IO1A 2XZWA 1IKWA 3CDBA 3HD2A 3VAHA 3BHXA 2WPWA 4UA3A 5IS2A 4R5PA 4XPCA 3PXGa 2ZEEA 4Y2MA 3QSYB 2DXDA 4NGQA 2XLIA 1L3SA 3HZGA 4LR8A 4A8OA 4EK2A 1MMNA 2W7PA 1SL0A 4NLRA 2D74B 2ZNZA 4O44A 1RK8A 4QCLA 4B3OB 4P4BA 4MJKA 1RZMA 2B4UA 4N76A 1MMDA 3CMES 2HB6A 1JMTA 4KOUA 3PJ9A 1U6FA 1RAEB 4E8OA 2DITA 1M5PC 5LOQA 1J27A 2DR5A 2QA4G 4YR2A 4J7CA 3C3LA 3M8QA 2HZVA 1X0PA 2KU7A 3KLVA 1PAEX 1YBUA 2G1HA 4OC2A 2QLJB 2ZEJA 3JB9k 2OFHX 1CPSA 3HFZB 1A7GE 2R8JA 1TQLA 2HNDA 3W62A 2CPEA 1IN0A 3R9GA 2KB2A 2PJ3A 3NS6A 3MEDB 3QAUA 3W66A 1U8SA 3MMAA 2ZJRQ 1FJGJ 3DYAB 1S1WB 3CDAA 2DGXA 2PJ4A 3H4BA 4DL4A 3G86A 4QQBA 3OL8A 1WKJA 2CQIA 2N3OA 2JRSA 2PSZA 4YP3A 1Z5RA 4ZBGA 3DLGA 3T5JA 4MIBA 2WZNA 1SL1A 3R95A 4KRWA 4ZK7M 4DS4A 4FYYB 3IGRA 2Q6BA 4B3SJ 5LJ5Y 1WTBA 2AU0A 2KXHA 4EI2A 2E9RX 3GKRA 4J9KA 1EQ0A 1RAOA 1DY3A 3RJMB 3N6MA 1Y9OA 2KL8A 2V68A 2OMOA 2HMIA 2UU9F 1W26A 4H4KA 1LAMA 2XEGA 2W9BB 1WKKA 4ES2A 3PFEA 8RUCA 1UWAA 1KDNA 2MKJA 3G8SA 2E1RA 4RUAA 2G3AA 4KBIA 1CEZA 3D1OA 3CJQA 3UY5A 2JEIA 3SSQA 1UWYA 1LK7A 3M7VA 4CNZA 2XLKA 3GPAA 2XEXA 5CYMA 1URRA 3MEDA 2D4PA 4AL7A 2BMBA 3O5TB 2E5JA 2XTJP 3KDOA 3MTJA 2EVZA 4ED2A 1B87A 2H5JB 3NGDA 3MN8A 1TKZA 2KT5A 4ED4A 2ZDPA 1NJWA 3CJ0A 4MKAA 3R5BA 1RTJA 3RAMA 3RB0A 2UU9J 4M5DB 2BYCA 4NJRA 1VMBA 4I7FB 2E29A 3ULHA 3FNNA 2KTQA 4OX8A 3PHTA 4ED7A 1ZA2B 2QLXA 3R27A 1Q4RA 2WONB 2BABA 4ZVUB 2PI4A 2CJXB 3TO8A 1M5VC 1FRMA 2OI2A 3J81U 1OQ3A 1GAOA 3KK3A 4Z65A 2V2QA 4AYBD 1XEZA 3IR5B 5G0RB 4PG5A 4WP8A 2V4RA 4ZKAA 1SJ4P 1NMEB 3V5RA 3MEEB 2IIHA 2YNGB 3IJ3A 4P7TA 4OJ3A 3PR4A 3J81Y 3WZ0A 2CPDA 1VCTA 1ELLP 1VQ8S 2EG2A 2HGLA 4PAAA 4WWSA 3LPYA 3EC4A 2V4JB 2N7YA 1DQAA 5DETA 3MFHA 2F9JA 1V5VA 4U8VA 4YFUA 3C14B 1AA1B 1ZBTA 1FDDA 2OEMA 4OADA 2C2EA 1TL1B 2UUBF 3NLCA 4LSNB 2DXQA 1KC8T 1HBOB 1AW0A 4GC6A 3AODA 5D3GB 2CNKB 1XERA 4X62F 2CQ1A 3THPA 1OZPA 5KFKA 1UVKA 3BQ2A 4OMFG 4RO0A 1DQ9A 2ZEDA 1I3OB 5L46A 1UJ6A 3VWSA 2QMUB 3IBFB 4TY9A 4JYAJ 2VG5A 2WOMB 5HJYA 4NGTA 4DX5A 1TK8A 4R57A 2VFTA 1FJGF 1VBZA 4KHPF 2QYVA 2VPYB 4NLYA 4MCQA 1R89A 4WIQA 4FN5A 3UVJA 3DOMA 2HK3A 4WFZA 1QSLA 3QRQA 1AUSL 4F4AA 1VBXA 2P6SA 1FCAA 2CPFA 2E1CA 3CJ8A 4CLWA 1IVZA 3UD3P 4LUBA 3SFUA 4ES3A 3BBBA 4ZA1A 4C3MA 1CC8A 4BC9A 3P5BP 4DG1B 2ZZMA 1T9XA 2HFZA 5HQ8A 2GGPB 2IC3B 4KO0B 4MYTA 2CJQA 2CDQA 3BGRB 2X7IA 2Y0MA 5JQ4A 3QIPA 2B4DA 4R3KA 4MY0A 3M9MB 4N47A 2Y9HA 1CQNA 4ETZA 1ZTTA 3TQ1A 4JI1F 5IT4A 1EP4B 2Z3MA 3NGSA 2HFOA 4KY3A 4YHHJ 3EWGA 4NGSA 3PBEA 2HHWA 4RBVA 3TVYA 3HLUA 3BI1A 2R7UA 4G1IA 4IK2A 1YJ7A 2D3UA 5ISVA 5LYIA 5JJBA 2XZTB 4CAWA 3EJMA 3V4MA 2DNYA 2DIUA 2CDRB 1HBMA 3GG0A 2OEKA 2HFNA 5A8KB 3Q2TC 4QYZJ 3EVOA 4A30A 4E2AA 1S1UA 1S9GB 1D8ZA 4A32A 3FDSA 5GAHI 1YDLA 2OP5A 5CA5A 1M4GA 5A76A 4KUBA 1ON0A 2EK8A 1TU0B 3PNIA 4CM0A 3EM1A 3PB8X 1AMPA 3A8IA 4XDDA 2LA6A 2A6MA 4P72A 2EKNA 3PZPA 4ILMA 1OS5A 2J9AA 3DDNA 2K3IA 3O1LA 5SZTA 2JBJA 2KCWA 3K2YA 1YBAA 1CM0A 2HUZA 4A8XA 2G3TA 3I0SB 1J5EF 1M1HA 3VALA 2VICA 4RWXA 2UUBJ 2IJNA 3D7GA 2DXFA 4DV7F 1RT7A 4ED0A 3DHWC 2VONA 3RRGA 5KFAA 4K4ZA 2ZEOA 3CO0P 2DT9A 2E7XA 3TVKA 3VWEA 2DNPA 1X5TA 3SQOP 4DQRA 2ZH1A 3RUBL 4KSIA 2ZXVA 4C8NA 1IB1E 1RWMB 1S57A 1BWEA 4RNHA 2FGOA 3HX9A 3NMRA 2X1GA 3JSYA 2UUTA 2Z0GA 3CCES 3D9BA 1NSLA 1NLKL 4ED6A 4ZVFA 2ABYA 2PEHA 3GIJA 2RSQA 4DL5A 1YI2S 3OLBA 2F40A 5KT6A 5AJ3J 2NR0A 3QT5A 1Z4UA 4NPOA 3LGNA 3CJRA 3MEGB 3UN5A 1X10A 3G2XA 2WB4A 1YZ7A 5IC6B 2YNFB 2E7WA 2WYRA 1M0SA 4NA1A 2FY8A 2M7SA 1IOFA 4WFBQ 2QYCA 5HMXA 2DGTA 1B6BA 5T7LB 3MFIA 1PJ5A 