3IT0A

Crystal structure francisella tularensis histidine acid phosphatase complexed with phosphate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
329
Chain Sequence
b'SKLIFVSMITRHGDRAPFANIENANYSWGTELSELTPIGMNQEYNLGLQLRKRYIDKFGLLPEHYVDQSIYVLSSHTNRTVVSAQSLLMGLYPAGTGPLIGDGDPAIKDRFQPIPIMTLSADSRLIQFPYEQYLAVLKKYVYNSPEWQNKTKEAAPNFAKWQQILGNRISGLNDVITVGDVLIVAQAHGKPLPKGLSQEDADQIIALTDWGLAQQFKSQKVSYIMGGKLTNRMIEDLNNAVNGKSKYKMTYYSGHDLTLLEVMGTLGVPLDTAPGYASNLEMELYKDGDIYTVKLRYNGKYVKLPIMDKNNSCSLDALNKYMQSINEKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid phosphatase
molecule tags Hydrolase
source organism Francisella tularensis subsp. holarctica
publication title Crystal Structures of the histidine acid phosphatase from Francisella tularensis provide insight into substrate recognition.
pubmed doi rcsb
total genus 114
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2009-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3it0A00
2RFLA 5CDHA 2QNIA 1DKQA 1IHPA 2EKBA 3K4PA 4D4LA 3IT0A 2H4ZA 2A6PA 1DKOA 1XQ9A 2P2ZA 2OWEA 3MBKA 1H2FA 3QPVA 5CU7A 3E9EA 4GPZA 3FDZA 4ARSA 2DWPA 3GP3A 3QPWA 3E9CA 3EOZA 1T8PA 1BQ3A 2WNHA 4PZAA 1H2EA 1TIPA 3HJGA 3QPUA 4EMBA 1QHFA 2IKQA 2P79A 3GW8A 4JOBA 1QFXA 2HPAA 2DWOA 2H0QA 3D6AA 3PGMA 2OWDA 4GPIB 1RIIA 3F3KA 4ODIA 5AJZA 1V37A 3E9DA 4PGMA 4FDTA 5AJYA 1FBTA 1BIFA 5AJXA 2I1VB 3BIFA 2P78A 2AXNA 3FDZB 5HR5A 2A9JA 1E58A 3R7AA 2WU0A 2P75A 1UJBA 2EKZA 2P30A 4PZ9A 1FZTA 1SK8A 5AK0A 3KKKA 2P2YA 4E3WA 3ZHCA 5AJVB 2H52A 3DB1A 4D4KA 1C80A 1EBBA 1K6MA 1YJXA 2PA0A 1QWOA 1BQ4A 4MA4A 2YN0A 1ND5A 4ARVA 4IJ5A 4JODA 3D4IA 3OI7A 4JOCA 4FDUA 2ENUA 3D8HA 3IT3A 2EOAA 2HIAA 2P6MA 5CX4A 1YFKA 1E59A 1RPTA 2P9ZA 1C81A 2ENWA 3DCYA 2P77A 3C7TA 3FJYA 3IT1A 1SKAA 3LG2A 1SKBA 4D4MA 1DKNA 3EZNA 1DKPA 4ARUA 2GFIA 1DKMA 4EO9A 1NT4A 4D4JA 2HHJA 2H4XA 4IJ6A 2P6OA 1CVIA 4QIHA 2WNIA 1UJCA 3LNTA 2P9YA 3F2IA 5PGMA 4AROA 5AJWA 1RPAA 3MXOA 3GP5A 4HBZA 3NTLA 5HTKA 1SK9A 2P9FA 3K4QA 1DKLA 2YN2A 4TSRA 1ND6A 1V7QA 3LL4A 3NFYA 1C7ZA 2BIFA 2F90A 3IT2A 3O0TA
chains in the Genus database with same CATH superfamily
3FTQA 1R00A 4OLFA 2JASA 4U3JA 2FZ5A 3F74A 4P82A 4XOIA 3OJWA 3TLKA 1DOHA 1W8DA 2GSWA 5BNFA 1QVRA 3W7BA 4RFVA 1Y8QB 2H6EA 1QV7A 2GYWA 2ZS9A 2ZRKA 4M22A 1GRCA 2PJRA 4LNUB 2EERA 2K87A 3BGOS 3SZOA 1L5HB 4LHWA 2JANA 2XB4A 4R2HA 1M2HA 3SSNA 2BFMA 1Y5RA 2WHPA 4H77A 4PAMA 5GTDA 2F8MA 4BKQA 2VYND 3FNRA 4MGIR 4OBBA 4OOFA 4OHYA 1YKSA 1SUIA 1WS6A 1XKXA 3JRXA 4ZT7A 5SYAA 4LQDA 2W7TA 1OKKA 2QN7A 2G8LA 3ZJ4A 1WXIA 4TKLA 4UNRA 2IOFA 2ZUTA 1E2DA 3Q2KA 4Q3NA 1M6EX 3TX6A 2GHIA 2HEIA 2WWTA 4NATA 4FMBB 4NMMA 4P22A 4HWSA 3ANLA 1QZZA 4XD2A 2MYNA 4FJ1A 1PJAA 3H9GA 4GVPA 4DWJA 4KPEC 4FB4A 1KU6A 2H0QA 4RDHA 2PJDA 4TV9B 3S70A 2WWRA 3ZCPA 5IKMA 3QRWA 1Y34E 5K0LA 2AEEA 2QJFA 5J58A 3TXXA 4RTPA 1TD9A 1N2CA 3EC1A 5TY0A 4OA8A 3WX0A 3FDIA 3PD1A 5G0TA 3ZHOA 1JWAB 1OT5A 3SQWA 1L5MA 1SKYE 1E6WA 3OT1A 1TAGA 3JQPA 1JZTA 3EE6A 2XYRA 3BMCB 1Z06A 3Q87B 3JSAA 4C7OA 3GRCA 1NLMA 4FFMA 1OIVA 2QGZA 4Q9IA 3PP8A 4TTPA 1D6NA 1U0GA 3BZUA 2JLQA 3E7FA 1XTUA 4NXNB 1QP0A 2E18A 4J90A 4FMPA 5BSGA 3CHYA 3EH2A 2FN9A 4B83A 4F45A 3LL7A 1EEHA 3AB3A 1FDWA 2B1IA 2H7YA 2OCGA 3EF0A 3LHSA 2IY7A 2Q0HA 3CX3A 2Q2QA 3DVAA 2P3LA 3U3JA 5K4HA 3WWYA 3LK7A 1A4IA 3M4ZA 3IAUA 4FINA 5AJVB 3NDPA 2YUTA 3RVLA 4LVOA 1G55A 2J9YB 5THKA 3LKZA 4C5BA 3GA5A 1E4YA 4QXAA 1W5AA 3RC3A 4P86A 4XPIB 1YV9A 1N3IA 1G19A 1TUIA 4MRMB 3IUMA 5EKTA 1I2BA 2QAGB 4E70A 1CZHA 2QTTA 4MV3A 4RLHA 3ECAA 3P94A 4B09A 1OAKA 1UPBA 2FSVC 1S3SA 1VGVA 3I6BA 4BVLA 2ACKA 2WIAA 1XRPA 4A9AA 4KQ9A 3NHJA 4QYSA 3OZFA 4ZD6A 4B2PA 1QCCA 1SKBA 2GNAA 4JLBA 3ZYZA 3X3HA 1ZMTA 3NGXA 1HG1A 1OVGA 2JFFA 3GNTA 1WHTA 3KRTA 1Z4OA 5EE5B 3IUSA 1WP9A 3R7DA 3KQPA 3TZCA 1ZX1A 3FH0A 4IVNA 3WQRA 5C53B 3E0XA 3U7JA 2HNBA 5T6MA 1PJ2A 3BSYA 3E9ZA 4D3YA 3SZGA 2OK7A 2P6OA 1G1MA 5IDQA 2O7SA 5FORA 3Q3GE 2UUAB 4WECA 5FUXA 3KWJA 1O6CA 1UP4A 4G5HA 4IFIA 5ILGA 1XLWA 1Y1LA 4A8JC 1LK5A 1Y3DE 1A8UA 2HDWA 1FC0A 3KSUA 4HT3B 5AK3A 1KNQA 1IMOA 1VLHA 3AILA 1GTG1 1F06A 1C8KA 3LU1A 1H3NA 2FWNA 3HYNA 4FR0A 1L4MA 3NONA 1EFVB 2ZETA 3EOBI 3FSJX 3ZZ1A 1T9HA 1ZH0A 1UC4B 2FSPA 1FUEA 3EIHA 3FDFA 3HKDA 2W6QA 4GWKA 2ZKLA 4TVKA 3RS7A 5HFNA 4BFTA 4O4LB 3OX4A 2J5QA 2B3DA 4LY0A 3TBKA 3U40A 1U7UA 3GJ0A 1WCXA 4MLDA 1W48A 4PC2A 4RIIA 4R8RA 2QNIA 1JLLA 3EQ9A 4MUKA 2F9MA 4LMBA 5E6RA 5F9MA 2QS9A 4IGAA 4L5YA 1XAHA 1H5QA 3FHLA 5EQJB 3IAS1 4XGRA 4GVLA 1XUOA 2PMWB 2YCBA 3HL4A 1H2ZA 1GP2A 2NV0A 3A1FA 5HKKD 4YAWA 3FHTA 3N53A 3V8MA 4FT2A 3ZE8A 1HM5A 5HJEA 4HEA1 1BH6A 1PUJA 1XOIA 1IEWA 1ONNA 1HQKA 1KGSA 4LJ6A 1P18A 4UHJA 3C1TA 3D3NA 3HCCA 4GE3A 4H31A 4R0MA 3ENWA 4GOOD 4Q39A 1C0KA 1N92A 5AKYA 5FHQA 2CHQA 4TVSA 1IBCA 2W8BB 4BRWA 3AHEA 1OGJA 3SHOA 5IKPA 4Z9XA 4MP8A 3H5NA 1EX1A 1U1CA 1E5TA 1NL3A 5C1DA 2C7BA 3NGMA 2WZDA 1N2GA 4G65A 5ICMA 5KMGB 4CEHB 2CXQA 4OB7A 3RBAA 3JQAA 5T8KA 3Q41A 1N6OA 2F9FA 1K6XA 5LXTF 4IV8A 1V2HE 4C4TA 5GIPE 1NVUQ 4KE9A 4XDHA 1G17A 1MO3A 1S2DA 2XYVA 3A1UA 1UJNA 1NULA 3A1EA 5EYPA 1LDEA 2O5CA 1R4AA 1WKVA 3QVWA 4L9WA 5A6SB 4E1AA 3ANTA 2V5AA 1H6DA 3EYWA 3K31A 3DNMA 2P75A 