3ITDA

Crystal structure of an inactive 17beta-hydroxysteroid dehydrogenase (y167f mutated form) from fungus cochliobolus lunatus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
260
structure length
260
Chain Sequence
b'YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLFSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-Hydroxysteroid dehydrogenase
molecule tags Oxidoreductase
source organism Cochliobolus lunatus
publication title Structural studies on a fungal 17beta-Hydroxysteroid dehydrogenase
rcsb
total genus 105
structure length 260
sequence length 260
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3itdA00
4B7UA 5L40A 1YH3A 4CQLB 4IGEA 3DZIA 2CVZA 4ZJUA 5DBGA 2GCGA 3MTJA 3ULKA 5JCXA 1H5QA 2ZATA 2HDHA 3D4NA 2Y0EA 4L73A 4FOSA 4I5GA 3OJLA 1A9ZA 2H5LA 3DMTC 2FR1A 3E48A 3SBOA 3SXPA 1P33A 3QWBA 2H9IA 2AE1A 3U49A 3EAGA 1LBEA 3FHLA 3CTMA 4GGPA 3ST7A 2EIHA 4EJ6A 1DC6A 2ZB7A 3I4FA 2FPIA 1NQTA 5F21A 1R16A 3GN2A 3NAQA 3HWRA 4AJKA 4D3SA 1D8AA 1YL5A 3JYLA 2DPHA 4RVHA 4UUOA 5DDIP 4XWYA 3MJCA 3STHA 2DUUA 3GHYA 3V5NA 1MXHA 4IPTA 4XKJA 3FPLA 2DLDA 1U28A 4MVJE 4PIVA 2ZQZA 3QA9A 2P9CA 2GASA 3BXXA 3U5TA 1EE9A 4EBFA 3WICA 4AFNA 1VL0A 3JYPA 3DOCA 1Y8RA 1W6UA 2WD8A 4U7WA 1UR5A 1IL0A 1O8CA 5CHEA 5CFZA 2J3JA 3H7AA 3BIOA 2BFAA 3RD5A 4YQZA 2EWMA 1YJ8A 1U3UA 4J0FA 1TI7A 3DONA 4BO6A 1CETA 1HZJA 4HV4A 1C0LA 4DVJA 5KVSA 2ZTMA 3RCBA 4J7XA 3HUDA 2VHZA 3E18A 3RJ5A 1OOEA 4IQ0A 4OM8A 5IF3A 1HDCA 1NVMB 4XB2A 2P4HX 1NPTO 2PH5A 3L4BC 4UVHA 4YACA 4NIMA 4OL9A 2B36A 3KLPX 3QE3A 2PWZA 3GGPA 4QO8A 4QXMA 4NU6A 1EBUA 3S8MA 1Z7BA 2EV9A 3I3OA 5CAEA 4MVJF 4ZRMA 2EGGA 1T2AA 4XR9A 4BNMA 3OIFA 4ZGWA 1D1SA 1BRMA 2PZLA 3G0OA 2HQ1A 4NK4A 5KVCA 2PD4A 5C7OO 3GVPA 1X13A 1CYDA 4IQ8A 5AYVA 1XCBA 2BLLA 3HJAA 4TVOA 4URFA 1BVUA 3IC5A 1HE5A 2UUPA 3HZZA 5G0TA 3KSUA 4NJMA 4WLFA 1GUFA 5CDUA 1JAXA 1ARZA 3OMLA 2X7HA 3TPCA 2WWRA 2IZ0A 1PJ4A 1PEDA 1MC5A 1M76A 4MVJM 4PLGA 3IIEA 2QQ5A 4QEDA 1ZSNA 3QVSA 2VRCA 3U4IA 4XQCA 5IFLA 1U3TA 2D0IA 3EC7A 2EKQA 4G5HA 4BMVA 2HRBA 4Y9DA 2NM0A 3PIIA 1DPGA 4XR4A 3RUCA 2AA3A 3AI3A 3L4SO 3F1LA 3AOEA 4XYLA 4AJOA 1U3VA 1V3VA 2G82A 4NU5A 3GVCA 1V8BA 3OECA 4WCFB 2QX7A 4XEHA 3N74A 4Q3CA 4EYEA 3TZ6A 1W0CA 2GGSA 1KIFA 3RQSA 1BSVA 1VRWA 4RPJA 1KETA 3CMCO 3LC2O 3EVNA 4N5NA 6ADHA 1EMDA 2Y99A 3G79A 4ZICA 5EN4A 4DPMA 1CQIA 1M67A 1MC4A 2NQ8A 3QWAA 1MV8A 2PA3A 5L4NA 1E7MA 4H7PA 4TRRA 4NBUA 4CQLA 2WM3A 4IM7A 4YAGA 1ZVMA 4YRDA 5FF9A 3RUEA 3M1AA 3HFGA 2NU6A 4L74A 4A0SA 1E1NA 1XSEA 1YOVA 4YRBA 1BXGA 1V6AA 2VRBA 2DTXA 4J16A 4ONEA 3VPSA 3F4LA 1DIRA 4CODB 2JHGA 3LLSA 3RVDA 4FFNA 4L4SA 4MKRA 4XA8A 4CM7A 4MIEA 1RPNA 3F6YA 1HXHA 4ND1A 4O63O 2E82A 3GNSA 4PLHA 3IP3A 1E3WB 2VWQA 4CR8A 3WJ7A 4M8SA 1EZ4A 1PJ2A 3UW3A 1K6JA 4C4OA 3HHPA 3JSAA 3SVTA 1DFHA 1JAYA 3INTA 4ALLA 2EW2A 1T26A 2OO5A 4GL4A 3C85A 4BB6A 5ILOA 3EY4A 3ZU5A 5JCJD 3C7CB 5B4VA 3RKRA 3V1TC 3AUTA 3BMNA 5IDWA 3FNFA 3I9JA 1EEHA 3EUWA 4YWJA 1SBYA 2VHXA 4OKNA 2DU8A 2FPPA 5LC1A 1DAPA 3PVZA 3W6ZA 5FWNA 3L07A 1M66A 3I6IA 2QRKA 1EK6A 4TWRA 1Y9AA 3QLJA 3OEWA 1YRLA 1TT7A 2B69A 3ZWAA 3DZHA 5JMWA 2D4AA 4XJTA 1CEQA 3BYZA 1RJWA 3D7LA 3NX4A 5EL0A 1U8XX 2G0TA 2P4QA 3IS3A 1DSSG 1PGOA 3MOIA 5COQA 3LF2A 2Z95A 1NQOA 3FWNA 3JQFA 4RF5A 1GAEO 1MFZA 5ITWA 1YB4A 1V0JA 1KVSA 2NLOA 1ZSVA 2PGDA 2PY6A 1E3LA 3DO5A 3V1UA 4E3ZA 4AJ1A 4KOAA 3ZHBA 4YJDA 4GVLA 3PPIA 4M49A 1CERA 4E33A 3DB2A 4FFLA 3T4XA 4BGVA 3H9QA 4XYMA 1BW9A 2HK9A 1ML3A 1DC5A 3BAZA 1P1JA 2YFQA 2Q50A 4HUJA 1YVEI 3H6KA 3PGJA 1LSOA 3ROPA 4Q3BA 1X1EA 4RVGA 1H2BA 4XJSA 5DCYA 4WE3A 4RZIA 4PRLA 3KV3O 1U3WA 2O3RA 2DBZA 2X8LA 1SC6A 2BGLA 4ZRNA 3AFNA 1F17A 3OQ1A 4BO7A 4GMFA 3QV1A 1LDNA 3ETDA 3H9UA 4OXKA 1HRDA 2O23A 1VC2A 3FNGA 4IS2A 2O48X 3RBZA 3WLEA 1UXKA 3KYDB 1P9LA 4O1MA 4HNHA 3RASA 1T2EA 1ZK2A 3R6DA 4E30A 1HDRA 3PJEA 2IYPA 4CLHA 3GZNA 1IULA 4RVDA 4QUKA 5F1PA 5KKCA 5L9AA 2IE0A 4IJWA 2FZWA 1YKFA 2I3AA 1YQXA 3DAGA 1Z6ZA 2ZYDA 3GK3A 3D1LA 4I5EA 3JTMA 4J9UE 4TZTA 3CE6A 5EIOA 4CV2A 2W90A 3NDJA 2GN6A 4R5HA 3WYCA 1GD1O 1L7DA 4LN1A 4IXTA 4RORA 1VJ0A 3WIDA 3KO8A 4IGFA 1TT5A 2X0NA 2Y1DA 5KCZA 3AUAA 4PG7A 5A5EA 3IDSA 3RBVA 2ZB3A 3EVTA 1DLIA 1O95A 1R4NB 3LLVA 1BXGB 1YOVB 2PFGA 5DN9A 4DMLA 1GFSA 2VUUA 3VC7A 3PK0A 4QFCA 3SJUA 4B79A 3VPXA 5DP2A 2Y1EA 3GOHA 3A14A 1RKXA 4LSWA 2OORA 4CL8A 1PJ3A 4D43A 1DLJA 4FC7A 1C1XB 3WMWA 2X9GA 1LRJA 1QYWA 3KB6A 1LSSA 4WNCA 3ZN2A 3ZWYA 3ON5A 4AICA 3KSDO 3VDRA 1ZK0A 2D5CA 4MVJA 3PEFA 1EBFA 4UEKA 4BGEA 4CV3A 4BQRA 3C8MA 2X86A 3FPCA 2P5YA 4UEOA 3HSKA 3HFSA 4AJIA 4BHTA 4R69A 4FOOA 5DBFA 4B7XA 1BWSA 5B12A 3ZWBA 1PGJA 3AWDA 4GSKA 4IDGA 4QSMA 4WCFA 2IZZA 4GSLA 2ZJ1A 1PWXA 1SB8A 4E31A 3T7CA 5C7LO 1E92A 1GYQA 1KYQA 3CEAA 3A06A 3SX2A 2YV1A 2EJWA 4OJNA 3CSDA 1X14A 4FFMA 4ZQBA 3C7DB 1UAGA 2E6UX 2GYYA 2P9EA 4JJIA 1GPDG 1LSJA 1S6YA 2CVOA 2EKLA 2GSDA 1T4BA 2UV8A 1SZJG 4CMEC 3B1JA 2Q2WA 4IS3A 5HS4A 3TNLA 4E0BA 2OBYA 4CL3A 1ZJYA 4TKLA 4BO0A 2POQX 4YRAA 5IZCC 1JWBB 2R00A 2P91A 4OSOA 3UXYA 3TF5A 5THKA 4B8WA 2FR8A 4LVUA 1F14A 1OAAA 1IE3A 1P74A 3WIEA 4IDDA 2V6BA 1LDMA 3HB5X 5I9LA 4JJGA 3W4IA 3NTQA 1MFPA 