1B7YB 3FF3A 1MN9A 1HWUA 3J7A1 5DJBA 5C2GA 1JLQA 5F8JA 4M5HA 3DLEA 4F6AA 4QJVA 4ZJQA 4LF6J 1KVKA 4EYIB 1FTCA 5LL6d 5KFXA 3I87A 3QQCD 1KOOA 5J2QA 1G3OA 4MHPA 3R5CA 3BM7A 3THVA 1S99A 2B7BB 1JKHB 5I3QA 1KONA 2K06A 1R27B 4CI0B 2VXKA 1X4HA 2WSCC 1SUQA 4K2JA 3OVSA 2ZH9A 2CA9A 2HHUA 4JV0A 2I5JB 4FKYA 1XJOA 5J2QB 2R7TA 2ZKUA 4I2PA 5AT1B 1RWWB 4JI5F 1M4LA 2CNMA 3DCAA 1HBNA 3WC6A 2OSRA 3LWMA 3KLHA 1VRUB 1XBWA 4X4NA 3AT1B 4QOTA 2DNZA 3VHQA 3KQZA 1WEZA 2DNHA 2XSJA 3DMJB 4DUZF 4LF5J 2HNYB 2MKIA 1GMVA 3L09A 3W91A 2HHQA 4UZCA 4ZDNA 1ZZNA 1YGHA 4RW7B 4UF4A 2PEBA 2F8MA 4AG7A 2A1BA 2ZEMA 4ED5A 3FKBA 1QUPA 3M1VB 2XY6A 3AB4B 3HPOA 2MKHA 2NXCA 3JQJA 3CCUS 3MPUB 3T1YJ 1FRIA 3BS9A 2OZHA 2XC9A 3K0JA 2KZMA 3H8FA 3JSBA 3A3PB 2VH7A 1CP6A 4PWDB 2HQFA 1RISA 2AFXA 3J81j 2NZCA 2UXCF 1H73A 2LQBA 1EB0A 4X2BA 2GLFA 2R1IA 2AW0A 3GCWP 3ZZOA 4J3GA 2RNEA 3ZZYA 2R8HA 2OH2A 2YTCA 4A37A 3KUGA 1RCOB 4EO6A 1FI4A 2MSTA 2BA9A 4XNHC 1XRYA 2P6EA 3F41A 4WF9Q 2VG6A 3VQTA 4KV8B 1LFPA 2EVNA 4RUCA 2V6AA 2AGOA 3KMSA 3D0HE 4B3MF 1SQHA 2XZDB 1FJ7A 2RIJA 3R1HA 5C7PA 4EBEA 4R76A 3GY9A 4PUOB 2G0BA 1S1VB 1JXEA 1OO0B 1HMVA 4JZ0A 2BV3A 1RHRB 2BRKA 2LVWA 5AG6A 3UD5A 2I6WA 3KMQA 3J7AN 2JFDA 4MIWA 1S97A 1KSPA 1XR7A 4YHHF 4X8IA 1VRUA 2V8PA 3CIMA 4LIRA 4BS2A 1IXKA 2DIVA 3H0PA 3S9NA 4OIDA 1RYRA 1JLBA 4K7QA 4OC0A 1UL3A 1QQ9A 2LFVA 2M2BA 4XAKA 2QMXA 2G4BA 3K58A 2M3DA 1I5OB 4HEA9 1DTDA 4RR5A 2UVWA 3NAHA 4DS5A 3ZZTA 4DQSA 4DR6F 2A2CA 1K73T 4PABA 4IG3A 2KXNB 3TX8A 5HROB 4I4BA 4A94A 1VQYA 5AG5A 4OZNA 3FCVA 1JQGA 4AVBA 3CGIA 3IIBA 4KZTA 2K1RA 1MMLA 2GAHC 4X66F 2VKRA 4LQGA 1VOMA 1Q0NA 4DL6A 3DLHA 4USIA 4UW2A 3M8ZA 5EMIA 1AZSA 2AIRB 3IBWA 3HHLD 1JJHA 5MLCV 1B0PA 2NUHA 3CD7A 3C16B 1UA0A 4KVME 2ZOMA 1XR5A 1S7LA 2GZOA 5DLGA 4QIFA 2DH9A 5LRJA 3T5HA 1H38A 1Q78A 1TL7A 3OL9A 1HW9A 4HNXB 3NNAA 4P71A 4DNCA 2Z58B 4B5PA 4B3TJ 3VVUA 3UNGC 2Z57B 3R2DJ 2JEVA 2DJWA 4KHMA 3GJRB 4L72B 1NMTA 2C6GA 3KHLA 4E8UA 1UVIA 2WCXA 2FLOA 2NREA 2BJ7A 5I3UB 3CE8A 2PT0A 5F47A 1KHWA 3E3XA 4ENOA 4LT6A 3K9UA 3RU0A 4CS0B 4OP4A 1SPBP 2XMVA 4ECWA 4F2SA 1NM2A 4P6YA 1TUVA 3KASA 1R6VA 3CD5A 4MKBA 4LIWA 1NJIT 1LOKA 4A8SA 4LFCJ 2DNMA 4MCSA 2RVJA 2HHHF 4X4SA 4C7QA 2VQFJ 2RMLA 4NXNF 4FPIA 4MAKA 5THWA 2HBRB 3EXNA 3D0GE 4ANEA 2WHOA 4FNIA 1SJ3P 1Q8LA 4ZPVR 2WONA 2YH0A 2W24A 1V0CA 3BQ0A 5AG4A 2FJDB 2MPUA 2ZOFA 3RAXA 1T05A 3ZTSA 2E5HA 3HJVA 2AWZA 3QT8A 2B8QA 3FX6A 3MECB 3VARA 1L3KA 4IHMA 3AJ1A 3CSKA 1V3RA 3CDEA 3C2PA 3VATA 2FHMA 3NWRA 3M30A 2IL4A 2FT0A 2VQEJ 1SVDA 4AE5A 4RBTA 3VAMA 3KK1A 1CPZA 1R0CB 2B9EA 4FS1A 3U7JA 2OPRA 3PB4X 5F8GA 4LF1A 5KFRA 1ZG9A 1U6ZA 1S0VA 5H9FJ 1H0HB 3ZTPA 9ATCB 4F0YA 1SQGA 4EUVA 1ZETA 4QUSA 2W2NP 4WJBA 4DF4A 2HBYB 3CC4S 3ZNJ1 3M8RA 3MI7X 3WR7A 4TYAA 2ZC4A 2FDNA 1LWCB 2RJZA 2ADCA 1NSQA 1RQ0A 3TYTA 1RUSA 3D5MA 3ILIA 5BJRA 3RO0A 2B4PA 1Y7RA 3SDEB 3HP6A 3EXYA 4MI4A 2JLEA 4DR5F 5FJ4A 2R2TA 2BQUA 2CPZA 1IKYB 3BF4A 4MFBA 4KQZA 3MM9A 4RNFA 2YNEA 4ZVOB 1ZZFA 3ZJ0A 3FBCA 3KLGB 5MAOA 3TVZA 1Y11A 1HQEA 3MAQA 2ASLA 2HVDA 4A8QA 2P0WA 1RBOB 3Q86A 3F0AA 1FKPA 5ETTA 4XPDB 1GT8A 5IXUA 3IG1B 4DV2J 4F2RA 1KEKA 2FHOB 1S1VA 4C8KA 2QSWA 4KHRA 3MMJA 4MXUA 4LFBF 2CWKA 1U24A 2G2OA 1XR6A 1Z4EA 2YWKA 5ETRA 3MR2A 1NHUA 3DRRB 3HLPA 3CJKA 4ANDA 4OC3A 1TL1A 2OGUA 2CQHA 1PJ7A 4NYOA 4JJXA 4OI4A 1GXLA 2CIMA 4DSIA 2LU2A 1YJVA 4S0MA 4USUA 2B3TB 3VZIA 2E9ZA 2HV2A 3B6BA 4K4SA 2B4VA 2CZVC 1AB8A 2KM8C 4GKJF 4IKAA 3MR3A 4KKOA 1PBAA 2XYHB 3FBUA 3SEOA 1FRHA 3GIKA 4Y0FA 2P6FA 2G2ZA 1FFWB 