2GX6A 2QN1A 1CLUA 1A7JA 1PBNA 2PT5A 2C9BA 1JL3A 1ULAA 4UEKA 3ZHZA 2GKSA 3DDHA 2G28A 4EQ6B 4XVRA 5JU6A 5JARA 4H1HA 5IWCA 3EQ7A 5TSDA 3NM6B 3WHKA 4FN4A 4I1OA 4X1IB 1MXHA 5F12A 3STTA 3W78A 3VR5H 2RB4A 3KDPA 3ZIAA 3GMIA 2JLVA 3UTDA 1TYZA 1H66A 1GARA 3DZJA 5B1YA 2KE5A 2C4TA 4IIJB 6CHYA 4QQFA 4N5MA 5IF9A 2EZ9A 2Q2WA 3NETA 1OZ0A 2FRXA 3DOUA 3NLLA 4NF2A 3C3WA 5TRTA 3ZW8A 3VPCA 4MPDA 4YJ2A 3CUSA 1RM5A 3OJCA 5SV2A 1RRGA 1VTKA 2ZSFA 4XX0B 4YRDA 5YASA 3U9TA 4AIIA 2BGKA 4L5JA 4MQUA 2EJTA 2FOIA 3JR7A 4ZTUB 4RZXA 2OR3A 1N7JA 2O3SA 3BFXA 2FZKA 2JHFA 3AR5A 3ESXA 3PHJA 3ZXIA 2FMHA 2AE2A 3HKCB 3HRKA 3I12A 1B6RA 4F04A 3OPYI 1OZFA 3GLFE 1PGJA 5J63A 3DCYA 5AKLA 2Z4TA 2XUOA 4GXTA 5H59A 5JMPA 4XEHA 1KZ4A 2AMYA 5L4SA 2VAXA 2EIHA 3UXHA 3TG2A 3UCFA 1YO6A 4TTVA 5DULA 4C4RA 3TQQA 1EFLA 3HTXA 1E2MA 1GPUA 2CV1A 2FPSA 2OUIA 2P4EA 2VQDA 1RWOA 4KDFA 3T5BA 3W5HA 3HO6A 1KO1A 2E48A 3IR5A 4HXFB 3JQGA 4FE4A 1THGA 2EJWA 1ZICA 2BGJA 2IF0A 2RH8A 4GQBA 1E9EA 5DWVA 2ZB3A 4UXJA 4G4GA 2A0KA 3B2NA 1IXZA 4D9JA 1N5LA 1GNRA 1P7YA 3AJDA 5EFOA 1NF2A 1HETA 1NPDA 2ACWA 3PUHA 3IDOA 4GW3A 2ZZMA 1U7OA 2YJTD 2C97A 3AHCA 3UJ8A 3CCCA 1P1RA 3PL5A 3BWVA 2OV4A 4E14A 4UE2A 5B1SA 3NO4A 5DSXA 2CVFA 1U94A 4QG7A 3VV3A 3STVA 2GARA 3R3UA 4MV0A 4KXQA 2DU8A 3IDAA 2C7RA 4ZT5A 3R41A 3SC4A 3UICA 1QGYA 2ZYVX 3GHYA 3LTEA 4WJLA 2PXCA 1P0PA 1DP4A 1QS0B 4C20A 3GH3A 5K0NA 16PKA 1O94D 4ID9A 3UMRA 2OFFA 3SNKA 1AMUA 4H6XA 1ZOOA 1SXGA 2RGRA 3S44A 2O4UX 3CF6R 2X6TA 3QUSA 5CNMA 3I72A 1GQ2A 4L02A 1KERA 5DI3A 4B43A 1DNPA 3SR4A 5BOSB 1PVOA 3SICE 3E7XA 5SZKB 2YKGA 3B3GA 3NCHA 1NFRA 4EB6B 4BP1A 2UYYA 3FTNA 3TOCA 3HI6A 3PQ3A 4L4XA 1NPYA 5LP6B 2HR1A 3KZKA 3DMYA 2WFLA 2LP4Y 1W46A 5DSZA 1DIHA 3QMMA 2CF6A 1KAQA 4AJHA 1OFUX 2QJWA 2X40A 1SCDA 1L3IA 1XMSA 5AJYA 1SOAA 4HB3A 5FTNA 2XXAA 4ZZ0A 4PGFA 2MSLA 4UNNA 1U2QA 2V9PA 4KB5A 4YH1A 4J43A 1TGVA 1IZ8A 1IG3A 1EP3B 1HNNA 4UM8B 1KQGA 2DTXA 1E60A 1H8EA 4ZEMA 3BFKA 3AVQA 4TYQA 1EK0A 3U80A 1CC1S 3BE6A 5B3LA 5C1OA 1FCJA 1ORVA 2ZE8A 3E22A 2NO7A 2PKRA 1GPDG 4AUMA 3FSGD 3RYCA 1P7WA 1JYEA 4JSYA 4KSCA 5TPZD 4NJEB 3MAAC 3T95A 3NB0A 4D44A 3QWBA 5FWXA 2WJZB 5T4BA 1U63A 3AYXB 3L8FA 5F5LA 5KJEA 3K0SA 2CZGA 2RAVA 4LY6A 1OI3A 3S40A 2G1PA 1FRVA 1S2LA 1IXSB 5L40A 2Y0CA 3REQB 1OLUB 2QAGC 3DUFA 3MJRA 4B6FA 1IVYA 2O0HA 3JATB 3KTDA 4R40A 5IJXA 5K03A 4R5HA 4TTJA 2FXIA 2GEUA 2H9IA 3KOWA 3QWAA 5JNRA 2ZIAA 2ODPA 4FD3A 5G4LA 4G41A 1HDCA 2P9TA 3JAKB 3OCWA 1M6NA 4O2AB 1EDOA 1NUPA 3AUUA 1C81A 4IDNA 2AG0A 3ST7A 1BYIA 3AFGA 4XX1A 5AH0A 2RGEA 3D43A 4DUGD 1OB5A 3QOFA 1B8OA 1PR4A 3R75A 5AW3A 5C81A 4TXJA 1PVVA 1ENYA 5I45A 4LMPA 4F85A 2QSJA 1KK1A 3A9UA 1VCHA 3VVMA 3FJOA 1M73E 2PZJA 1VLVA 3MWLA 4M8LA 4PRYA 3BIOA 5DEIA 5HMLA 3SJUA 1FK8A 1FPMA 4AICA 2J6CA 4D0RA 4HXYA 4J4HA 4OL9A 1AGRA 5AXBA 1QFSA 1N5MA 1SVWA 3VSAA 4YX9A 3BBPA 5DGXA 4UU7A 3VRHA 4MYSA 2BI4A 2VBIA 4RVOA 2HKIA 4XA8A 3B82A 4G37A 4KBGA 1BJTA 3TVYA 3DZFA 1CUWA 1XTIA 4MWSA 5CFZA 4WJKB 2AVNA 4AG5A 4QJ5A 2VSQA 4L74A 2XUFA 3K4PA 4N8EA 3V42A 4TTTS 2CMDA 1RRCA 2V97A 4RE6A 3JQFC 3H4IA 3GLTA 3AVPA 3P9XA 3TJMA 2WQZA 1ZVKA 4ZQBA 2DQYA 3U13A 3CPHA 1ZD1A 2PX2A 3R4VA 4GBJA 4BIIA 4HNAB 4U0JA 4ZOBA 3U0BA 1R8SA 3ZOZA 4FLMA 1UBLS 5K3OA 3UJDA 4JXKA 4K9PA 1CUJA 3KUDA 2IIQA 3HCFA 3MS7A 3T34A 3GGGA 1T8PA 1LV7A 1WIWA 1YB1A 1RTKA 3F7NA 2HK9A 3QE3A 4KOAA 3W8EA 1Z82A 3P2MA 3AERA 4U7WA 1QAMA 2CNNA 5ALNA 1I5OA 4LNAA 1SBQA 1YS9A 2E4UA 1DMRA 2VF2A 1L7RA 3JZDA 2QWXA 4L5CA 1NXSA 2XA9A 5F7JA 4F2GA 1E3QA 4X84A 4RTOA 1A9PA 3WLNA 4JLAA 4UBKA 3IAEA 4P31A 3D59A 5HUJA 3K1TA 3L5OA 3OHSX 4NTZA 5KBYA 4R2MA 3NAMA 3NTXA 1RIIA 2BZGA 2PGXA 2ZWIA 3N8HA 4U5XA 3VH1A 2OXIA 4KGVA 1NP6A 3VZBA 4KR7A 1SNYA 3KVYA 2IHNA 2ZUEA 3PIRA 2XVYA 1GUYA 2YZ7A 3HS3A 3PS9A 4MQ5A 5HNKA 3C5EA 2GDJA 4AULA 5FOVA 3SG0A 1ACLA 5FV7A 2HHHB 4J91A 2QQEA 1MQ8B 3COVA 3KT8A 5ENVA 2WD7B 3ZE1B 1MIOA 1N5IA 5IAKA 3TYXA 3WL8A 4E4RA 3AR7A 1LLCA 3NX4A 4M1WA 3OFVA 4GAEA 4UUMA 4EP1A 1JHRA 2BFEA 2OZKA 3LCRA 4TYPA 4GX2A 1FVOA 3G8CA 1O6ZA 3OEED 2DCMA 2B9VA 1F60A 1Q0QA 1QSGA 1ODJA 1ZSYA 3GLHE 5BUCA 1Z2AA 2GM9A 3DR3A 4I3GA 4J2HA 5BV1A 5LWQA 2ZIVB 2W0SA 3GU3A 2RKWA 3L0SA 3QNUA 3AB7A 2Z3VA 1V7PC 2R97A 1ZIYA 2XSZD 1SHLA 4LV8B 1P2UA 4W9NA 4M89A 3R0XA 3KJEA 3VM6A 4UREA 3VMFA 1KU0A 2VJYA 3TI7A 1N5OX 3FD8A 3IBTA 4JI8B 1K7EB 2QTHA 4CM8A 1D8AA 1GTJ1 2PZ8A 5DE3A 5FHRA 1A82A 4QICA 1L1FA 4P5PA 2XZOA 4XPIA 2VOJA 1NW6A 5FT9A 3UNXA 4DBLC 3R0VA 1PQYA 1WQ3A 1RD4A 2AI3A 4HI0E 1ZM7A 2UYCA 4DJ5X 4DC9A 5EIOA 3P9SA 1C3EA 1RW4A 4EKEA 3E3MA 3GUCA 2FOXA 1PHRA 1H4QA 4RQTA 4JMLA 1FRZA 2Y05A 3AW8A 1DMSA 3WRXC 4BYGA 2H2FA 3LT1A 1T24A 1G3RA 4PLTA 5ANRB 3RFVA 4YTEA 2ZTHA 3QE2A 4QUGA 3UK2A 1BKYA 4IDQA 2ZK7A 3OF5A 5JADA 1F7UA 1JHOA 2QVGA 3T5GA 3W4IA 1VBKA 5JS7A 1BAPA 1GDTA 4CIAA 2OP0A 3ZUPA 5IVPA 4DKJA 1RAAA 1MNAA 2WDZA 3WNDA 5AM4A 2JFVA 5KKNB 3B51X 3HBJA 1UT8A 1V8FA 1SUWA 2QN8A 3LDHA 1WPQA 2R8PA 1P29A 4G5XA 5EQFA 3WLAA 1VKJA 4AS2A 4CEJB 5AVVA 1CEEA 4IKPA 5FNZA 3WL6A 1K0UA 4BX8A 1FP7A 1OV6A 1SXHA 1OLXB 3IKJA 1YS6A 1L9XA 3USES 3WIEA 9LDBA 1EIZA 3LT4A 1COZA 1VKOA 3CA8A 4JELA 2UUCB 4DREA 1F3OA 1NVVR 1RP7A 1BGWA 1UBRS 2R7KA 2HGSA 3GX1A 