3ITDA

Crystal structure of an inactive 17beta-hydroxysteroid dehydrogenase (y167f mutated form) from fungus cochliobolus lunatus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLFSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on a fungal 17beta-Hydroxysteroid dehydrogenase
rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase
molecule keywords 17beta-Hydroxysteroid dehydrogenase
total genus 105
structure length 260
sequence length 260
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3itdA00
3CH6A 4NR0A 4AJJA 1FF9A 4BNVA 2BFMA 2J3HA 4XWYA 1GUFA 3JYQA 4QQRA 1Q7CA 4Y98A 4NBUA 2FR1A 1WZIA 3INGA 3ZWPA 2P5YA 3K8ZA 3R3JA 4A2CA 3D4OA 3H9UA 2E48A 3DZIA 4II2A 3DTTA 3UICA 4MPDA 1DJNA 5IZCA 4B4UA 2PK3A 1HLPA 2VYND 1MC5A 9LDTA 2YDYA 4RDHA 4BNNA 1E7MA 1HE2A 3E9QA 4BV9A 2ZTMA 4PG6A 5A3VA 1I5RA 1AN9A 2A9FA 3PHJA 5DCYA 3DC2A 1FJHA 4Z0HO 4OJNA 2W2KB 3HNPA 1PGJA 2DTDA 1IB6A 1XGKA 2ZQYA 1YBMA 3F5SA 2GGSA 3HUDA 3JQ9C 5I9MA 1AGNA 4RDIA 5JCJD 1HDGO 5IJZA 1LLDA 4NK5A 4WNIA 3INTA 4R9RA 2O3RA 3VAZA 4E31A 5FI5A 3RFTA 4MP3A 1NQAO 3FNHA 1MX3A 2BD0A 3FF4A 4TZKA 2QHXA 3C7CB 1DRWA 5EJ2A 1GCUA 3PJEA 3VPGA 3WGOA 1RYEA 3U0BA 4DMLA 3V1YA 1PJLA 2YV2A 1W6UA 1F06A 1U1IA 1J5PA 1Y1PA 3C3XA 5KVVA 1FDTA 5BSEA 1HXHA 4CLDA 4ONEA 3O26A 2EP7A 4KUEA 3OEYA 4YACA 2VOEA 3BTSA 3TQHA 3O4RA 4CM9A 4EJMA 2RAFA 1HT0A 1T1RA 5FEUA 1ENOA 3F9IA 3RC9A 2HUNA 4D46A 2V65A 4R16A 1E7RA 4YAEA 3B70A 4R1NA 4RPHA 2BH9A 3F47A 1LBEA 4IDFA 3WJAA 2W2KA 3X2FA 4D42A 3B20A 3GOHA 1LRKA 4A27A 3SBOA 3D3WB 1GFSA 1F17A 2BI8A 1UZNA 3FPCA 1BTOA 1ZH8A 3BMCA 2OP0A 4XGKA 1B0AA 1N1EA 3I1JA 3DFZA 3GUCA 4RQUA 4MVJA 1LDNA 5I9LA 5KNLA 2VT3A 2YFQA 2OUIA 4CMHA 3S1LA 2PD3A 1N9GB 2YYYA 2NACA 2B5WA 3L07A 1PR9A 1ORRA 1L7EA 3L0DA 4WE3A 3HDHA 3QVOA 5K9ZA 3VVBA 2Q1TA 4E5YA 5L7TA 1T2FA 1JKFA 2UVDA 4NZ9A 4J1SA 3IS3A 4E3ZA 5KCZA 4F45A 3WR5A 4J90A 3PP8A 1ISHA 1J4AA 2BGLA 3DQPA 1Z75A 2EG9A 4R1UA 4E2XA 4YQZA 4RV9A 4XIJA 1IPEA 5KIAA 2VHZA 3BMNA 4J49A 4QEDA 1LJ8A 3I52A 4PG7A 1R4MA 4KDEA 1Q0LA 3H3FA 2VNAA 3EVNA 4F3YA 4BNUA 1ISMA 3WSVA 2PZLA 1IHXA 1ZW1A 2PZMA 2Y0EA 2O7SA 4NI5A 1DDOA 4CMKA 5AYVA 3DXFA 3I4FA 2VWQA 4Z9FA 3MJSA 1E1LA 2CDAA 2Q45A 3IOYA 3GR6A 3ITKA 4WLVA 3WIEA 4UEOA 1E6WA 2BFAA 4R3WA 4RCVA 2GF2A 3FTNA 3IQDB 3L4BC 2VRCD 2VTEA 2RIRA 3TZCA 3OJFA 4IMPA 5HA5A 4HNGA 3VTFA 3TWOA 3GPDG 1YOVB 4CM3A 5A4DA 1A71A 1ENPA 1E3LA 4LVUA 3OIDA 3O9ZA 3ABIA 4MVJE 1LRLA 1NPTO 1ZEJA 4I5GA 4MVJF 3OETA 4DPMA 1E5LA 4TRMA 3NX4A 2NLOA 4JROA 3WNVA 4ALKA 4R68A 3H3JA 3ST7A 3RASA 2O3QA 2OZPA 3KOUA 4LSWA 3I5MA 3WYBA 4B4WA 1N2SA 3R3SA 1A5ZA 3DHNA 2ZK7A 3KETA 1E1NA 4EITA 4DYDA 4ZU3A 5G0VA 4O6VA 2BFOA 1XQ6A 1LQTA 3QSGA 3INRA 3ZNNA 4AFNA 3JQGB 1RYDA 5C37A 4WK6A 3LF1A 5TSDA 2JJYA 3W6ZA 1CERA 4IS3A 2BMAA 2JD1A 4JJIA 4CMEC 1BW9B 4FPXA 3ADOA 3JV7A 2X58A 1WMBA 3KLPX 5JDCA 4GGPA 4O63O 5EIOA 3TZQA 3CXRA 4ALJA 4E5KA 1GDHA 1T2CA 2Y1GA 5JAZA 1O9BA 3NAQA 3RFXA 4LCEA 3K6JA 3OJ0A 4UVDA 4RJTA 1WW8A 3RBVA 1BHSA 4BNFA 4C4OA 3VPFA 2NQ8A 2BFPA 1V0JA 2HAEA 1NX6A 2EGGA 3C7DB 2YQ5A 3H9JA 4IS2A 1JA9A 1XU9A 1C0LA 3GDOA 4ZQHA 1KEVA 1HYEA 4M1QA 4P4GA 3CUKA 1C1XA 3I9JA 5LC1A 3W6UA 1HDXA 2NM0A 3X2EA 1U5CA 1P45A 3OICA 4IQ0A 3D0OA 4XYEA 3UFXA 2YQ4A 4YB8A 1D7OA 1ONNA 3VZQA 1NNUA 3P2YA 1FDWA 2BRUA 3PFWO 4WOKA 1P1HA 2QYTA 2GASA 1PS0A 1GQQA 2EW2A 4QSMA 3WMWA 5FYDA 1GU7A 2CF6A 2BKAA 4FD3A 4GGOA 4RQTA 5JAQA 1C1DA 4BO9A 3MJCA 4R1TA 3C24A 2HRBA 3R6DA 1GAEO 2G0TA 2O7QA 4QO8A 2E82A 3ZCXA 2ZKLA 2CVOA 5ES3A 4L75A 2DM6A 4ITUA 2B83A 1GUZA 2C2XA 2HMVA 3K96A 4N5NA 4CLOB 2UUOA 4KWIA 2QRLA 3AI1A 1SAYA 3N7UA 4A10A 3U3XA 1FMCA 1JDJA 2W2LA 4BKPA 1I3MA 3LLVA 1EFKA 4WASA 4PVDA 1OC4A 3I3OA 2AEJA 2I67A 1YO6A 3H5RA 2DTEA 2GERA 2H5LA 4CLXA 1A7KA 5G4KA 1YBAA 4AJPA 1I10A 2AA3A 3T7EA 1HDOA 3ZV3A 3AU8A 3FNGA 3ZDFA 1IUKA 3KV3O 2XXBA 4DPKA 1D1SA 4QFDA 5L7YA 3HDJA 3LDHA 4PLHA 4O59O 4RZIA 1DPGA 1NHGA 1PJ2A 2NTJA 4PLFA 3F1KA 1Z7EA 4W9NA 4YRBA 1U4OA 5L40A 4S3MA 4PLYA 4P22A 2Y1OA 3JQDA 1DIGA 2YZ7A 3GK3A 1LUAA 2HU2A 4AL4A 4Q3AA 1SBYA 1ONPA 1UUFA 2HKIA 4B79A 5T8KC 5AOVA 4IDCA 4ND5A 4Q3NA 2UYYA 3GA0A 4LRTB 4ZRNA 4CM7A 3WGIA 1E3JA 4NNJA 4WCFC 4I9UA 4WNCA 1BVRA 4IDAA 1X0VA 2ZCUA 4G81A 5G4KB 2GUGA 2Y1FA 2JFFA 3HN2A 4J1QA 3QE3A 5G0WA 3M2PA 5F1KA 3ZI0A 5IXSA 2VWHA 4OKNA 2C2YA 3RU7A 2ILTA 5GZ6A 2YV1A 3TSCA 4NFHA 3TDKA 4KTTE 3PJDA 3WXBA 4ZQBA 4YEDA 4WEQA 3HE3A 4BKRA 3VH4A 3FNEA 4KUHA 5IDWA 4XGNA 2W90A 2NV6A 3LC1O 3T7CA 1PGPA 5JBIA 3GAFA 3RUFA 4E13A 5L4NA 3UCXA 1AHHA 1U4SA 2HRZA 2GDZA 4JJGA 3M1AA 5HS6A 4FFNA 5JCXA 3WGYA 2O48X 3CZRA 3IDSA 4HWKA 5ER9A 3IKTA 3QRWA 5A9SA 2GNAA 2O3TA 1KY5A 2YV3A 1H6BA 2I99A 4PRKA 2C20A 3DZKA 3RKUA 1PWZA 4TRNA 5FFFA 4B3HA 4HBGA 3JYPA 4FC6A 4YJFB 3DBRA 4ZGWA 1E77A 2HMSA 4JNKA 2BGKA 4OOFA 4YAKA 4JXKA 4F46A 1K6XA 1GV1A 3NRCA 1U3WA 5T5QA 1DJQA 4YJDA 3PVZA 3FD8A 1W8DA 3PLNA 5T64A 2OORA 3KM0A 1KEUA 1U28A 4KWHA 4YTEA 2FSSA 1ZXBA 2CNBA 1ONOA 3ZW9A 4DLBA 1UP7A 5GY7A 