1RDRA 3CPAA 3KK3B 2AEFA 3JSRA 1G6BA 3DLBA 4DL3A 3DNCA 1OIAA 4OZLA 4G6VB 1APSA 4CLZA 4UTGA 3BO3A 2O53A 1FO1A 2L9NA 3KUEA 5H9FK 2J8RA 2FJAB 1YRTA 2YQ3A 3L2NA 1MNEA 4USHA 5CQGA 4KFBA 4CLTA 3OBIA 2Q7BA 4KORA 4AVCA 1HBUB 4K4YA 1GH8A 1IY7A 4ZLPA 2C3YA 1OSCA 1WG5A 1HNZJ 4AB7A 2MLYA 2E44A 5E5NA 4CLFA 1HWJA 4NWBA 2RH3A 4CYQA 5HMWA 3R1LA 2HAFA 5E2QA 3KJVB 1BWVA 1QSYA 1CX8A 4L3KA 2HG4A 3SI0A 3V6DB 1UJ4A 3F0NA 3D6FB 1XMBA 1ZOTA 2PDOA 3QFHA 4GO5X 4Y2IA 5G0RA 2ROEA 1ZM2A 3G8QA 3EGZA 2JLFA 3UR0A 3RR8A 3CB4A 3KJQB 4A95A 3M8YA 4UUWA 4NLSA 4K50A 5KG1A 4DU7A 4DR7F 2J0QD 5BXIA 4WTOB 3BEGB 3FBFA 2VQEF 3KXDA 3B3CA 3SXOA 3CJ3A 2VQFF 3DNSA 1HQUB 1JK9B 1K0VA 5L9NA 2SXLA 4TKTA 3JQKA 4OHXA 4I67A 1RWKB 3BLNA 4IO1A 1KTVA 1SIWB 4ZX8A 1SC1B 1V3SA 1VRTA 2Q66A 4PPDA 1FT8A 4OZ2A 1LANA 3CCSS 1G4CA 5E3PA 4F67A 4ZLJA 1EJ7L 1LRZA 2F63A 4MFKA 4X66J 1MU2B 3OPKA 2JNJA 3Q83A 3TO7A 1KFSA 3HVAA 1VGYA 3MMCB 2NXJA 1DFDA 1IUJA 3QO9B 4TNUA 1MW7A 4FKXA 4P73A 1J5EJ 2C6CA 4LSZB 4WZMA 1FD8A 4CO0A 4NX9A 1SKWA 2V9WA 2ILYA 4DX8H 3ZTQA 3LP2A 2W4PA 1QY7A 3I82A 4F25A 3D4JA 1S1TA 3D7HA 5ETSA 1ZG7A 1UZDA 1SBRA 4ECXA 1JNZB 2R7XA 1S76D 3BSOA 2HWHA 1YWXA 4LBPA 2QYGA 3PVXA 3BGUA 4A8WA 2WBRA 2J6TA 2XM3A 3R5DA 1NKEA 4EVYA 4Y3CA 3V6HA 3K57A 3H5SA 2YWGA 2PJ5A 1Q1KA 2ZKTA 2XYGB 2MY8A 3HKWA 2EFPA 5L9XA 4USVA 1C0TB 1DLOA 3FCWA 4ZX9A 3ET6B 4OJGA 1IYKA 4YN3B 4EMDA 4KGVB 4ZIVA 5A6PA 5C88A 4H4MB 4ZVEA 2ZEGA 1BD6A 4HH1A 2M5YA 1IU8A 2J0WA 4O4RA 3FCHA 3MR5A 4LQ3A 3KR4A 1Q8KA 4WXOA 3KKWA 4BINA 2W9AA 3PIPQ 4ZPTR 4GKJJ 3NA6A 4FP9A 3BBFA 8ATCB 4USKA 3MCMA 4J90A 2JEWA 1DURA 2JC0A 2OR4A 1RAAB 4NI2B 3NAIA 4F9VA 2EBJA 3F5BA 1XOVA 3OVBA 4NRTA 2ANPA 1WELA 5LSRA 1X0FA 2OZUA 5L1KA 1NPRA 2H65B 1OYDA 3ZNUA 1LEOA 3EDQB 8CPAA 2AJFE 4OZJA 2YX7A 4NCZA 2MKCA 4IFVA 5HH1A 4DX7A 3NG8A 2GQQA 1HDQA 2GX8A 5JGFA 1T05B 2MYFA 3B4MA 3ZTRA 5AE2A 1HNVB 4J9LA 2RD5C 3AOAA 3T1HJ 4N8OA 4J9SA 4K59A 2R8GA 4E2FB 4F4KA 4CRYB 3CXPA 2Y1JA 3QGHA 1SV5A 3TFYA 3TEGA 1S9EB 3KK1B 4TQSA 4ID5B 3D7FA 2IM2A 4DSEA 2W1BA 1OY9A 3PYFA 1JJ4A 1QAJA 2JC1A 4PXDA 4DQIA 2AHOB 1N8RT 2HFUA 2XI3A 5KT3A 1FNMA 2UXCJ 4K4WA 1C4CA 2HHTA 3M6XA 3ZZZA 3I56S 4ZY1A 2GHWA 2HVHA 4HACB 1LW0A 1WJ9A 1LKZA 4QPXA 4FZVA 4UWJA 4QIGA 4KPCA 5AXKA 3RB3A 2Y8WA 5B0GA 2O4HA 3NEKA 2LLZA 3R2CJ 4LJMA 2LMIA 5IQQA 3JUWA 2GGPA 2ZVIA 2XS7A 2DEJA 3EMTA 2V63A 2ASYA 2V2ZA 4C98A 1QUVA 1PU9A 4QIEA 5IB0A 1T03B 4DPOA 1VHOA 4DF8A 2MY7A 4EYHB 1JLCA 3ISND 5L1LA 2W25A 5L1JA 3QWUA 5CZVA 3ZZIA 1EZZB 3BKFA 1S6UA 3VCDA 3W5YA 2BE2B 4WP3A 2DNRA 4N41A 4L6V3 3BR8A 4FBEA 3VF0B 5KT7A 2BJ3A 2R8KA 3SI2A 3PRBA 4R6TA 2GVDA 2WSAA 4NZ0A 1GX5A 4DQQA 1F5BA 2IYIA 4HDHA 4EZ9A 1P1LA 4ZYQA 2JFKA 3I9ZA 2F8EX 3GFZA 3QAYA 2IC3A 5HLFB 3H20A 5IV3A 1VIOA 4CYUB 2N7CA 4J9OA 1X9SA 2PRBA 3MWBA 2QFJA 1NK6A 1SJ1A 3RG6A 2AFOA 4C6AA 3H42A 3PKYA 4P74A 1KWMA 2OKQA 2KVQE 2ZNYA 2AZ1A 5CD4A 3GZ7A 2CQPA 5HANA 4P10A 1GQEA 1IM6A 3PGPA 3H2UB 2W7AA 4ZN1A 3W3SA 3EZ5A 3PY8A 1GYTA 5J1NA 2EI5A 3KL9A 2BQ3A 1H2TZ 5U47A 4M5JA 2HWTA 2HBZB 3MD1A 4UZBA 1FRKA 3MAHA 4A8KA 4CWBA 5JM6A 2K8GA 2QO3A 1OYEA 2XULA 5E7OB 4LRDA 3NCRA 3KFWX 3LALA 3HSZA 1U1RA 4E0DA 5LYFA 1RXOB 3TAQA 2GIQA 1FXRA 5DQHA 4C7HA 3BR9A 5KAKA 3T19A 2BUEA 5F9NA 3HHKA 1OSDA 5CYQB 2RQKA 2FE7A 5KFJA 1QSOA 1LW2A 2YVSA 1VHIA 3P2FA 1UFKA 1Q8IA 1PBUA 3AAWB 3AFGA 4H4KC 4ONWA 1FF2A 4LR7A 4URGA 1Y7EA 4CYPA 4I69A 1EHWA 3FIXA 4U9RA 2CUYA 1RAGB 2XNQA 2CNOB 4LF9J 2CTCA 4WFAQ 4FYWB 3J7YI 1S1TB 5ETLA 3TAMA 3PRDA 1Q2CA 2DNQA 2PJ2A 