4G5QA 5LQSA 1CVRA 3NS7A 2XUJA 4DF3A 2V7QA 3BFPA 2GEBA 5DLDA 1UZAA 2YCLA 2NV2B 4OBWA 3T1HB 4DLZA 1SKMA 2JVKA 1JE0A 1F4PA 3K15A 4A15A 1C8LA 4ENPA 2Q7DA 4M9QA 3TRIA 2RGDA 1RPJA 2G17A 4FR2A 1TYDE 3KS9A 3T4XA 2GCOB 1F8GA 4MVYA 5LPNA 3NI2A 2YZMA 1Y8RA 1UFKA 1YCHA 2R79A 2QN3A 2F3QA 4RKRA 3E9CA 4PE5B 5JVDA 1BQ3A 3S8YA 4PRZA 4BJ6A 4LBZA 4CF3A 1WSAA 1O89A 1ZI9A 5C7LO 4BNDA 1MW9X 4YMHA 2J3HA 4PBTA 1UMCA 2GNOA 4HX2A 3IEPA 3AVOA 3LY8A 1HE2A 5EZSA 3FKSD 4FZVA 5HKOA 1XRNA 1U7PA 2FW7A 4KN5A 4IP0A 4R6XA 5E2BA 2JIDA 4Z5XA 2VDLB 4P5DA 2V5VA 5EJ2A 1JT9A 4FQ5A 4ML3A 5CRIA 2VNIA 5CBPA 2CSXA 3D6FA 3DDSA 3O92A 2QRMA 3PD7A 3V4LA 3WIVA 5IDVA 5CEFA 2ZU6A 3QY9A 1WVMA 3K73O 2N47A 5DTIA 1TO2E 2D1FA 4ERNA 5DBEX 5BN4B 2H0AA 4LDZA 5I7FA 1X8LA 4G24A 1E7RA 4K28A 1G0NA 4FNGA 5I9TA 2GRAA 4PTZA 2ROQA 4GKVA 2NPIA 4IPTA 3RK1A 4RUKA 1DFHA 4OFBA 5K2MA 2X5OA 3ORSA 4CKZA 4HQKA 1RKVA 1G3UA 4OYLA 1TTHA 3ABIA 3IVCA 3S7TA 3VU8A 4TMVA 3DHNA 4JVOA 4QTXA 4YJGB 5F1YA 5EJEA 1ULZA 2PSSA 2WIKA 4ND1A 3E8SA 3H5RA 3RTGA 5KEIA 3VX4A 4ZDWA 4AWAA 1NSFA 2YWXA 3VC1A 4CEJA 3MWJA 4X61A 1R0SA 2VLIA 1M2OB 5D01A 3K0FB 5HF5A 2JGFA 1G3MA 2QUHA 1HO3A 3EASA 2O2XA 4HR7A 4FP9A 4EHAA 1KGDA 4HYTA 1DO0A 1QRUA 1XTBA 3UHFA 3LZDA 4CTMA 2NUPB 2GJKA 3FG9A 1TU4A 2XUPA 1J1IA 5FL3A 4UHDA 3F71A 3I52A 1PEAA 1STOA 2WU8A 3MJ4A 3EW9A 1U2ZA 3TSOA 2ZZNA 5BN4A 1FYVA 3CNHA 5DRYA 3HR4A 4BEBA 1S7GA 3N76A 4RD2A 3BK7A 3K1ZA 3PRYA 1D4ZA 5AVXA 1QDEA 1EDDA 1IEVA 4KKVA 4R0VA 5E1BA 4D42A 1EIWA 2FVYA 3C6BA 3DD5A 1MEJA 4QQ8A 3RV3A 1A7KA 1X38A 1I6KA 3UKJA 2WVGA 3HNPA 4ZMSA 5FPYA 5KOJA 2H1LA 4QBFA 1FTGA 1VLQA 2ZS8A 5BMOA 3HPQA 1Z0DA 1P75A 4OUDB 3OMLA 4UFPA 2HHJA 4MXDA 4X6YA 1QUEA 2FUKA 4IIGA 1GCGA 4BNDB 1XE3A 4PG8A 4F1KA 3ABSB 1W75A 1YK1A 3PFNA 3E3AA 4OK6A 2PR2A 3SMQA 1IPHA 4FYPA 5ESDA 1XAIA 2RI1A 3F49S 3QA3E 4ZK6A 5B3JC 2JD0A 3C3MA 5J4LA 1XBTA 3ZY4A 2Q1TA 4IHJB 4C4OA 4L4UA 2W8BA 1E6CA 2BKXA 1RU3A 4Q3BA 1UWCA 3RTEA 1U4SA 2H51A 5FQNA 4NRDA 1GLNA 3T0GA 5B4UA 3M9XA 3EFBA 1W5EA 4IH9A 4GSKA 4M8SA 5E4JA 3B36A 3EEIA 1IY2A 3O9MA 5GONB 5HF8A 4DQ0A 1GZ6A 3CGGA 1LI7A 5JSZB 1IHPA 4D9GA 3ZY2A 1DDIA 2B2CA 3M2TA 4M1ZA 3PUYA 4GEKA 3WGTA 4Y9TA 4TKMA 1H2FA 1NAHA 3WRYA 6NULA 3VVLA 2YN4A 3LS2A 4RHFA 1UMCB 1SEVA 4RXTA 4CMJA 2ZJ1A 2X2PA 4C0AC 2WNHA 4N0DA 2YUIA 2H1IA 4OB8A 4R54A 4G5OA 5D84A 2ZFUA 1UDRA 4PQFA 2XE4A 4I2NA 2H3HA 2QTCA 5K01A 5C8VA 1WD5A 4PYQA 4P08A 5JJ5A 1SCUB 4D2IA 1M54A 2OFPA 3OZDA 5JECA 4JBLA 3P19A 4ZEVA 1AV7A 1QIEA 1V3TA 3T3MB 8MHTA 2AFHB 1FYWA 3C87A 3MGKA 3ESRA 4P53A 2E5FA 1KI2A 3HFGA 3EJ6A 2OHFA 3AJRA 5U1PA 3WXBA 2FSVA 5KNCH 4QEDA 4P0TA 1ZVMA 5HZKA 2HJWA 2FPIB 4MIEA 3GL9A 2VNJA 3DVLA 4S35A 4A03A 1I1OA 4B34A 1SD5A 4JZKA 3I2GA 3RFUA 3U2QA 1VL5A 4DGSA 1Z39A 3UMVA 3CKYA 1JB9A 1QYWA 1QH0A 2ZYHA 4DCCA 3K0BA 4GP9A 1W34A 2OGZA 3ZE0B 2WF5A 1PEDA 2JGLA 5ALZA 2HQRA 1H69A 4QARA 2YRFA 4PR3A 2VCEA 5HGJA 3WY9A 1EZ1A 1MOSA 4L5IA 4W1QA 5FTLA 2CLFB 1SK8A 2Z08A 1VE9A 1ZN8A 1T4CA 3CRZA 3VZCA 1G8PA 2XQKA 1PL8A 3QEMA 4E3WA 3RC8A 1ZN7A 3EDOA 3QXCA 1Z5GA 4GZ3A 2NQ2C 4KXLA 5KJ6A 4EZBA 3HEMA 2L69A 2HYDA 1CR1A 3DEFA 2CV2A 1FBNA 3G9TA 4YRGA 1HZZC 5C1BA 2E0IA 2UUOA 5L7TA 4QAJA 1SQSA 1AC5A 3HCEA 3IQDB 1UZLA 3T5MA 2AG8A 2R4UA 1F6WA 2XLCA 3P5BA 3RKRA 1E3WB 4KQIA 5FOXA 3UN1A 3YASA 5JASA 1GR0A 3DZKA 3O4IA 5B6IA 4J0IA 2A4KA 2HA2A 2OD9A 4LSWA 3FE2A 2H29A 1CRWG 2OFOA 1MO5A 3GCXA 4I1YA 1YCFA 4LDPA 1M66A 1AU9A 1WSWA 2WI8A 3GI1A 1IM8A 2P27A 2VWQA 3Q3IA 4MR7B 4NPHA 1MPXA 2BVNA 4TS1A 5K0FA 4Y8VA 1A4RA 2EEPA 4YIKA 5C7YA 2GXUA 2CXUA 4IWYA 5KQRA 4LDJA 1F9AA 4MS1A 1XLTC 4AQDA 3IALA 5JAQA 4DE5A 4ZC8A 1WM1A 4WOBA 5EJ5A 3ZY5A 3WTCA 3LSTA 3NBMA 5H0IA 2XBMA 1MC8A 3KSDO 4JN6B 4RANA 5FWDA 3TCNA 4UOZA 3GGOA 1U8XX 2CJFA 2AIRA 1TJ5A 4MR9A 5EG5A 3BRQA 4CL8A 2X6QA 3VSDA 1KMHB 3CX8A 4NS4A 1L5QA 1NFQA 1VBNA 1GCUA 2IYQA 4RVHA 4IEIA 4AECA 1Y63A 2FOLA 4F38A 1FMTA 3TNLA 1TIKA 2QYTA 3ROTA 4EFLA 2BJHA 1IM2A 2E37A 1UMBA 1AURA 2W2LA 3C14C 3Q7IA 3K6KA 3QELA 1H9BA 1EB8A 2XF8A 4NFSA 3UWPA 4FFPA 4IHQA 4P3XA 5JYDA 3A0RB 2ZIZA 3GLSA 1XDWA 5B30A 3ZNQA 2CY0A 3ZI0A 1BDHA 4N5LA 2HSJA 5EWLB 4B3IA 3I04A 2XE6A 4MV5A 3M4YA 1ONBA 1ZW6A 3PC2A 5IDYA 1DLJA 4CQLB 3MVEA 3LGSA 4DYVA 4FIDA 4ETWA 4MCJA 1B8NA 2RBKA 1NWHA 2Z58A 4LXTA 4C7VA 4IDGA 4CL3A 3UT0A 1LPPA 2R4QA 3ZLTA 5IHXA 3ZLJA 1ZOLA 4D0NA 2DLNA 2J1LA 4HEA6 4JX9A 4B3RB 3N0XA 2DFNA 4FGKA 3U7IA 1E3LA 3BHJA 4B79A 4LSMA 5K0BA 2CKDA 3FIUA 1SCBA 3TB6A 2WYUA 3MIZA 1YBMA 3OQVA 2AWNA 1IXRC 2LZ0A 3PQDA 3RDPA 4WNCA 3RRFA 4IJUA 1EFTA 2PPLA 4XWYA 4C7JA 3FY4A 4QDUA 4JR1A 1NVAA 3T7IA 5FWYB 3F3KA 1LSSA 2IZZA 5IYZF 1QKJA 2IUTA 4X7RA 3VR5D 1QONA 1UBCA 3D1VA 3AJ9A 5DIFA 3EUFA 4PNZA 1K9VF 5EKXA 4ZVPA 4CR7A 1B76A 1WWKA 1D1QA 2Z6QA 3DPUA 4YYZA 5JFTA 5CFOA 2YJ4A 2NM0A 2F8SA 3RYFA 3QXXA 1XSEA 2PTHA 3DC2A 2AD5A 1O57A 4ZI5A 1OX6A 1DC8A 2CYCA 1FP4B 3JAWB 4REOA 5CD1A 5DGHA 1NVKA 3NASA 2B1RA 3GCDA 4YXFA 3UHAA 3M6VA 4ZQHA 4YQYA 3R3VA 5LBTA 4OHZA 2ONZA 2PO7A 1ZONA 4LOIA 2RHMA 3IDZA 3EVAA 4RTJA 1R0LA 2XDQB 1P73A 3HCNA 5F1PA 3E3OA 1NKSA 2B94A 1GPAA 2WAXA 3HLTA 4WQMA 3ZE6A 4N0MA 4R98A 4U2EA 4PM4A 4YHHB 3WV4A 1DBPA 3F6EX 2J3LA 6REQA 4Q3OA 3QXGA 1NRXA 1YR9A 