5C7OO 1EVZA 4MVJP 2Q3EA 1RM5A 4NDNE 1V6AA 2NU8A 4H7PA 3C1TA 1P74A 3WB9A 3ASVA 4R41A 4YCAA 4E2WA 2AEFA 4MVJM 1L1FA 1MFPA 4DQUA 3ZWYA 1GD1O 1JTVA 3QWAA 3PJGA 4YBZA 4XQ9A 3GHYA 5CAEA 4WOJA 1UH5A 1B15A 3BMNB 2PV7A 3FN4A 4CL3A 4IXTA 4B3JA 1F12A 2AG8A 1ZFNA 3MZ0A 5F1OA 3GH3A 5JYEA 1I8TA 5TC4A 2H1SA 3LLSA 4JIGA 4NK4A 4XQGA 3NV9A 4JGBA 5HTOA 2X23A 3D4PA 1I30A 3K9QO 4E4YA 2WJPA 2Q1UA 5KKAA 1MG5A 4AJIA 3QVTA 2PY6A 2HLPA 2P4QA 4CV0A 1YE3A 1Y6JA 3GT0A 4HNHA 4WEOA 2CMDA 5EN4A 3GRPA 5IAAA 3ZNQA 1C1XB 5DP2A 4UVGA 2NTVA 2O3UA 5CEFA 2DFVA 2O4CA 2WWRA 1LXCA 4Z3DA 2LDXA 3MJ4A 5AXDA 1E7SA 1LC0A 1QYXA 1SEVA 1B8PA 1U5AA 3OA2A 3PK0A 5COAA 4ZQGA 3MTJA 2O3JA 1LTHR 1FDVA 5DNAA 4QXMA 4BGVA 3ETDA 2RCYA 2VN8A 4NBTA 3WGGA 3ZWXA 4FOOA 1M66A 3AM4A 4URFA 3PPIA 5DOVA 4IMRA 4UAGA 5JNLA 4ZHSA 4R69A 2C5EA 4WCFB 3DBLA 4CMIB 2BLLA 5IDYA 1AXEA 2PH5A 4DL9A 3HB4X 3A14A 2Z1MA 1CETA 2HMTA 3JQAD 2CY0A 1AE1A 1RM4A 3S2GA 3D7LA 5L53A 3V8BA 4BO2A 3JQ9A 3E48A 2XF8A 1NQOA 3CZMA 3OF2A 1VKOA 3N58A 1MLDA 3AOEC 1PIWA 1ADFA 1TXGA 3KSZO 2UDPA 4CUJA 2ZJ1A 4CQMA 1H6DA 4E33A 1JKJA 2DVMA 1WDKA 4NG5A 4INAA 5ER6A 2VZ0A 4WPGA 2JFGA 1Q7GA 1EE2A 3AFNA 3LVFO 3H9GA 4GKBA 3AOEA 4BGEA 2X22A 4CM9D 3V2UA 3IJPA 3S2IA 2ZTVA 1YDEA 2X9NA 3P2OA 3TOZA 1NAHA 4RPKA 1LQUA 2X9GA 3BMCB 4WLFA 3NUGA 3MOIA 1BXZA 4KUGA 4XQEA 5ILGA 3EGOA 2W2LD 1HWYA 4CLOA 1JQBA 4IIVA 1S6YA 3JQBA 1KVSA 2E49A 2DU8A 3JQ7B 2CFCA 2JCYA 1DRVA 3GFGA 3PHGA 1WLYA 4BGUA 1G0NA 4BKOA 1MUUA 3ZNOA 1ZK1A 4TQGA 2QRJA 3ZN2A 2LDBA 2RHCA 3AM5A 2AHRA 4HKTA 2FP4A 1E1KA 3BHMA 5EESA 6LDHA 5JAMA 1SPXA 2V6BA 3F6YA 4PLTA 2WSBA 1IPFA 4BNLA 2AMFA 3ZU2A 1NXQA 3ZV6A 2ZCVA 3ITDA 1I01A 4BMNA 4YXFA 2OL4A 1HYGA 4FGSA 3ROQA 1YQXA 3R0IA 1WZEA 3JD3A 2VNSA 1I2CA 1H2HA 4OAQA 3G49A 1VL0A 4J4BA 1GZ6A 2POQX 4GPD1 4MVJD 2G82A 4B7XA 4AJ2A 1R15A 1PGOA 2CDCA 3ICCA 3DHYA 4U7WA 4IJUA 4OHUA 3ANMA 1ZXLA 1MB4A 2CZCA 4EEXA 5I8WA 4BNJA 4BNIA 4PG8A 2AW5A 3SLGA 1PEDA 3I4CA 4Y6RA 1XU7A 2HQ1A 1NYTA 2PNFA 2ZB7A 3IP1A 2B69A 5JFOA 2AQ8A 4BNXA 1HRDA 3AY3A 1HF3A 3DO5A 5A9RA 4IY1A 3I9LA 2V6GA 5BNFA 1XYGA 2NUAA 3VZPA 5C7LO 1LU9A 1QV6A 2A94A 2DQ4A 3SC4A 3DTYA 1CJCA 4W99A 1LDGA 4H15A 4UVEA 4GVLA 4JP3A 1BG6A 3VH2A 4CR6A 3WLFA 3OIFA 5DT9A 2CVZA 2HK9A 4WLUA 1B16A 3V2HA 1X7GA 5ENDA 3DZJA 2VWGA 4GQAA 2JD0A 1XHLA 3H65A 1WDLA 4Q3CA 3UCFA 1KYQA 4CMEA 2NVBA 1BRMA 2UAGA 1BXGB 3WGQA 4OSPA 3M1LA 5T67A 4NMHA 1OC2A 2Q2QA 2Y68A 4FGWA 1YGYA 1LRJA 3GG2A 4HFMA 4FJ2A 3K31A 4ZD6A 5JC1A 3NEPX 1Z74A 1UDBA 2WYWA 3D3EA 3PWSA 2B4RO 1S7CA 1X7DA 3E9MA 3HDYA 4FQ8A 4ZQFA 2ZB3A 3LZ6A 3A06A 4BMVA 2XXJA 1E6UA 1ZK0A 2J5RA 2HSDA 1GQ2A 4R51A 1EEHA 1BMDA 5F21A 3HZZA 3DMYA 4IUYA 1QRRA 2O4UX 4U0JA 4LISA 4W7IA 1EQ2A 3ZWNA 3RIHA 3QHAA 4BQPA 3WFJA 5B4TA 2EF1A 5BNTA 4DWVA 3DBHA 3R1IA 3O8QA 1P1FA 3VZRA 2O2SA 4OYRA 4ID9A 1YH3A 3AI3A 1ZIDA 4XGIA 4L74A 1YL7A 1NFQA 4LN1A 3GVCA 3Q11A 4R5HA 1OAAA 1WNTA 1UDAA 3AUSA 2EKLA 1OBFO 5KJEA 3U49A 1Y9EA 4RVFA 4E32A 1HETA 4Z9XA 1YRLA 1C3VA 1P31A 1U7TA 4Q9NA 1VRWA 5KOIA 1Y81A 2W98A 3GC6A 4TKMA 5L4LA 2VHXA 4R3NA 1UZLA 2YHIB 5AXCA 3P5SA 4XB1A 2FMUA 3JD1A 1NVTA 1G1AA 2EGHA 2NNLD 2DPGA 1ADBA 2CF5A 1PSDA 5KJ6A 2Y1EA 3D5TA 1HE5A 4IQ8A 2JHGA 4MKRA 5JDIA 3UW3A 3VPXA 5A5EA 3ANLA 7ADHA 4IIUA 1MA0A 4EDFA 3PRJA 4K9DA 5EERA 3KXDA 3BMOB 3DBRB 4GWKA 4Q3BA 5U9CA 5CPFA 1GYPA 3TL2A 1UXGA 1HE3A 1VSUA 3L6EA 5B4UA 4J7UA 4MVJH 3Q9NA 3DL2A 2IDZA 1DAOA 3OSUA 3M6IA 2W8ZA 4I5EA 4S1VA 4BNTA 1V8BA 2ZB8A 4HFNA 4HY3A 1QYCA 5IZCC 4MOWA 4ALMA 3D5QA 3KBOA 2DBVO 5T8KA 4DBVO 4CUZA 2ET6A 3GUYA 5TJHA 4ND2A 5EMHA 2HK7A 1UAGA 4O1MA 2YHIA 5GZ3A 3AW9A 2WD8A 2D8AA 1QORA 2C5AA 3KB6A 3E18A 1GV0A 2IE0A 3WFIA 3ZZNA 1UXIA 3KYCA 5CDTA 4D3FA 4FJ1A 1PL8A 2YDXA 4Y6PA 1PJCA 4G65A 1PTJA 1RPNA 2YW9A 4RVUA 4YWJA 3ZH2A 1J6UA 1YDWA 1A27A 4XQCA 2X1HA 3AJRA 1DLJA 3H5NA 3SJ7A 3U62A 4YT4A 1LA2A 2FY8A 2D59A 1P1RA 1UJMA 1XR3A 3L6OO 4UUPA 1ZUD1 1CQJA 3FTPA 1U3TA 3OQ1A 1GL3A 4YDRA 2FRDA 2P68A 1N9GA 1W4ZA 4KTVE 1PJSA 1J49A 3EC7A 3GN1A 1Q2XA 3DAGA 1LDBA 4J7CA 5IZ4A 4HP8A 1NFRA 3KEOA 4PCVA 3I9KA 3GVIA 3W4KA 5U4QA 3MJVA 3GMSA 1BGVA 2A4KA 1QKIA 3RSHA 3VPHA 1E0DA 1P0FA 1EVIA 3HN7A 3I9NA 1E7QA 4MDHA 5I9NA 1GTMA 1NWHA 3AY6A 4BNHA 2YHUA 4O5OA 2Q49A 3W4IA 4NFSA 2IZ1A 2IYOA 1X0XA 3DOCA 5A02A 1DFHA 3N74A 4BS9A 2C29D 5A5FA 4G5HA 1BXGA 4RLSA 4WLOA 1T24A 3IL2A 5ICMA 3PQFA 4AJHA 4BHTA 1J0XO 1FXSA 1JU9A 3QWIA 2D0IA 3T4XA 1MC4A 2YFHA 4H16A 2PLAA 5TT0A 1XDWA 1Z7BA 2O2YA 2QZ9A 3JYLA 1RM0A 1X13A 1SEPA 3SC6A 3E6AA 4IJWA 3NKLA 4YJHA 1F0YA 1Z73A 3NT4A 4FOSA 3QV1A 1D4FA 2NVWA 1T26A 5TS3A 5KJ1A 3QVWA 1DSSG 1MGOA 3I6QA 3JCZA 2R00C 5I8ZA 3WWYA 5JDIC 5CPBA 3E82A 1U3UA 3HSKA 5BSFA 1T2EA 4BO3A 2D1YA 1QG6A 3DAPA 2EEZA 3I6IA 1T4DA 1KY4A 1IOLA 4DUPA 4EBFA 5K6AA 2FZEA 1JWAB 1M6WA 3B6ZA 3CPSA 3ZWCA 1M6HA 2F1KA 2IYPA 2O50A 3QWHA 3JQAA 3AOGA 4LVCA 2JAHA 3RFVA 1U8XX 3NJ4A 5THQA 5GZ1A 4K28A 1ZO8A 2X5KO 3OJOA 3FWNA 3DZBA 1E92A 4X54A 1KERA 1CF2O 1LEHA 4A26A 1M76A 1DRUA 3PDUA 3ZWMA 