4ANCA 3OTEA 5F3ZA 1XJWB 1R43A 5H1SV 1NE9A 3Q8UA 1LOUA 2C2DA 2BJDA 4DPYA 2XMTA 3EGVA 2CNTA 1VQ5S 1B0VA 4B6ZA 2DYAA 3S7RA 2GW8A 3B54A 1OBRA 2WVEA 2NZ4A 3HUVA 3N5FA 2JZ5A 3DYAA 1F3VA 3PM9A 3UPFA 1GTHA 5KG4A 3MHYA 2FVQA 2CY2A 3ICLA 4RS2A 1KLMA 4OV6A 1N52B 1T3NA 2OLWA 3BKTA 2BJ8A 1YX2A 3BGLA 1HL6A 3CIZA 2MLZA 1H8LA 4DV4F 2GMJA 3MM7A 3SV3A 1FKOA 1FKAF 4FF1A 4UBRA 5HP1A 1KBRA 4V1Ak 4ALZA 3R3TA 2HHXA 2ZHOA 3OHAA 2ZE2A 3POTB 4ZVQB 5KG6A 3H2LA 2CQGA 4L75A 4PG4A 3LQVA 4RW6A 3OR2B 3OL6A 1SQFA 1LV5A 4AL5A 1Q16B 3CCTA 1YG0A 4X2TA 3GYAA 2JLMA 2GVZB 5GAHU 1U6BA 3E2EA 3TQEA 2QMWA 3ZZUA 4DG1A 2RC4A 2YQ1A 1FXDA 2DH7A 2UVRA 1LWFB 4ICLA 1U02A 4DFJA 5K20B 3MEKA 5F9LA 1H2UX 3NCQA 1URNA 1ELOA 3NBPA 1CP7A 4YRHA 3PJWA 4DV0F 1GK8A 1GMWD 1C1CB 4EMEA 4PG6A 1FEHA 4JI0F 1NB2A 4XDCA 4NGPA 1OY8A 2V67A 4N8NA 1YMEA 3JSMB 2B9WA 2CNNB 4HNWB 4Q45A 3WC0A 4NI2A 1Z2LA 3DLGB 3KNGA 4K0KJ 4PXCA 3FEXB 3NP5A 1P27B 3CPXA 4HHJA 3FJUA 5KFWA 3V2UC 4MJ8A 4JI7J 3E01A 3VAGA 5CABA 3H4QA 4P9SA 4I6YA 3K59A 5HVGA 1PGZA 2O67A 4C7IA 1U2CA 3RW6A 1XMQF 3NWGA 1JLGB 1FX2A 4ZP7A 1VHSA 2Q79A 2FJBB 1ICEB 3ZTOA 2E5LF 1NRKA 1TP7A 4MTPA 2CQ3A 5LMUJ 3B7IA 3GWCA 4F4YA 4O23A 2FIUA 5KFQA 1JNRB 1S4EA 4EGLA 4OZ0A 1LW2B 3MR6A 1UFLA 4YQWA 3M9NB 5D0RA 2HIQA 4H6ZA 3GTYX 5EDWA 4OAEA 3FSXA 1U4BA 3FEZA 3V4IB 4B9UA 1N88A 3N01A 2EEYA 4QW9A 4Q8FA 1ZO0A 3U1LA 2XS5A 2RFHA 4IFYB 1LXNA 4F3QA 5HMZA 2DCLA 2KYZA 2QT7A 3TZYA 5HROA 3FMCA 3J7ZT 1MWYA 4PXEA 1RABB 2CYYA 3KHGA 4C3LA 2FJXA 3SBMA 2GU2A 3W5ZA 4V19J 6CPAA 4BHQA 2E1AA 4RW9B 5KFDA 1IKWB 1VHFA 2FXFA 4IFVB 3DGPA 2KM8B 4QWDA 4X4UA 4OJ1A 2GMHA 5KFSA 1CVJA 1VRQC 2HQDA 3MM9B 2QA4S 3T41A 1HNZF 2F8HA 3BI0A 1OMSA 4P45A 4OZ5A 3S1TA 3MM8A 3CCZA 1F60B 4ONUA 1SJRA 4KUAA 1RKJA 5KTCA 1VR6A 5C82A 2REFA 2YY3A 4P4IA 1EX8A 3NXZA 4GVBB 2I8EA 2FQQB 2Z3PA 4M8LA 2DY1A 3EVMA 3GYGA 2J7WA 4E98A 4DR3J 2PA3A 3HK2A 3TZWA 2EWBA 3NS5A 4CZCA 4HT5A 2MZJA 4KPYA 4TN2A 4WU3A 2HS3A 2MZSA 4IR1A 3QSIA 4DV6F 2BRLA 1BHNA 2B7CB 3HT3A 2WBMA 3ZXWA 4KGXB 4CYNA 2GLJA 3GQCA 1OJ4A 4DLEA 4W90B 2EG1A 4TWEA 4B10A 4P4DA 4K4TA 1FE4A 1YW6A 2QA1A 4L89A 2CTBA 3OW2R 1MK4A 4OV1A 1RT4B 2H1YA 1XWLA 1VYAA 3DRSA 2B4DB 4ZPBA 4MYUA 2PIYA 3TJAA 1AROP 2MDAA 5DS0A 4B02A 2D4OA 2OH1A 2ZH5A 3K5PA 2PO4A 3W2WB 3V6KA 1KLNA 3KZWA 4DJLA 3ENQA 1LCPA 2H51B 5G1ZA 2LECA 1XBUA 3UFCX 3KUHA 4AXIA 4A8MP 3QNWB 1JX4A 1NO8A 2RDDA 3T3FA 3CMAS 1M1KT 1DARA 5DO2A 3QJPA 3H2VE 2MEWA 5ADZA 2R3VA 2MGZB 2CQ4A 4MRIA 3U27A 4C48A 1AXQA 1TMJA 1HARA 1YREA 1YRXA 1UW9A 2B4BA 2IVFB 4F0KA 1Z8XA 3NY0A 4GMKA 4U7UK 1R3NA 1PYOB 2KVIA 2OELA 3MMBA 2CIJA 2GREA 2VBQA 1S7KA 2DRDA 2FHJA 2LKZA 4ER8A 1S4FA 3DLJA 2B0GA 2K3KA 1CJTA 4B9TA 3VVTA 1NPKA 3MZIA 5F8NA 3MOZA 4Y00A 1KVIA 3DLKB 2A2DA 2KH9A 1VS3A 1J5OA 3W1YC 4A31A 4CGOA 2DH8A 3ONQA 4BC7A 2YKAA 1F9EB 1T9WA 1JWQA 5D0GA 4NL5A 3RB4A 4GKKF 1NEEA 2OPPB 1IJFB 3CNQP 2D3O1 1RWOB 4PK3A 3IXQA 1FA0A 2YX1A 3CCRS 2F4VF 3PJXA 3IWEA 4FNHA 1CULA 2VUGA 1WI8A 5HP1B 1UVNA 4ES1A 5ETOA 3QAEA 1JJCB 2FVPA 4J9RA 2AJQA 2XMMA 3OL7A 1KQKA 4JYAF 5KFMA 4NLGA 1KQSR 3QMQA 3KLGA 3G6VA 3I4PA 3MM8B 5A8WB 4HI1A 4IRCA 1YR0A 4J5OA 3BJYA 5BR8F 2XMJA 3TAPA 2V2VA 4JI8J 5D4LA 5IWAJ 2CPIA 3UR3C 4JI7F 4KT0C 2OD6A 4P2SA 2EK1A 2GQCA 2CQCA 3OLAA 1HI8A 4WFXA 4A8FA 4K2XA 2Z2LA 3QPIA 1HI0P 3BSNA 4HKQA 1HHQA 1S7HA 4BWJA 2VPXB 4C11B 4TLRA 5C25A 4YMEA 4UOGA 2PJAA 3I31A 4ECZA 2ZBCA 5KG2A 1K44A 4ZOSA 3CD0A 2MKSA 1N4LA 5KFOA 4ZCIA 2KJVA 4C2YA 4Z37A 2AKWB 2ABZA 1W7WA 4A46A 4CNYA 1N6QB 2BJEA 1RT3A 