4UQLA 1GKIA 4HV4A 5L7WA 5B58T 1SG9A 4PTLA 2AXPA 2YIMA 1GL7A 3DLAA 3D5TA 2GILA 2ZI4A 1TJ3A 3N86A 4XAQA 3LVBA 1N3LA 1YOVA 1XTSA 2FN7A 3GNLA 1C3XA 1M2WA 1RQGA 1WB6A 3L41A 3OF2A 4M9UA 2YZGA 4BMDA 3QX9A 4WA7A 5D85A 2NV6A 5HIIA 1YRBA 1CB0A 3TVDA 3VDNB 5FFMA 5GJVC 1M8JA 4UJ5A 1HDGO 4K5QA 4PAQA 4B7UA 1M83A 3EXHB 5CFLA 3OPXA 3L43A 5KTRA 4MYUA 1ZD3A 2ZBQA 3HJBA 1Z4JA 1OTHA 1VJDA 1I7DA 3AEUB 5IYZA 1ZMRA 2NSLA 5CA0B 4MPRA 3DLCA 1XZBA 1B4DA 2Y92A 1QTQA 1UJMA 3RUHA 5K8LA 5TE9A 4ZCMA 5K6TA 1EINA 1NTOA 1GNQA 5LA6F 4M7RA 3C74A 2AXQA 1J8YF 4LYGA 5U9CA 3I61A 4U0KA 4ZO7A 3CUTA 3JYOA 1DKLA 4JR0A 4RZIA 4U7PB 2QV7A 5DBGA 4BNJA 4BEJA 1M33A 1QFYA 5AVKA 2IBMA 3AGQA 5AHWA 4MGKR 4UNSA 3L07A 4PSUA 3HYRA 5KINB 5T4FA 2NU9A 4DUYB 1CJBA 4L0CA 1XG5A 5BORA 1ZUNB 1ZNQO 2BFPA 4INZA 3WZLA 4B87A 4WBSA 4QXQA 4DOMA 1Y6GA 3NH9A 4MVJG 2A1IA 5HBGA 4C06A 3WK8A 1P4AA 3L9WA 3LC7O 3DWFA 3TQCA 1R5OA 4DA0A 5EIXA 4JI0B 4AMUA 2PMCA 1U9YA 2XDWA 3KQVA 5FF9A 4CEHA 4MS3B 4IV0A 3K09C 4M99A 1A2BA 1H65A 2Q4OA 1VIAA 1Y48E 3H42B 4UVGA 3ZGOA 3PFIA 4L4SA 2C8LA 3ZWPA 3EUWA 1PV2A 4KZKA 2P6NA 4NP6A 1OLUA 1CU1A 4JLSA 4TM8A 1Y8CA 4X7MA 5F7ZA 1DADA 1R50A 1EFUA 3LBNA 3UPUA 3KQLA 2J3MA 1QFXA 4HN4B 2BJVA 1YQEA 1W49A 3H6KA 4Q15A 1U5AA 2YWBA 3TSCA 5JSHA 5FX2A 5JMWA 2DBRA 2EZ8A 3FCXA 3ODGA 2QDKA 4JQSA 5EJ7A 1SPBS 1EUDB 3ZS8A 4DMHA 2BL4A 5KJFA 5KUTA 3Q9SA 3UA3A 3LYHA 1C3LA 2KX7A 3JZIA 2I6FA 3B7GA 1ZJ4A 4RY8A 3RK0A 3M49A 3TH5A 4LJRA 3PA6A 4H3VA 2YRWA 2WABA 4ZVKA 5HA5A 4KX5A 2IW1A 2H4FA 3LOUA 4B3SB 5I7HA 1CUEA 4E31A 5D1NA 4C3UA 1H4TA 2DAPA 2Y77A 5EKUA 1S3GA 4HNTA 7REQB 4AY5A 2YMMA 4IIVA 5DHAA 3ZI4A 2QJTA 5FAXA 1XZJA 3KLBA 3T9DA 4BCCA 2ZJ6A 2ZRPA 1AGPA 4FFWA 4A0RA 1OILA 4P0PB 3R3JA 3CSSA 1CJTC 3QTBA 1U0JA 4RY2A 2H52A 3IV6A 5AIBA 2AG1A 2YZKA 4PFSA 2RG1A 5KYWA 2VA9A 5B7PA 5EPEA 4H7KA 3NYQA 1GNSA 2NUBA 3SZUA 3ZWVA 1OB2A 1ND5A 9ATCA 1JNYA 4W5RA 3G2JA 4L6IA 3GQBB 1T6YA 3BXFA 1KJJA 2X77A 1QS0A 2PUHA 3SXUB 4EJFA 2VTKA 1N2HA 1Z5PA 2JVIA 1V16A 3PL1A 3CVOA 4QD3A 4RZUA 4B6GA 2WFMA 1L5KA 2Q1XA 3WGGA 4ZOCA 4DIMA 4DLBA 4XCXA 1FDOA 2M98A 2HU5A 5LQNA 1I30A 5JLAA 4YT4A 5I6DA 3ZW9A 2XT0A 1GUZA 4Y2JA 5AKJA 5HKAA 4QPZA 4U2FA 1YA4A 4WOCA 4A1FA 5JISA 4KR6A 5B1EA 3AVTA 1ENZA 1D9XA 4M9ZA 2Q3CA 1JKFA 1Q7BA 1WJGA 3KBBA 3MWGA 4JOQA 4RTKA 4F3TA 4N7RA 2C20A 1JDTA 1MQ9A 3RRXA 2XUIA 1J1ZA 2ZB7A 4UUQA 1Q1ZA 3EN0A 5KOHB 3EMVA 4KI7A 5BYAA 1I7QB 2FN8A 3AOEA 3ZV7A 1PGPA 1NUUA 1A9ZA 2ZULA 3DDOA 3IJPA 5CDSA 1F8XA 2BZ0A 1K4MA 5ALIA 2QMHA 2FEPA 1KEEA 4J3JA 5LMNB 3PXAA 1JIQA 1KO7A 2HA5A 4FQ7A 3QVGB 3EXFB 2HWUA 6AT1A 5FOQA 4ZIRB 1WCV1 2FSSA 1C8VB 3UXEA 1Y1RA 1TKRA 2RHHA 2FW9A 2RGAA 1A5SB 1O58A 2ZJ2A 3DTTA 2PBZA 1XEXB 3QVKA 4WKOA 2H48A 1KMIY 3CISA 3ROKA 1MTZA 3U5TA 4DV3B 4O4HA 4Y18A 4H7PA 1BXKA 2RGNA 2O2EA 3H8JA 5HJ7A 3VZPA 2WFLB 4YN3A 1A9SA 2I6SA 1O6FA 2NZYA 1T2NA 2DWQA 5DH9A 2L0XA 2PRIA 1DPGA 2HBRA 2Q41A 5DJ5A 2YX1A 4E21A 2C3PA 3KJGA 4I0WB 2IP2A 4QSHA 4EHFA 2IH2A 1TIBA 1X7XB 2I80A 1K6JA 2QJOA 1DV1A 3FYDA 3QVUA 4B4OA 5BWOA 1PT6A 1RQ2A 1NA5A 2XQJA 5CXSA 1SUAA 3FSGA 2A14A 4RH1A 4ZVVA 1FSFA 3C8HA 1A0OA 3QW2A 1X80A 5A71A 1Y89A 5ER9A 2ZM5A 4N48A 2C78A 4CNBA 4ISBA 3AUFA 1M0TA 2E4ZA 1MB9A 2FX2A 5KYXA 3BGDA 3QXSA 1W94A 3QUAA 3NWBA 3MGAA 4QYIB 1VJCA 3D7SA 4JBIA 2NSHA 4FU0A 3A32A 4GDFA 4KUEA 4DIEA 1LS1A 4MV8A 1QH8A 5AJXA 3DV0B 1IOVA 5BN5A 2HXSA 1ICIA 2FR0A 5K7SA 4IJWA 4NCXA 4A6DA 4EYGA 5C35A 5CURA 1E3JA 4JLPA 3I5YA 5ECYA 3WYCA 1P8AA 3TRDA 3FNGA 2K7FA 1DXQA 1XQ6A 2P30A 4PZPA 3T3IA 3PC8A 4IMIB 3ZCSA 1PR9A 1HNXB 3O93A 3OFSA 5HE8A 1TUBB 1PS0A 4JJ7A 3IE1A 2NZ2A 4A2PA 4D9BA 3CUEF 1WXXA 4JLOA 2BW0A 1I3NA 4QGBA 3W6UA 3PF8A 3W6ZA 4CMBA 1H9AA 2PRJA 2Y0DA 4KLZA 5TR9A 1E9FA 1Z0AA 2EX0A 4K6CA 2AN4A 1V71A 2FG7C 1FSSA 4TZ0A 1P1FA 5DHRA 1WR8A 1UL1X 2WM8A 3HV2A 3WYNA 3MWYW 4XYBA 1F0KA 1JLRA 4I2VA 2C3YA 4JMPA 4O2LA 4BKMA 3EWNA 2PJUA 3NRCA 3RFTA 1NBMD 2XUQA 3PGJA 5EXXA 4MGEA 2ZYTX 3L1UA 1AO3A 3JQAB 1DJPA 3NHPA 3TAUA 5ESXA 2JJ1A 4HUQA 4YPOA 2AFHA 4TUYF 1YVUA 2BEVA 3A70A 3UJ6A 1USUA 1J5XA 3WO1A 2SCUB 4IQ8A 2P68A 1FTSA 1CW2B 2HD4A 3E9MA 4L15A 5EJ8A 1HTBA 1TJYA 1SKAA 3M89A 4PBRA 5CVJA 4M60A 3PNKA 3EXHC 4A7PA 3ASUA 1KORA 3BQ9A 4A2WA 4KPYA 4DV1B 1CEXA 4JLNA 1DRUA 4LXGA 1E1CB 1NR1A 2VL7A 1AS0A 3PR3A 5B58C 4KQ1A 1KKLA 2QR5A 3KB2A 1KSJA 1HOXA 1J39A 2QTRA 3P97A 3Q40A 3RM3A 1MABB 2Y1LA 2DUMA 2UZ4A 5HVNA 1D2MA 4JJ4A 3G3EA 2I1QA 4PCAA 4BMSA 4EL5A 4MVWA 1G21A 2OQRA 3VDMA 2QRZA 1V8OA 2A1UA 1BNCA 2Q28A 5KYYA 2JAUA 3WGVA 1J8QA 3DAOA 1O96B 4FSDA 5DNAA 3ZV5A 3CVWA 1H8HA 3PRJA 4CMKA 2D0IA 4AT1A 1SUFA 1V4NA 1J8FA 4K6MA 4QASA 1V26A 2VHVA 2FWMX 1IB6A 3C0KA 3AZQA 3KLOA 4I50B 1E1MA 1EMDA 1FDTA 4QFMA 1UM9A 2C2XA 3A58B 4HZGA 4GHWA 1SCJA 4JU9A 4QDKA 5IK2D 1MIHA 4X62B 1A9OA 1XQ9A 2JIQA 3L79A 1Z13A 5GZ3A 5LR6A 3CZPA 3FPSA 3K1JA 3TTYA 3KK0A 2I3GA 1F12A 1AZLA 1BU8A 1XHEA 1GSAA 3QSGA 1T2FA 3GP3A 2GRUA 3OH8A 3BCHA 4MWOA 3TUZC 2QZJA 2Y9MB 1BXGB 2JB9A 1I2ZA 1NPTO 4BQQA 3OEYA 4CW7A 1E2PA 4D9KA 4GM1A 2DULA 3DBOB 3H9UA 4H35A 5FTJA 1GDDA 4F84A 10MHA 2P6RA 1UC5B 3D4BA 2ZBUA 1SEPA 4KW7A 2PGLA 1O96A 4W7SA 2X4LA 3WRWA 4QYMA 4TWIA 4U9UA 1GAQA 4UTOA 1X92A 1N36B 1K7CA 