4PFJA 3IQDB 3KBOA 3D64A 4I9NA 1H6AA 2JCYA 3TZQA 3B1FA 2B0JA 4NPCA 4MP3A 1ENOA 4CMEA 4DGSA 3QSGA 3LDHA 4O6VA 1OZAA 3DMTA 1FDSA 1I01A 3MJEA 4OH1A 1M6WA 1QP8A 2YY7A 1ZEJA 2Q3EA 4JJFA 3WYBA 4CMJA 2GERA 2X9VA 3ZHXA 4K6FA 1ZXBA 1TA4A 1KY5A 2OBNA 1GR0A 3H9EO 5F5LA 3RUHA 2A92A 4BGIA 1GY8A 4E21A 3ZCXA 3AM5A 3AM3A 4XDYA 2YJZA 3OM9A 3LT2A 1N7HA 4I9HA 4HFRA 4RF2A 3EZYA 1H6BA 3H5AA 4KWIA 3P5SA 4TRJA 4WUVA 3ITKA 1KVTA 3M2TA 2WJPA 2O4CA 4TRNA 4WJZA 4ALJA 2QRJA 4YJFB 1JDJA 5IDQA 4NG5A 4MO2A 2HMWA 3MJTA 4BNTA 5H83A 5HS6A 4RJTA 4J90A 1ADBA 4RPHA 2DTDA 1XKQA 4CV0A 4DPKA 4BNUA 2HLPA 5A04A 2CDCA 2A9FA 1GQQA 2I67A 4JK3A 5COBA 2WSBA 3QY9A 1P77A 1QV6A 4QQRA 3PDUA 3NTRA 1U9JA 3ROKA 3I52A 1R4MB 1ONPA 4YEDA 4J49A 4OXNA 1A5ZA 1OFGA 4WPGA 2C7GA 4U0KA 5HBRA 1ZUD1 2VUTA 5CG1A 1SEVA 2Q46A 4FQ8A 1E3EA 3PJFA 4HX5A 3H9JA 3UCXA 2J6IA 2PD6A 3KYCA 4YAEA 4R1SA 1XG5A 1DO8A 1WDMA 3E03A 4CPDA 5IG2A 1OI7A 2IDZA 3ZV3A 2CFCA 3U4HA 3GUCA 1T24A 4GX2A 3I9NA 3KEOA 3G17A 1G0NA 1KEPA 3D3WB 3WSWA 1U2DA 2RBEA 4NR0A 3H5NA 2BKAA 2W2LA 4R1UA 2AG8A 1EQUA 2AW5A 1E3IA 3BMCB 1JU9A 5KNLA 4CLOB 1H93A 1OC2A 1WLYA 1F8GA 3AK4A 4IBOA 2SCUA 2O50A 1KC1A 5COAA 4U5QA 5I7SA 5A9SA 2TMDA 4KUGA 1DJQA 1C0PA 4NBRA 5ILGA 1XU9A 3ZU4A 2GZ1A 3KETA 3Q1LA 1JTVA 5JYDA 1LI4A 3ZU3A 3GT0A 1SB9A 3ZV5A 4PLVA 2EGHA 3HN2A 1H6CA 1O94A 3WTBA 2Y93A 1HDOA 5KWEA 1DIHA 4FPXA 4CUKA 4NH4A 3TDKA 4WOKA 1E6WA 3GLQA 1Z82A 3BHJA 1SOVA 1PJCA 2OP0A 3VH2A 2H6EA 1RM0A 2C7VA 2DAPA 5FI5A 2NQTA 5KVQA 1E5LA 2J8ZA 2I65A 3R1IA 2DPGA 1ZCJA 2BRUA 4KMSA 1RYEA 1YQDA 2J3HA 3WGHA 1PJSA 5G4LA 1WMBA 1HE4A 1N8KA 4YXFA 3TN7A 1YONA 4BNIA 1IOLA 1K6IA 1HEUA 2HUNA 3E82A 3QJ5A 1Q0QA 5IN4A 1ONNA 5F5NA 4J1NA 4BNJA 3ANMA 1BXZA 1WWKA 1E3SA 5IJZA 4YT8A 1CQJA 2NUAA 4RPGA 1C0KA 3JQAA 4E2ZA 2YDYA 2WE7A 3KZVA 2VRCD 2EP7A 4ITUA 4P4GA 4MJLA 1WDLA 1ZSYA 4AL4A 4YQYA 3NJ8A 5A4DA 5CEFA 5MGBA 1G0OA 2Q4EA 4KZPA 3HADA 4H16A 1CWUA 1YL7A 1UUFA 4DMMA 3ROMA 1Y9EA 5TJHA 2PK3A 2VOJA 3NYWA 3C7AA 1ADCA 1QLJA 1I2CA 3PWSA 3JD3A 5CPFA 1GCOA 5TSDA 1I8TA 2VNSA 5JY6A 3Q9UA 4OAQA 3VZPA 2E48A 3PTZA 1A7AA 4JXKA 5AVOA 4XYBA 3PIDA 4R3NA 5T64A 2G1UA 1PU2A 3UCFA 4NHEA 1T1SA 2D1YA 3RC1A 1JN0A 1PGPA 4ZA2A 3P19A 5DNAA 3GN1A 1XQ1A 3GFBA 4BO1A 3JQ7B 3DHEA 2VNAA 5A1TA 4IJUA 2HJSA 1PJBA 4R51A 4CM8B 1M75A 3BTVA 1NQ5A 4BKRA 1K89A 4A2CA 2VT2A 2XXBA 4R01A 3UVEA 4IY1A 1E6UA 1SAYA 4D41A 3JD2A 5LCXA 1UAYA 1FDVA 1MG5A 2BGKA 4RDHA 3VTFA 3RWBA 1ZFNA 1R0KA 1VLLA 4HY3A 4OQYA 5L4SA 2DBVO 3PYMA 3JQDA 2CF5A 2PNFA 5KKAA 3LC7O 4DPLA 2HSDA 3LSYA 1SPXA 3PQFA 3GNQA 2FR0A 5JO9A 3NDIA 5G2OA 1LLQA 2FHSA 3MWEB 3PXXA 5CP8A 4E6PA 4UEJA 3ZWMA 2YHUA 2VWHA 3DAPA 2DC1A 2VCYA 2RH8A 4J0EA 5BQFA 4B3HA 1TVEA 3M2PA 1LLDA 5KJ1A 3DFZA 5KOIA 3MCVA 4PZCA 5JSFA 1U4OA 2G5CA 2QRLA 3N7UA 4FW8A 1E6EA 2O4UX 3DZFA 2GN4A 4QECA 4CR6A 3QIVA 1SO8A 1NXQA 3HDHA 6LDHA 5CDGA 1GZ4A 3CINA 2NNLD 4ND4A 4S3MA 3QRWA 1QSGA 1YE3A 3GDFA 1CF2O 2R00C 2Y05A 4OGWA 1YDEA 3RBXA 4AJHA 2NSDA 4F3YA 1NPYA 4CMCA 5B4UA 4MVJH 3F3SA 3GG2A 5GMOA 3DEYX 1P44A 2PLAA 1Z7EA 2H63A 2YQ4A 2BFPA 1PL6A 3GEMA 3I6QA 4NQZA 1GV0A 1U7TA 1XLTA 5A9RA 1J4AA 3H2ZA 1GPJA 4BVAA 2UAGA 3WGGA 4L8VA 1H0KA 2PZKA 5T8KA 2DT5A 1GV1A 3CZRA 4LGVA 3KOUA 2ILTA 3TOXA 3TWOA 1E3JA 3H65A 4NJOA 2PGJA 4CM4B 2BHLA 4GX5A 3JYQA 4YPOA 1QYVA 5G0UA 4DREA 3GQVA 4D42A 1HE2A 3U0BA 2GR9A 5AXCA 4R9SA 2E4AA 5TT0A 1EVZA 4I08A 3QWFA 5JDIC 3AU8A 2JHFA 1A4UA 4WECA 2JD1A 2ZJ0A 5IDYA 3ADPA 5TX7A 2NTNA 3BMCA 1KOLA 3SC6A 4WLUA 1E0DA 4KUEA 4XYEA 3K5PA 2BFMA 4LK3A 1ZK4A 3DWFA 3KRTA 1GUYA 4EUEA 4CM3A 4JP3A 1X7GA 4WLNA 2W8ZA 5F1KA 1EVIA 4R3WA 4HADA 1PJQA 4XIYA 1QMGA 1EVYA 1U5AA 2NVUA 5IDXA 2PKQO 4JCOA 4TQGA 3WGQA 4DXHA 2LDXA 3DZGA 1I30A 2OOSA 1HL3A 3GFGA 5HA5A 4WCDA 3MEQA 4GMGA 3SLKA 5G0WA 4OOEA 5G4KB 2WE8A 4E13A 2I99A 1BVRA 5TLSA 5T57A 4RL6A 1K6XA 4E5NA 1Y8QA 2DFVA 2RAFA 2W4QA 4KWHA 3AY7A 1Y5RA 5ENVA 3TZCA 2VYNA 2D59A 4BO3A 1PL8A 4X54A 4F6CA 1T4DA 1UH5A 4AG3A 2CSUA 4CMAA 3NUGA 3ONFA 1NFFA 2FMUA 4D45A 4ZN6A 4IMPA 3WTCA 2OUIA 4PLFA 3WGYA 1XU7A 4NFYA 1HDGO 4QT0A 2CY0A 1ZZEA 2VWGA 4GGOA 4W99A 1PS8A 3UFXA 1P0FA 1WZIA 2O3TA 2OGUA 1Y5MA 3BTOA 3L6OO 1ONOA 2NTVA 4XD2A 2YDXA 3JQCA 5DBIA 5B37A 1N1GA 3WR5A 5A5FA 1CRWG 1DOHA 2B4QA 3IL2A 3I9MA 2VZ8A 2EERA 1A27A 1NAHA 2Q2VA 3HNPA 3Q9NA 4EUFA 3K2EA 2OHXA 4BO5A 1NR7A 1I5RA 1QYXA 3A4VA 1LEHA 1AXGA 5KJ6A 4NJMB 4DIOA 1ZO8A 4GKBA 1B0AA 3OEYA 1R0SA 1DDOA 4GQAA 4YT2A 1AN9A 2NWQA 4MDHA 1EVJA 4WLVA 1ISIA 4FSHA 1X0VA 3DZBA 5AXAA 1ISGA 1ZEMA 9LDTA 4II3A 1FXSA 1P45A 3QWIA 1RWBA 1ZNQO 1MG0A 4CM5A 4II2A 5GY7A 4KQXA 3OA2A 4PG6A 2XPCA 5G0VA 1D1TA 3HB4X 2I3GA 4BNHA 1XYGA 4XRRA 1VM6A 2VHVA 3ZDFA 5DULA 3WQSB 1HZZA 5GZ3A 2UYYA 3D4OA 5IAAA 2NVWA 1B8UA 1U4SA 3BTUA 1XDWA 4JBIA 3W8FA 4DRYA 1L7EA 3JYOA 3FWZA 4DYVA 2GD1O 4CMBA 4CV1A 2C82A 3Q3CA 4M89A 4MVJI 5BR7A 3KEQA 4Y6SA 1ZKMA 1NQAO 2AEFA 5L51A 4GVXA 4BNFA 1IZ0A 2AEMA 2CDBA 2X5JO 5ENDA 5IXSA 1ZMOA 4DQXA 1M6HA 1YDWA 3JQ8B 2VYVD 2BELA 1UDCA 2HMUA 3NRCA 3U9LA 4P38A 3AY6A 4N7RA 3FNEA 5JAZA 4BNNA 2Q99A 4L4RA 3CMMA 3ZNPA 5CG2A 4FDAA 2Q1TA 1SOWA 2WTBA 3JQ9A 4XQGA 3MJSA 1VKOA 3CXRA 1E1LA 2X22A 