4CR8A 1JLLA 4QO7A 3ROKA 2G1UA 1ZCJA 2WYUA 4BNKA 4CM8A 4YT5A 1MFZA 2VRCA 5KWEA 4CMJA 1TA4A 2VZ8A 1ZSVA 2FN7A 2WD7A 1EQUA 4GX1A 3OECA 3UAGA 3WQRA 4D0RA 4E5PA 1U9JA 1U8FO 1XCBA 4IINA 4ND1A 3I23A 3FWZA 1UP6A 2RHRA 1TT5A 3DBLB 3D3WA 4CMIA 5F3RA 5THKA 3K2BA 4D7AA 1AHIA 3BHJA 4ZICA 4PFJA 2RH8A 2BF7A 1C14A 5IDQA 5JPIA 1ZZEA 4U6SA 1I33A 3ZHZA 3FBTA 4DLLA 4PVCA 3A28A 1QYDA 3RI3A 1CYDA 3MTGA 4MKXA 4PN3A 2GYYA 3CTMA 3GQVA 4BB5A 4XCVA 1N7HA 2H63A 3TOXA 1JAYA 2I6TA 4R5MA 2FPGA 4WCFA 4AJOA 2QG4A 3GMDA 1LDEA 4L9RA 4MKZA 3F3SA 4J1TA 1FDSA 1H6CA 4CPDA 3QVXA 3SJUA 4XR9A 1PJ4A 1UP4A 3CSDA 1YQDA 4KQXA 4BKUA 1VI2A 1IULA 4LCJA 3A1NA 2FPIA 2DT5A 4LW8A 2PH3A 1GZ4A 3ZW8A 5G4LA 4GSKA 1P3DA 3RCBA 3WYEA 1EDZA 1O0SA 4IQGA 4FFMA 2OHXA 2ZQZA 4J16A 2PD4A 3ETEA 4DIFA 2PR2A 1PS9A 4GI2A 3L9WA 3L9XA 4E6PA 4AJLA 4FS3A 2JFHA 3OIGA 2D5CA 1YONA 1BDBA 3OEWA 4QX6A 5CG1A 1ML3A 4R54A 4KP7A 3VKUA 1DB3A 1H6AA 3RWBA 1K89A 4FFOA 1HSZA 3QP9A 4TSKA 2X5OA 2EV9A 2X5JO 2IZ0A 4MVJI 2P9CA 3GLQA 2GD1O 4OXKA 2Q2WA 4DREA 4O0LA 4QTZA 1HLDA 2J6IA 1Y5RA 1ZK2A 3GEGA 3AM3A 4K6CA 4Y6SA 3BA1A 2WTBA 4YQYA 1LI4A 1NR7A 2EKQA 1XLTA 3GDGA 3LC7O 3ONFA 5EQFA 1GEGA 1LLCA 3S2EA 5BSGA 2WE8A 1DO8A 4TZTA 4XKJA 4JCOA 1D8AA 1I0ZA 1LSOA 4CUKA 1PQPA 2HMWA 1BWSA 3DOJA 4EJ0A 3HDQA 3RBXA 3PTZA 3E8XA 3U4HA 2BI7A 2HO5A 3BMOA 3WTBA 5HRUA 3PYLA 4XA8A 1O95A 4XEHA 2X0JA 4PLWA 4G2NA 4L73A 4JLWA 4M87A 4UVHA 1PJQA 5H82A 1KC1A 2D4AA 1PQUA 1NVMB 1BXKA 5A1TA 4N5MA 3RC7A 1YQGA 1QXSA 2B4TO 3TZHA 5JC8A 4E12A 3TF5A 3RUAA 3GVHA 5A05A 4BO8A 4DRYA 2VUTA 1F14A 1P0CA 2C07A 1EUZA 3GNSA 3EK2A 5ITWA 3RROA 1DC3A 4BNWA 4DYVA 1YS4A 3KRTA 1K6JA 4WLNA 3ZU5A 3BMQB 2B36A 1PGNA 3L4SO 4LSMA 1K6IA 4Z0TA 1UXJA 1K0UA 1SC6A 4WLEA 4F6CA 4OMUA 2AEMA 4B3IA 2ZYDA 3ZGYA 1CEQA 3CINA 4Z9YA 3V5NA 3Q9UA 1YKFA 3GZNA 1I3KA 4XZ3A 4DC1A 4U8GA 5JSFA 4ZA2A 5ITVA 3FBGA 2H9IA 3NJ8A 3ZWVA 3W4JA 1YOVA 1EBFA 3ZNPA 1NVGA 1XG5A 3PHHA 4OSOA 3KYDB 3VHRA 4D43A 4E5NA 4Z3KA 3I83A 4GVXA 1PU2A 5G2OA 3OJLA 2EXXA 2FR0A 3PYMA 3RUEA 4GLLA 1XA0A 4ND3A 2NQTA 3G79A 2IEBA 1LDMA 2GN4A 1PR3A 2AXQA 3MOGA 2DC1A 4FR5A 5CDUA 1I24A 1A9YA 2JCXA 4RVDA 1WMAA 1ISFA 1OFGA 4FFPA 6ADHA 1SMKA 5A06A 1DC5A 2DBRA 3MJEA 4FSHA 3TL3A 4B8ZA 4TRJA 3VH3A 4EW6A 9LDBA 5HS4A 3NDRA 3AUUA 3PGXA 2I3AA 4UEJA 5B37A 3W8DA 3D64A 3KO8A 1QYWA 3PGJA 4AJ4A 3OHSX 4FB5A 2BELA 3C8MA 4IGFA 4D41A 1ISGA 2J5KA 1QLHA 3NTRA 1O89A 1HZZA 4CQLB 2GO1A 1R12A 2Z5LA 3VDQA 4B8WA 1DBVO 4J3FA 2WD7B 4EZBA 4XJTA 2ZTUA 5AXBA 5JAIA 2J3JA 3FRJA 3OM9A 5JO9A 3JYNA 4RVHA 4NQZA 4GX2A 1DFGA 2X6TA 1P9LA 5DZSA 5TNXA 3CMMA 4OOEA 1NR1A 4GAEA 2PD6A 3EVTA 4UUNA 1YWGO 3NGXA 3LT2A 1WXDA 1GYQA 5L51A 4IBOA 4CMGA 3EZLA 4CV3A 5IXYA 3QIVA 4M8SA 1ZVMA 1V3VA 2FR8A 2GZ1A 3OFSA 1E3EA 4PRLA 2PA3A 4MVJG 1PZGA 1IHYA 4Y8VA 4XJSA 3GVXA 2NADA 3ZV5A 2OFPA 1N8KA 4PLCA 1DFIA 5A9SB 5DBGA 5F1PA 4BGIA 1A4IA 4RL6A 3OMLA 4NPCA 3KSDO 1V3UA 3PJFA 4MO2A 4YRDA 2VYNA 4BO5A 3P7MA 1EVJA 3WX0A 5KTKA 3HHPA 3IAHA 1CIVA 2OXIA 3WMXA 2VYVA 3EMKA 3UGKA 5GMOA 1ADCA 3ASUA 4XDZA 3DB2A 1I36A 2NVUB 4XB2A 2B37A 4BO0A 5CG2A 4JK3A 3JD2A 1GEEA 1N5DA 1OI7A 1VM6A 4IDBA 3JQ6A 4CMCA 5I7EA 3KYBA 4L0QA 5G0TA 1NWCA 3C85A 1O6ZA 4YJHB 3Q6IA 4DC0A 2B4QA 4J9VA 3ZHYA 4EEZA 5HBRA 4GX5A 3ZWWA 3KVOA 1IZ9A 3MEQA 3IUPA 2CVQA 3DZFA 1IYZA 3G0OA 5DN9A 4XYBA 4I9HA 5TRTA 4JBIA 3G3EA 1B8VA 4M89A 1ID1A 2Y99A 1WVGA 5TLSA 3S2FA 4RLHA 3MWEB 3GGOA 4A5OA 3GFBA 5F5NA 4AJKA 1ADGA 5CFZA 4CLRA 1H93A 3VVCA 1DC6A 3BZUA 3BMQA 1HE4A 3WS7A 4TROA 1I2BA 2EKPA 4XD2A 1V3TA 2R00A 1CWUA 1N7GA 1VSVA 1YL5A 1ZBQA 2J8ZA 3JSAA 4CM4A 2RH4A 4W9NC 1GQYA 2IXBA 2NSDA 5DP1A 4L4SA 4CMAA 1P44A 1JVBA 2C0CA 1K3TA 2Q99A 5IN4A 4Z0PA 3GPIA 5IG2A 4N18A 1H0KA 1Z82A 4C7JA 4ESOA 4UUMA 4KDFA 3ORFA 1DHRA 1B3BA 1C0IA 1FDUA 2F00A 3BTVA 1RKXA 3QWBA 3KZVA 4J2HA 3H2SA 1ENZA 1VJ1A 5LDHA 5A3JA 1DEHA 4GL4A 3U4DA 2AQHA 1GY8A 1EZ4A 2I3GA 1Y5MA 3HQ4O 4FBGA 4KQWA 4LK3A 4BO7A 3GEMA 4MP6A 1HKUA 2JKVA 2Q50A 3LU1A 4K6FA 5H83A 3WQQA 4BO4A 2XAAA 1R6DA 4AG3A 4FCCA 1CQIA 2Y0DA 3KTDA 1XELA 4DTIA 5JO0A 3Q3CA 3AUAA 5KJFA 3GGGA 4PG5A 1N1GA 3UH1A 2DLDA 4IM7A 3UXYA 3H8VA 4I5DA 4NJMB 5TF4A 1EUCA 3PIDA 1PL6A 3FHLA 2P9GA 1DIBA 1Y8QA 4WKGA 3ZU3A 2A35A 2X0IA 4Y67A 2VHYA 4M86A 1I3LA 4HXYA 3NDIA 1WPQA 1YBVA 3AWDA 3RBZA 3KYDA 2WEKA 3UOGA 1P77A 3L6DA 4EI2A 1JN0A 2JL1A 1TVEA 5FF9A 3GDFA 2VCYA 4Z6KA 2HDHA 2SCUA 2JD2A 1H2BA 4NJMA 1KEWA 1PZEA 2I9PA 3B1FA 2Q1SA 4EGFA 2Z1NA 2VRBA 3JQBC 4HADA 1PS8A 3VOSA 2ZIZA 1B14A 4LMRA 2I66A 4PLGA 1JWBB 2V6FA 4OQYA 1GYRA 5AQ1A 1HDRA 3GF4A 4YAGA 5DBIA 3ONDA 5B12A 1ZJYA 1T4BA 1YJ8A 1P33A 4NBRA 1LX6A 4LMPA 5IN5A 4NU5A 1JAXA 1Q1NA 3KLMX 4RPJA 1Y8RA 2X8LA 2X4GA 1ZKMA 2AG5A 2FSVA 1YB5A 4PG4A 4E0BA 4R01A 2QIOA 3OA0A 3QVSA 3ZWBA 3NT2A 5CHEA 4IPTA 4CR7A 5KVQA 4Q3EA 1NASA 4J2OA 3ENNA 1XWFA 1B3RA 3KYCB 1SOWA 4K26A 3CMCO 4CJXA 3VC7A 3JQ8A 3V2GA 3WGHA 4BV8A 5A03A 1Z45A 3BAZA 3LC2O 4J1NA 5ADHA 2WDZA 2DAPA 3EUWA 3SVTA 3RKRA 3ENKA 1JVSA 4A03A 3AFMA 1ARZA 