1UZNA 5I8WA 3SVTA 1G59A 4HJRA 1QQBA 3C8UA 3RIYA 1JI3A 2CBZA 5G0UA 2CLDX 3N2KA 5UKDA 5LLDA 2E5LB 2FUG1 2WKWA 1VG9B 3HZRA 4UARA 4A3SA 1TEHA 4JL5A 4KVZA 3ZI7A 1OH6A 4FHDA 2CDRA 2A9RA 3ID6C 4XTRA 4Y0NA 4QXRA 2P40A 3ND6A 5DDIP 1JKJB 4ZJPA 3C97A 4M36A 3CH7A 3IGFA 4PSAA 3TQHA 4EAAA 1V5WA 3BF8A 4AO8A 4BE9A 1IZ0A 1GZUA 4C22A 1E79D 1OOEA 1FS6A 3K35A 1F38A 1QOZA 1FMCA 4YJKA 5K0EA 4Q05A 2CXHA 1JT2A 4DLKA 2FHPA 3G7NA 4URFA 5DHFA 2KPOA 3C43A 3KPVA 3R6DA 4BLWA 5KNCA 5DFAA 4HLCA 4X64B 1IVSA 3CKLA 2L82A 4LI0A 3I9KA 5EMJA 1N77A 4DRZA 4PLFA 1DSSG 4FKZA 2DPHA 3LNCA 3WXMA 2FTKE 4JY7A 1LX7A 2NP7A 1M1YA 2NP6A 3TAXA 3S2UA 4BVKA 1RI1A 1ZBQA 1AQ6A 1E0JA 3U26A 5FEUA 1DQPA 1G42A 2ENUA 4QO8A 4TN1A 2LKDA 1MB2A 4Q37A 1P91A 2GBPA 1POWA 4PO1A 4XM2A 5AI9A 5HIKA 3U19A 3PTZA 5ISMA 3VAZA 2FEKA 2IQIA 4RHXA 4FGSA 4A91A 2QLBA 5EIEA 1EP9A 3PEFA 3NTUA 2FYTA 2G7MC 3AX6A 4GYYA 4G1UC 1WMDA 2P0EA 2YYZA 2PH3A 3WHLA 3EXG2 1QB8A 1H6BA 3AL2A 3C48A 5MF6A 3B13B 5HMMA 3RIGA 1D03A 5K8UA 4ZU6X 2CXXA 1GGEA 3MAGA 5E9AA 2ZRLA 3IDQA 4WZZA 5CEJA 3E6AA 1GD1O 1XVAA 2XUAA 3DL7A 4TV8A 1GLGA 3MWEB 4ILKA 3TKAA 5ALVA 4OV6B 5BSWA 2VOEA 2R25B 2H59A 1T6NA 2AF3C 3UGTA 1Y8QA 4OKSA 2ETVA 5I8ZA 1XNJA 4H6WA 1H4SA 2P9EA 2CNBA 4IJVA 3ICWA 2OZLB 3FMGA 3RSLA 1XU7A 1ZD5A 3E0QA 1ABFA 2Z2YA 3BJEA 2O5VA 4RORA 3MWKA 3WNQA 1CZOA 5E6UB 4ZVRA 1JR3E 4RGVA 3GCZA 4D4LA 1U65A 3T1TA 2E82A 2A1TS 2VC2B 3WFZA 4DJDC 3KZ1E 5CDFE 1Q15A 1WG8A 4ZVUA 5HOEA 1XA4A 3AQIA 1AUXA 4C0BA 4F96A 1XK6A 2FN3A 5EWJA 3E7WA 5T67A 2NVUB 4DDVA 4ZGWA 5KWIA 1W36C 3NHKA 3A1VA 1Z2OX 4QU0A 4M1MA 3EZ7A 1P8JA 1ZRMA 4MRMA 3WK4A 4BC0A 1UXGA 1SM4A 4PLZA 3I34X 4YMTA 2Q2VA 4PV7A 3GEHA 4F7DA 2YQ4A 1Z35A 2HJHA 3S6JA 1FJGB 1XD8A 4FI3C 5HF6A 4EKIA 2C0QA 3CRNA 2VPQA 2G63A 3G82C 4BO2A 4P34A 3X2EA 4AY6A 4Q18A 1QFMA 3IBFA 1ZLXA 2EWWA 2LKCA 3GROA 4XQ0A 3CBQA 3VR4H 5HUQA 1J5EB 1NR5A 2HA3A 2PS9A 1JA0A 2JKZA 4HY3A 1QIJA 4NCNA 4C14A 3HZZA 2C99A 3JVDA 2NXCA 4E2ZA 2ZIXB 1Z75A 2M2IA 1RHMA 1Q12A 4IY1A 4LX0A 4W5TA 1TUBA 5T41A 4F4HA 1YULA 1IM5A 2IUFA 1MAUA 4B3BA 1XJ5A 3E2PA 4WEOA 2VYQA 3PNBA 4P3NA 4AKHA 1IDN1 4H3HB 1G7SA 4DPMA 3VOSA 2WWGA 3EGCA 4E5DA 3ML1A 2XZLA 3OZUA 5JPDA 1KSFX 1YHNA 1PJ3A 3FZYA 4F5ZA 3FMOB 2D4AA 3B48A 1XEFA 5GJCA 4K2HA 4J7CA 1P80A 2C4MA 3AINA 4LZWA 4UUPA 1WKCA 4ND5A 4UVIA 2ZSAA 4DRXB 5K2OA 1A69A 4FNOA 4XUEA 3OM9A 4DMLA 3R4CA 2DEUA 4V0NA 2FFJA 2V9ZA 1KY4A 3QLVA 4Y1EA 2WJWA 3HVKA 2P5SA 4OSEA 4CLEA 1OXSC 2QHXA 4U9HS 1E20A 3G2LA 3ZQ6A 4KV7A 4LTNA 2PL5A 5CW1A 1LEHA 3LP8A 4P92A 3T9BA 1X1CA 1E8NA 8ABPA 1BWSA 1AX9A 2CMKA 2OCBA 4BVFA 2P4QA 3HY3A 3O03A 4LBVA 2ENWA 4CTJA 1RBMA 2PFGA 1W7AA 3WLPA 1L5OA 1O5IA 3QMPA 1UQTA 3NRBA 1JSLA 2GRJA 3IFSA 1D5WA 2YRXA 2C9CA 2CNWA 2WJHA 4MJLA 4DADA 4DC1A 1QBKC 5KDOA 3QLUC 4CM3A 4YJ3B 4V38A 4KFCA 1IMJA 3LW7A 1W4LA 3MJFA 3JYLA 1Z5NA 3DCJA 5FOWA 4POOA 4P5EA 2FFHA 3B9QA 3ISJA 3ABRB 4HNVA 5LP6A 2E6UX 1P39A 4OHRA 4EF6A 1YZFA 2I2CA 3GRRA 4XJXA 5CB8A 3ZVNA 4PF1A 1IK4A 1DUSA 3MJHA 1BRMA 1NWCA 2VUSA 1DQRA 5DXAA 5IZ4A 1IN1A 4WK0B 1NI3A 1Q91A 1XYVA 5KAPA 1NYTA 4PC3A 4QHTA 1NUTA 1E61A 3HWSA 1XFDA 4ER5A 2UYHA 1X39A 4QPDA 3BWXA 2IPMA 2J6IA 2GASA 3UAGA 5HZHA 3HACA 5G4KB 8ATCA 3BCUA 4G5SA 2GHTA 4JQYA 4PYRA 2YHBA 1O9HA 2NU7B 1C4KA 2YMPA 3PPWA 1U2TA 4FGUA 2TYSB 3A2MA 3AFOA 4HO1X 3P4UA 3CW9A 4GLJA 3VJMA 1EFRA 4O3FA 2VLBA 2MSKA 3IAM6 5EXPA 1NUQA 1NR7A 2VAPA 4P6VF 3RYIB 3EXIB 1UC8A 3G02A 1FFCA 4I55A 3F90A 3PC7A 3RAPR 4RA6A 2IRWA 2JJ2A 1SA0A 2VJQA 2V6BA 1CZUA 1G66A 1HURA 2BM1A 1RFGE 2WSLA 4JSTA 1WXGA 4YFYA 5EY5B 1MGOA 4R8SA 2PK3A 3RBXA 4LWQA 3FWKA 2BGNA 1W36D 1MABA 3W90A 4ER7A 3BMQB 3BK1A 3I45A 4BKRA 4DLUA 3ZZMA 7YASA 3ROFA 3PQ4A 4MDHA 3G2KA 3ZJTA 2GS9A 2WKQA 3BXHA 2OBNA 1YZUA 4GLFA 1G8SA 4KFTA 4OXKA 4R1MA 3PX7A 3OCZA 2Y76A 3QIVA 4NQZA 5F2KA 2B5WA 4K6KA 3SOPA 4D9IA 3DV0A 3OQBA 1RBZA 3QLVC 1KAHA 4P38A 1MJFA 4WOKA 4ES6A 4GIBA 1YXMA 2Y8EA 4PG7A 3PUZA 1CYDA 1LQUA 3D02A 3M3HA 3PFGA 4JA2A 1PU2A 3H2HA 2BGUA 4ARZB 1XTZA 4G23A 4CM4A 3B6KA 4EJMA 2JGMA 5TNXA 2KWIA 2UUBB 1TZMA 4EENA 1XRLA 3GEDA 4KXFB 4PS0A 2NZUG 3LHKA 2XAAA 4HDCA 4MO9A 5G1PA 2WE7A 3MNFA 2R68A 4QNRA 4LJAA 4JNKA 3REQA 4B3FX 5COQA 1SCIA 3H19A 4KN9S 1U9IA 3BB4A 2Z57A 4Q4JA 1DC5A 4CN9A 3JU3A 1AKWA 3KL4A 4X7BA 3R7BA 4HXEB 1OXXK 2VDUE 5HS4A 1Z6ZA 5JXHA 1IPFA 5CNJA 4Z86A 3IMGA 4IZ6A 3C3KA 4DMRA 1XDBA 4TYNA 2X3FA 4W7HA 4PSDA 4QDTA 2I2WA 5CX1A 2B99A 3DGFC 1RZRA 4XFDA 3K8YA 4AJEA 1EZZA 1W6RA 4R9SA 5H16A 2RH5A 4Q16A 4J8PA 4DJAA 5BQ3A 1MRNA 3JQGB 2ZSDA 3A9RA 2ZSUA 4BO3A 2XODA 1PG0A 4ZP1A 4MUIA 1YTLA 4L7VA 1W5SA 1EFPB 2H16A 3E5MA 4X20B 1H2RS 2CL0X 4CG2A 3EVTA 2XW6A 4WY2A 2B5VA 1UMBB 4ZU3A 4RM3A 1GTMA 4Y1GA 3H2ZA 4M0DA 4HS4A 5E95A 4YPVA 3DTYA 4U7DA 3I73A 4LPSA 1X3LA 1MA3A 2YY6A 1NQOA 1Z8DA 1IHYA 2HBYA 3ANNA 4FYVA 1EFRD 4US1R 1SC9A 3TZBA 4YUWA 5JJLA 5LQJA 2GLTA 1IBSA 1SBYA 2B7CA 1TD1A 4MPPA 1KQPA 2HX1A 1X70A 3F97A 5GOZA 2ZVPX 3T7SA 1ND6A 1LK7A 4HG2A 1QANA 3GGPA 4G1MB 2JVJA 4C4XA 4CKCA 1P7VA 1AHIA 2VTVA 1I51A 3A3KA 1UBHS 1BGXT 2IHBA 2QRGA 4K1LA 4WWHA 1TE2A 5DSTA 2XBUA 3THRA 5ITZA 4DIDA 1WLSA 2PKWA 3HMQA 3MK31 3PE3A 4JB3A 1EQAA 3QK7A 4GZMA 4NJEA 3K0AA 4Y6QA 4BASA 1JLHA 