4JV5J 4P4FA 1WC6A 4M3SA 1QE1B 5DWNA 4NLPA 2DPJA 5KFZA 2CKWA 1SXLA 4M5LA 3IGNA 3DXSX 4ZP9A 1VC0A 2B5JB 2CPYA 4UEZA 5EWGA 3TEHB 1F9HA 2YBVA 4KOXA 3KJFB 4A33A 3BPDA 2XO7A 1S12A 3I1UA 1NJXA 3M05A 4BWMA 1KTQA 1NK7A 4DV5F 2AEMA 4OI1A 2VL1A 2VPZB 3NMAA 4F3MA 4KKOB 1XNQJ 2YNDA 5KFIA 3Q8QB 3MCOA 1X4CA 4PWUA 4ECUA 1HWIA 2H5IB 3S6GA 1CULB 2LCWA 1KOHA 4QU6A 2C3UA 3TZXA 3P49B 3OXGA 2XS2A 2QLWA 4F36A 1NK0A 5LM7E 4Q2MA 2R7VA 4OHWA 2D69A 2KO1A 2VB6A 3WX4A 2ZW4A 2YNHA 4M5KA 4B14A 4UT4A 2QC3A 2DHGA 1TKTB 1Y5NB 4NEXA 1SC6A 3QB8A 1RT2B 1ZAVA 2YQ0A 5AXLA 4KSEB 1QDUB 4JYWA 2E9TA 3V4IA 3H8GA 5B7WA 2BQRA 4V19X 3HD1A 1KN6A 1PUAA 2RT3A 4B9MA 2YNIA 4RKUC 1WOSA 4IYQA 2C2MB 4O4GB 1F5CA 3NS7B 1HLWA 4U67Q 4RW8B 1QVFR 2OTLS 2R2SA 5LSLA 4OFZA 3JS9A 4ETXA 1DJ0A 4DR4F 4FS2A 2QRRA 2DRAA 2N3LA 1M1GA 2J9DE 1UP1A 3PYGA 4DUYJ 5HBMA 5DDRC 1T03A 2N4DA 4X5KA 5HI7A 1JLGA 4YY3F 3LP2B 4U7UD 3ELHA 1LNQA 5HSPA 1TFYA 4B5OA 4OZ3A 3R1KA 1E6VA 4K8RA 3LP1B 2APOA 4J9VA 1VK8A 3LGHA 2OSQA 3H8EA 1XN9A 1HWLA 3BDPA 3VV2B 3DU5A 4DYOA 4TU8A 3K9TA 3KQXA 5GAGU 4BLGA 4CGLA 2E66A 4ERDA 4OLLA 1KS2A 2R7RA 4KOWA 5AE3A 5HN0A 2YXLA 1BO4A 2B4OA 1KZFA 4AT1B 2EW9A 4QU7A 3FEDA 1N32F 2GAGC 5D0EA 3PKMA 2HVIA 4DLGA 4MCRA 3CC2S 4JI5J 1HYSA 2DCUB 2PA8D 1KUYA 3Q23A 2BE2A 4HTJA 4YEAA 2FUG9 3OWCA 5C2CA 3CEDA 2ALZA 6AT1B 3C66A 5KFFA 3OR1B 4W98A 2NXUA 1A9NB 5EX0A 5I42B 5F8IA 3BGOP 3W9IA 3AJDA 1CJUA 1J4JA 3LW5C 4HPSA 1NDLA 2RU9A 3JAMU 3OR2A 4R8FA 2QA2A 1RAIB 3L95X 2ZZNA 1FFGB 1S49A 1QSMA 4MBUA 3BYRA 4CLPA 3U02A 4ZCKA 3FC9A 3DM2B 5M2PA 3T5LA 1WKLA 4NGNA 1PILA 4H4OA 1FX4A 4DV3F 1U0HA 2J7KA 1NSPA 4RWWA 4TQRA 4W4MA 5DDPC 1RHUB 3G87A 2G13A 3D8PA 2Z56B 2Z11A 5C42A 2CWXA 1CSJA 4ZHRA 1MWZA 5BWAB 4LBHA 2BZ2A 1CQMA 2MGZA 2YKPA 1A2ZA 1X9MA 1LXJA 1PJ6A 3NRBA 4DXLA 3D3BJ 2QECA 3K7RA 4F8ZA 4PQUA 4B11A 1N54B 3FFIA 3W61A 2KRRA 4KGMA 1E6VB 1S79A 1I51B 2NXEA 3EFAA 2J8NA 1T3OA 3BV8A 2L9WA 4ZPWR 3PW7A 5KFNA 2IM0A 4J9NA 3AQOA 3KNAA 2VBZA 4X64F 3DI6B 2CG8A 2QN6B 2F9DA 2JVOA 2JLGA 1UAWA 2VG6B 2OIHA 1TL7B 3MGJA 1B7FA 5HVHA 4NE9C 3MM6A 4NYZA 4DV0J 4FUUA 2Z3KA 4TY8A 1HI1A 2VFRA 2X1AA 2K5TA 3O6QA 4UCNA 5D8NA 4NLDA 4ZJLA 5JXSA 3GV8B 2BUNA 5CNPA 4OLOA 1PYTB 4DPTA 1W25A 3UN2A 2AMCB 1BC6A 4DPWA 1FWLA 3HVWA 2PJCA 2HHHJ 1MG7A 3LWUA 2GO8A 2PD1A 4USWA 3CUNA 1FVSA 4RW6B 4OHVA 5KFBA 1WI6A 1X60A 3EUNA 5A0YA 3FYNA 2ZH8A 2CJBA 2LP4A 3ISNC 3CJ2A 1I1GA 1DE4C 3OSPA 3QZ8A 2XGQA 3BO2A 1H74A 1RTZA 2AFZA 4ZPDA 2E1PA 1U7LA 1I21A 7AT1B 4X4QA 2FZCB 3R7BB 3IA0A 5JVHQ 2WB1D 4KSAA 4GC7A 4RUBA 3FMWA 1L0CA 3PW0A 4CH0S 4TXSA 1FJCA 4JI3F 4C0OC 2O1PA 1MLAA 2UV8A 2V50A 4LREA 4H4OB 3GE9A 3TX0A 4ZVGA 2G0CA 3M2RB 5KFYA 2CJKA 2RF2B 3QT6A 2R7OA 1RXTA 2GQ2A 1X5OA 3RZAA 3P6YC 4HLBA 1S9EA 2Q4ZA 3RAQA 1HPZB 2PE3A 4DR7J 4EFAC 1XQIA 2C27A 1Z8TA 3MMAB 4G1QB 1HNWJ 1YX0A 2RF2A 1Q53A 2R2UA 2KKHA 3OTOF 1FJEB 4R0EA 3S6EA 1N6QA 1MU2A 1RWUA 5ETPA 2GV1A 3B3TA 2IBOA 5B0DA 4B9NA 4DHVA 3MPWA 3UO0A 1N56A 2XWXA 4QW8A 4C2XA 4O3RA 3JTPA 1HBUA 2ZJPQ 4KHPJ 1WOPA 2VFSA 2W8LA 1S6OA 2GO9A 1HD1A 4IOCQ 2BCOA 4WTYA 2VODA 1Q8BA 4FXWA 4FXVA 1U1OA 3RR7A 1M5HA 1TL5A 1LWEB 1H7XA 1UPMB 1NZAA 1JLCB 1MJ9A 4KOVA 4IOAQ 2Z2ZA 4U9ZA 4XNHB 4O3OA 1R57A 1VLYA 2X1BA 4DI6A 1N34J 4C8OA 1R7IA 1OY6A 3CDUA 4OYWA 4DX6A 2KRBA 1ZLIA 3HSJA 2CJAA 5FVJA 1LWEA 2PFDA 1S1WA 3BDEA 2FVGA 3D3SA 2MKYA 3RNZA 2RRBA 1QMUA 5GAEI 1X4FA 1S1XA 3TA2A 1P6TA 3TUPA 3R96A 3TAMB 4P2FA 4JI2F 1IBMF 3NNCA 4OC4A 3EPGA 4DSFA 4FD7A 1EETA 2CQ0A 4DR3F 2MSSA 4M5IA 4YR3A 2HQIA 