1DHTA 2GZ2A 2B0JA 4D44A 1NQTA 5JXWA 3PQDA 3LYLA 3FPLA 3K92A 3PZRA 2E6UX 4CV2A 4NBWA 2G76A 5FWNA 1I2ZA 2FPPA 3DZHA 5DCUA 1QMGA 2X0RA 5L3ZA 4RGBA 5T6BA 3PHIA 5BNIA 3ULKA 3L77A 4ZN6A 2QRKA 1A4UA 4CLHA 2Q1WA 3BTOA 3PWZA 3LF2A 4JQCA 1O8CA 5BT9A 1B7GO 3D4NA 4TVBA 4J0FA 1E3WB 2GPTA 3IKVA 3ROMA 3EDMA 4BO6A 2CSUA 2B5VA 4GBJA 1UR5A 3MCVA 2H6EA 5EPOA 1AUPA 1KVUA 1SCUA 2EP5A 2VUUA 3JD0A 1H9AA 3RU9A 4DGSA 3U09A 3DMTC 5IDXA 1IZ0A 3UCEA 4P4LA 3E1KA 1DIHA 2YJZA 4BIIA 2UUPA 2P5UA 1U3VA 1KVTA 2Y67A 1A72A 4PLPA 2G17A 4DVJA 2P4HX 4IJKA 2GSDA 4XYGA 1YVEI 3FR8A 1NM5A 1EFLA 1T2AA 2Q2VA 1LSUA 4EUEA 4ROSA 3K73O 3HJAA 3BXXA 1LLQA 4UREA 2BHLA 1NAIA 1HYHA 3GHHA 4OL9A 1NQ5A 5T57A 3JQAB 1E5QA 1HDYA 3DWFA 4CM4B 1GCOA 3W1VA 2R2GA 4DMMA 3NTOA 4DIBA 3HB5X 4PLVA 1BDMA 3RUCA 1E3WA 2V6MA 1FK8A 2AQIA 2IZZA 4J4TA 1B8UA 1TT5B 3FR7A 4TRRA 5KJCA 3AUTA 2D2IA 3VDRA 4E2YA 1YB1A 2J3KA 1RJWA 3DR3A 3I9OA 4IDEA 2FZWA 4XYMA 5JS6A 1A7AA 3S8MA 5F5LA 3WGZA 1R0LA 4DQVA 3WSWA 1MV8A 2OGUA 2PWZA 3GG9A 2OBNA 1VE9A 4IJVA 4FIZA 2GZ3A 4RORA 1CDOA 1H9BA 2GN8A 2P91A 2V7PA 4JBHA 2EJVA 3ZU4A 3FSRA 5DBFA 4DQXA 3H6KA 5TX7A 1PZFA 3IIEA 1DC4A 4DPLA 3IC5A 5JLAA 2DPHA 1TEHA 5AVOA 3LK7A 5C5IA 3DZGA 2UV8A 1QP8A 1UXKA 1R37A 4BVAA 3U9LA 3WQSB 2QW8A 5COQA 4Q39A 3ZWOA 4JJFA 3Q0EA 3DOOA 4L76A 4OXNA 4E2ZA 1UAYA 4XR4A 5TGDA 3VKVA 1K5HA 2C82A 3NYWA 2VTDA 3UUWA 4W7HA 1R4NB 2HCTA 3ZV4A 1N92A 3LT0A 2QX7A 1ZNQO 2GR9A 4D0SA 1KVQA 4OGWA 3NT5A 2Z95A 1HDCA 3WBFA 2ZYGA 3TZ6A 3AK4A 4NH4A 4J6FA 4I9NA 1NFFA 3DEYX 3PQEA 1F8GA 1KIFA 2B35A 3PXXA 4I1IA 3V1TC 2VZ9A 3VPSA 1PJBA 1HTBA 1XEAA 3G1TA 3WBBA 1NPDA 1F8FA 3QQPA 3ANNA 4FFLA 2VT2A 1U2GA 1AXGA 2D5AA 4J91A 4UUOA 4N5LA 1EK5A 3TFOA 2Y0CA 4OH1A 1G6KA 4HV4A 1NTOA 1UDCA 4U5QA 3AU9A 1BSVA 2I65A 3RUIA 1DIRA 1X1EA 5ILOA 1R16A 3KHUA 4GSLA 3PHLA 2PKRA 4E5MA 4R9SA 4PGFA 3W8EA 3ON5A 1DLIA 1Y8RB 3NGLA 2WYVA 4YJGA 1QSGA 1C1DB 1DOHA 1MXHA 4YPOA 3GNQA 3BIOA 5U1PA 3PZBA 3DBVO 3ZWAA 1LLUA 4RVSA 5CP8A 4W82A 3K5PA 1SNYA 1TT7A 4PZEA 1Y7TA 2GRAA 4L4RA 3WOHA 1O94A 4DIOA 3E9NA 4RPLA 4IZIA 3GAZA 4GX0A 4FN4A 4OM8A 4BO1A 4ALIA 3F46A 3WDSA 2AQKA 1IY8A 3I9MA 1ISJA 4MP8A 5KKCA 2DBQA 2ZYAA 3UVEA 3WJ7A 1NHWA 4YYZA 3K30A 2XOXA 1UXHA 3RQSA 2X9VA 2ZATA 4RF2A 2NU7A 2PFGA 3M2TA 4KOAA 2C54A 3TJRA 3SLKA 4AVYA 3H7AA 3FNFA 4JN6B 3CKYA 3IUSA 2QZZA 2WMDA 4AJNA 1C0PA 2VOJA 3P19A 1HSOA 4D45A 1WWKA 3WIDA 5FI3A 3W8FA 2EERA 4BNGA 5DULA 1OOEA 3RJ5A 2Q4EA 2P2SA 1VC2A 4GLOA 1Q0QA 1R0KA 2PKQO 3FI9A 3JD4A 3NDJA 4P4NA 1U2DA 4ZVVA 3QY9A 1EUDA 3WICA 4MIYA 1E3IA 1R66A 2G5CA 3F4BA 4YT8A 2VHVA 3E03A 3JYOA 3PEFA 2NWQA 2X86A 1P1IA 2EIHA 3CIFA 4I5FA 2X7HA 2NU6A 3EZYA 4XRRA 5JE8A 2JCVA 4GMGA 2FWMX 5IFLA 1UZMA 1R0SA 2OP1A 1Z6ZA 5ENVA 1T25A 3E5RA 2OO5A 3GZNB 8ADHA 1YL6A 1A9ZA 1ZK3A 3ZHBA 1C0KA 2HK8A 1GADO 1E7YA 4EJ6A 1GUYA 3JTMA 4ZJUA 1P1JA 3DMTA 4FJ0A 3BTUA 5LCXA 3JQ8B 4JP2A 4BB6A 3MJTA 3PFFA 2NU9A 3H2ZA 3HFSA 4FFRA 2AE2A 1GZ3A 1QLJA 1M2WA 3IJRA 3GN2A 4NU6A 5TT1A 3B1JA 4PIVA 4FW8A 3WYCA 2PTGA 3TFQA 4GWGA 1ZK4A 4RF5A 4YJFA 5CEJA 4D3SA 4QFCA 4U0KA 5KVSA 3NTQA 4RVGA 1K2WA 3B1KA 2O23A 2DFDA 1YXMA 1H94A 1VL6A 1XIVA 1KS9A 4HFRA 2Y66A 2DUWA 5JYDA 1V9LA 1XSEA 3HADA 4TVOA 1Y9AA 2EJWA 4ND4A 4YT2A 8LDHA 4H3VA 4DBZA 3DONA 4Q3DA 1LDYA 4R4JA 3TZKA 2E37A 1EK6A 4AJ1A 3ICPA 1SO8A 4WECA 5TQVA 4YR9A 3RUHA 1MG0A 1D1TA 3F1LA 4B7CA 4CV1A 2VWPA 5JCJA 5J23A 2Q46A 3G17A 3KSUA 4BNZA 2ZB4A 3DFUA 4NFYA 3RD5A 4BOYA 2I5PO 3ONEA 3O38A 4K1LA 4TMFA 4U6QA 5L95A 3PLRA 3OH8A 1EBUA 1ZMOA 4NIMA 3LQFA 2Y1CA 3VZSA 1X15A 3GEDA 3VH1A 5K6AC 1SB9A 2PGDA 4MIEA 5CDGA 1PZHA 1H5QA 3PIIA 3LT4A 2VUSA 3JQFA 1P1KA 3C7AA 3QWFA 4FC7A 3SEFA 4E21A 3DDNA 4RF3A 4EUFA 1KETA 3BHIA 5TJ9A 1LSSA 5HM8A 1ZMTA 1DXYA 3IP3A 1VKNA 2NVUA 4OO3A 3PWKA 2E4AA 2HJSA 1PL7A 2TMGA 3FCOA 3GNTA 3TRIA 5ICSA 1VL8A 4J0EA 2Y05A 1SZJG 5I7FA 3DHEA 2OBYA 4LRSB 4RZHA 2VQ3A 1VLLA 3WGTA 1GPDG 5JMPA 3ZHXA 2R6JA 3F5QA 3H9QA 2CDBA 4CM8B 4XRGA 4IDGA 1CRWG 3ETGA 4CLRB 4YRAA 3OJEA 5COBA 1HZJA 5TIIA 2ZJ0A 2QYSA 3HWRA 1LC3A 4J4HA 4CL8A 3CEAA 2X0NA 3HFGA 4W4TA 1GR0A 4CODB 3GRKA 4II3A 5B4VA 3HG7A 3AI2A 5JW6A 3VTZA 1E1MA 4AJEA 2DKNA 3QW2A 1ZSYA 1G0OA 4N7RA 1L7DA 1I3NA 1XKQA 2Q4BA 2C7VA 3EHEA 3COSA 3PDJA 1IL0A 5BR7A 1I32A 4BMSA 1RM3A 1ZEMA 3F4LA 4GKVA 3TN7A 4OIMA 2QQ5A 1HL3A 2AE1A 4ALLA 2O3SA 3GZ4A 1EDOA 3UF0A 1B2LA 3RUDA 4CM1A 1HEUA 1KOLA 1W0CA 3WWZA 4NJOA 4NBVA 5G0UA 5L7WA 2PKQP 4YA6A 5C3MA 2D3TA 2YUTA 2OOSA 4E30A 4M49A 1KEPA 4CM6A 2DBZA 1QV7A 4EYEA 2CD9A 1YJQA 1X7HA 2GLXA 3JQGA 4BUCA 4ZQEA 1IE3A 2PGJA 1V35A 4UULA 1TLTA 1MXFA 2EHDA 1EMDA 4D79A 4KZPA 3UKOA 3WG9A 5C7IO 1KBZA 2WE7A 4D3DA 2I76A 4I08A 3EY4A 4FDAA 1SB8A 2IEDA 2Y1DA 2PZJA 2W4QA 3GVPA 4I8XA 4WJZA 4BKQA 4CQLA 5L45A 5LDGA 2Y93A 3S55A 5MDHA 3DAFA 5DDIP 2WM3A 1U7HA 2DUUA 3C1AA 3LT1A 4B7UA 3O03A 1T2DA 2YY7A 3OP4A 1SOVA 4GH5A 2ZTLA 3LSYA 2A92A 4ZRMA 1LNQA 4IGEA 1GPJA 3RJ9A 4AICA 1HDZA 1KVRA 4WCDA 4C7KA 4QECA 3KUXA 2IXAA 4YVFA 1E7WA 2OMEA 5JDCC 5MGBA 