3O9ZA 3LT0A 2ZTLA 5JCJA 1R37A 4A27A 4CLOA 1SNYA 1ORRA 4YJGA 1PTJA 2LDBA 3W8DA 5G0SA 1QLHA 4S1VA 1UZLA 1HDXA 5BSGA 1FK8A 2W2LD 3PFFA 4R1NA 1NYTA 4TROA 1LA2A 4CJXA 7ADHA 3KLMX 4DQVA 5U9CA 4N5LA 1NP3A 3WNVA 3MTGA 3TZKA 4GKVA 4FS3A 4Z0PA 3INRA 3GNTA 1LX6A 4UVIA 1LXCA 1DHRA 1R0LA 5FYDA 3WYEA 3ETGA 3DOOA 1IZ9A 2QG4A 3GEGA 3K73O 4ALIA 1C14A 1N92A 3LQFA 3DC2A 4ROSA 3OQ6A 3WS7A 1DIAA 2AE2A 3CKYA 3ENKA 4BIIA 1HYGA 1YGYA 4DQUA 3NT4A 3RJ9A 3ETEA 1I10A 2JCVA 3QHAA 1B26A 3L9WA 4M54A 3RSHA 2VQ3A 1GZ3A 4CLEA 4MIYA 3ORFA 1IPFA 4J4HA 4H3VA 4FBGA 1I2ZA 4Z0TA 2O3QA 3RKUA 3HDJA 3A1NA 5CEEA 5TIIA 4NBWA 4WEQA 2OZPA 2CMDA 1K0UA 1YQGA 2Q4BA 1RM3A 5I7VA 1GL3A 3EYWA 1ADFA 3GH3A 1O6ZA 5IN5A 4DWVA 4BNVA 2BD0A 2YW9A 3TFQA 1YB1A 1PWZA 1H6DA 3RFVA 4I1IA 4RF3A 3DFUA 4BKUA 2X6TA 2OP1A 2QHXA 5ICMA 1QYCA 3TRIA 3WOHA 3K2BA 3OQBA 4KQWA 2BF7A 1O89A 1B3BA 3MJVA 1ZIDA 3OH8A 4CM4A 1EDOA 3X2FA 1DXYA 1IB6A 1Y1PA 3GAFA 3UICA 4ZHSA 4K1LA 2AQ8A 5A06A 2J5KA 2Q49A 3DDNA 2RCYA 4U6SA 2UVDA 1NNUA 2XOXA 4D7AA 4DYDA 2HJRA 2D5AA 2P5UA 4J1QA 1HETA 1NVTA 1PZGA 3OJOA 4FJ2A 2BGMA 2ZYGA 1JW9B 3RROA 2UDPA 2HK7A 2I6TA 4Z3DA 1B8PA 1FDUA 3KUXA 4D3FA 1P1FA 2HRZA 3PDJA 3OJEA 2FY8A 3BMOB 3BTSA 1T2CA 1O0SA 4J3FA 4K28A 3OF2A 1GEEA 1DRWA 1UP4A 4FGSA 1BTOA 3GDGA 1NTOA 1L1FA 1KEVA 4AJLA 2ZTUA 5ES3A 2IXBA 5ER9A 3BMNB 3HN7A 3LT4A 1PZHA 1Q1NA 2J5RA 4GI2A 1NX6A 1R66A 3RU7A 4RDIA 1XWFA 4BNKA 3EHEA 2DTEA 2AQHA 1PGQA 3PWZA 4R1TA 1C1DB 4PZEA 3NKLA 3R3JA 4RV9A 2C2YA 3SEFA 2NU9A 3GVIA 4Q3EA 1OC4A 4YJHA 3JQEA 3GPIA 5MDHA 2O7QA 2UUOA 3IJPA 4CMIA 1VI2A 2IODA 1V35A 2X9NA 5KJCA 5AOVA 3ZHZA 1JA9A 3CUKA 4U6QA 1HDYA 3QVOA 3VDQA 2H1SA 4L9RA 4UVDA 5AQ1A 5JXWA 1E5QA 5JDCA 3DBLA 3RUDA 3W8EA 4FR5A 5CDSA 2G17A 5HTOA 4FJ0A 1NPDA 1C1XA 2Q1SA 3E5RA 3TJRA 2YHIA 3IOYA 2PR2A 5L7YA 4LSMA 4A7PA 4BS9A 4YBZA 1PQPA 2ZQYA 4YAKA 1IHXA 3QQPA 4YAJA 1ZBQA 1Q7GA 4NFSA 3VAZA 4CM8A 4Q9NA 5K9ZA 1I32A 1X0XA 1I33A 1N1EA 3WX0A 4HXYA 2O3JA 4R9RA 5JPIA 1IUKA 3DOJA 5BT9A 5K6AC 2YHIB 3C1TA 3WGZA 4CM6A 1ID1A 1WNTA 5U1PA 4AJPA 2AG5A 3R3SA 3PP8A 1C1DA 3D3EA 3DBHA 4RPLA 1DRVA 3JQ9C 1Q7BA 4MOWA 3DHNA 1XGKA 4O5OA 1P0CA 3AW9A 3TL3A 5JE8A 2B4TO 4CQMD 5L7TA 1AE1A 1P3DA 4QO7A 1I2BA 2JKVA 4TZKA 1HE3A 4CUJA 1KS9A 4K6CA 5JYEA 3VZRA 1Z73A 4IINA 4Z6KA 4BMSA 3IP1A 3RU9A 2JL1A 3NT5A 3QVTA 5TJ9A 1TLTA 3FF4A 3DL2A 1I3KA 1LDBA 2JFFA 2FZEA 1I3NA 2J5QA 1LRLA 3UKOA 3GAZA 1RM5A 3PZRA 1PQWA 1UDAA 4WLOA 4BKOA 1F0YA 4J6FA 4GX1A 4E5MA 1PIWA 2GZ2A 3RFXA 3W4KA 2VHYA 3D4PA 4KP7A 1F8FA 2Z1NA 3LVFO 3MWDB 1ZK1A 2A94A 4PN3A 5KJFA 5JS6A 5LDHA 3ZV4A 5L95A 1LDYA 3N58A 4TRMA 5C5IA 1V3UA 1XELA 4FIZA 4RGBA 3WFIA 3OETA 3DBRB 4H15A 4IDCA 1BW9B 3HDYA 4UUNA 2C07A 2GLXA 3RUFA 2E49A 1A9YA 4BO9A 4JGBA 2NU7A 1GQ2A 1DB3A 1FF9A 2I9PA 2X1HA 4GLLA 4DC1A 1XR3A 2D3TA 2ZB4A 3KXDA 1LQUA 4L4XA 4UUPA 2C5EA 2YFHA 4J91A 4RZHA 4F6LA 2GN8A 2V6FA 2WYUA 1ISMA 1E7SA 2RHCA 3AY3A 2F00A 4OIMA 4L76A 4Z9XA 5F1OA 3FBGA 2WDZA 4J2HA 2C29D 4EJMA 3GVHA 3WBBA 3FNHA 5L4LA 3GDOA 3UAGA 4Z9YA 3U62A 2D2IA 3WQRA 4D0RA 3PHHA 1YBVA 1W73A 2C5AA 5FFFA 3OHSX 4G81A 5A9SB 2DM6A 2PKRA 2CUKA 1OMOA 1BXKA 1Q7CA 4CQMA 2GRAA 3L4BA 2XXJA 4OO3A 3B20A 4WGGA 5DCUA 3TOZA 1AUPA 4OQZA 4CMHA 2Y1GA 4PLZA 4OKIA 4TKMA 4P8RA 2YYYA 4YA6A 5F3RA 3UH1A 3FN4A 1KEWA 5TRTA 1WDKA 3ROQA 1Z75A 4UAGA 5CDYA 5I9NA 4CM9A 1ENYA 3G3EA 3NEPX 2QYTA 3GC6A 3I9LA 4LRTB 4OYRA 3FTPA 4UULA 1IPEA 4HP8A 3JQ6A 3W4JA 2ZK7A 2IRWA 4EUHA 1LLCA 3L6DA 3O8QB 3R0IA 2NACA 2E37A 4E12A 1JLLA 1PGNA 4GBJA 5EINA 1RYDA 4L0QA 4ND3A 3S1LA 3JQGB 3JD4A 4DL9A 1PL7A 1B7GO 1YBMA 4HBGA 2GDZA 3KSZO 2C2XA 3U3XA 2DKNA 4Y67A 1NBOA 2EJVA 3SC4A 2HU2A 3JQBC 5KVVA 4GH5A 3KHUA 2QZ9A 3RAJA 1HSOA 2Q1WA 4J7CA 4IZIA 4FD3A 3IMFA 3PFWO 4O59O 5DT9A 3IUSA 5EPOA 1ULSA 3LC1O 3AOEC 1R15A 5TC4A 4IDAA 5JY1A 4BOYA 3PZBA 1GZ6A 4BKPA 1UZNA 5L7WA 4ZQHA 2PZMA 2QIOA 2YZ7A 1EE2A 1MX3A 3ZV6A 1PSDA 2EG9A 1KERA 3OA0A 4MP6A 1DC4A 4BNLA 4XGIA 4JN6B 1N5DA 4BO4A 4CLDA 4YT5A 1H9AA 3FD8A 8LDHA 3K96A 4W7HA 3UN1A 2FRDA 1GQYA 3L0DA 2AMFA 5CPBA 5FEUA 2X5OA 1P1RA 4UUMA 1N9GA 1H2HA 1EUZA 1XA0A 2HK8A 3VVCA 1I36A 4N18A 4RO0A 2VUSA 4UVEA 4MVJP 3DTYA 3QVWA 3DAFA 4CLRB 3HG7A 4ESOA 1Q2XA 4C7JA 3DBRA 5TT1A 2CZCA 1LDEA 1DRUA 4LRSB 1MUUA 1T1RA 3DXFA 3QWHA 5GZ1A 1QG6A 3IJRA 1YXMA 5IXYA 1PX0A 5DF1A 1LRKA 1I0ZA 1Y7TA 2EHDA 4EJ0A 1NFRA 5A9TA 3ZWOA 3WJAA 4A10A 2D8AA 4P4LA 2OMEA 3WWYA 2V6GA 4M55A 3ANLA 1HDZA 4PZDA 2W2KB 4U8GA 5TF4A 4AJ2A 4ALKA 5DP1A 3VH1A 1BDMA 1K5HA 3GA0A 2GPTA 4YAIA 3GY0A 2CVQA 4PG8A 4XQ9A 1PJLA 1IYZA 2FOIA 4Q3DA 1PQUA 3ASUA 4NI5A 3W1VA 2Y1OA 5JFOA 3GHHA 1WXDA 2FSVA 3QVXA 4I5DA 1UXHA 1G1AA 1SMKA 7MDHA 1U2GA 1YWGO 1JKFA 1XQ6A 3H4VA 3DBHB 4EI2A 3I4CA 4D0SA 1EUCA 3T7EA 1Y6JA 4D46A 2O3UA 1Y8RB 2P68A 5I8WA 5JAMA 3VPFA 1LTHR 3W6UA 1MB4A 1YB5A 5EERA 4KTVE 2VZ9A 5EQDA 1B15A 1UDBA 2FN7A 3KTDA 2ZKLA 4RF4A 2PV7A 1GCUA 4E32A 2HO5A 2JFHA 4BV9A 1Y8QB 2NTJA 4IXWA 3NV9A 4KDEA 2OXIA 3B70A 3IKTA 3GMDA 1BG6A 2X5KO 4LW8A 1MXFA 4TSKA 4B4OA 5C37A 1LDGA 4MKXA 3I9OA 4M1QA 3H8VA 4P4NA 2ZYAA 4MINA 4KTTE 4DBZA 1P1KA 2Y66A 1R4NA 1KBZA 4FFRA 4LMRA 4E2WA 4RLSA 2P9GA 3ZWNA 2NADA 4BNWA 