3FZ2A 2ZH7A 3CT9A 3BZQA 2FTRA 5ETVA 3ETOA 2EPIA 2N4CA 1NK5A 3HT0A 1MJBA 2VF3A 2UUCJ 3AHPA 3BJ8A 4R9MA 5GMDA 2IPOB 1RHKB 4Y49B 3VR1A 1L3VA 5AG7A 2IRUA 2BM1A 5IZHA 5F09A 4NCBA 4KGZB 4OX7A 2OPSA 3S9MA 2P9EA 2FPHX 1U1QA 3GJQB 2GANA 2QL7B 3BSAA 3VTIA 2V8DA 3W64A 4FD6A 1IBLJ 1HNVA 2AQ4A 3X1LB 2R7QA 4I49A 3VH9A 1Q2YA 1BLLE 3OTBA 1ACMB 4DSLA 1YQEA 2L08A 2EFNA 2X1FA 2OD4A 4F0HA 3DN9A 2RAQA 2DVIA 3C8YA 1NXIA 2HRTA 2YKOA 1FEEA 2E1MC 1IM4A 3RYOA 4UY8T 1XMQJ 4UOFA 4PRFA 2IQ6A 3RYLA 5F8HA 1JLEA 3MM5A 3CTRA 1IKXA 2AT1B 4DJBA 2WSEC 2YKMB 2FLNA 3HJFA 3FUYA 4QIVA 2IM3A 2OFGX 1GMUA 3Q24A 1H3DA 1RT1A 4RW4B 4X65J 1RBAA 4P44A 4DZDA 2QMLA 5J1EA 2EFQA 3DRRA 3CCJS 3W2WA 3M2UB 4CO2A 3NGTA 2GVZA 4PQAA 5J2MB 1S9FA 5H84A 4OC1A 4AXVA 1S1UB 5IC4B 3W8PA 2I00A 2YNHB 3PYDA 1TZ0A 4CO4A 5GADU 4C8MA 2LDYA 2M4MA 3R6GB 1RWPB 5HAOA 1C1BB 3HSGA 4ZVHA 5LYLA 3AB2B 3HHLB 4WK1A 5KTQA 2ATCB 2I1RA 3VAIA 2DGSA 3VGVA 2M9KA 4O3NA 3CWJA 4RNMA 2HHSA 1TKXA 2M52A 4PXBA 1OWXA 1CJKB 3DOKA 2ZFHA 4YB1P 3SZ2A 2FVRA 1S7NA 1A6LA 2ZHAA 2DPTA 4NLUA 1C0UA 2RUGA 4YB6A 2GIVA 2C3PA 3OFFA 2GS8A 4DR2J 3T1AA 1WDTA 1B3TA 1FWKA 2N82B 3LGMA 2B9YA 2M88A 2B58A 1P0HA 3PHEA 4DSJA 2IM1A 3SJGA 2J8AA 4DV4J 1PC4A 2XNRA 1WF1A 3GFYA 1F6TA 3GB0A 1RU2A 1JLQB 1QTNB 4QWCA 2DY9A 3W2VB 2B3VA 3H8YA 2UUWA 2QVPA 1O6XA 2NPFA 1TTHB 2B5GA 3F56A 2DKOB 3ZZRA 1KD1T 4JWPA 4CRJA 2DNNA 3TW0A 5J8FA 4ZY0A 3TR5A 2CQ2A 1U25A 4ZPAA 1GFWB 5D15A 3ENVA 4ED3A 3JVNA 5LJ3Y 1IWGA 1H6KX 2YNIB 2OTJS 4OYXA 2UUAJ 2HAIA 2EKYA 4NMLA 1KQGB 4Q38A 2PGCA 4IH6A 2IFXA 3V8IA 4IF5A 1ARLA 4NZ7A 1LWFA 1Y00A 4QB9A 4ELVA 5KG3A 2W2QP 1HNXJ 2PJ9A 4JI3J 1HPZA 2K2PA 3TJ8A 1SKUB 5FLXU 1BQMB 3LAMA 3I4HX 2B9XA 2XCPA 4FWUA 5IM0A 1ZM3A 3PX6A 2ZELA 1IR1A 3LO3A 2IRYA 4IDKA 4P75A 3M6WA 3WC7A 1YGYA 2RKIA 1RT3B 5KT2A 1S10A 2CJYB 3D54A 1XNRF 2P5VA 2H5MA 3BQ1A 3KJVA 4NA2A 5IB9A 2WRMA 3R5JB 3OV7A 2LEAA 3FQLA 5L38A 3RGIA 3KJNB 4OI3A 7CPAA 2IDEA 2HNZA 4JI4J 3L9ZA 4TNOA 4X3RA 2EK6A 1LK5A 4I64A 1M1DA 3UN3A 2QL5B 3SCKE 1KRPA 1J2VA 1TR0A 2JL9A 3GJTB 1X7VA 2ZW6A 1OPIA 2HKEA 5A8KA 4FBTA 2DD8S 1TV6A 3MR7A 4OX6A 3VGTA 1VQLS 4JXQA 4JI6F 3LA0A 3EDRB 4L8AA 2EFVA 2HC9A 3K89A 2HZCA 1IQTA 2D7SA 1XE4A 2WVCA 4IOBA 4YWYA 3ENAA 2BACA 3MUTP 3D2PA 1SC3B 3MM7B 2ZOGA 4IH5A 4GM5A 2EO8A 1T95A 2HS4A 4NSQA 3K8WA 3G3SA 3NBPB 1JLAA 2Y8YA 3HFKA 3FJ2A 1S5ZA 3N4WA 3KYLA 4OL8A 1U6MA 5GCNA 1UFHA 1VI7A 2PC1A 4OYBA 2FYXA 1NB7A 2Q1LA 2C3OA 2DR8A 1L3UA 3ILLA 3H5ZA 5EGYA 2XMUA 5EBVA 3D2MA 4WYWA 3W2VA 3MAAB 2XI2A 2PE8A 5E3AA 1U45A 2MQ8A 2RHSB 1HR0F 1CBKA 3EZUA 4JI8F 4BMHA 3NE8A 3GMGA 1XMOF 1CJVA 2KFNA 1FESA 4K4UA 1RI7A 1NKCA 1LAPA 1RADB 5DQIA 4DFPA 4KTQA 1L3TA 1BPNA 4WE1A 3QGGA 5A27A 2F5IA 1M4DA 4ZY2A 2YGWA 4B3MJ 4LF8F 2Z4PA 3W6XA 5LRGA 3RRHA 2RILA 1YLOA 4DZ6A 4CYOA 5L8RC 4IQMA 4I0WA 4KVOE 4ID8A 4F0XA 1RB0A 2WAQD 4NASA 5KFEA 3CC7S 3EO4A 3C15A 5A8RA 1UEVA 2ZM6F 2FC9A 3DI6A 2C6PA 5HO4A 1CJWA 1YJNS 1Y5IB 2P6GA 4JUZA 1Y7PA 3H4DA 2B6AB 2OPPA 1YLXA 4QPTA 3HI9A 2LXIA 1M44A 2LQJA 1NK8A 3W5XA 4LRBA 3AQPA 3OSNA 3QRPA 2BE7D 5B0AA 2VJVA 5DG8A 4BDPA 4J37A 2Q51A 5J1EB 2JX2A 3MMBB 4PYDA 2YWEA 3HMJG 1NZ8A 3W6SA 1ZA1B 2WUUA 4KAIA 5I3PA 1N5VA 3IRXA 4OI6A 1YSJA 1K1SA 2GNKA 4DCPB 1IBCB 4R87A 1HYSB 4CRZB 1P8GA 2CAJA 4I56A 2Q0YA 4W92B 1HFEL 3CULA 4M5MA 3T1HF 2HRUA 1R8HA 1VLOA 2HHPA 3FVLA 3HHEA 2FVSA 4IQXA 3Q8YA 4F3OA 2DGUA 1AFIA 3GUXA 4TVAB 2VA2A 1WSVA 4NZ6A 3OVAA 1G2EA 1YHQS 3B78A 4JBCA 3AA9A 4RL1A 1VQ6S 2UVVA 2VEZA 3W60A 4IG3B 2IHR1 3F44A 1IR2A 