4PC1A 4B44A 4D56A 4ZI2A 5T3YA 3K92A 3T3EA 4BE4A 1P1IA 1LBSA 2Y1KA 2OT3B 1J0XO 3JQ8A 1N2EA 3OFNA 2I4NA 1U8TA 4YAIA 5K6AA 5FOUA 4D25A 1R6BX 2HA0A 3I4LA 4Z4GA 3ELYA 4ZQGA 4RK4A 2BY4A 4MOWA 3DNPA 4QOSA 3LYAA 4Q7KA 2BFDA 4L6CA 3H2BA 5CAEB 1AZTA 1GTRA 5KCMA 4MUAA 4OJQA 4KRFA 3LXRA 1XN4A 4Q9DA 3QENA 4I3FA 3I4CA 5FP0A 4ZCQA 2IVZA 3M82A 3NHMA 3R40A 5JXGA 2QU8A 3TL2A 4ZICA 2O0MA 2WTXA 1KO8A 3N8NA 4EEXA 5CX1B 4HB0A 1QAQA 4QBIA 5LB2A 5KSZA 3UMMA 4JUDX 3W1VA 3WYBA 1OH7A 1ZJ5A 2CLIB 3FPAA 3L7BA 3RKSA 2HAEA 3CLTD 4G8CA 4QYTA 5NULA 3DT8A 3GLGE 1HFKA 1X7ZA 2WLTA 4O0MA 3V6MA 1X0XA 2I1VB 4J3NA 1TK3A 4TVBA 3JQ6A 1SBCA 4G01B 1PW5A 2ZRDA 2PGIA 3BICA 1FVFA 1M2JA 9ABPA 2J85A 4IOMA 4CIWA 2RAFA 2FWIA 1LPNA 4FEEA 2IZ6A 3FB4A 4DAOA 1T3HA 4G0ZA 1V4VA 1LGYA 3ZNNA 3H6GA 2MSNA 4C78A 5IW8A 5MFPA 2I76A 3RRYA 3TDNA 1HPLA 1DQZA 1RJWA 1TLFA 2RAUA 3AKEA 5B4VA 4HQNA 3DB1A 2Y1DA 3R6WA 4YQFA 1ZRNA 1ST2A 2EWVA 2C9DA 4PPFA 1ESCA 2JD2A 1EDBA 3L40A 2BYTA 1ACJA 3VSCA 3ORFA 3QLUA 4M0UA 4NKRA 3T6KA 2IKSA 1YQDA 4D9CA 3CH6A 4Y2XA 4NV3A 1JGTA 4EI2A 5AJTA 2EFEB 3ZLUA 3D4IA 1XVVA 4CJXA 5LBUA 1LDMA 2VF4X 4MS3A 3LX8A 4MWEA 3BHNA 2FX3A 1F2UB 1TMGE 1V6SA 4GXRA 3CEHA 4XQCA 4E22A 5TF0A 1RPZA 4CFYA 3C4VA 4KQHA 1C9KA 1P5FA 2A8YA 2GZDA 3K9LA 5KVVA 2FQQA 3FN4A 4JI2B 4B9AA 2E9SA 4RCYA 1KO5A 2MSDB 1JSXA 2NLOA 4HAYA 4J0QA 3EPPA 4LVCA 4D8VA 1PQUA 2EP8A 1KFBB 3LGXA 1Z5WA 3AZOA 5DBHX 4TPKA 4B6QA 1FDIA 1Y4SA 1GPNA 4O2AA 1F5SA 3LBFA 3RGGA 4NOKA 3NWJA 5IG2A 3UB2A 1IC6A 1FU4A 2KBEA 2R6ZA 5A9SA 1ZHFA 3M3DA 3TW4A 5PGMA 5AI8A 5H81A 4OAOA 2YQ5A 3S2YA 4E5KA 1X0VA 2YWEA 5CR9A 4PIVA 1QTNA 4DQLA 4NMWA 1HYQA 2GTHA 1XMQB 5AI4A 3IE2A 4DDTA 1H0KA 4E12A 5BSKA 1I01A 2NN3C 2JJ2D 3NFYA 3NJ8A 5MN5A 2FPPB 2JGRA 3WKAA 4DV5B 2JI6A 1R1DA 2OYSA 1XRRA 4U7FA 3NIDB 2B8NA 2PD6A 3WR5A 2UZ3A 5CIYA 2GTPA 1I1QB 3B9RA 1Y4AE 1RWNA 2D2XA 2ZYDA 3AF1A 2ZRHA 3EXIA 3KELA 4ACBA 2E21A 5HJ2A 3R76A 4B7ZA 4Q7LA 4E33A 2PUAA 3AY7A 3QU2A 2Q5CA 2IEBA 2XMQA 5AJHA 1R88A 2J33A 1C0EA 2WF8A 1SXJD 1YACA 3KYIB 3BB1A 1LU9A 3CTPA 3GJYA 3ZLVA 1E1NA 3PF9A 1VXRA 4QFBA 5IABA 4IS3A 3PT9A 4LJ4A 5F73A 1SBIA 1GUAA 1HK7A 2VI5A 3EPHA 2QTFA 4HDOB 4DSOA 2O23A 3VX3A 3GVPA 3AB8A 3T9CA 3TLXA 1WX1A 1A7UA 1OFTA 3ESAA 1VHQA 1W35A 5ICFA 4BQEA 1GRRA 1WCIB 2AK2A 2DT5A 2WF7A 4AZ0B 1ILEA 5E1DA 4RW0A 3MLAA 4FCVA 4DA9A 4HRVA 4NK4A 1BWQA 1CD5A 1ECJA 4JAVC 3HSKA 4WBNF 5IF3A 4GMHA 1CUVA 3ZBPA 4HC4A 4B2IA 2PGDA 2BFBB 1H94A 1T3GA 2C2MA 2QMUA 1MLDA 1T2DA 2DVMA 4MJXA 4M9XA 1DX6A 3NP7A 4FDTA 1WA5A 1Z0KA 3NM5A 3QNWA 2WW8A 2QK4A 2NUAA 4BP8A 5HGXA 1NOKA 3FPCA 4FFRA 5AW6A 2LDXA 4CV3A 3DLHA 3A36A 3LQ4A 3KJFA 1L7NA 2FI1A 1L5LA 3A3NA 3HCRA 1N75A 1YVDA 1FJHA 2LDBA 4G0OA 4GZ5A 4TV9F 1JAIA 3E9QA 1A4XA 1V3VA 2G67A 3UKOA 3O3OB 1PJQA 4RIEA 1OYYA 3LY5A 3O7WA 4TTQA 3VNQA 4CMEC 1TNDA 5EJ6A 5KB3A 1ULBA 2ZJFA 5LQMA 4BVAA 1JR6A 4HNSA 2E1PA 3DVSX 4H3KB 1E9CA 1Z36A 4Z4CA 5FO1A 2IV2X 3M9WA 3VDQA 3WDSA 2F43A 2FCRA 3RYHB 3WFIA 1OAOA 3HN6A 1AKVA 5A06A 2A33A 2WP0A 1RRPA 2Y0BA 3CZRA 4KAXA 3WDLA 2Y71A 4JUIA 3PNSA 2XBLA 3LPAA 3V9AA 3S81A 1R3UA 2HJ9A 5M7EA 4NFLA 4B3GA 1ZP6A 2ZAGA 4X8MA 3WRXA 5K4GA 4KSBA 1JQ5A 1RC1A 1C2TA 1UJ2A 2GPSA 2ONKA 3CPEA 3HRHA 1KBZA 1LBEA 4R1TA 4PLHA 5DT2A 1CSEE 1DB3A 5EMNA 3H7AA 4W5HA 3CSDA 3BQNB 4HAZA 4XGIA 2GHQA 3ABZA 4O59O 2ZJOA 3OD5A 2IYLD 4PYKA 3ADKA 4MW6A 3GLHB 5D3ZA 1R6DA 2R5WA 2XOEA 3DZIA 4BCDA 4ARCA 3GJ3A 3WB2A 1U11A 2WOJA 1YL7A 1S4QA 1U9IC 2QX9A 3CT4A 3LVFO 1NJ6A 3Q6NA 2Q9UA 4GD3Q 5EE3A 4B31A 2J09A 2ZT5A 4FCTA 3I01M 4EARA 1JFFB 3QI2A 4MWGA 5DYIA 3T5DA 4F93B 2UAGA 2W93A 2YIJA 1PR2A 5L51A 2YH2A 1I80A 2PVPA 3L8EA 4LCEA 1CXZA 1NE7A 3DKIA 1N9GB 2AXEA 2AX3A 4H27A 4IMJB 3D31A 3VXKA 2G9QA 4O2BF 4RQBA 5FDFA 1PD1A 2ZBRA 4UZEA 3LQ2A 5FPKA 3SJAA 2OZPA 3ENQA 3OO0A 1L4BA 4EHDA 4FI3F 2W90A 3WKDA 2HUNA 3IPRA 1BHSA 3L7OA 1FMJA 5JZBA 2G82A 2H17A 2XMSA 2NADA 3AY3A 4N54A 3RVOA 4E5YA 1O3YA 2XB9A 3QYJA 5JZMA 4N41A 4BNTA 3N87A 1YTUA 4UAJA 4PANA 2GK6A 1FTWA 2ZTUA 3KD3A 3CURA 5EHQA 3HDHA 1J25A 3P45A 1Z4NA 3UB4A 2APJA 2P9HA 3T7KA 4H6VA 3X2SA 2Z5FA 4CG1A 1P4SA 1X7WA 2ONJA 1WUKS 1LPMA 4YS6A 5ERXA 2A57A 3MG9A 3OZTA 1W1IA 1ZIXA 2Q6IA 2WMDA 3BMCA 3G85A 5AQ1A 3VNAA 2L17A 3O75A 1E5VA 3SCZA 3DEIA 1L2TA 1LVGA 2FPIA 2I6QA 4IWNA 3CVUA 2EJVA 2VZLA 5I01A 1F17A 2OA0A 2YWDA 1XGKA 1YZLA 2GNPA 1CUCA 2J4CA 4MMZB 1G5TA 2HO4A 5T6BA 2PMDA 5DKFA 3HA2A 3AXTA 1K06A 1KA9H 2AZMA 4MVCA 3LBYA 4PQRA 2OXCA 1Z47A 5DNCA 4RDCA 4BX3A 3FYUA 5AVUA 5K8JB 1YE5A 1SHTX 3N2GB 1NBOA 3QVXA 3L4KA 3TW8A 1PT8A 1OAOC 1LNSA 2JHPA 1GG2A 2VHQA 1MJHA 3EDCA 4KHZA 4Q3CA 4UEOA 4EVIA 2BOVA 4YECA 1VIDA 1XZLA 3HA5A 3B6JA 2PLWA 1CV2A 1IB0A 1WZ2A 3AI2A 2V6MA 2AG6A 2QP9X 4L95C 5LP6C 1OCEA 2IPLA 3FR8A 1AGNA 2F64A 3JVIA 3KYJB 3NHFA 4OP1A 1RJGA 4HH1A 4GWGA 1GZ7A 1UH5A 4Z0NA 1Z83A 1A98A 4HVTA 1Y98A 5HF9A 2QT9A 2VP0A 2R65A 3NXSA 3RW9A 3ZOKA 5I7OA 1EVEA 1ZBDA 1HXHA 1SC6A 5ERYA 3UGKA 2PUEA 4II3A 2FSUA 2C2ZA 2A9OA 1PJZA 1YVRA 3FKQA 3QFHA 4ETMA 4YUZA 1CQZA 5IJWA 1U1FA 5KYGA 4X41A 4DMKA 3FOEC 4AKGA 1B73A 3FI0A 1VPWA 2ZUFA 3W5SA 3LHIA 4NEQA 4OQMA 1KZHA 4DBZA 1XDGA 1ICEA 1JECA 3S1SA 3QYPA 4J9VA 1DINA 1QLWA 2IIVA 2XIQA 5EWJB 3GPIA 