3GZ4A 2JAHA 1TT5B 2P2SA 3L9XA 4YJHB 5G4KA 2QZZA 5BNFA 3BZUA 3AI1A 3FBTA 1NVGA 1HF3A 4PCVA 1GUZA 3L77A 4GLOA 4JQCA 1TXGA 4ZVVA 2ZTVA 3ITDA 4W6ZA 1NM5A 4OMUA 4I8XA 4N5MA 5A05A 2X0RA 4ZU3A 1KVUA 2NVUB 1DIBA 4INAA 3FR8A 3JD1A 4FFOA 4CMIB 1U1IA 2VYVA 1ENPA 3AI2A 4PGFA 4TVBA 3BHIA 2DVMA 3ZI0A 4BL5A 4JP2A 4ALNA 4MPDA 2BMAA 2Q2QA 4FCCA 4LVCA 4DLBA 3HDQA 1K2WA 2ZCVA 3KYDA 1ENZA 3BMOA 3LK7A 5THQA 3RUIA 4XGKA 3F47A 3I83A 4DIBA 2X4GA 3NJ4A 2PTGA 2V65A 3ZU2A 2NV6A 4UVGA 3I5MA 3LYLA 3H2SA 3D5TA 4IJVA 4CMKA 3JV7A 3VHRA 4RVSA 3VVBA 3CIFA 4MVJG 2PKQP 3WGIA 4RQTA 4MP8A 4B8ZA 3DR3A 3H3JA 3O03A 5JBIA 1LQTA 1UXIA 1PJTA 4PLTA 3D5QA 4HKTA 3E8XA 5DOVA 4BV8A 3FTNA 4BO2A 2WYVA 3EMKA 4LCJA 5KTKA 4BMNA 2ZB8A 2GZ3A 1QXSA 1ULUA 4KUHA 5EMHA 4D44A 5I7EA 2RIRA 3ZW8A 1GYRA 4XIJA 1P1HA 3TSCA 4K9DA 3I23A 4WNIA 3GG9A 1AGNA 3C1AA 5TQVA 3ZWCA 4HWKA 1EUDA 2JJYA 3Q0EA 4W9NC 1XHLA 1N7GA 3BHMA 3AOGA 1NWCA 3D0OA 3DTTA 4B4UA 4JBGA 3RUAA 1WVGA 4HFJA 1A7KA 2VT3A 5IZ4A 1EDZA 1E1KA 1ISHA 2OFPA 1T25A 1LNQA 3TQHA 2G76A 4E5PA 4Z3KA 1WAMA 2J3KA 9LDBA 1J5PA 3JQBA 3K30A 3GMSA 3V8BA 5FI3A 1Q0LA 4QTZA 1HSZA 2B4RO 4DLAA 2X58A 3NDRA 3WMXA 1J6UA 3T4EA 2PZJA 4RQUA 2BH9A 1H94A 2DBRA 4CMGA 1PS0A 4EITA 2BI7A 3ONDA 3EDMA 4W4TA 5AXBA 1DBVO 2IEDA 2VN8A 3AUUA 3OJFA 2DUWA 1HYEA 1LSUA 1UZMA 1KVQA 3UF0A 4BQPA 2Q1UA 3KVOA 3DZJA 1VPDA 1D7OA 1B3RA 4IDBA 4QFDA 5JO0A 2X0JA 5A3JA 2XF8A 1QORA 4AJEA 5C3MA 5JC1A 5IZCA 4IDEA 2Z1MA 3OIGA 4CM1A 3WGTA 1ZXLA 4PLCA 1N2SA 1UXGA 3JQ7A 4IIUA 3WWZA 5ICSA 1EQ2A 4XGNA 3H5RA 4Y98A 4JIGA 5BNTA 2Y68A 2I5PO 3MZ0A 5T67A 4AJJA 1I3MA 4BNXA 2ET6A 3AFMA 2DBQA 4R68A 5AXDA 2WYWA 5ER6A 5U4QA 4YCAA 1ADGA 3I9KA 2RHRA 2Y67A 3X2EA 4PVCA 3IAHA 1Q0HA 1U8FO 4R54A 2YUTA 3GVXA 5L45A 4QX6A 3KM0A 4IDFA 2O3SA 5CEJA 3AUSA 2EP5A 4JBHA 3E9NA 3GEDA 4GPD1 2PH3A 3ZHYA 3JCZA 1EFKA 1XIVA 1JVSA 1PR3A 2I66A 3K31A 3WNQA 2QYSA 2PGLA 2YQ5A 4BKQA 4IIVA 1NHWA 2WD7A 3PRJA 2GNAA 1ZK3A 1T2FA 1DHTA 3PQDA 4YJGB 3WGOA 2AXQA 2O2SA 2HMTA 1B2LA 1DEHA 3UCEA 2PD3A 3BA1A 5B4TA 1H9BA 3JQAB 2HAEA 3Q2KA 4GWGA 4J1TA 1DFIA 4B7CA 5BNIA 4J7UA 3OBBA 3WDSA 1QR6A 4NMHA 4IMRA 4PLPA 1E77A 3JQFC 3VKVA 2F1KA 3C3XA 2V7PA 4EGFA 2QW8A 4YVFA 3RC7A 1JQBA 3JQ8A 2IEBA 3PLNA 4Z0HO 3ZWVA 4ALMA 4F45A 3VZSA 1W8DA 2W2KA 3FI9A 4ID9A 3VZQA 4DIFA 5HWSA 3O38A 4G2NA 3BMQA 2J3IA 4M87A 2EEZA 1ZW1A 1O5IA 4GWKA 4BNGA 4AJNA 3QW2A 3WLFA 2EF1A 3P2YA 4FB5A 3LZ6A 4A03A 3LU1A 4JX8A 3UHAA 1ISJA 2JAPA 3PHGA 3K8ZA 3WSVA 4E5YA 5HRUA 5T5QA 3ONEA 1VKNA 2VOEA 1S7CA 4R41A 3V2UA 1J49A 1HT0A 3ZZNA 3EK2A 4ILKA 4I5FA 2R2GA 1KC3A 3A28A 3L6EA 1YO6A 1DIGA 2C0CA 2FSSA 1X1TA 3BMQB 4R16A 2JD0A 1NR1A 4GAEA 4J2OA 4N54A 5A3VA 5CDTA 1BHSA 1BGVA 3PYLA 3M1LA 1LU9A 3GUYA 1I24A 2DFDA 5BSHA 1NWHA 1TB4A 1A72A 1P1IA 4EEXA 4NFHA 1G6KA 2RH4A 3HQ4O 4L75A 2AQIA 4DC0A 1HKUA 3VH3A 2Y1CA 5ADHA 3H9GA 3FRJA 1YBAA 4JLWA 4O0LA 3SLGA 2CNBA 2EXXA 4BB5A 1UJMA 4J9VA 3FSRA 5JDCC 3OJ0A 1FMCA 1HWYA 3NT2A 1A71A 3H3FA 3PJGA 3DBVO 5JLAA 4B3JA 5TNXA 4EW6A 2JFGA 4RCVA 1VL8A 1JVBA 3F9IA 2JCXA 3VPHA 4R5MA 3RIHA 1LJ8A 3S2IA 4U0JA 3VTZA 5I7FA 4JROA 2FPGA 1LUAA 2O7SA 4AJ4A 3I1JA 3RC2A 4I9UA 2IZ1A 4Y6RA 2NU8A 1ZH8A 1ZMTA 3KYCB 5JNLA 4OSPA 1R12A 1FDTA 4R4JA 4WLEA 2VTEA 2NVBA 3O8QA 3D3WA 4WOJA 2OL4A 2ZIZA 1R4MA 2B35A 4JNKA 3WG9A 3E9MA 1NASA 1KEUA 3EZLA 3P2OA 1XEAA 3KYBA 3VKUA 5TGDA 3F5SA 3A9WA 4J1SA 1UXJA 3ICPA 5BSFA 3S2EA 1EK5A 5ITVA 4NDNE 4LCEA 4KDFA 4D3DA 5DZSA 2AHRA 4Q3AA 3ADOA 5DOZA 2VHWA 3ZW9A 1Z45A 3OIDA 3V1YA 4CQMB 4OXYA 5KIAA 3B1KA 5L3ZA 1VL6A 4ZD6A 4B3IA 3WBFA 3INGA 4RLHA 2B5VA 2WMDA 1MLDA 1NAIA 1YS4A 1TEHA 4M86A 1GTMA 1VSUA 4FJ1A 2BFOA 2VWPA 1P31A 4XCVA 2GUGA 4YJFA 1A4IA 2HCTA 4B4VA 4WKGA 3G1TA 4YTEA 3TZHA 1X7DA 4PLYA 5A02A 3CPSA 5L53A 1D4FA 1F12A 5K6AA 1WZEA 2CD9A 4K26A 4CLXA 1FDWA 1HLDA 3GR6A 1LLUA 3PHLA 3OICA 3UOGA 3U4CA 1ISFA 3WQQA 2B5WA 4ND5A 4MKZA 3JQAD 1MA0A 3DMYA 3PGXA 2B83A 4XDZA 2FP4A 1K3TA 1FJHA 1SCUA 2GO1A 2HKIA 4PLWA 3F4BA 3G1UA 3ENNA 3FR7A 1QYDA 3V2GA 4HFMA 2HMVA 4YR9A 3ASVA 3EGOA 3NTOA 4J4TA 3ZGYA 4BNZA 4AVYA 2IYOA 3ICCA 1U5CA 1WPQA 1DJNA 4CR7A 1DAOA 3LF1A 3Q2IA 4HFNA 4PG5A 3K6JA 1WW8A 1PR9A 3F46A 1QV7A 3RFTA 3WXBA 3FCOA 5LDGA 2YV2A 4PVDA 4IUYA 3C1OA 3CZMA 3C24A 3PI7A 3PJDA 4FC6A 4J43A 5BSEA 2HMSA 1O9BA 3ZNQA 1QKIA 5KJEA 5B1YA 3DQPA 3GF4A 4P22A 3S2FA 1U7HA 3NGLA 1WMAA 4PG4A 1D3AA 1GYPA 3ANNA 3JD0A 1BMDA 1NFQA 3DZKA 5JW6A 1UP7A 1E7RA 5J23A 2VTDA 4LISA 3WFJA 5T8KC 1R6DA 4YT4A 1LC0A 4E5KA 5HM8A 2Y1FA 1Z74A 1UP6A 2FWMX 4PRKA 2Y0DA 3ZWXA 3CH6A 4TMFA 1JKJA 1AHHA 2VZ0A 3IUPA 3S2GA 4EZBA 2CDAA 5EJ2A 5GZ6A 1Y81A 4F46A 5K0ZA 4ZQEA 2JD2A 1C0IA 1E1MA 1M2WA 3F5QA 4FGWA 1E7QA 3DHYA 1OBFO 2C54A 3ZWPA 4CUZA 3PQEA 1KY4A 2TMGA 2WD7B 2XAAA 3AU9A 3K92A 5I8ZA 2Q45A 4YB8A 4Y8VA 1HTBA 4IQGA 3E6AA 1KVRA 3QP9A 3U4DA 4J4BA 1PZFA 4DTIA 4EDFA 1GEGA 4HNGA 2IXAA 5JC8A 8ADHA 1E7YA 1VJTA 1I3LA 1CJCA 3OP4A 4WEOA 2AEJA 2R6JA 3B6ZA 2Y0CA 5T6BA 1DC3A 2A35A 3K9QO 4MIOA 4YYZA 3MOGA 4XB1A 2VYND 4NZ9A 3ZWWA 4DUPA 3DBLB 4DBVO 4A5OA 4BGUA 2EW8A 4NK5A 3PHJA 4YDRA 4W9NA 3ZH2A 4E2XA 1VE9A 3SJ7A 2X0IA 3UUWA 1MP0A 3PLRA 1VJ1A 2ZCUA 5JAQA 2EKPA 2C20A 3GZNB 