1WDDA 2RU3A 3VWDA 2HW3A 2AEJA 2LEPA 1U47A 2HSEB 1IR0A 3FRZA 4WKYA 4N7TA 1DAXA 1UMJA 1NCLA 4X4RA 4HACA 1RTDB 2W8KA 1VIXA 4U8YA 4Q44A 4LF5F 4II9A 2IYGA 4WFYA 1DTQA 4DV6J 5E3QA 4F8RA 2GHPA 3HHLA 3MM6B 3PB9X 4X4PA 2IJFA 5CYMB 4ZCMA 3PIOQ 5F46A 2LQ8A 3IFEA 3IWWA 3JRUA 4N56A 5T14A 2DGWA 2EXUA 3LTOA 4CCHA 1RTIB 2XY7A 3K5MA 4N5SA 4URQU 2YNCC 1RA7A 1RT2A 2I79A 1DQ8A 1YBTA 5K9FA 3WHIA 2XEFA 4F9UA 3VAFA 5KOWA 4KJIA 2L48A 5J2PA 2MMYA 3D6HB 2AFSA 5CH7B 4QWAA 4M6GA 1W2BR 4C0HA 2J5AA 2AJ0A 2XCAA 4LF6F 4EEYA 3KLEB 4DR5J 4JXRA 2NXNA 2OEJA 1X9WA 1IBLF 3OTDA 2G2YA 1S48A 2B43A 4L3NA 3FZBA 1EETB 3LANA 3Q2SC 1AUDA 1C1CA 4HDGA 2K1RB 1Z9UA 3KLFA 4JLYA 4WYLA 4OI0A 1UVJA 3PRTA 2CQBA 2AE6A 3A9LA 3GV7B 3TC8A 3ENWA 1IOIA 1SCJB 2BX6A 3LP1A 4CH7A 3B3VA 2AGQA 4FVMA 2OPRB 3T6BA 3AD9C 3VAKA 5D3GA 2V2KA 2JDCA 2H54B 4RI1A 4P2XA 1RT6A 3UE2A 1U48A 3UDLA 3EZOA 1FKOB 3OXLA 3M32A 1B99A 5AXNA 1VQPS 4BBYA 4LQ9A 5IOLA 4CLLA 3LWLA 4KC5A 4AD6A 1DRZA 1HMVB 1BGXT 3MEEA 4K4XA 1VC6A 3S9LA 3DOLB 1MROA 1WF2A 3DHXA 1IBKF 3RB6A 2BEFA 2CADA 5LT5A 3SXLA 2DNKA 2JVRA 3G82A 5HL7Q 4Q5VA 1F2PA 5A0YB 3QYYA 2VI7A 1K47A 4MCPA 3KOAA 3QO9A 1TF8A 4OYIA 4HVZA 5A8RB 4OX9J 4KOTA 4RNOA 2GIRA 2EFGA 4NA3A 2YKMA 4I7FA 5D78A 3Q22A 2GIFA 4C68A 1IBMJ 1ZTWA 2R2RA 3ILJA 2PJ6A 2UXDF 4QYZK 1GMWA 1WHWA 4NLWA 1N48A 5CD4H 4DBQA 1WSRA 2HEKA 1F0XA 2NSCA 2MKKA 2HIYA 1TKDA 1N0UA 2DB1A 1B70B 4AQYF 1CJVB 2LQ5A 3W8GA 4JI1J 1TXRA 3VZHA 1SL2A 1CJUB 3PTWA 2OPSB 4C0BA 2VOPA 2CPXA 2HBQB 1UZHA 2E5LJ 4X64J 2FJEB 1S7FA 3R6LB 2WSFC 5AGEA 3A3OB 3C26A 3D68A 3FFIB 2PIIA 1S72S 5CHCB 3E51A 4NOHA 1QTMA 4NLTA 2WPXA 3HZEA 5LMNF 2DEAA 3FEEA 3SJXA 3HDSA 5CZXA 5LMNJ 1O51A 4M85A 1BQNA 4UIBA 3IAM9 3HCXA 2GVDB 4C3KA 1RP5A 2AJ1A 4YS2A 5HQMA 4NMXA 4MFZA 3DKDA 1V3ZA 2OUGA 2CZ9A 5D0HA 5I0CA 3E0KA 1HNIB 2G0JA 4O3SA 2GA7A 2J7UA 2H4WB 1Y10A 5HMNA 4OMEA 2D9PA 1RT5A 4PSWA 3KK2A 4UIAA 3B8HA 2V94A 4LVNP 1H72C 2DNOA 1YQHA 4O3PA 1U8WA 4C8LA 1IKVA 2W9CB 3DOLA 3VGUA 4R5PB 4RU2A 2HLUA 2DISA 2CG4A 1K8AT 5F48A 2REEA 2OPQB 5DRKA 2DR9A 5EN1A 1SC4B 2HFVA 1YIJS 2YKQA 2QEXS 4KS9A 2P9GA 3A13A 1D1UA 2GHVC 3CJ4A 1WHXA 4WK3A 2MLXA 2QIFA 4NLQA 1JLFA 2OO4A 3OUYB 2IY5B 1S60A 3MTKA 4C97A 4NFRA 4J9MA 2GJFA 5ELYA 3KHHA 2Y1LB 2FIAA 2X7BA 1SV5B 4K5RA 4F50A 4X84A 3AOBA 4OKOA 3MD3A 2KFYA 1Z8LA 4XTTA 1FNOA 4NXMJ 3W65A 2UVUA 5I42A 3OJUA 3PACA 3TA0A 3LP0B 4DFKA 4C2ZA 2HYIB 1BUXA 2QTWA 2JSXA 1NSKL 2EC0A 2UV8G 4KE5A 2Q44A 1ZH5A 3D66A 5C5JA 4GVLA 4N77A 4DR1F 4J91A 1LW0B 2Z0ZA 3R8YA 3DOKB 3HVRA 4DV2F 1R0AA 3BXMA 1N0VC 3GFHA 4O0IA 2NSBA 3DGPB 1QM9A 4LF9F 2ZWOA 2M8HA 5KTAA 2XY5A 5C24B 2ZC3A 2WK4A 4KVXA 3GONA 2XG8A 4K0KF 2C3MA 1R6YA 1FE0A 3D67A 2K7KA 2AV5A 4L74A 2COLA 2XWYA 4ECVA 3G9CA 3D7DA 4UCPA 1WD6A 3M2VA 1FRJA 4JP8A 3I55S 3CCMS 2DHHA 3DLKA 2L41A 2Q3PA 1UEUA 4A4JA 1R8CA 5KFPA 2BR0A 5F3TA 3JTNA 1WC5A 1RT4A 1ZM9A 4ZIWA 4KLVA 2BJ9A 5J2NA 4PEOA 2IRXA 3FECA 3LUYA 1TF9A 3L7UA 2QGFB 2FJVA 1WHYA 1KQFB 5KFHA 2ZVSA 1DTQB 1I12A 4M63A 4ZS6A 3AD7C 3O3LA 2MJUA 3HHDA 4PWWA 2G1DA 1NKBA 1CG2A 3IR7B 3OFGA 3CJSA 3TOQA 4B3SF 2OJ3A 4P2MA 3Q0AA 4CAFA 4RLEA 3UCZP 4A38A 4IH7A 1AUGA 2ZH3A 3TO9A 3ZZ0A 1O5JA 4U95A 3QAHA 4JD6A 3UI3A 4FD4A 4LFCF 5HMYA 4B12A 2M8DB 3D7SB 4B9VA 4HNYB 5B08A 1H98A 3M6UA 4Y6IA 2PVVA 1K9MT 1BXNA 4Y49C 1N71A 4ORFA 5A8WA 5F41A 3SYZA 4OYOA 3GSIA 4JI6J 2UXBJ 1RWVB 3D4UA 4NF1A 2PQ8A 2R7SA 3BSCA 1NHKL 3TUIC 3GIUA 1O0PA 1RSCA 3JYTB 3MM5B 4FYVB 1D0EA 1FVQA 1ZS6A 4I2QB 1OPZA 3M32B 3U1MA 3PW5A 4CGNA 4LFAJ 2AX0A 