4HFJA 4A73A 2DTXA 4BQRA 3MWDB 4CMBA 4ALNA 4CLEA 4DA9A 3OQBA 2JHFA 3U5TA 4HX5A 1O5IA 1PWXA 2TMDA 3G1UA 3H5AA 4PZDA 5JMWA 1MP0A 4YAIA 3PI7A 4JBGA 4XIYA 1VJTA 2IRWA 1PJ3A 1Q0HA 3BYZA 5BQFA 1PX0A 4GMFA 4M54A 1JKIA 1NPYA 4XX0A 3WNQA 1OMOA 1RWBA 3SXPA 3JQFC 2JAPA 1DIAA 3WLEA 4CQMB 1YB4A 4QUKA 2RBEA 1T1SA 3U4CA 4CQMD 5DCWA 5EL0A 1PJTA 4UEKA 3RC1A 3QJ5A 2GCGA 4QT0A 4JX8A 1M75A 4BNYA 4MIOA 4CM5A 1ULUA 2P9EA 1BW9A 2VHWA 1D3AA 4XYLA 5EINA 4BNMA 5IF3A 1EVYA 2FHSA 4M55A 5CDSA 5JY1A 5CEEA 1VPDA 5B1YA 3D1LA 3JQCA 4IDDA 3AY7A 1QYVA 3OQ6A 5JY6A 4UVIA 1NP3A 1JW9B 4YJGB 4YAJA 3GY0A 3TNLA 5KVCA 3EYWA 3Q1LA 4MJLA 3DBHB 3V1UA 3IMFA 1R4NA 4IXWA 4J9UE 3A9WA 3UHAA 3RVDA 3JQEA 4DLAA 5CDYA 1PGQA 4B4OA 3RAJA 3OBBA 2EW8A 4LGVA 4P8RA 4PZCA 5A9TA 1ISIA 4DXHA 1Q7BA 2FOIA 4WGGA 1E6EA 2J5QA 5DF1A 3TPCA 4F6LA 1B26A 3C1OA 2C59A 3L4BA 4A0SA 4A7PA 2CUKA 1R4MB 4L8VA 3GGPA 3T4EA 4OQZA 1Y8QB 3CE6A 5DOZA 5BSHA 1ENYA 5L4SA 5I7SA 1NBOA 1BVUA 4TKLA 5AXAA 1TB4A 4L4XA 2IODA 1WDMA 4N54A 4NHEA 4WUVA 1TI7A 4RF4A 3H4VA 1WP4A 4OKIA 2GN6A 1X1TA 3KEQA 3A4VA 3E5MA 3UN1A 3K2EA 2VYVD 5L9AA 2PGLA 5HWSA 3RC2A 1X14A 4KMSA 3Q2KA 1ZSNA 3EAGA 1OZAA 1PQWA 4EUHA 4PLZA 4TWRA 2PZKA 1KC3A 2EWMA 4ILKA 3QLJA 2C7GA 4BL5A 1EE9A 4J7XA 4P38A 4B4VA 1VJ0A 2BGMA 3ADPA 1XQ1A 4RPGA 1W73A 1ZJZA 3QA9A 3ROPA 4HUJA 3O8QB 1M67A 3EW7A 4IZHA 3STHA 4R1SA 3U4IA 1DAPA 4XDYA 3PYXA 5I7VA 2GN9A 2J3IA 2NTNA 7MDHA 1WAMA 4OXYA 3Q2IA 1QR6A 5K0ZA 4Y9DA 1E3SA 2HJRA 4W6ZA 4MINA 5EQDA 3JQ7A 1LSJA 4J43A 5G0SA 5H81A 3SX2A 2XPCA 3WTCA 2HMUA 4RO0A 1ULSA 3H9EO 5A04A
chains in the Genus database with same CATH superfamily
3A26A 1BGXT 5ICFA 1RW4A 2OXCA 2WTMA 3FPGA 1X1BA 2NZVG 1UC8A 4F2HA 1EB9A 3JYQA 2RKWA 3FY4A 2QVZX 3QX7A 3QKIA 1T4CA 4PC1A 2FR1A 1WZIA 2PKWA 1VCOA 3INGA 3HI4A 4LQCA 2AZMA 4YMGA 4Q9LA 3ZJ5A 5JTTA 3IIKA 3R3JA 1UDXA 1JDBB 4TUYB 4K9LA 3UAYA 4M9UA 2JIOA 3QG1A 3KL4A 1RQXA 3FMVA 4AI6A 4I55B 3ZQ6A 1E2MA 1E6KA 3QITA 2GRJA 9MHTA 3H5LA 4HS9A 4M0CA 4MPDA 1DJNA 3ZIDA 1LZLA 2FOLA 2G5GX 7REQA 5IZCA 3FZQA 4RK5A 3OTOB 1Y37A 1LWOA 1SZPA 1A98A 5BV7A 5IVKA 3BB3A 2W48A 3ILYA 2C5HA 2ILVA 3C8DA 1E7MA 2QMZA 1C7FA 4BV9A 4PG6A 3CVYA 5A3VA 2ZXFA 3PHJA 1N6LA 4CDRA 5IEJA 1FJHA 3UAXA 3BORA 4LF5B 2B1GA 3T0FA 3IOBA 4HZUA 3L0CA 2W2KB 2QPOA 3RSGA 1UBSB 2ISQA 1TECE 3SE7A 4EB0A 3G23A 4KW7A 5C5CA 5CVVA 5ED0A 1OPRA 1C50A 2GGSA 2Y9PB 1NKVA 3HUDA 5JCJD 1BEUB 3CF6R 1LLDA 4E31A 2O3RA 3VAZA 4P0PB 2OAGA 3ONVA 4NSNA 1JG1A 1Y7IA 1MX3A 2PNJA 5M2QA 5EJFA 4RM3A 3C7CB 5EJ2A 4LRWA 4DMLA 1Q11A 2H92A 3LSTA 3N53A 4YLGA 2AI1A 4IOJA 4KN6A 3CO5A 4V0SA 3U0BA 3V9PA 5EJ6A 1XQXA 1GG5A 4U7PB 3J7TA 2IS6A 3FFXA 1J5PA 2QT9A 1WUKS 3CVVA 1KJZA 2ZUSA 1HXHA 1Z26A 1A5TA 1E4YA 4ONEA 2CNNA 4LYAA 2X0KA 1PCXA 1EWTA 1PYGA 521PA 3OZUA 1QFYA 2YXEA 2O8EB 2JGNA 2EZ4A 1T1RA 4ZPXA 4GEGA 1PLLA 3PQ8A 4D46A 3OO0A 2VDPB 2OGSA 1C3LA 3O82A 4IKPA 4IEIA 4RVNA 4YALA 1U8TA 1E1QA 1EJ2A 2H4JA 4YAEA 2J9GA 3E1SA 4K9RA 4OU5A 3C45A 3R8CA 4D57A 1LBEA 1NLYA 3BK1A 1P3Y1 3GRRA 1TTQB 3HDTA 3JZFA 4G4JA 2W2KA 4OH7A 1XTIA 3GOHA 3LPDA 1LRKA 2WJHA 4PXSA 1RC8A 1UZNA 2FPPB 4EF4A 2W6JA 4X94A 1G20B 2OP0A 4XGKA 5K8IA 3RABA 4GUAA 4Q19A 1H2YA 2YVUA 4QNNA 5I9LA 3VYRB 3OQIA 5TPZA 3MIZA 3ZDXB 1KHTA 2VT3A 1ZZGA 4MCJA 3VHXB 1ESDA 1CJVC 1EWRA 1N9GB 2QSZA 4GG1A 3S1LA 3AKDA 1DX6A 1LNZA 3WA6A 3U4QA 4UXHA 2B5WA 3L07A 1PR9A 4EY5A 4Q4AB 2BSQA 2O8CA 2OQ2A 5LSAA 2VZEA 1OTHA 4NLLA 4IIYA 5EWJA 2WG2A 4E5YA 6PFKA 5ADWA 5L7TA 2R5FA 3CTPA 2UVDA 4HGPA 2ORED 1T5OA 4RGYA 1E1RD 2XYVA 5KCZA 2WSSA 4F45A 2GYVA 1ISHA 1MKYA 2JATA 1Z75A 2EG9A 4JUBA 1JJVA 4MS3A 4E2XA 1WBDA 2JAQA 1SKUA 2HYIC 3VYVA 5KIAA 4NQRA 4RJKA 5EKTA 2ZS8A 4ZVNA 1GZ5A 1VOTA 4MRPA 7YASA 1E63A 1XA4A 4MW2A 3SR0A 3IQHX 5IF9A 4KI0A 4BVKA 1OB2A 4L8GA 1YQWA 4TSRA 2FW9A 4LXHA 2Z6AA 2K4MA 1QX4A 3WSVA 3HJUA 5F51A 5CA0A 2R97A 4OLJA 1LS1A 3GPBA 3K0FB 1DDOA 4A0FA 4CMKA 1QO7A 2W8BA 4Q1VA 5J5VA 1U1EA 3BWCA 2VWQA 1J7JA 4U02A 3EFBA 2UZ1B 3IP9A 1B74A 1CUFA 4X93A 3GLHA 1STOA 3WIEA 1FBTA 4UEOA 3NW9A 1S2IA 1GARA 2BFAA 2X1MA 4N1AA 2EVWX 4KLRA 2P4SA 1FYFA 1K8ZB 3NH6A 1Q0PA 4KC0A 4OJKA 3ABRB 4RCVA 3R5HA 1TAQA 5LA6A 1SD2A 3L4BC 2JJ2D 2VTEA 2YS7A 4G89A 1HZZC 3GJYA 4JLJA 4KBGA 1IUNA 2X8JA 5KSOA 3B1YA 1ITZA 4LTNA 1NXWA 1X7ZB 4OD0A 4GIBA 1D7AA 4ODIA 1KEKA 1O97C 1YOVB 4CM3A 4E4RA 3TMYA 5JJCA 1E3LA 2E89A 4JMPA 2YYAA 3BDAA 2WP8J 1DCMA 4LVUA 1YA8A 5EJ4A 4ANFA 2PH1A 1Y63A 1L4LA 1H1LB 1T2VA 1AUQA 1ZEJA 2VQ6A 4X63A 1E5LA 1R8XA 3WNVA 5E38A 2C2HA 3FM9A 4ALKA 1I5EA 4MV6A 2A5FA 2L19A 3RASA 3PXAA 9ATCA 1QLWA 3RS3A 4H7EA 3SR4A 1M0TA 1N2SA 2QORA 5AVTA 1Z62A 1JFSA 1O5TA 3FTFA 3D2AA 4LGCA 1KH1A 3DNPA 4B76A 2H5EA 4O6VA 1KJQA 1PBNA 2BFOA 1N2CB 1XQ6A 2WJ4A 3HUTA 5ABPA 3AVWA 3GW8A 4AFNA 5E8JA 4DA7A 3WRXA 4G0XA 4RV4A 3PF9A 2FPOA 2ZJ3A 4MZXA 3W6ZA 1CERA 1SQ5A 4IS3A 4R2JA 3KK0A 3W2FA 5GIOE 3ZHCA 4MEBA 3R3VA 2HIMA 2QMOA 1R0XA 3M8KA 4A36A 3LHFA 2ADFA 4FPXA 3JV7A 5EQTA 2VK1A 5K3CA 4DR2B 4GGPA 2DH6A 4L3VA 2ZIGA 