3HE3A 5EQFA 3S55A 2WEKA 4DLLA 5JDIA 1F06A 3AM4A 4OOFA 2DQ4A 4IJKA 1AXEA 4BO8A 3TL2A 1B16A 2X23A 3VPGA 1X15A 1GADO 4WASA 3UGKA 2AQKA 5DCWA 1PZEA 5I9MA 3Q11A 4W7IA 4XYGA 2O2YA 4G65A 2GN9A 1IY8A 1V3TA 4Y6PA 1BDBA 3GPDG 1W4ZA 4NBVA 1WP4A 4GX0A 3RI3A 4XX0A 1PS9A 3GRKA 1B8VA 4NNJA 2CF6A 3AJRA 4WK6A 3M6IA 3ABIA 1JWAB 4A26A 3P7MA 3RC9A 3EW7A 3JYNA 4ZQGA 3GGOA 4XRGA 3PYXA 2C59A 2I76A 4FN4A 1B14A 1YJQA 3OFSA 4FFPA 5JAIA 1LC3A 4MVJD 3GRPA 3OSUA 4EEZA 1GDHA 4D79A 4OHUA 3ZNNA 4Q39A 5EESA 1CDOA 4Q3NA 2BI8A 4RVUA 1E7WA 3V2HA 1EFLA 2B37A 3IKVA 3TFOA 4ND2A 1YL6A 4UREA 1IHYA 4DA9A 1VSVA 3G49A 4CM9D 5TS3A 3O4RA 3PWKA 3LT1A 4CLRA 1JKIA 1HYHA 3NGXA 1QRRA 1SEPA 4C7KA 5C7IO 1J0XO 4NBTA 2YV3A 4W82A 1N9GB 4A73A 3MJ4A 3Q6IA 4RVFA 1C3VA 4IZHA 4Z9FA 3WB9A 1DFGA 2A4KA 4XQEA 1ZJZA 5JMPA 3F1KA 4B4WA 1NHGA 4BUCA 1V9LA 2GF2A 4E4YA 3VOSA 5H82A 1AHIA 1E3WA 4E2YA 1CIVA 1X7HA 3ZNOA 5H81A 4BNYA 2V6MA 4ZQFA 5A03A 1RM4A 3U09A 3COSA 3PHIA 3E9QA 1T2DA 1MGOA 2W98A 3E5MA 4WCFC 3VH4A 1GU7A 1HLPA 3JQGA 2Z5LA 3E1KA 3GGGA 4LMPA 3O26A 4RPKA 4XZ3A
chains in the Genus database with same CATH superfamily
1XDDA 5FJIA 2E1RA 3B9PA 1KS2A 4CQLB 1JQJC 5C32A 4YONB 1QDLB 1VQ1A 1R0CA 2CVZA 3QOXA 4Q9DA 2X42A 2RAVA 3HY4A 4EIWA 1XNQB 1SKUA 1QG2A 4RYDA 1PWYE 2ZATA 5DCLA 1O6FA 2Y0EA 1OV6A 1EX7A 4L73A 5JEEA 3AUJB 5T6MA 4EELA 2FR1A 1L8XA 5HJEA 1P33A 2IHVA 1FNNA 2H9IA 3DLBA 1X74A 1DKRA 3CTMA 2X2PA 4Z7NB 4EJ6A 5ES4B 3CW8X 2FZ4A 1TMOA 3NHYA 4OU5A 3B85A 2ZB7A 2YFKA 4NS1A 1LK5A 2ATEA 1NQTA 3FFWA 3FG9A 4S35A 1R16A 3LUBA 3FHOA 3O8DA 3NAQA 1E2DA 4HB3A 3GCZA 1YRAA 1L4EA 1C8BA 4KV9A 3IPAA 3IUNA 4LC9A 3JYLA 4RVHA 5K0LA 1U0LA 3BD9A 3RRXA 4ED9A 1E96A 1TGVA 3GP3A 1VIMA 1MRSA 1MXHA 1Y4DE 2YMMA 5EAIA 2G28A 1XTZA 1U28A 2N46A 4BMZA 2QQGA 4BGDA 2ZQZA 5K0JA 4Q47A 2GD6A 3E9CA 4EOGA 3BE6A 4G97A 5E4JA 2GASA 3CRZA 5J40A 5HGXA 1EE9A 1JHUA 1WB6A 2YVAA 1VMKA 4V0QA 2HIGA 2INGX 2XQIA 4AW9A 3B1XA 4G25A 3TSZA 1NMYA 3NHLA 3HS3A 1SOMA 2WIDA 2PTHA 1IL0A 1O8CA 1YULA 1Z3CA 2R1VB 3MWFA 4UAVA 5LZ7A 4C6TA 1YTLA 3KQNA 1FX0B 2BFAA 1UBMS 3D2LA 2PSEA 4JJ7A 4RK5A 4KH0A 4W5QA 3NHSA 4YQZA 1YJ8A 4GPAA 4J0JA 3DONA 5CX1A 5LSAA 4HV4A 1P4SA 1DIOB 3SWWA 5KVSA 4ZMSA 4MW1A 4Z4EA 3RCBA 3K8OE 2ZYTX 1HNZB 2VHZA 3K0AB 1OOEA 2QRGA 2X41A 2K2WA 3PF8A 4IQ0A 1GNVA 1D0IA 1ZRHA 1HDCA 2P4HX 3EISA 4R84A 4L85A 1TTTA 2V3CC 5DSZA 1M6VB 1DQYA 2H1WA 4MQFA 5DHUA 5ALSA 4F72A 3W2IA 3GGPA 1JIXA 1K7EB 4QO8A 2AJ8A 2O8DB 4HAXA 4QXMA 2CYCA 2V9CA 4YMWA 2A9OA 4NMXB 1R0WA 2JCBA 3A9CA 4MVJF 1T9GS 4ZRMA 1Q22A 4BNMA 6GPBA 3OIFA 3UT5B 4EK9A 2H92A 2HQ1A 5KVCA 5LUAA 5AKZA 3N0WA 3U4AA 1WABA 1MHPA 3X0DA 4WFKA 1CVRA 3GCXA 1X13A 2BBOA 4IQ8A 4XCXA 3GLIB 4CEIB 1NC1A 3WY9A 2DPYA 3EZ9A 3HJAA 4QUGA 3BIWA 4TVOA 3FFBA 4OGGA 3T34A 2JGJA 4RFVA 2IPAB 3FHCB 3R7NA 5G0TA 2H07A 2H4WA 2RBGA 2UYGA 3KSUA 4FGUA 1N3LA 1T9GR 5CDUA 2HC9A 3OU2A 3OMLA 2X7HA 2NO7A 3G82C 1WD7A 4HN9A 1N78A 3UMYA 2KWIA 4MVJM 4PLGA 4HLQB 3R44A 4DNPA 1L7MA 1RTTA 2QB5A 4C2TA 4N7JA 5KCMA 2ODQA 2PPVA 4PC2A 4KLRA 5FPTA 1ZSNA 1QH8B 3DO6A 5ICFA 3VR4A 3PNLA 4DA7A 1JMYA 2GBIA 3K0AA 4XQCA 3RT9A 4OHRA 1GCIA 4L7VA 4Y9DA 4M0MA 3EQ7A 2KHZA 5LN1A 5CA1F 3OZFA 1V7QA 4G9GA 4XR4A 2AA3A 3F1LA 1ADJA 3O8CA 3AOEA 4AWAA 4TYYA 2PEYA 2Y76A 2G82A 2Q6IA 3CH7A 1G17A 1OXVA 1JF8A 3UT0A 2WP0A 2MYNA 3OECA 1G7RA 1TIBA 2WHXA 1QCCA 3EY9A 1JMKC 4GE3A 4W8OA 4Q3CA 3KV1A 5BR1A 1W0CA 4P08A 4C5BA 1A1VA 1KIFA 2YXBA 2BUBA 1BSVA 1I6LA 3E3AA 2ZANA 3G0BA 3GJ8A 4RPJA 5CB8A 2ILVA 1KETA 3LC2O 1J1IA 2DOKA 2QPOA 4FLEA 2PPLA 3CZ9A 2Z5GA 1L4NA 3EVNA 2GEUA 4UBNA 4ECAA 3HA5A 1KDPA 5EIHA 2DWUA 1EYZA 1L7QA 1SXPA 2W37A 1L2TA 3IV6A 3HB1A 4XSVA 1OB2A 3PL1A 4D4MA 1B23P 2XMDA 1X1DA 1Y48E 1MV8A 2D5IA 3IOCA 2YIDA 2FB9A 3V4SA 4MAMA 4TRRA 1DBWA 1QQBA 2XMQA 4PCUA 1L5KA 3IPYA 5GP1A 5JECA 2Y0PA 1NA5A 1G18A 2XX3A 4YRDA 5FF9A 3RUEA 3ZEIA 3IXMA 5KYGA 1K5PA 2PO5A 4G2TA 4R7GA 4RABA 2HJHA 4FYKA 1T1JA 4LAFA 2I2XB 5FH9A 3WK4A 2O0JA 3GLVA 5DGHA 1V6AA 4JKYA 4MRVA 4D9KA 1WKCA 2WILA 4B85A 3LOQA 3HJUA 3WV4A 1OYWA 4FEAA 3S0JA 1MVOA 1VPVA 2COKA 4CODB 2UYOA 3FDZB 2XCSB 4KR6A 2HH9A 13PKA 1V9SA 1B93A 3FA2A 3MUOA 3PUZA 4L4SA 1PVDA 1E2KA 3AB8A 2XKAA 1ZUNA 4XA8A 1RPNA 1X1BA 4C0LA 4EW1A 4B3SB 4RH0A 2NU9B 1FP4A 1MRZA 2XVXA 5E3HA 1XCGB 1ODFA 2BHSA 3B48A 3LI2A 3QEMB 1TQHA 2VWQA 3CLHA 4KQ1A 4X6YA 3UTCA 2PUBA 2ORYA 3L8MA 3SX4A 3K9FC 3UW1A 1FLNA 4QGGA 4RNDB 3WWOA 1DAHA 1KMQA 1GLNA 2GCEA 3RAJA 721PA 3KR0A 2QUZA 4LV6A 1XC7A 4YUXA 2OO5A 4GL4A 1JLMA 3ZU5A 2QVBA 1EP2B 4JY7A 1WUHS 5IDWA 1KK3A 2BFDB 3I9JA 1OWLA 4YRZA 5SZKB 2XUHA 1D09A 4A6EA 2BW0A 4EJSB 1WV1A 4FE4A 5FWNA 4TKUB 2XD4A 2IOFA 3V1NA 1SRRA 3EXHA 4Q03A 2G7ZA 3CQ9A 1EK6A 1NW9B 2ZIGA 1YRLA 4B82A 5HZKA 1D2GA 4PZ0A 5E9AA 1AHPA 1Z5GA 3IQFA 1QO0D 3ZWAA 3EZ6A 5JMWA 1C9JA 1TU3A 4L3OA 1LKZA 1X80A 1CEQA 3OT5A 1B8OA 3BYZA 3HBNA 4Q4HA 2GZRA 2NVOA 3D7LA 2BHNA 2R84A 2A6PA 3PUXA 3S29A 2P4QA 3MOIA 1PGOA 5COQA 3X1WA 1BDJA 2Z95A 3C8ZA 2CCJA 1H22A 3FWNA 2VDQB 3OP1A 3CRW1 2OQ2A 3OZTA 4GM0A 1FUUA 1MFZA 1N2HA 3H86A 1V0JA 3KFVA 4PW0A 5DLQC 1ZSVA 3H16A 3LX4A 4U2GA 4ER7A 4E3ZA 1K98A 1SOUA 3QM1A 4AJ1A 2HRCA 1GKYA 