5IZCC 2GETA 3DDZX 3B1ZA 2BP7A 2A78A 1PL7A 5GV7A 3W9BA 2QD3A 4DV0B 3RUDA 1TPYA 2GFIA 4RYLA 5CB4B 2HM7A 3N70A 4U6QA 1PJSA 1XZ8A 1CKEA 4MZDA 1E8MA 4OQFA 1T1SA 3I1FA 4BNYA 3PIIA 1NHWA 2CLCX 3GN1A 1RXCA 1TRKA 1ZH6A 3X44A 4EO4A 3S8EA 1QRAA 3P2KA 1CUXA 3CEJA 3DEKA 3IE0A 4F6RA 4PZYA 1TTQB 2WE8A 3QM1A 3LLCA 4XSHA 1NLUA 3IUBA 1XPUA 3F3SA 1IQUA 1PK7A 4WNIA 4XYMA 2BDTA 2EZ4A 1RMQA 4RIGA 5EUBA 2PZBA 1UZUA 3D4LA 1FFXB 2BKVA 3GO4A 4KVAA 5BW5A 3MTJA 3O0TA 1K97A 1VM6A 4JASB 3SIRA 1RRVA 4DWOA 2G4CA 4QGAA 2ZGVA 4MW7A 5A4MS 4Z4IA 1GPYA 1Q0HA 3OHMA 2JEZA 2YC4C 4ZV4A 3RIMA 4HGRA 4BQPA 1UQRA 3EWAA 4FSHA 3F0TA 5K4AA 1OXVA 4TSKA 4C0LA 2YVKA 3JWGA 4B81A 2P7HA 1OA1A 2JS7A 4GMDA 4Q1DA 3NDRA 3T99A 3B3AA 5HCUA 2W6JD 5GONA 2YW9A 3EWIA 3AHJA 3DYIA 5CLFA 1W8IA 4B48A 3H4MA 2NYAA 3VDXA 5A62A 1P6UA 4R2LA 5A02A 3SIWA 4BUZA 1R8YA 2J46A 1QHXA 1QHNA 4UCQA 2DHCA 3TTSA 2V1UA 1AXRA 2DG2A 4NZ9A 1T4MA 2CXOA 4F4CA 1NJSA 1XQWA 1EUCB 5E7JA 3T7RA 4BV8A 4RXMA 1XPRA 1TDJA 1ZMBA 4ZARA 1NVEA 1RVDA 1OWMA 1U98A 2O52A 2VZ8A 3L6EA 3RIXA 2YFYA 3LKVA 4UD2A 2OILA 1GQOA 3KKMA 3LK6A 3QSYA 2FJUA 4E2FA 5LIPA 1S1MA 1HG0A 1BFDA 4UE6A 5KVQA 2OGSA 2QT0A 3LIIA 5F4ZA 4X24A 1KP2A 2P78A 1F0NA 3PB3A 1Y4DE 3WZ2A 2B0CA 4S1VA 1NMQA 4U39A 2WU0A 3F5DA 2I4MA 5HIAA 2BBWA 5K45A 1G7TA 2HXYA 3LWBA 8AT1A 4BB6A 4GX5A 5IC6A 1Z2NX 2PX8A 5CDUA 5KO2A 1JAXA 3ZU2A 3CG4A 4YJDA 4F0JA 1NVMB 3L8MA 3EQ8A 2X4IA 4M8NE 2V0NA 1DRWA 3HHPA 4D4KA 2XI4A 4WN9B 2OD2A 4OJYA 1EBBA 1L7PA 2DHRA 2ZB2A 4RZQA 3I37X 2QAIA 4H59A 5IAEA 1UEXC 4MA4A 3ZWBA 4QBTA 1GIAA 1FF9A 1O5TA 1TM3E 1DG9A 1I4EB 2HMUA 4KNVA 3C3EA 4MA5A 4GDMA 3T61A 1JTEA 1G8YA 2BC9A 2PLFA 1B6GA 1QC5A 4ZRDA 4TV9A 3K32A 3LBAA 1KDOA 3OTWA 2NAPA 5LDDC 3MD0A 3HPRA 2F17A 3I5UA 2G5TA 1DIGA 4TS9A 3R5HA 1C7QA 3MMPA 4LBYA 1R8QA 4YEDA 2M6KA 5FLKA 3V4PB 3DAGA 3GJRA 1RC0A 4Q0MA 2AQKA 4N47A 2L18A 1RAEA 3OQPA 2C1EA 2DGDA 4S24A 5BN3B 1SBZA 4Y6RA 1W2GA 5I7WA 1N9KA 3V7UA 2XA1A 1OXKB 3HGQA 4IVPA 3RS8A 1ONPA 3FAKA 1JH9A 2AOTB 3ZXUB 2JW5A 3MUOA 1JA9A 2OKGA 3FETA 1FTYA 3D3WA 2SECE 4UDNA 3CUWA 3RUAA 4Z54A 3JARA 3K4QA 3DE4X 1UDBA 3M1LA 4ZOLB 1X1BA 1Z62A 2B0JA 2YYAA 1ZUNA 5IX8A 5LUBA 1ADGA 2V7EA 3LA6A 1JEQB 2O1EA 2QG6A 2ZI7A 3G2HA 4UHCA 1FQKA 1NF9A 4X85A 1T1GA 1HDXA 4H7EA 4JS0A 4RV5A 3TLGB 2AS0A 1W47A 1E18A 2XA2A 3JWEA 3Q9UA 1OJLA 1KDPA 3WJ2A 4AO6A 2NW6A 3WKBA 2OWEA 4PTYA 4EHBA 2HT1A 1OLSA 1GWNA 1AJEA 1SXJA 2BBTA 4W8OA 4F5DA 2C2KA 4GI3A 3LUHA 1Z37A 2F8LA 1K3FA 3W5UA 5D3QA 2IY9A 3RJ9A 3SZ3A 1VMDA 1VSTA 1ZN9A 3GEBA 4M0LA 3TLAA 3NUQA 1GZ4A 2WV9A 3P7MA 1RQ7A 7MDHA 2G1JA 1Q7CA 2MJLA 1UBNA 3TPCA 1HE8B 2DHEA 4OGWA 4QM6A 3DT9A 1ORIA 5JZVA 2P79A 1CF9A 4BUJA 2GEKA 1E0DA 1ID1A 1T0IA 2JFWA 4G81A 3F4LA 1SXJE 5JAMA 3KQWA 3IODA 2X5XA 4ROTA 2R8OA 1C1HA 4DEXA 1AXGA 1XVUA 1DS6A 2X1VA 5L3RA 4CZ2A 4D0LB 5A9SB 1WOYA 5A9TA 2CEAA 2WY2D 1PWXA 5L3VA 3RYCB 4ZTZB 5I4IA 3AI3A 2XYGA 4GPD1 4FT4A 2PX0A 4R7TA 2DBYA 3CUVA 3ENNA 1EUYA 2PUVA 5JJIA 1T25A 1RRMA 3LOPA 4MR8A 4DNXA 4CYMA 1Y9AA 3ACCA 1ZKMA 5C34B 3L8DA 3QTLA 1QG4A 1RZ3A 5DF1A 4C87A 4M46A 3OTGA 5IARA 3INTA 1L4KA 2P2DA 2I71A 2X5NA 2D3TA 2YYSA 4FYYA 4HFMA 4G56A 4YRPA 4DABA 4LXYA 1IHUA 2D2EA 1XZCA 1ATZA 1N25A 1X7DA 4K7JA 1ZIPA 2NUTA 1N6RA 5ALOA 1KAEA 2V0CA 3M6LA 2B8EA 2ZRMA 3AR8A 3ENVA 3Q9NA 2Y1CA 2AMFA 2A5DA 4L0MA 1QP8A 4D74A 1B6SA 3HBFA 2RHOA 4JQOA 3KWLA 4BY9E 1QCDA 5DTJA 2FWBA 5JVDF 1AKRA 3ME5A 3ORRA 5DLEA 2A0YA 4D0SA 4IO1A 4GOND 4CMIB 4OAPA 4P2BA 3NT4A 1IAQA 2ZRIA 4K3VA 5BRNA 6ABPA 1U9CA 2YV3A 1M2FA 4ND6A 2WC1A 1YFJA 4TQAA 1RXIA 3LG2A 4JEHA 2NTVA 2PX6A 1G18A 1X9GA 2CE7A 3O2NA 3PCXA 4DG8A 5AQEA 1PFVA 1AKMA 2PTGA 3MT7A 2EQ5A 3R20A 1AMNA 5JSUA 1ODKA 1K7YA 2EJUA 1KEVA 3IPYA 1ZMOA 5A6SA 1JLKA 1ILWA 2ZUBA 1FS4A 4KXYA 4OXXA 2VKQA 3GT0A 3SSOA 4ZCPA 4COKA 4EUFA 1U3GA 2ZCVA 4OFXA 2I7XA 5AHRA 2R6R1 3KQOA 4IXMA 1JRLA 1RWXA 1YDGA 4PIMA 5JBIA 5IT9A 4A8HA 3ZQ4A 4RQUA 1P4GA 1U7XA 1FNMA 2R6AA 1VI6A 5H02A 1P1BA 1QK5A 3VR3D 4V39A 3FVWA 4HFRA 3IQEA 1VG1A 1PGNA 4MVJM 3ZX4A 4L5AA 2YN2A 3ESYA 4B3XA 3C8DA 3GLIB 1PK8A 2A5JA 4PQEA 4ZAGA 1JDPA 4NZMA 3WVNA 3SJBA 1BKSB 2YIVX 3L0YA 3P4XA 4JH0A 4AJ4A 4CF5A 4DDHA 1GKYA 1RI5A 1VMAA 2YVAA 5ES4B 5I8PA 3AI7A 4LRTB 1ZG3A 2D5AA 5IFKA 4OX9B 2ECFA 3H1PA 4N18A 1EFHA 2A9PA 2FPUA 2G1UA 5LYYA 4K46A 2HDHA 2REXB 1I2MA 5DLQC 3NTOA 3DEJA 2ISSD 3Q1LA 4NU8X 4WZBB 3PYMA 1Y5IA 1DARA 4ZI7A 3AG5A 1LPSA 1K66A 3HDYA 1IN8A 2ZIFA 3PNYA 3UJHA 3F4BA 4BKUA 1SKYB 3LDFA 4D4HA 1VBFA 3BH7A 1TM5E 3GFFA 1TM7E 1YQ9A 1U4NA 3QEOA 3ZHBA 4P2GA 4FK8A 2JGAA 3PPXA 3R1IA 5AW5A 1B93A 1SU6A 3QLTA 3LZCA 1U0NA 5FNVB 2O57A 2PRYA 3FXAA 3HHEA 4QHYA 2I3ZA 1F2UA 5BXYA 4J6FA 4Z3OA 4NH0A 2C5LA 4D4GA 1V1MA 2IPAB 3TZEA 4R1OA 2BH9A 2CNDA 4N39A 1YS7A 4JX8A 4ER6A 3P9QA 5DV9A 3RRJA 1ZA1A 3HJTA 3EXAA 3GJ5A 1NM5A 1CS0B 4C0HA 5A7FA 4Q4JB 1W85B 3ITNA 2VP3A 2HDOA 2YHIA 4LVNA 5EHXA 3MHPA 1H2XA 4EY3A 1ZL0A 4X97A 5AXAA 3ZTTA 4DWWA 1U3WA 3H65A 2ZRQA 3QPBA 3GJSA 4KMMA 1G8MA 2I03A 3AOEC 4GYWA 1TK9A 1ZESA 3FM9A 3OT4A 1V48A 4JLUA 4M8KA 2X2FA 3WK7A 4CU5A 4JP5A 4X00A 4YV7A 3W5BA 5LN1A 3BBLA 3ZGNA 3AUTA 2P62A 2AR7A 3R3YA 4M1QA 2H4WA 4EW1A 1WPGA 5E6SB 3TIVA 3ANSA 2DFVA 2JL1A 4FQ8A 