4ACBA 1PV4A 1GDHA 2E1RA 4XPIB 3V4LA 4I4LA 3WKDA 3PUXA 3LUJA 2P9FA 3URMA 3WK6A 5LD2C 1W4CA 1WW8A 5DW0A 4RJTA 4C4OA 3I8XA 3VPFA 2DFKB 1Y3AA 1Q2UA 1V8ZA 3O7MA 2HA0A 1NX6A 2EGGA 5IXJA 2IITA 2C2ZA 5H59A 3MQ2A 3NR2A 2IU0A 1C0LA 1X1AA 2AGVA 2ZWPA 4ITVA 2CWWA 4WFIA 1JI0A 3V3TA 2ZFUA 1BJRE 4M1QA 5F5XA 2QTTA 3TTUA 3CR3C 4E46A 3QXJA 1ULAA 5CITA 2ZT8A 3FFBA 1Y6QA 4EY4A 3TDNA 3QPDA 4BBAA 2HXSA 1P45A 1IUOA 2GJKA 2Q3DA 3OICA 4XYEA 3VZQA 5LQAA 4YB8A 2WJGA 3WLLA 3NZEA 2P6UA 1BNCA 3P2YA 4EH1A 4WOKA 2R6HA 2J0EA 1RADA 4DA8A 1P1HA 1SA0A 2QYTA 4QJ5A 4QSMA 3STTA 2IEAA 2CF6A 4FD3A 1EX1A 1JJBA 1ZOLA 2BKAA 2GKGA 1H3EA 1P7PA 3EVCA 1TIBA 3EIQA 3EXIA 1GU0A 3IPRA 1ZD9A 5AK0A 3VAAA 1H0RA 4R1MA 2YVAA 4DJJA 2DCUA 2Z6VA 1GAEO 2G0TA 2O7QA 4ZGGA 4M0PA 5MFPA 3NWPA 3QENA 2VZLA 1GPWB 4LZLA 4E3WA 3EIWA 4F5WA 2WQ7A 1C4KA 1YR1A 2FJPA 4L75A 2B83A 2I7XA 2FFBA 5JWHA 2WF7A 3KUDA 2HMVA 1E18A 4M1EA 1QVVA 1O6BA 4CLOB 2XODA 3DE7X 4HS4A 2PZ8A 3TZBA 2FSFA 1HEYA 5ECGC 2P9TA 2YUIA 2ZU0C 1TQ4A 3IDQA 5GGYA 4ZZ0A 1EUQA 1SBTA 3AUXA 4FFVA 3LLVA 2H1HA 5FUWA 3H5RA 1FW6A 3LHIA 3Q72A 1OFUX 1I80A 3IBFA 4RMGA 1FC0A 3B7PA 3BCSA 3N59A 4BVLA 5LLDA 2H9YA 2ODBA 2WOJA 3FJOA 5FWXA 4XQ0A 4U7HA 5JSQA 4KNYA 2ZITA 3E3NA 2ZJOA 1EG2A 1XL0A 2VBGA 2YJ5A 3DPIA 4GMHA 4QBFA 6REQB 1YCGA 1PT7A 4IF6A 4LDRA 4OCZA 4QWWA 4J2TA 5DXFA 6ABPA 5EPEA 3STUA 1E1CB 1JSXA 1ZAYA 2F4NA 3ND8A 2BUBA 3IMGA 2HXYA 4OLAA 1PX2A 2BTQA 1G8GA 3HACA 1JFLA 3CH5A 3LDHA 3MS2A 4B7ZA 1RIIA 5DYTA 5LZ4A 4GE0A 4KFSA 1OWLA 1NZDA 3DUWA 3GELA 1VKZA 5T4FA 4GDFA 1E79A 4S3MA 1U9CA 4P22A 1K97A 2CK3D 1YVDA 3JQDA 1DIGA 3N87A 2YZ7A 4YCMA 4ETMA 5K4GA 1S5PA 3N3AC 3UV7A 1ISRA 2W6IA 3EWSA 4TXNA 2HU2A 3KT8A 4AL4A 1SBYA 1ONPA 2CE2X 3ZCQA 3VZBA 3KR1A 3V8QA 5IAGA 3R5XA 5HZHA 1U2GC 2WJZB 4FT2A 4BZXA 3UK2A 3L0SA 1C30A 1GUAA 5BW6B 5T4EA 4WDRA 1JALA 2W2PA 4G1VA 2UUCB 4UHDA 3W6PA 3WGIA 3JR3A 3QZUA 1RIFA 1BHQ1 4I9UA 4QUHA 3VYSB 2IY8A 4G81A 4PTLA 3LW8A 4AURA 2OAQ1 3W5VA 5G0WA 3QE3A 4UQLA 1NVAA 1U7WA 1A04A 1Z5VA 5JS1A 2AFIB 5IXSA 3A3PA 3KQTA 4O08A 4V24A 1UADA 2V9CA 3LQ4A 3P9NA 4HH3C 3TVDA 3NCHA 5GZ6A 4ZOEA 2IHYA 2NVOA 3EXIB 3ESZA 3G9ZA 3UQYS 3MLAA 4DUGA 3A32A 5HR5A 1S01A 3LXXA 3K3PA 3ESRA 4CKZA 1SVNA 1YAHA 2IHTA 4WEQA 1AA9A 4C3ZA 1VKRA 3PUIA 5IMBA 5K0BA 1VMAA 2YXDA 4BQOA 5CH8A 1SUBA 2NO1A 2NTEA 3A9CA 4R2HA 4URYR 3WKAA 2XUZA 3U1TA 3RUFA 4E13A 1XDBA 4ZO6A 2WAOA 3A1EA 2HSJA 3OT1A 1DKOA 1U4SA 4G5XA 3VVMA 2HRZA 2XCIA 5LU9A 5C8VA 2GDZA 5E0OA 3OF5A 5HS6A 4FFNA 5PGMA 4P3PA 4AQYB 3PDHA 3G0HA 1THTA 2Z5FA 2P6PA 5A9SA 1UJ5A 1WD5A 2IOYA 3CLVA 3SNHA 3DLCA 4GMKA 4D0LB 4LC1A 4DZTA 4DUZB 3DZKA 4ABTA 3PX7A 4ZO8A 1PWZA 4TRNA 3HVUA 4M0UA 1Z36A 4F92B 4OQMA 2V54A 5T6MA 3RRXA 2WSMA 2HMSA 5TVGA 2QUBA 4JXKA 1K6XA 1GV1A 2HU7A 3ES9A 2V7VA 1GSHA 3PC7A 1U3WA 4UARA 3HCEA 5CNMA 5AI5A 5T5QA 4KH1A 1AZLA 4MWZA 2JFNA 3PLNA 1IXYA 3R7LA 3PA6A 1Z0ZA 4UFNA 3ZZ0A 2CHEA 1KEUA 1YVUA 2DZDA 2CFSA 2AF4C 4AO6A 1JEAA 1SGWA 1X2EA 2X5NA 1YIDA 3TLGB 1H4TA 3ADBA 1KO7A 3GXOA 5KOHA 4GW3A 5JALA 5ALMA 1V6AA 3U3DA 3K20A 2NU8A 5JYCA 4KSBA 4WKNA 2BE9A 3FUCA 3QUCA 3CRVA 1YZGA 1EPUA 4YYEA 4NC9A 1W0JA 2DUMA 4DQUA 1TTHA 2HA5A 2P1RA 2QR3A 3ZWYA 4NV1A 1GD1O 5CFPA 1HTTA 2P77A 4PBRA 4XQ9A 3PE6A 1XXHA 3DTNA 5EJ5A 1CNEA 2PV7A 5F12A 4WBXC 2ZJ5A 621PA 1VG8A 4FZRA 3CQ9A 4UATA 4HRYA 2P6MA 5BW4A 4OAOA 3V4SA 4K0KB 3UTCA 4BEWA 3KVVA 2PLRA 3GH3A 4TVSA 1V5GA 4LQLA 4R1QA 4JNCA 5JR3A 4X44A 2W42A 4FSXA 3LLSA 3WVNA 1GTG1 1TZCA 1A50B 1HYQA 3KUUA 3IILA 3NV9A 3IBTA 1U3GA 4RESA 4F5ZA 5HTOA 4MB6A 4MGYR 5F1YA 5EJ8A 3DBIA 1Z8HA 4R8LA 2QG9A 1GAWA 1IBSA 2WJPA 3W3AH 3IQGX 4BFUA 5J3JA 2PUDA 1QF7A 2QTMA 4AJIA 2VTKA 1ZRHA 1YE3A 3AXSA 2G6TA 8ATCA 1DC8A 2GPBA 3T9EA 5DP2A 3RGWS 1QDLB 3SOZA 1QGUA 3PLAE 3QMVA 4OHXA 1XVUA 5J63A 4HDNB 1DWQA 1I2AA 1W75A 3MJ4A 4UJ5A 3EN0A 1GNTA 5AXDA 1LC0A 1Z5UA 3PK0A 3OA2A 5COAA 5F33A 3PC8C 4IGAA 1E3MA 3B1VA 4O4LA 5IBCA 1FDVA 1X1CA 4A6EA 3OZDA 4QDUA 2HPVA 3PT9A 3RC3A 4BGVA 4EUSA 2WRZA 1KWKA 3B2QA 1QP0A 2E4ZA 2V98A 4GOXA 5EFOA 3WLPA 1JQLB 1QGED 3PPIA 2VAWA 2PWAA 4C87A 1TM7E 3GEEA 4R69A 4ZHSA 2XTAA 4WCFB 3DBLA 3VSDA 5IUJC 4YMIA 4XM2A 1RQ2A 2FEXA 4UU1A 4JEUA 5I5GA 1AXEA 4XIFA 3HB4X 3A14A 4DL9A 2Z1MA 5CXUA 2JKZA 2OV1A 1ILWA 2TMYA 2HMTA 4PQRA 5DTEA 1QZXA 4KBFA 2DJIA 1Z4NA 4MCIA 2H1VA 3EEQA 1R0ZA 3RDPA 4BO2A 4GRDA 2WTUA 1G41A 3E48A 2HIHA 2XF8A 3CX6A 4FZJA 2FFJA 4H17A 4OHKA 4UHJA 3T6KA 3TIIA 3ZXYA 5HBGA 4ZV4A 1MLDA 1MX1A 2FW0A 3AOEC 2ZUFA 4NMLA 3S1AA 1WV0A 3MGCA 1TXGA 2Y4OA 4DV3B 5A0VA 4JUDX 3BSYA 4Y18A 3UGTA 3HCPA 4L07A 2OCYC 1TVCA 4O1HA 4QGSA 1PG2A 2FW8A 2H00A 4GR9A 1N0HA 1JKJA 4E33A 1N2BA 2XUGA 4FIDA 2HD4A 2CXTA 2JLAA 3MW8A 2H1FA 4GZLA 4MVXA 4Q37A 1L3IA 4A2WA 1EXNA 2YCLA 5LXTB 1QDUA 2BWJA 3K8QA 3VR5D 1YK1A 1UWCA 1EE2A 1ZI8A 3RPEA 1D2EA 4C88A 2CHGA 4M7OA 1DJMA 1O54A 3KJQA 3PBKA 2QUKA 3V2UA 3IJPA 2J7PD 4RKEA 2G77B 4ZYLA 2PPVA 4KREA 2HRDA 2IYVA 4RPKA 5AJHA 5CTJA 1XZHA 3BMCB 1GKUB 3NUGA 2XSZA 4AP6A 2K7FA 4LOLA 4B6FA 