4YJDA 5G53C 1JA1A 4GVLA 1QO7A 3L6CA 4KR3A 4ZV9A 3MOSA 4FFLA 4UBJA 3T4XA 4BGVA 5K0TA 1GUAA 1NN3A 2D2VA 4V0KA 3GCDA 1DMRA 3QXJA 5G41A 2GFHA 3ABZA 3BAZA 2MIIA 2YFQA 5IX8A 3GFPA 1RHRA 3JAMA 2ZP1A 1H0SA 1Z6GA 2VFAA 2E4VA 3GRFA 3H6KA 1EWRA 1X1EA 2PLFA 5E38A 2FG5A 2EWWA 5DCYA 3EBOA 1QZZA 3C5VA 4ZOCA 3ZHQA 4B4KA 2I6SA 2XNCA 1U3WA 5I45A 2O3RA 1JB9A 4DV1B 3JYHA 1MOQA 1SC6A 3LMKA 3ZXYA 2BGLA 3NC4A 3P96A 1F17A 4PNEA 4LRXA 4GMFA 1XRMA 4Z1OA 1X3SA 4KOEC 3OLWA 2O23A 2UZIR 5EZ5A 4IS2A 4WOPA 2O48X 4J6EA 4QLBA 3WLEA 3G5AA 4HS4A 5EMMA 3B89A 4MWDA 1EUQA 3IAS6 4UZSA 5AW0A 3N76A 4NZPA 1L3BA 4KBFA 1FS5A 2OXEA 3OZDA 1E3MA 1ECJA 1D0SA 4CLHA 1FW6A 2C1ZA 4MPPA 1BDHA 1JQ3A 2BC9A 3MT0A 2FZWA 1QHFA 3ISJA 5I4IA 1W4RA 3DEZA 5JVDA 3NHMA 3DAGA 1RMQA 1U7DA 4ARZA 3D4IA 1R5JA 5EKXA 3BBPA 3GK3A 4I5EA 1QRDA 2GBGA 2LNDA 1Z36A 2BONA 1JEDA 4QYIA 1ICEA 3IQGX 2C2KA 2CXNA 2J3DA 1EB8A 2GN6A 3QF7A 5LXTF 1J22A 5AKKA 4UCXA 3WYCA 2BZGA 2DBYA 2ISCA 4GYJA 4RORA 1VJ0A 2ZDGA 1T5OA 1K3FA 2H3EA 1YS1X 2AVNA 3B3QA 1NZFA 1OX6A 1XXHB 2C5LA 2GK7A 2MINA 2Y1DA 5FB3A 3IDSA 2LD4A 2CLFB 3JR3A 4JX9A 2FMFA 3QBTA 1DX9A 4KPUB 1XJWA 4MRPA 3TLXA 4P3NA 1R4NB 4G4GA 3CF0A 1EQAA 3IAUA 3KQPA 3PCTA 3PENA 4JP8A 1J09A 1YE5A 2A1UB 2PFGA 3KOXA 3QOWA 3SDZA 5JZMA 1BX0A 2O14A 1GPMA 4B79A 3BK1A 3CBQA 4I1UA 2XYRA 4LJ4A 4UKDA 1FYWA 3A14A 1UADA 1Y9ZA 2OORA 1W9HA 2P7HA 3N2GB 4C4PA 4CL8A 2CNWA 2WF5A 2JVIA 1LV7A 4QOEA 3V6MA 2JFPA 1LSSA 4W1RA 1WMFA 3ZN2A 4YNBA 3NH6A 3OJCA 4WNAB 3RRNA 1L7BA 3CG4A 2EG5A 3MCWA 3F2VA 4AICA 3KSDO 5AVJA 1T2NA 1IOWA 5A3QA 1P1BA 3HEAA 5HR5A 4JL8A 4MICA 2CDRA 4BGEA 3FTCA 4CV3A 5A3RA 1HV8A 3PDWA 3SG0A 2Q1YA 4BQRA 4YMVA 1NLFA 4EVSA 4MHTA 3AVUA 3H1GA 2P5YA 1FVFA 1NY5A 2ZRPA 3HFSA 1VCHA 3SS7X 3LL4A 4WCFA 3H1EA 3R9XA 4JELA 3E8MA 4LTMA 5KTMA 4R2HA 1XCPA 2ZJ1A 4OL0A 2VPPA 3N2KB 3O1IC 3NOXA 3VDNB 2OCLA 5IYZB 1RHKA 4G0XA 2YS7A 3KJEA 5TQ2B 1O2DA 3ZY5A 3CEAA 1PSZA 1XZFA 2DH5A 2VXBA 2QX6A 2AR7A 2Z2XA 1WPRA 3DV2A 3FYSA 1V47A 3HPRA 3P4YA 4NNOA 3RHFA 3FHJA 3DR5A 1JIJA 4FFMA 1UAGA 1HR0B 1GPDG 3WHPA 4CCYA 5FHQA 4E46A 3L7KA 4URVR 1PVOA 5CUQA 4PYOA 4C4XA 3GLKA 2IUSA 1L5HA 4WN9B 1DJMA 2V1XA 3EIOA 4WFIA 5EJMA 5DM2A 5HS4A 2OCXA 3TBFA 2P9YA 4E0BA 2P0YA 2EFDB 3N0VA 3HA3A 1GG8A 3QNUA 3SXJA 4BZPA 1LZKA 2HL6A 3NM5A 3WOVA 4B8WA 5AK5A 1F14A 1ONSA 1L4BA 4RY2A 4ZREA 3WIEA 5JATA 4IDDA 4OI0A 1ESZA 3HKCB 5I7WA 2V6BA 1LDMA 3QJGA 5C8YA 4PBSA 5ECGC 2WWGA 3IURA 2WMNB 1L4FA 1XAGA 1ZOPA 1H6AA 1ZD8A 3FZNA 2GAOA 1ZX1A 2RGWA 3W1WA 4KXVA 3AVVA 3OE7D 2QR3A 1ENOA 3C3MA 2XSZA 2PVSA 4JVOA 3KHKA 4HGYA 1U80A 1ZGJA 1M6WA 2HLHA 5INTA 1VIAA 4Q9KA 3R76A 2YY7A 3AESB 2RC6A 4J0DA 1Z5NA 1X92A 1B6RA 4BCBA 3WYBA 4S1TA 4L15A 1KJYA 1SD2A 1XRQA 3GX1A 4CMJA 5CD9A 2PUGA 3FTFA 5HJ5A 1N8TA 4H0CA 2X9VA 2G04A 3A9UA 1ZXBA 3TQSA 1TA4A 5M5BA 1ETUA 3F5FA 4BGIA 1IEWA 5HRAA 2AN5A 5I4KA 5MN5A 3M6UA 3ZZMA 3OM9A 4WKCA 1KFKB 1XTJA 3B8EA 1AMOA 4PX9A 1D2HA 2QE7A 2WPNA 5HK8A 3RK0A 2JI7A 1AZLA 4HFRA 4RF2A 4CDGA 2NZJA 1H6BA 1SUEA 1Z4JA 3R77A 1J90A 4K0RA 3P5SA 1Q16A 1ZGBA 4RMIA 4BFCA 4JR2A 3M2TA 2B3TA 2GKOA 3A2MA 4ALJA 3PXAA 1WW2A 2QRJA 3H2YA 4WJZA 3HFJA 3UJCA 4DAOA 5IDQA 5KNBA 5CCBA 2HGSA 1ZESA 2CFTA 3C39A 5KYUA 4M4SA 3RTEA 2F62A 4H1TA 1XKQA 2QJFA 4MW0A 3LPDA 5FOVA 5BN3A 1DT5A 2CDCA 2A9FA 1HQDA 1GQQA 5FL7D 3ZQKA 4BLRA 1JQAA 3WSTA 2C98A 3TW4A 3VO9A 4YROA 1P77A 3ZZ1A 1AA9A 2JFZA 3AEXA 3PDUA 1EI9A 1U2DC 1SZDA 4NCJA 1KBQA 3I52A 3ROKA 3VC2A 4RAOA 1CZRA 3MQ2A 1OFGA 3OCJA 4Q4AA 5AWFC 4E94A 2OXRA 4EI7A 5IJ0B 5HBRA 3ZKAA 1DQSA 1SEVA 3G89A 3OLXA 4FQ8A 2QV0A 1RHMA 4E09A 3RYTC 4I4NA 3V7WA 2J6IA 2PD6A 3UOWA 1SULA 1DV2A 1J07A 2SKCA 2QQ0A 1UF9A 2XUPA 3NNDA 3NCHA 1WDMA 5BW6B 2ON6A 5CA0B 4PQRA 1FYEA 4UARA 3MT7A 4FI3C 3HM9A 3THYB 2IDZA 4I3FA 2NPFA 1HORA 2VJKA 3S28A 3ZU6A 4EENA 3ER9A 3A3PA 3E2PA 3EA0A 3PPYA 1X7ZA 4RD3A 3WSWA 2WU3A 2RBEA 1Q15A 2W2LA 1Z4PX 4I5IA 3DCIA 4M0DA 3ZBUA 5BWBA 1A96A 3VX4A 1EQUA 2H2FA 2DSTA 1MB3A 4RK1A 4Q18A 3IA7A 4XB6B 4CLOB 3CSUA 3BQMB 1GNRA 4C2UA 4MVWA 1RI4A 2VHUA 1VJ5A 4OJYA 1YHYA 4H7EA 2VP9A 4IBOA 5FKJA 3U61B 4XD7D 3K7EA 3RT7A 4LNAA 3N8HA 2A9RA 5A9SA 4NBKA 3PGVA 3OG9A 4EYQA 1C0PA 5P8WA 1HT1E 1RMTA 4OJTA 2GZ1A 3WGVA 3Q1LA 5JQGF 2VHJA 4DCOA 2OO3A 4HYTA 1T5TA 1WQ3A 5FOSA 3CNEA 1LD3A 3V2IA 1SB9A 3ZU3A 1U28C 1CHDA 1Y33E 3NAMA 4I9FA 4J3JA 2IU6A 4KGXA 4TLDA 1SG0A 1UBUS 2CJWB 2Y93A 2C03A 4FUQA 1BWPA 2JIMA 2MU1A 3RSSA 1M34E 4MDEA 4CUKA 1A95A 4BEVA 1IN8A 4XPZA 1GTG1 3HKCA 3OCXA 1Z82A 4LY9A 3NVKI 5TMEA 1N6PA 1SOVA 2ORVA 2Z9DA 1FMFA 1FMJA 2C7VA 3IO3A 2DAPA 5E3IA 4N3CA 1P29A 2JFNA 3AR4A 1Z25A 2FLVA 4MXDA 3EARA 1L6RA 2CLLB 3OPXA 4PEVA 1MO3A 2J9GA 1V9CA 3R1IA 2QVGA 4BJ5A 1GN8A 1I1NA 4KK4A 2FE1A 3QG5A 2F3TA 4C05A 2FE4A 2RIPA 3KZOA 3QX8A 5D00A 5JV5A 1F4VA 3D8HA 5LQAA 2QUHA 3PEYA 2VJDA 4LFBB 3DPUA 1JLSA 1XLVA 3IP6A 3WNCA 1O9HA 4GXTA 5KYVA 2QWXA 3HU2A 3CLTC 2EQBA 3O7WA 4V0NA 2HUNA 2NXEA 4F3NA 1AY0A 1ONNA 3DT8A 4BNJA 1MO2A 1WWKA 4V1CA 5LL6P 2O8NA 4BMYA 4CIWA 1E3SA 1XEWX 4CU2A 1ITZA 1N5JA 3KAKA 3MBOA 2BN4A 1FEZA 1C0KA 2B1QA 4RPGA 5JCOC 1XMSA 2YDYA 3NHUA 3CKKA 2AMVA 3BT7A 4IHKA 1ZSYA 2P69A 1ULTA 1WCV1 