4FF2A 1L5UA 1AYEA 2DNGA 3G8TA 4OIWA 3DRYA 3MEGA 3H25A 2JDDA 2R42A 4ICLB 4P4JA 4QWBA 3ITHB 3G6ES 2Q4YA 3LF0A 4PZVA 4ELUA 4RN7A 5ETQA 4DOZA 5E96A 4KGKA 1WTFA 3UCGA 3WT4A 2DPSA 2R7WA 2L3MA 4MHDA 4F4WA 2MQPA 3G6YA 2B6AA 2WW8A 3PEJA 5C24A 3KHRA 4K30A 2PJ1A 3ZO7A 3RBUA 5DDOC 5HXDA 2BKNA 1S6QB 2C2KB 4MY3A 4DV5J 2AYBA 3C16A 4PG7A 3TA1A 1ROFA 1UWBB 3IS9B 2FD2A 3OXFA 2VU5A 5DWMA 1TKJA 2A6OA 5DGBA 1T0TV 3WC2A 4KOYA 1VISA 4CLYA 2VJUA 3AD8C 2IVYA 1WACA 3DDDA 5LSOA 2R9LA 2BEIA 4XPKA 1WG1A 5CYJA 1M5KC 3K5LA 1KLMB 4GRSA 2ZM6J 4LF4F 3BGRA 4FVCA 3H90A 4LF7F 1U0SA 3TO6A 1N5QA 3P4UB 2QFIA 3D0IE 3DLLQ 3NGRA 2DK2A 4NXNJ 3JAMY 1FDBA 2C22A 2YX4A 2O3DA 3CO9A 4FF3A 4QVTA 5LXYA 1WC0A 1N5YA 2J0XA 3B2YA 4UQTA 5CAAA 1TKXB 1D8YA 4Q36A 1HHTP 2HQCA 2YWHA 3PW4A 2C1CA 3C6UA 3SIPB 2UZAA 1C1BA 1UJ5A 3NGKA 3DR8A 2AF6A 3DXBA 4DN9A 5I4MA 2OPQA 4Y2AA 4TU9A 3MOJB 2ZUAA 4O3QA 2ZH2A 1JJ2R 4CO1A 2ZH4A 1HD0A 2NYHA 4OYPA 1FK9B 3PR5B 4B3OA 4LF7J 1NDPA 4DR6J 1O8BA 4ILRA 5HK4A 1VQ4S 1WUUA 4FYDA 3N79A 1RT5B 3GR0A 3T5KA 2DPIA 3QBCA 3K17A 1YVOA 4KV8A 3A12A 3H59A 4A47A 1HNIA 1U09A 2EBEA 2IDLA 2IAJB 4CIOA 4DMZA 1YJRA 1RWXB 5D4PA 4PG8A 1G1XA 2PMHA 1BQNB 2BO9A 3SJEA 4A2ZA 2W7OA 3KG0A 4X62J 2AFUA 2D41A 3ETMA 1I6JA 2EK9A 1HNXF 2NMTA 4WZQA 4H4MA 2ZUGA 3MDFA 1QSRA 3BH6B 1HKAA 4DV3J 3TUZC 2IA6A 4C4WA 2J8MA 1X4AA 3P2HA 3PEIA 3TWZA 3IP0A 3T6JA 5E33A 5K8OA 4OYZA 1ZG8A 1MROB 1J5OB 3T90A 2KFZA 2XO6A 3QJJA 3NGUA 3IG1A 1QD1A 2HQYA 3A8JA 4CLKA 1NJZA 4NCGA 2KXFA 2MHNA 4XPDC 5AJ3F 3FSIA 3P3DA 4ZVRB 4OZ1A 3MECA 2CVEA 2HVEA 3RW7A 4YFJA 4PUOA 3JYTA 1CBXA 4KYZA 3VAJA 3BJ7A 4Z7CA 2CXAA 1F1BB 2ZW5A 5FLXY 2FHJD 2VBXA 3N5BA 1TL3A 3EYZA 5G4DA 2DGOA 2B3UA 4IG0A 3WC5A 3G82B 1JWWA 1RWNB 1ZPVA 4CP5A 2IA0A 3KDNA 1NDCA 2VFUA 4P6QA 1ZPWX 2LYVA 3UD4P 3IU2A 3B3WA 1F5AA 3OR1A 2RQ4A 4GKKJ 3MXHP 2DO0A 3R9EA 1Y0RA 3L3CA 4NRUA 1RJJA 3KGQA 3KR5A 3BPSP 4EBCA 1NU4A 1IKXB 3SI1A 2J9DA 2IAJA 5DZ7A 3W9HA 2KHCA 2BE9B 3Q8VA 2FL4A 1N36J 3KHXA 2XMAA 4CLUA 2W2OP 5FIIA 1EAYC 3D28A 1HWKA 4G1QA 3SCLE 1UEKA 3NFZA 5LXRA 1ULRA 2R8IA 3AOCA 2RE1A 2MQLA 4O44B 2CQDA 2HQ3A 3I32A 3BO4A 3A8KA 5KG7A 3HHLC 3OT9A 2LQ9A 4NEYA 4QR0A 2NYIA 3DRXA 3UDEA 1RE1B 7FD1A 2ZITA 4UCMA 5A28A 3HXMA 1GNKA 1RTIA 2A3JA 2RDIA 5GADI 4NLXA 1M5OC 2DGVA 3JTKA 1FKPB 2HK2A 1F2GA 2IBKA 2ZJQQ 3GYNA 2CF4A 4Y34A 1YK9A 3OJSA 3IMQJ 2LEBA 2ZBIA 1HQEB 4UOHA 4F7VA 2OAUA 4ATNA 4CM2A 1RBLA 3ISZA 5IQ6A 2DEIA 3RRKA 4Z2XA 1KVJA 4RU9A 1QAXA 4DPUA 3KG1A 3Q8PB 4JI2J 2QJ3A 3I3GA 2J6SA 3I5AA 2V77A 2ZEPA 1VQ9S 3KLIA 3AJ2A 1S6PA 2DHSA 1NHVA 2YPYA 1NNDA 2HGNA 3SJFA 2W4DA 1X4BA 3IWNC 3EICA 2VV5A 5KG0A 2E5IA 4PWDA 2AD9A 2OOTA 2ZBQA 5DS7A 4PSXA 1EKRA 4YR0A 2DF5A 4AG9A 3CD6S 1WNEA 2OHDA 2UUCF 3DC2A 3OFHA 3M4XA 3P96A 2Q4VA 3E01B 1UFWA 2BXJA 5BYQA 5CPAA 1U1MA 3HO1A 1TVRB 3OHBA 4P7VA 4NYPA 2NSMA 1UTAA 3I9SA 3DLEB 4TU7A 2BVZA 1XC9A 3FRYA 5FD1A 5AXMA 5F8LA 4IRDA 4AQYJ 4DWIA 1Y3JA 1CJKA 4A8YA 4LRAA 4RW7A 3TARA 2E7VA 1GTEA 2MZTA 4IUSA 2AYMA 3NOGA 4ECYA 1HEEA 2QSFA 2V4JA 1RCXB 5L39A 5D77A 2GFQA 4LRCA 2AFMA 1T94A 4HL9A 3S6FA 1RA6A 4ZP6A 2BBEA 1XNQF 4B9LA 2JHEA 4MFPA 1PO6A 3GV5B 3QJLA 2RHQB 1X8DA 4OLPA 5E3RA 4XPLA 2JH3A 3LPEA 3MPDA 1RKIA 1TV6B 2LXFA 5HQLA 3CF5Q 3DDKA 1LFWA 4DN0A 3H98A 5K8PA 4CO3A 4UEFA 1BPMA 3WIUA 2PJ0A 1PG5B 2IMWP 4RBUA 2ZE2B 3L7PA 3JQMA 3B4DA 3WX8A 2VHGA 3NOCA 4DV7J 4DL7A 4USJC 3V81A 2PMWA 5IV4A 1JLBB 3A1YG 1RTDA 4ZGYB 1VQMS 2FS5A 3K8VA 3D1QA 2ZPAA 3LACA 3FNCA 4WP9A 4WE1B 2AGPA 1EP4A 1VC5A 4JV1A 4UFXA 1YRUA