1KSGA 1QIMA 4KUGA 4MPRA 1HLFA 4I2NA 4XQEA 2W2LD 3A58B 4L5YA 3DLBA 5EUBA 1NNEA 4NAUA 4TL8A 2N9UA 5EE9A 4CLOA 1L7VC 3IDOA 4IIVA 1CNMA 3OU7A 3U1BA 4TSFA 4GM0A 2E49A 3FDZA 1ZNYA 1KYVA 2GKSA 3H16A 1V95A 1DRVA 1IVSA 4KR2A 3E84A 4YUAA 1RPZA 4BGUA 4P7FA 1T9KA 1Z13A 4CT5A 3GJ3A 4AJ9A 3ZN2A 1H0HA 4DSOA 2RHCA 4J75A 2XYPA 2AHRA 3AF1A 4YCCA 2XBUA 3DZCA 1HG1A 3SEZA 2YIDA 1UJBA 1E1KA 3BHMA 1Q20A 3R7BA 1KK1A 3V3KA 3EISA 3U3JA 2A1IA 5DTRA 5DYWA 4BNLA 1TF5A 1XTTA 2VP4A 4PPFA 2AOUA 2B1RA 5EZSA 3UUEA 3D6VA 3GIWA 5KOJA 4YXFA 2OL4A 2ACKA 1T9DA 4R7GA 1THMA 1CNFA 5BUQA 2P5TB 2C8KA 2PA0A 3IVAA 3RAGA 4Z7JA 1XVTA 2IW3A 4RLFA 1VJCA 4DNPA 1H2HA 2V3CC 4OAQA 3KQQA 3VV3A 1VL0A 4J4BA 3HXQA 5IJAA 1QH9A 1CJKC 2HDOA 4MVJD 4U2CA 3M34A 4LBWA 3ZGLA 1BFUA 2Z8YM 3LOPA 1U63A 3DHYA 4TUYA 4ZEXA 1QV9A 2OBFA 3K1AB 1PR2A 4OHUA 5E3JA 2YQZA 3ZQKA 1WMDA 1QIIA 1T13A 2JASA 5C4MA 3WLRA 1GGKA 2AG1A 4K9SA 4LI0A 3ET5A 2N3ZA 1GQSA 4G4SO 3FUTA 5LYYA 3ZIAD 2A9JA 1XU7A 1YR3A 2BP7A 1YJCA 2HQ1A 1NYTA 3IP1A 3PC2A 5CMLA 4RIFA 2VI5A 1NE7A 3QUBA 4XE5A 5A9RA 1SWWA 3RVJA 4IY1A 4XASA 1C4OA 1VECA 3HNOA 1QH8A 1QKJA 3SICE 2BTOA 1F5NA 2NUAA 3OTQA 2POCA 5BWNA 1QB8A 2DQ4A 5YASA 2FCAA 1CJCA 4ZO9A 1YZNA 1KKMA 1ZUWA 2NT4A 4W99A 4H15A 4UVEA 3R24A 3I6YA 1GWNA 4UCFA 4GC9A 5JHHB 4JP3A 4R8KA 3D7SA 1MX5A 1R4AA 2WKPA 1DGQA 2Q0XA 5CNKA 3VR2A 3GBPA 3W9BA 3OPYA 5EMKA 3U6BA 4ZVKA 1SC1A 2H06A 1F9EA 4HYEA 3WHKA 3QW4B 4NCBA 5DTQA 1BMQA 1ILEA 3HVKA 3IESA 2XZPA 3WYNA 3OTIA 1IOWA 5FA8A 5SY9A 2CFTA 3EZGA 4D26A 1BRMA 1KAGA 1BXGB 5EOVA 1M2EA 1IFXA 1SA0B 1VP9A 2IZ6A 4PGMA 3N05A 3Q3HA 2ZBUA 4YAFA 3VSCA 3B2EA 1CYEA 1OC2A 4FGWA 1LRJA 1KI9A 4OLHA 4FJ2A 3OEHA 1A1SA 1DDIA 3RARA 4J07A 3JASA 1Y1KE 2WYWA 3D3EA 2A86A 4J0DA 1S7CA 3HDYA 3LZ6A 2WYOA 3NP9A 2XXJA 3O0TA 4GKAA 1M1ZA 3LE8A 1ZK0A 3LCCA 4D99A 1T9CA 4PAGA 5CK5A 1Q92A 4ZTUB 1EEHA 4F3NA 5F21A 3NM5A 3PTLA 1IBMB 1MH9A 3OIWA 1QRRA 4XXHA 4U0JA 1MEJA 1EZZA 3OPYI 1GAJA 4L5IA 5C1IA 3B36A 4RFSB 3LP8A 1EQ2A 3ZWNA 1GG2A 3LECA 1NRXA 4K6KA 1JT9A 1L7BA 2I03A 3L1UA 3TR0A 2EF1A 3BXHA 5A4MS 3ML1A 2FEWB 3DBHA 4LKRA 3R1IA 4H0FA 2YMQA 2MSNA 1NYRA 5D5PA 1P1FA 2PKXA 3H9CA 3F2VA 3SGLA 5JV5A 3HCBA 4P35A 1AXRA 4OYRA 4FWBA 1URPA 3WFZA 5K8JB 1XVLA 2F62A 1XJ5A 1ZIDA 1SXJC 1YL7A 5CBKA 2XB4A 3MS4A 3N2ZB 1HK7A 3GVCA 3Q11A 3RB8A 2VP2A 1WNTA 1UDAA 2EKLA 1Y9EA 4L4YA 1EX7A 1HETA 1UBLS 5HEKA 2FR8C 4HQ0A 4WESB 4YJ2F 3UK0A 1VI6A 4Q9NA 1HC7A 5E6RB 5BURA 3MGKA 5C53B 2W98A 3E70C 3I2HA 1J1IA 4X7BA 1QG0A 1SURA 3H7IA 1VLJA 2GAIA 1KQ3A 1REQB 5ALVA 3WK7A 1TD9A 3WDLA 2EGHA 3ESQA 2IHVA 1T9AA 3L92A 4KOEC 1VGRA 1IB0A 2WPDA 1HE5A 5B2FA 2JHGA 3CT4A 4PTYA 5CYFA 5A5EA 2QEQA 1F6WA 1T4MA 2DHDA 2XOKD 2QUAA 1TYEB 3MQFA 5EY5B 4C05A 4BFSA 4HTFA 1NY5A 2ZJYA 4Q9AA 1KDOA 5EERA 3JASB 1IEXA 2I6FA 5D1HA 2J87A 4GWKA 4WFKA 3TM5A 3PU6A 3BEDA 4ENVA 1VSUA 2AZXA 1AS2A 1D4OA 1VRCA 2AR7A 3HV0A 1W35A 3I53A 3L6EA 4IHKA 4JBXA 4MROA 3ZLTA 5B4UA 4ZCRA 1OU4A 2IDZA 3OSUA 1M7GA 2W6NA 4I5EA 3GFFA 1M6VA 1ZUIA 2QL9A 1EFDN 1MX9A 1QF9A 3FRIA 4UQPA 4IMIB 2VHQA 3K0SA 4L0MA 4DV0B 3JVDA 2PVCA 5HCNA 1J0CA 3HY4A 5T8KA 2PV0A 3KKNA 4RQBA 2F2TA 4B47A 2ET6A 6NULA 3H04A 1NBAA 2BFDA 3O9VA 4EG4A 4KO3S 2NZJA 2WZBA 4L8LA 5C32A 4LZOA 4O1MA 3SQNA 3Q9LA 4PIMA 4EPRA 1U04A 2WD8A 3I1IA 2C5AA 1DAFA 1GQOA 2IE0A 2JCGA 2V4UA 3E18A 2AN9A 3OPVA 1AQYA 1XZNA 3U17A 2A0UA 4C20A 4FJ1A 1PL8A 2YDXA 1PJCA 1A2OA 3QX3A 2I4MA 4G65A 1X39A 2GPYA 2GZDA 1GRNA 1WP9A 4YWJA 1QJCA 3ZH2A 1GQFA 5EMMA 1KJYA 1T8SA 3IAM6 4G1FA 1B0ZA 4R0NA 2YXBA 3HYTA 2Z4SA 4HLUA 1LA2A 1XR3A 3FVWA 3A6FA 5J2UA 1PHRA 3KQOA 4UUPA 4DG5A 1TIKA 1CQJA 1U3TA 2NU6B 4YDRA 3K8YA 2B30A 4PAWA 1H8HD 1N9GA 1A95A 1KIAA 1W4ZA 3QEKA 4RE6A 3G8BA 2MU1A 3GN1A 4LY0A 5C5EA 5BWBA 1YF3A 1LDBA 5IZ4A 4ARZB 1BA2A 2R6AA 3ANXA 4HP8A 5SY4A 1NFRA 3I9KA 3GVIA 4FW9A 3SXJA 5INTA 3H75A 3QKRB 4PONA 1NDHA 5H68A 4YJ2B 2AJDA 2IZ7A 3DPSA 3FB4A 3MTEA 3OZXA 4HNRA 5GM2A 5IJ0A 2XCSB 4MWTA 1TA9A 3TL6A 4MDHA 3BL6A 1TTTA 1GTMA 3AY6A 3W4IA 4NFSA 3PR1A 1E2KA 2CLSA 2W0MA 1G17A 2DWOA 1JIUA 2C29D 3KB2A 1BXGA 4RLSA 4WLOA 1T24A 5F2EA 1JQDA 5GJWC 3SXUA 3PQFA 1Q3HA 4JSRA 3TQIA 4AJHA 4B4DA 1FXSA 4BHTA 1JU9A 3D9QX 3HU1A 3T4XA 4ZT3A 5IANA 4HYTA 3L8EA 1Q44A 4QBTA 2GM9A 4IWXA 3PRYA 5DLDA 3RS9A 3A6HA 1NBEA 1U8AA 4KVZA 1RM0A 4MA0A 3SC6A 3E6AA 2WFZA 3VR3D 1AKQA 4QNRA 3VU0A 1W94A 2V8OA 3C3AA 2IYLD 1T29A 5JISA 4NZYA 3LUDA 2V3VA 1U31A 4LKOA 1CY7A 1FX1A 4Q4HB 1AGYA 1N3BA 2YBDA 4YV7A 5KWVA 5CLHA 2R25B 3L4EA 2GD2A 1S2OA 1DSSG 2BBOA 3I6QA 4MPTA 4NENB 2R00C 3KAKA 3AP1A 1GDTA 5JDIC 4JJEA 2I6GA 3FMFA 2D2XA 1T2EA 3EVZA 1DUIA 1X1SA 2K6GA 2RGWA 3UUGA 4PNZA 3DAPA 4HD8A 3I6IA 5BVHA 4KXWA 5JAUA 5CNJA 5JI3E 1WO8A 2NXNA 1IOLA 2XY4A 4EBFA 1N2IA 1QFXA 1XVVA 5DM70 4W63A 4F9FA 3QWHA 3BGIA 3OC6A 4H4EA 2W00A 2J5XA 4DEXA 4IIDA 1G4AE 3RJTA 1T5LA 2BEUA 3X0DA 5L6MB 4B84A 1L5ZA 1HQYE 1MO6A 2VJLA 2RAUA 1KERA 3IQZA 4A26A 3MXTA 3GWGA 1JLLA 2D5LA 4G0MA 5CCDA 4IVQA 3OAAA 4LA4A 2UUBB 1WKBA 3U13A 