3H2BA 2DG2A 4LYAA 4B6FA 4CKBB 5KNBH 3RUPA 4M1ZA 3KT6A 3VSDA 5KREA 1Z5OA 1YL7A 1W59A 5DRTA 3H9BA 2JZOA 3TKYA 2CLKB 4FMPA 1UMKA 1J2UA 3C7AA 2VIIA 2RE8A 2XJ4A 1QLJA 1FSPA 3OLVA 4RIHA 5ECYA 1XDUA 2FUG1 1YD7A 1L4HA 2PSSA 2WG2A 2PKXA 5CPFA 5HCIA 2UVPB 5TSDA 2NP6A 2O5EA 2VH5R 4UM7A 3OQJA 3VZPA 4BYGA 1P81A 4ETWA 3MB5A 4L4YA 3G9TA 3WLKX 2VQEB 3C4JA 1RHJA 3KT0A 1S8NA 3UFXB 3QEAZ 4XXHA 3DE6X 2WAAA 2IEIA 5K6TA 5FAKA 5ELLA 5LVAA 2VHEA 5AW8A 1PU2A 1CY7A 1IUNA 3LQKA 4TS3A 2UXBB 2PBLA 1SC4A 4LE1A 4CI0B 1A3CA 1T1SA 2D1YA 2R6HA 1JN0A 2COUA 4UUBA 1N6RA 3HB0A 1VLMA 2JIDA 2VNAA 5A1TA 1Q7RA 1NUQA 3EVDA 2QQEA 5KU7A 3DBIA 1KAMA 1XYVA 4R51A 5IU6A 1K8RA 4P6VF 3WBKA 1UMBA 1P7VA 3BTVA 1K89A 4A2CA 4TLLB 2C9MA 2JF0A 4R01A 3ET5A 1B0PA 1E6UA 2BTOA 3R0XA 1FDVA 2BGKA 4WINA 2FFBA 3VTFA 4NSNA 1IG0A 1ZFNA 1R0KA 2CHFA 2Q4OA 2QLLA 3LZCA 4HY3A 4OQYA 5EE3A 4E1AA 1IBKB 3PYMA 5E1MA 1J0CA 2BVNA 4C5CA 1JR3E 2C8KA 2PNFA 3KAQA 4GZ6A 2Q5EA 1EFDN 3LC7O 3OZBA 1NE7A 3SMVA 1XYYA 4DXDA 3GNQA 1G5HA 3PSHA 4TVSA 5AVZA 4KO8A 1XJQA 1KFEB 4JQZA 3MMZA 1JIVA 2DEUA 5HBGA 1IATA 4TMVA 3N3AC 4E6PA 1W7AA 3PXXA 1KMHB 2V3VA 4LOJA 2ID4A 2IEYA 2OLJA 1UJCA 2O57A 1DCTA 3DAPA 1Q19A 2Q3DA 2VCYA 1JHPA 4I50A 4J0EA 4IIBA 4M1MA 4QDOA 2ZUCA 5BQFA 1QBGA 1QZTA 4PQFA 4PZCA 2QDXA 1TLFA 1GTL1 1NATA 3BSFA 2GF0A 1I7PA 2VTKA 4LWQA 1JYEA 2Z3VA 2HJVA 1E6EA 4CR6A 2APJA 4GLJA 3AGPA 1GZ4A 3CINA 2ZLBA 1KYWA 3DOEA 3O3MB 5AR1A 4QOJA 3FKSA 3SQLA 1F20A 1QSGA 3PD0A 2R00C 4QUHA 3RBXA 4OGWA 1DG3A 1YDEA 1U98A 1VB5A 2V7EA 4P80A 1KFCB 3D2CA 4YUWA 1YGPA 2Z83A 1QOQB 2D8MA 3DCJA 3KZXA 4WBNA 4RV4A 3L0PA 5EPUA 4UTZA 1ZLXA 3F3SA 2PKWA 3DEYX 3PKJA 4EF4A 3R6WA 1MC8A 4D6YA 4DW8A 4DLKA 2Y1XA 1Z7EA 1DEAA 1WCIA 1P73A 4AX4A 4JYZA 4B9AA 1W85A 2IBTA 4AQDA 4CQNA 3T1YB 5C4IA 1PQYA 1SA0A 1XDBA 3I6QA 4Q3KA 1O5TA 5IC5A 5F76A 1JJ7A 3F9RA 4UHCA 3FE2A 3SJCA 2ZUFA 1K97A 2XE6A 4YO7A 3KFLA 3D4BA 2FUG6 3ODGA 3RTAA 3UWPA 4L50A 4MUFA 5CA1A 1VIYA 1GV1A 3CZRA 6NULA 1NUHA 5MF6A 3EG9A 3QVJA 3TWOA 1WCYA 1WBJB 1RBQA 4FVTA 4YRLA 2PGJA 1GAWA 2Z56A 3MHPA 2J6CA 3NRBA 2BHLA 5DLDA 1QGAA 3OZIA 4GX5A 5JXGA 3HKEA 3ORHA 2PZGA 3DDSA 4JWKA 2HDWA 3AI7A 2EATA 4DR7B 5CT8A 2R8BA 3Q3GE 2GR9A 5AM4A 2A5YB 3ZE2B 1FS6A 2E4AA 5TT0A 4BMOB 3SKYA 3UNXA 3MD9A 1EVZA 4FZ5A 5JDIC 1Z08A 2JHFA 2OWDA 3AU8A 4J2TA 4WECA 4ZDWA 4DV7B 3SZLA 4ZHSA 3RKSA 2BAGA 3BWBA 4GUDA 5TX7A 3GLGE 3JQQA 4XFJA 1NONA 3SC6A 3AB3A 2XY4A 4HLUA 3EULA 3ROEA 5HVNA 1P8AA 4IHAA 4KBYA 2BM9A 1IBMB 1LVGA 3L49A 4HSEA 2Z6AA 1BX1A 4R7TA 4B81A 1ZY2A 2XITA 1KMHA 1JFSA 3KTAB 1PJQA 2J0UA 4XIYA 7REQA 4RADA 2OG2A 4WAUA 1EVYA 1V96A 2G5PA 4JCOA 1WDWB 3MBIA 1OWOA 1HURA 4LZWA 3RYHB 4DXHA 5IDXA 1IY1A 2M1XA 2FW8A 4N7MA 2WMYA 2EBWA 5AI4A 4C7BA 5TY0A 3SBDA 1I1OA 2OOSA 2QVZX 3F0TA 2NUTA 2I03A 2XZDA 4YALA 5FWXA 2AKAB 1WRBA 1CV2A 3ASYA 4OOEA 2JGDA 4JYMA 2H7VA 2BHTA 3P2IA 1DDGA 3S27A 3Q8WA 4WJKB 2Z4SA 2HNAA 1DC8A 2H2AA 4EVQA 2X15A 1Y8QA 1XD9A 2P90A 2XVAA 4KWHA 5ENVA 4BO3A 2VYNA 3EIFA 3HLTA 4ZO7A 4BFXA 4Z4QA 2ZRQA 1K0FA 1XTBA 1NVKA 1X2EA 4YRJA 1Z29A 1M1XB 4CT0A 3PX7A 3NUGA 3WGLA 4KDCA 3T5BA 3TTSA 1NFFA 4HAVA 3IIKA 2FMUA 3KDPA 4IMPA 3U4MA 4TZ6A 3WGYA 1XU7A 3ZD8A 1HDGO 3LUDA 3RSLA 1ZZEA 3I04A 4C22A 4W99A 1PS8A 3UFXA 1WZIA 2O3TA 4MI3A 3WZLA 4ZEWA 1W2HA 1HE1C 3IAXA 5ULLA 2CNNA 3L1IA 3L6OO 4M1SA 4ZVKA 3H8WA 3ECAA 4YV0A 2PNJA 3JQCA 1W5SA 4EYOA 5B37A 3FNBA 1S4QA 1NI3A 3BE4A 4M0LA 4MQBA 1DJPA 2BISA 1I2AA 4ZANA 4BAZA 4I4LA 1CRWG 1DOHA 2H48A 4D25A 5HQJA 5EMJA 3I9MA 3LUHA 2EERA 1BE0A 4N5DA 1QPBA 4EH1A 5BW4A 4TPKA 3Q9NA 3NEYA 3HBJA 4B5KA 1ZC3A 3AYXB 3H4IA 3UJ3X 4BO5A 4DR4B 4HG2A 2ZJFA 1JSCA 2HCFA 3D2AA 6ABPA 3ENZA 4IGAA 3BGIA 4QDUA 1MTOA 4DIOA 1ZO8A 1NJ8A 5FADA 1A5BB 3QLVA 4GQAA 2F9MA 3BC1A 1A76A 1ORDA 3KZ1E 1F5SA 3LUGA 2NWQA 3UMCA 1EVJA 5JH7F 1ISIA 1QLWA 3I9FA 3UHPA 2IYXA 1CE8B 5CFMA 3OTHA 3DZBA 4RGVA 1GQSA 5AXAA 521PA 1ZEMA 3QENA 4Y2XA 5FLYA 3OOHA 9LDTA 2PSDA 3KZCA 5LQNA 1XQ9A 1P45A 3QWIA 3QBEA 3ILVA 1ZNQO 4INZA 4IIHA 1MG0A 1XTIA 1ESCA 4OQPA 4ZKDA 2GWHA 5AUPB 4KQXA 4YRQA 4FBLA 2XPCA 2BSXA 5G0VA 1D1TA 2N9UA 3DVSX 3R5TA 4BNHA 4XRRA 1VM6A 3ZDFA 1V8PA 1A97A 1VRCA 3RYIB 1N77A 5K3BA 5J4KA 2NVWA 1FRZA 3MJFA 2VLIA 3M5DA 5C18A 4UTRA 2AD5A 1L1QA 1W19A 4AKIA 3KT3A 1L7EA 1U90A 3JYOA 3DNFA 2I6GA 4YJ3A 4DYVA 4MQMA 5EQTA 2P11A 3Q3CA 5KAMA 5CX1B 2XYHA 1H85A 2P9BA 2YX1A 4MVJI 3KEQA 5BR7A 3D54D 1ODLA 1PJRA 2REBA 3ZXIA 4HZGA 3UZUA 3PICA 3C14C 3OIUA 2TMYA 4WIAA 1XO1A 4AJ9A 4W5TA 5HK9A 2FZVA 5IXSA 1HQCA 5JSQA 1W4AA 1M6HA 2IYLD 3KUUA 4P35A 1J8MF 4IRUB 3Q12A 4CKCA 1VMDA 2DUNA 3U9LA 1BQ4A 4P38A 4ZAXA 4ZYUA 2NZUG 4RULA 4OHCA 4N7RA 5EFZA 1M1NA 2G9UA 1TJNA 4G36A 4BNNA 3CF2A 2Q99A 4DXAA 3CMMA 3ZNPA 2QORA 2Q1TA 4FDAA 3U7RA 1SOWA 1T6XA 5A0VA 3G7SA 5ALUA 3CXRA 1E1LA 2X22A 2BKUA 4JLSA 1RSZA 4Q1VA 4XWOA 2ZTLA 3BRQA 4CKWA 1R37A 1Z13A 1F6DA 4CLOA 1GRCA 2R8YA 1PTJA 3KCQA 4H60A 3T1NA 3O83A 4LJYA 3W8DA 3BSWA 3AEKB 3T6KA 1SKMA 4X3OA 5G0SA 1NBMA 2XMSA 1USWA 3CXUA 3FCXA 1FK8A 4Q12A 1DUSA 1ZZGA 4BPBA 3QXGA 4F4FA 1M5TA 5DYGA 2ZZMA 1LLFA 2HY7A 1LX7A 4M6WA 3CH4B 3DS8A 3WNVA 4J07A 4E5SA 4N8SA 1G3RA 2YYSA 1ZNXA 2VS1A 