3TR5A 2XV1A 1IBMB 2W4QA 1IFXA 2JEOA 1EK1A 3UEOA 3L8ZA 2VHCA 1NW5A 3F6BX 1Z45A 2A0XA 1T9CA 4LXUA 4JVNA 1V5EA 2DFKB 1L3BA 2OBMA 1PX2A 2XMCA 4DLYA 2EKDA 4TMXA 4CETA 1C30A 1HYBA 4B5LA 4O2BA 5B53A 4UHBA 4BO9A 4QJ3A 3O47A 4FNAA 1ZR2A 4IS2A 3UFXA 1GADO 4TL7A 2ZTMA 1ECFA 4OMUA 2JFQA 4I5FA 3RC2A 4D9MA 3G5AA 2PUBA 4NEGA 1TC1A 3HSYA 4BECA 4QGSA 1K7SN 4DUGA 3L0DA 3WLTA 4OMCA 1SHZA 1YIAA 4WT7A 3VR6D 4D0GA 2MYPA 3WG9A 1WEHA 1CHNA 1TUEA 3GY0A 2WPDA 1OYVA 2Z2IA 4HNUA 1KSGA 5BV7A 2PN1A 2GAFA 3O5AA 3T9EA 3VR5A 3A2LA 4CIDA 2HMYB 4RD1A 1DHTA 1RWPA 1CEYA 4A6PA 5KMGA 4HDAA 2GK7A 2ANBA 3K0AB 2ET6A 5AK5A 3TR6A 3RUEA 5KU1A 2VPYA 1LNZA 4NAHA 4D79A 5T57A 4EX6A 3ER8A 2FLWA 3SSMA 5JRJA 2WAYA 4GU5A 4WPGA 4BQOA 3V7YA 3DDNA 2WJ4A 5TARA 4NV0A 1WP4A 3EIXA 4M1EA 2BMVA 2C0PA 3CLSD 2C29D 3HV0A 2B4AA 4ZREA 3T15A 2TMYA 3TKYA 2WMYA 4EF5A 4XWOA 4LE1A 2XGSA 1J0BA 5C52B 3GOQA 5JNLA 4RTSA 4GUDA 3GC6A 3BZWA 5JG7A 4AJPA 4H0CA 1T1RA 1EJBA 221PA 4DA8A 2QMEA 1LZKA 3TMKA 1NATA 3NBUA 1C3OA 4NQRA 3RSQA 3TO5A 1WZEA 2BGIA 3V1MA 1K92A 3LPCA 4D97A 3KPUA 1HQYE 4FXPA 2QQGA 3NC0C 1P5HA 1Q50A 3Q3EA 4RFSB 4U3JB 3TOSA 3BWCA 2W2LD 1E32A 2GN8A 2DUNA 4UTZA 1NOJA 3L8HA 3ADPA 3COYA 3KWFA 3U9SA 3W1WA 2HPAA 4H1VA 1ZK0A 3TZ6A 2RK3A 3A2KA 2AF4C 1C41A 1MH9A 2CHGA 2DWOA 3DM9B 4R81A 1R9JA 3SZRA 3DMDA 2QZ4A 3QEAZ 1NASA 1Q21A 5TJ9A 4UAUA 1U0TA 1CHDA 3ODPA 4U63A 2PGNA 4PPGA 2CFTA 4L50A 4E11A 3WGQA 4XJSA 2FGJA 3VU1A 3TI9A 3ETJA 5CLHA 5F4BA 1G6KA 1XZAA 2NZJA 3KCQA 3L1VA 2LW7A 3MRXA 2MINB 4GRAA 1KKMA 4HKTA 4RQAA 3T1YB 1ANKA 1CQIB 1PNTA 3AVVA 1Q22A 3I0MA 4FPXA 1EAMA 5HQ3B 5JTTA 1Y3AA 3AO0B 2Y67A 3I30X 5AVSA 1GQYA 2AGVA 4BVGA 3E1SA 1HDIA 4OH7A 3ZE9A 2MHCA 1DTWB 1N2CB 3T3NA 4AZWA 1QTRA 5HE9A 1Y1PA 1NW7A 1HZJA 3PK0A 3NTRA 3KXKA 3FPFA 1MAVA 5KYNA 1GYPA 1XALA 3O1HB 1ZCZA 1R0WA 3BFJA 4NC9A 2WU3A 4ANFA 3FOBA 4KDCA 1ABEA 3ONFA 3UMSA 4IGFA 4RF5A 4D9NA 4AJLA 1FL9A 1L5ZA 5U4QA 4JYAB 3G89A 1Y4ZA 5KOJB 2R7LA 4OGLA 2CMGA 3LCJA 2JFYA 2GF2A 2PXAA 1GFIA 1U0FA 3WHPA 1GTSA 3QVOA 1ABBA 2HSEA 5JOQA 1R15A 1SUBA 5AWFC 2UVQA 4US2R 1QO7A 2ZR0A 1WUHS 1DKPA 2V58A 1T9BA 4J0GA 1PFKA 4F3YA 1U3UA 2F48A 3AF6A 2X42A 2WP8J 2GJAA 1N6PA 3ICCA 4ID3A 4HDSB 4KH0A 1KFJB 1TT7A 3I5AA 1V45E 3FB1A 4H4DA 2JBAB 1UBKS 2GLXA 4J1QA 3E1KA 5G1NA 3EQZA 1KQFA 4X3CA 4XEUA 4ZPJA 3P26A 5CVDA 1ZNXA 2OAGA 3M0EA 1VL0A 4CF6A 4QTZA 2RH9B 1UAGA 4YRJA 1YR8A 3I2FA 1KYTA 1U8ZA 2REQA 3UGJA 2SBTA 4PGAA 4GG1A 2ZP1A 1L8OA 1YQQA 3ZW7A 4C7XA 1ST3A 3PZRA 4LOLA 2V7QD 1U0EA 4L4RA 3AT1A 2MINA 4PSVA 2VYFA 4A27A 4ZMBA 2RCYA 1CYEA 4G5YA 1OPXA 3A6KA 3KUKA 3KV3O 4F71A 5AVQA 4CEIA 4E5UA 4BNIA 1KY5A 3OQNA 4NBLA 1KR5A 1K5PA 1NUAA 3K9BA 2PL3A 3NHZA 5J1SB 1LH0A 3QPVA 5DHQA 2OMEA 2ZT7A 3ROZA 3HRIA 3D6HA 4KRGA 5KNDD 1OX4B 1APBA 2EBHX 2Y0PA 2QP3A 2OQ2A 5K1ZA 4CKEB 5HFJA 1OXUA 3R8CA 3SGLA 1NYQA 3WB0A 3C98A 3SY8A 2B1QA 3N2LA 4DCNA 1LJ8A 1XD2B 3ZVMA 3UMFA 3BN3A 1IBKB 2IYUA 3QPUA 1N33B 4BU0A 2OXRA 5EYPB 5C5EA 2NZWA 4TZKA 3MELA 4URUR 2AJCA 1VL8A 2XWJI 2YVUA 3IA2A 3MT9A 2B82A 1NXQA 3QF4B 4XDGA 1T3SA 8ADHA 4YCLA 3M1AA 2UZ1A 1GN8A 4QOIA 4RHEA 1CDEA 1D2CA 3PGMA 4IXWA 1XC7A 3PDJA 1REQA 3MMZA 2J9RA 2F1IA 3N0TA 1ETHA 3IIKA 2Q0XA 3KE9A 1WXHA 3PEEA 3FW1A 3QVJA 5I9IA 1BW9B 3LWNA 2AZTA 1R4MA 3NKLA 5JV5A 5IS2A 2UVPA 3G49A 2WJPA 2HMSA 3DMNA 3OZVA 3OLVA 3OO1A 1KS9A 2OBXA 1EXDA 2PWAA 1ZGZA 3BSSA 1ZINA 1L9KA 1Z7EA 2QPOA 4XDYA 2L19A 1C9EA 2VJMA 4IXDA 3NBFA 4RZ2A 3GCGA 3GYBA 2VSNA 3IVRA 1XK7A 2AOUA 4UQOA 1WMBA 3CLSC 4RK6A 1NGSA 3R3XA 3K9FC 3A9VA 2A67A 2FDXA 3W6PA 2HI0A 2WZQA 1VBMA 1ZY2A 3A4TA 1QIFA 3G59A 3DQPA 4ASUD 4L9SA 3PLNA 1DEOA 1SN7A 1XCPA 4CQJA 4F5EA 1TKCA 5FBVB 3VU0A 4URXR 4LK2A 3UWDA 4M6WB 1VB5A 3T52A 2D5BA 2I8LA 2HB6A 1M7BA 2AMLA 3KEGA 3H86A 5EE1A 3UBTA 2WUGA 5CM2Z 2HPHA 2WTNA 4ZVSA 3OPNA 4UQPA 1P0MA 3TSWA 2FK8A 2QYHA 3OUUA 2ZSBA 5FA8A 2C7QA 2OHVA 4S1NA 821PA 3ROMA 5TC4A 4QUIA 2E1RA 4TZ6A 4PX5A 2H5JA 2A0FA 4OLJA 2EGHA 3ZJUA 2JAQA 1YUBA 4FLFA 1HYEA 4QHSA 4ZVNA 4WKBA 3LC2O 1PR0A 2QD2A 1HWYA 3WGUA 4OG2A 3UWOA 2HRDA 2P77A 4C88A 1QIGA 1TCVA 1Z0UA 4BNVA 4URZR 1XU9A 3LPMA 1SMKA 3G9ZA 4UMDA 3D8SA 2YFQA 4E7OA 4LKRA 3T3HA 1RBQA 2VDMB 5BSHA 5I9NA 4R84A 1C7FA 4ESVA 1TJPB 1URPA 1Y5MA 4RADA 1ECLA 4YCBA 1J09A 5EL0A 3CLVA 1UKEA 2IYOA 2P9BA 3I64A 3SYMA 4U9IS 3IIIA 1J97A 3ZWWA 1SVUA 3KEFA 3UFBA 2CUKA 3EF1A 4PN3A 5DEOA 5EIBD 2J9ZB 4V24A 2QX7A 2W6ID 4DR7B 3O38A 1UPXA 1XXHE 3I8SA 2WT4A 1U81A 2AZ4A 3ORYA 3N58A 4YLGA 3U3KA 3AIKA 3WBJA 4Q6BA 1NW3A 4D82A 4DJJA 4KVGA 1SCNE 2FNAA 4JYMA 4JGIA 3V4SA 1K6IA 4RK0A 4AZTA 4IDBA 1EWRA 1WB4A 2PSFA 3N2NA 1IY9A 1U9JA 3H5LA 3DPSA 5B2ZA 5EJGA 3VFDA 4DIUA 5L95A 3DNFA 4H4EA 2AZXA 4QBHA 1XCGB 3BKXA 3BTVA 4QEKA 3ZEIA 4BNXA 3O91A 5KHLB 3WAJA 3E81A 1XWFA 4KLAA 2BTQB 4G97A 2FUG6 2IXFA 2IFTA 2HLPA 1R0RE 3WRVA 4UU8A 3L1IA 3S27A 4UTVA 2NQ8A 2HC9A 1O6GA 1T6BY 4R4JA 4QLBA 4QO7A 3ZD9A 3GFGA 3GLUA 4IR7A 1BWPA 4YO8A 1NLYA 1X7HA 5CFMA 5EEGA 3BSWA 4KOEC 3TK1A 3VZRA 3H1TA 4E5NA 4F3CA 2BKLA 2ZJBA 3MWDA 1GSOA 4LXHA 2MYUA 5M29A 1DJQA 3CEMA 5EP1A 3RS5A 3CC8A 4BAGA 4JEMA 1NZJA 3F46A 3I8XA 4XH9B 5IM4A 2BGRA 2BEUA 3EGDB 4S0ZA 1ZM2A 5FTWA 3ZN2A 3SQMA 3WIDA 2AVDA 1VCNA 3NEPX