1LXCA 1J5XA 1R0LA 4UVIA 1SCAA 3J81k 1V5EA 3BGSA 3DOOA 5C1BA 2VNHA 1JALA 4BB9A 4G1EB 3OZ7A 4MA4A 2AUNA 4R2XA 4AY5A 4UPEA 2V3WA 3WNBA 3LQFA 4ROSA 4URHA 2C7RA 2K2QB 3OQ6A 4ZAWA 1YS2X 2PQ6A 2XCIA 3G2NA 1E58A 1ZAKA 3RJ9A 4D9EA 1GTZA 2NTEA 1I10A 3QHAA 2OHJA 4OFWA 3L9WA 4M54A 4P5DA 2GAIA 2XKBA 3VV3A 4J4HA 4G0QA 4MV7A 3LUFA 1JH8A 3I2GA 3KU4A 2GCIA 3FJOA 1H1LA 5AMXA 3QLTA 3WISA 5K1ZA 3RKUA 1GR1A 1ZOOA 3HDJA 4YYEA 5C8ZA 2EJCA 4Z3OA 1IEVA 4PR0A 2CMDA 1GIAA 2BR3A 1FFWA 1Y37A 2PUVA 1AF7A 4OM7A 2XQFA 1UZAA 2W2TA 4DLUA 2C2ZA 4TKVA 1ADFA 2IXEA 4RHFA 2QTLA 2RAUA 4MULA 4PX2A 2YW9A 2PS3A 1Y8ZA 3BB1A 3OFJA 2LKCA 1TA0A 5K4AA 3ZJTA 3BB3A 1B0UA 2C5SA 5HE8A 2OHFA 1YI1A 2FV8A 2CLOB 4GNKA 4Z51A 1YR1A 5ICMA 3GJ4A 4J7AA 2BZ1A 3AR7A 4IG4A 1OZGA 3WOHA 3K2BA 2G4VA 1Q50A 2HX1A 3HCPA 3I6ZA 4DLVA 2GJ9A 4CM4A 1EDOA 2JS7A 4X00A 1MOSA 1KQ3A 4GF5A 3X2FA 5LQRA 4NCAA 1NN1A 4LHWA 1WW3A 3UICA 2PQ0A 3AEUA 3HRIA 2DJIA 4HX9A 1H42A 3DDNA 4U6SA 1MX5A 1IN7A 4IHJF 1NNUA 1O0CA 2Q3LA 2Z0MA 2D5AA 3ETLA 5KVAA 4J1QA 4DFDA 4HDSB 2GN2A 2HSWA 1VYUA 2C1XA 3OJOA 3V4OA 3U6KA 1OLSB 2ZYGA 3LVBA 2I2FA 2UDPA 2HK7A 2JW5A 3EQ2A 4QU5A 4TXMA 4Z3DA 2XT9A 5I4BA 1GPNA 4P7BA 3QK7A 3TW0A 1P1FA 4JBNA 3KOYA 3V7FA 2X8JB 3SZGA 3HYNA 4REQA 2ZRCA 4G4SP 3ZDRA 4PNPA 3SEAA 4GW3A 2ZR0A 1O0SA 3EHDA 5D6NA 3UWMA 1L5HB 1G9TA 1QH0A 4Q3LA 2CK3D 4GHWA 4RMNA 4DQ0A 1C7ZA 1BTOA 1U8AA 2KB0A 2RHLA 3IP9A 1DUIA 1RE1A 4RKEA 4IMIB 4RETA 1KEVA 5BO5A 4ARSA 1H05A 1HFKA 2GJKA 2ZTUA 4GI1A 1NYLA 3BMNB 3HN7A 4HGPA 3UUGA 5C1DA 3OQIB 5JNUA 2B0CA 1A7UA 2I7TA 3DM5A 1LS6A 4M0EA 2HJGA 3ESQA 1NX6A 4NEQA 5JZVA 4RDIA 5ITZB 3QLVC 5CLIA 2DTEA 1ZC4A 4ZVPA 4HVCA 1DMSA 2RHTA 1PGQA 1INLA 2ALJA 2HU5A 2Q4RA 4Q9IA 2VNJA 4PZEA 2H1CA 3R3JA 2REOA 4YX9A 3JVUA 2DPLA 4WBXC 4BQNA 1OC4A 1MJGA 3T94A 5EKDA 2ONCA 1RYBA 3DFIA 4H1HA 3H5IA 5K0SA 5ALQA 5ALXA 2NSJA 4QSHA 3ZHZA 4ZI7F 1KZ9A 2R6ZA 4QBIA 2IL1A 3OM0A 5AW2A 3KLBA 3QVOA 1BU5A 5A2GA 5C2JB 1OF1A 2VP2A 3ND8A 3UMRA 5JXWA 5BR8B 2HFJA 1TJYA 3DBLA 1BOFA 4G6ZA 1L5RA 3V8QA 4BVEA 5JD5A 2D2FA 4F5ZA 1HK7A 4JT4A 5FUBA 3C6KA 1T5DX 2YWHA 1P3JA 1XDSA 3E1GA 2OFXA 1I14A 1N2CB 1VBKA 4WDQA 1KR2A 3GB9A 3ICWA 1D1QA 1CQIB 2NV0A 1BMFA 2ZSIA 3SM9A 4RH1A 1XF9A 3W05A 2ZQYA 1D8TA 3MAAC 1ECLA 3OTGA 2QTHA 1JWLA 3LGXA 4NFSA 5CT5A 4N9WA 4N9QA 1BIFA 4GQBA 1I32A 4J0KA 2X9LA 2GRJA 4GNRA 3AVYA 1Y3BE 2GTHA 1UKVY 4MGYR 4R9RA 1X38A 3OOSA 4EY6A 4KXMA 5AJVB 2H0AA 3WGZA 5LR6A 2Y1KA 1N6KA 2HHAA 2AZ4A 2GO7A 3CJTA 5U1PA 4AJPA 3NTLA 1X77A 1W48A 3BCHA 4MWSA 2G6TA 2ZAOA 3N07A 4C76A 2EX4A 3IILA 3JQ9C 5H8WA 3DHNA 4XOIA 3ZYZA 3ROFA 4PYJA 3TL3A 1DDIA 4F3TA 3VYUB 1AE1A 4UHFA 221PA 2WG1A 4HH1A 4UDXX 2DY1A 4CUJA 4YJKA 1BFUA 1C1HA 1USVA 2HQOA 1X8LA 1K7CA 4HATA 1OPRA 4OK3A 3WIVA 4BVJA 5JYEA 1Z4OA 5BVHA 6Q21A 5KKNB 4PQYA 1XNJA 3TVTA 4WESB 3BXPA 3VR1A 1ATIA 1E2BA 4QYSA 1Y6ZA 1CDZA 4ZXFA 2UZAA 2O9JA 1J00A 1UBOS 3NT5A 4O2BF 5TJ9A 3ZE6A 4JAVC 3DL2A 4DMUB 4Y9RA 3DA8A 4DMRA 5JSKA 1XQWA 2FZEA 1PR0A 2HBYA 4AWXA 1T3TA 1K68A 2J5QA 3I8OA 3PQ7A 2X8JA 2ZWAA 4N8EA 5HQTA 4BKOA 1QE0A 2C4UA 4WLOA 1B76A 3IP8A 1D6JA 1F0YA 2C7QA 4KO1S 1DKQA 2GUWA 4DA0A 4E5MA 2VHYA 4KP7A 3HRHA 2ZRJA 4LHVA 4EMSA 2LE0A 3KP1A 4AY3A 1JECA 4LJRA 3TLZA 4Z99A 5M3BA 3B9RA 5LDHA 2GAFA 4EMTA 3IP5A 3N58A 2MSKA 2GOYA 1PG5A 5IRCD 2ATVA 3FIJA 5K7SA 1RI5A 5IKEA 5B3JC 1N5IA 1NW5A 2OFOA 2GEFA 1YDGA 5AVKA 3L7LA 1TJ3A 5FD8A 1NUAA 3QKUA 1N8NA 3VHXA 1QP4A 5EIWA 1GWNA 1O94C 3KL2A 1JT2A 4FDMA 3USCS 1QFSA 3A2LA 5L3VA 3WLLA 2ZYWX 5KMGA 3W9SA 4B6RA 5CITA 4NQRA 2D3TA 3KXDA 1HLGA 2FP4B 2C5EA 2CL6X 3AETB 6CHYA 1W5TA 2YFHA 1NXXA 3OURA 4JUBA 1W8IA 4RZHA 2X0FA 3T8YA 5JWRA 1O08A 2IHTA 3ZX4A 5KOJB 3RAPR 2LW7A 4BEBA 4DJJA 1KH1A 5KTRA 1VLQA 3VR6H 4HYQA 1LPAB 2YYZA 2X6RA 1XD2A 5AKHA 1YDMA 3FBGA 1SBIA 3PR3A 3EXHB 5A3SA 1ZCAA 2XGSA 1NDUA 3O2NA 3DLTA 1L9KA 1CC1S 1XAIA 3QXXA 5JMTA 5I3CA 4DRZA 3ESBA 4ZT2A 1C7FA 3WQRA 3FZEA 4D0RA 2HHJA 1NBIA 4KQEA 7MHTA 4G81A 1SUCA 1CZLA 1O57A 2DM6A 5KWVA 1YUMA 5IHPA 3HACA 2Z6VA 4CQMA 3RADC 4W63A 1UKEA 2V7WA 2ZRNA 4HDQB 4JI6B 3B20A 1BQ3A 3E9RA 1S7GA 3SYRA 3OSZA 4MW7A 3BXOA 5JANA 1NZDA 3IAS1 2E1PA 4B35A 1B73A 4QASA 1JLLB 2X1VA 2FW0A 2XYQA 2YYYA 3KOZA 4ZZIA 3T35A 1KEWA 5TRTA 3JWGA 4K6GA 1WDKA 4UM9B 2IUFA 2J0EA 4LWZA 1AQLA 1GNLA 5CT9A 4DNQA 5JBNA 4UDYX 4I6JA 5FFNA 4G24A 1YRHA 4TWAA 4JEIA 3S68A 4A1FA 5I9NA 3G3EA 3QV2A 2PL3A 4H0FA 4L6CA 4LRTB 3CX4A 1K92A 1M2HA 3FTPA 4PX5A 3H8SA 4UULA 1SQ5A 2FZGA 4F85A 3ESYA 5FEMA 1WHSB 3N7AA 3IIIA 2IRWA 3O8QB 1MPTA 2QPLA 2B82A 2QSJA 5F2NA 2O8CA 1LF5A 2V4UA 4QM7A 2XE4A 2ECQA 4GBJA 2GZAA 3NKVA 4L78A 1WHSA 4L0QA 4ND3A 3JQGB 5D3KA 5F98A 5KB3A 1JIKA 1YBMA 4NKRA 4FWBA 4HBGA 1M7BA 3JZFA 5JNWA 3A6FA 3KSZO 2C2XA 2FPGB 3NHKA 3EIQA 2DKNA 1XRPA 1NBOA 2EJVA 2WAYA 4NC9A 1HFJA 1YI8A 4YV1A 1M1NB 4BX8A 1FNBA 1GJRA 3KHUA 5CW2A 5KVVA 1JU4A 2WU4A 3QELA 3OD5A 2WHRA 3ZIDA 4EFKA 4JUFA 4O59O 5EPOA 2WINI 2WJVA 4YUYA 5KNDH 3LC1O 3IT2A 3AOEC 1L5YA 2X3UA 5EXSA 1YCGA 4Z1MA 3FLMA 3IKLA 5HDQA 3RIEA 3S2YA 1EWVA 2GWRA 1UPUA 3M81A 4B73A 4RSRA 5C51B 2YZ7A 4MR9B 3MTBA 3PXDA 4MP6A 1YR8A 3D6AA 4UU7A 1TVMA 3FKQA 1H9AA 5DNWA 1UJBA 4W8GA