3W2HA 2OKGA 1DCTA 3OE4A 1D5CA 2VL7A 1MFZA 2C83A 2Q9CA 2VRCA 2VYCA 3E61A 2H2AA 3KT0A 1BWRA 4CMJA 3BXGA 2ID9A 3KELA 4CEJB 2WD7A 1UBUS 3CU5A 3EMVA 4GX1A 3WQRA 1OKKD 4E5PA 1EDBA 2GTHA 3CFYA 1N3YA 3QOXA 2BJWA 3C5CA 3AHJA 3BIWA 3ICVA 5I6DA 2CHQA 3AUYA 1V16B 4CTJA 4DTCA 3G9XA 1T9GR 4OHZA 4RTRA 5B36A 4G0QA 3DBLB 5B1HA 5THKA 3K2BA 4D7AA 3L41A 4ZICA 5C46F 2J0VA 3PUKA 1Z5GA 1JE0A 4FSDA 5KQRA 3BD9A 4Q9HA 1XWWA 3JPWA 3MWKA 1UQRA 4U6SA 4KLAA 1I33A 2OHHA 4B3XA 3LDAA 4P4SB 1QYDA 3LQRA 5IBRA 4F9TA 1I51A 4I50A 3IO5A 2RGUA 4MKXA 2QM8A 1Z47A 4Q03A 2GYYA 3GQVA 2FQ1A 2GHIA 2I6TA 3M9LA 4R5MA 4XSVA 2EARA 5DLQC 5FLEX 4AJOA 2HH9A 4DMKA 4RY9A 5KSWB 3A6PC 3QF7A 4MKZA 3TQCA 4EB8A 4J1TA 1FDSA 5KNDA 3CISA 3ROGA 2C4TA 4GPTA 4XR9A 4P31A 1PJ4A 3H83A 4K9NA 4W1RA 5LQDA 2GK7A 3NIDB 3A1NA 3W1WA 4L6IA 4QG7A 5CA1B 2NZ8A 1GZ4A 4WZBA 3ZW8A 5G4LA 1JMKC 1V2GA 1MQAA 1ZVKA 3GYBA 1JU3A 3H05A 4ZALA 1O0SA 3CGWA 2G80A 2COUA 3UMMA 3TECE 1X94A 1YR6A 1PZXA 2AR0A 2FW6A 3KUKA 2ZI3A 1C7JA 2ZQZA 4F4UA 3ETEA 5AW7A 5JNRA 4L6AA 2PZFA 2B1JA 2V9PA 3L9WA 4KHPB 5LDDC 4R1OA 1E9SA 3A2MA 4QPNA 3TLEA 2QGFA 2XMRA 2PT7A 3OIGA 2D5CA 4O2LA 3SM3A 4EKGA 4G85A 2MHCA 2ZWIA 1D6MA 1WQ4A 1DX9A 3CV3A 1CT9A 4QX6A 2FRDC 3PUZA 1N2JA 2OVBA 3IV7A 4R54A 4KP7A 1L4MA 3SJBA 4CKXA 3HP7A 3VKUA 2RB4A 2EKZA 2X4IA 3I6ZA 3LXMA 1RWXA 3QMWA 3ZHQA 2WBLC 2ZIEA 1EXDA 2XVYA 4X1OA 1AZTA 2QQGA 4QUJA 2DSNA 4AYXA 1MW9X 2P9CA 3GLQA 4UHBA 5JD3A 4CVNA 5A3SA 2IPLA 3CLTD 4O0LA 3HKCA 5EXTA 2WQ6A 1XMSA 1I4EB 4YFYA 2XUHA 1G8MA 3BA1A 4ZQCB 1LI4A 1Z2EA 2R79A 3CKMA 1XLTA 4V0QA 1BDJA 1J0DA 3SX0A 1JIKA 1OBCA 2GAFA 4UTXA 1FA9A 4ECAA 1Q3KA 2CUTA 5AWFC 3H6GA 1GEGA 5BSGA 1N2EA 2AYXA 4P3XA 1DO8A 1F8YA 2L18A 1N7JA 1Z68A 3EPPA 1L8QA 2JARA 3L7AA 1G8JA 1GNLA 2B4KA 2PLNA 4ZMSA 1D8AA 2VAMA 5H4HA 3BFJA 2O8CB 1F0PA 4CUKA 3G2QA 1PQPA 2G9VA 3DOJA 3ELWA 3U4HA 3BMOA 1WCV1 5FFMA 1YFZA 2YNMD 4RPCA 1SHKA 1XDUA 5GINE 1V43A 5FWYB 3BFKA 4JLWA 4UVHA 9ABPA 4JI7B 1G3IA 1H8EA 2VKTA 3IH5A 5H82A 5HNKA 2I6XA 4I4TF 3OZBA 4UASA 1UBHS 3I6MA 4KEAA 2YJ6A 4FHCA 2GH1A 3U44B 1EJ0A 1FXWF 1H2RS 3ISTA 3ITEA 1UKEA 2B4AA 2C0QA 2HJWA 4Z54A 1QXSA 2NP7A 2ZAIA 3BIJA 1ZI9A 1YZ3A 2FEAA 3EIEA 4UMDA 3R20A 4Y9SA 3REFA 3GCXA 1G8PA 3WWOA 4BO8A 3UYLA 2DJ5A 4KNWA 2E1PA 1NIPA 1U7PA 2QRGA 1RCUA 1PT9A 4Q5IA 3A1DA 3EK2A 3UUFA 2ZAYA 4ZWNA 1NW5A 5CFLA 1YQUA 1QKKA 2J9YB 3O91A 2E55A 3KRTA 4G5RA 1CQPA 1WXXA 4HEQA 4KG7A 3SQLA 1RMYA 3UBMA 3BMQB 3ZU5A 4KLCA 2GN0A 2W71A 4LSMA 5A4JA 3KJGA 3AM1A 3HABA 1K0UA 4UFOA 1SC6A 4X66B 2OLJA 3D8NA 4HK4A 1EUCB 1ORDA 4YGXB 2REQB 4BLUA 4Z9YA 2HIGA 4DV4B 1W0KA 5HDQA 1Y1QA 3GZNA 3V7WA 2WG1A 2IK8A 1E2HA 1I3KA 4Y1FA 3WL3A 3SM9A 1SM4A 2WIDA 3ACBA 3GWZA 3NJ8A 1EBFA 1NVGA 1R6TA 1WRBA 1ZGZA 2FEPA 1SUDA 2FI1A 3IMKA 3VHRA 2KBEA 3ZLBA 4D43A 4LMAA 4Z3KA 5A5VA 4AQDA 5JXIA 5K1ZA 2RGRA 2GPJA 1T10A 1V4BA 1UMBA 2Y92A 3EQ2A 4GVXA 4L3OA 3S7TA 1VSBA 4IXDA 4G01B 1JDNA 2N75A 3DO8A 4GLLA 2NQTA 1T0PA 3NAMA 4L28A 1ZD3A 1VB3A 2IEBA 4IRUB 1LDMA 1TUIA 2CLLB 4AD8A 1Q17A 4S1TA 2Q7DA 3EPLA 1I24A 2JCXA 3CR8A 1ZHFA 4LIPD 2WSLA 4P1ZA 3V80A 2YWXA 5AHXA 2FV8A 3LLUA 2B1IA 4RTSA 1YR7A 2H1LA 1O0CA 3SC2A 2D54A 3U80A 3K94A 4HT3B 1SOUA 1CZUA 2YZ2A 3NDRA 4NCJA 3AUUA 3FWHA 3ZG6A 3MHPA 2AVDA 3AFGA 3U37A 1J0EA 1UKCA 4GRAA 1NUPA 3M82A 3PGJA 3PR3A 1A2QA 4AJ4A 3OHSX 4HAIA 3I01A 3RHTA 2F3PA 3KOWA 3C8MA 4IGFA 3SSNA 4D41A 2ZYRA 1A82A 3MELA 1OWMA 1GM5A 1AKMA 1ISGA 3E2MA 1G7TA 1Y7LA 4BAUA 4G9BA 3GEBA 4M6WB 1O89A 4NVRA 4HTAA 5BMVA 1U5BA 1B73A 2OGTA 2PO5A 3KX2A 5G1NA 2OPHA 2Q5QA 4K9KA 4QBIA 2J3LA 2Z5LA 4B8WA 4D9HA 2B98A 4QUGA 3O3CA 4UNPA 1RPTA 4JENA 5KC9A 5JAIA 2J3JA 4A8JB 3PNKA 5JANA 3URKA 1E1YA 1XDSA 1L5NA 2QLTA 1P19A 4NQZA 4GQIA 4ZPJA 2ZTHA 3HUFA 4F11A 3UHPA 2X6TA 4URXR 2YMLA 4NHOA 1P9LA 1KYTA 4B32A 4DSNA 5BRAA 4OP2A 1FB5A 2GCNA 3CMMA 2GXUA 2YBEA 4M9SA 1PRYA 4YDSA 2F1OA 2E87A 1CY8A 2J6BA 2VK4A 3LT2A 4QQFA 2GHRA 1DAGA 5EG5A 2I7VA 4TX1A 3U2QA 2IS2A 4ZOLB 4J0HA 3TINA 4B4KA 4CV3A 5IXYA 4CG1A 4FYMA 4RTNA 1V3VA 1HT3A 2GZ1A 1EFPB 2M98A 3E4CA 2JA2A 4QXOA 2A59A 2OV6A 4MVJG 4RX1A 5KQLA 2QRHA 4D2IA 2NSLA 3CLSD 3N70A 4TS1A 2GXSA 3TLKA 4LBYA 4ENQA 1AV6A 2NADA 2R8YA 3ZV5A 2FTKE 2CVPA 1XCMA 4PLCA 4R7TA 5FP0A 5HM6A 2BN4A 5DBGA 3LCJA 4BGIA 4GSYA 3GDWA 2JBWA 4RKQA 1OV4A 1ZGGA 1NV9A 1H1DA 4HJRA 4BCBA 2VJNA 1PR0A 1A69A 1EVKA 4Q16A 5H0IA 3CEHA 1KQNA 4MO2A 4YRDA 2VYNA 4BO5A 3LV8A 4CKCA 3B60A 2ZE7A 1Y34E 2QS9A 3HHPA 1QG4A 5GADl 4IICA 1XCJA 2VYVA 2BHSA 3EMKA 3HP1A 3HV2A 5LBIA 3JZMA 3UGKA 1H42A 1U4NA 3ZKAA 1UJ2A 1J8VA 1QFJA 4XCQA 2PDAA 3L7DA 1II0A 1FP2A 1GRRA 4HL6A 1RLOA 4KV7A 4Y0VA 3RVPA 2PYIA 5I7EA 3ZD9A 3ZHRA 1JSRA 3BWDD 5CBPA 5AI9A 4DARA 4R2XA 3W7BA 3ZHYA 1YC5A 2JLCA 2OE2A 3KVOA 3LUKA 4YV1A 5AOAA 1USKA 3OCVA 3ZCSA 1XE3A 1FYXA 1JEQB 3MEQA 4LJYA 4KR3A 1XZJA 2WU3A 2CXSA 1ZD2P 5JEDA 3NC0C 1OAOA 1B8VA 2AC2A 3Q9SA 3SY8A 1X6VA 5E4TA 4C7VA 2YJ4A 1WVGA 4ZOQI 2OQVA 1ABFA 2ZUCA 3MRTA 5K8TA 3ONWA 4RLHA 1JSLA 3C97A 3U26A 3TD2A 4A5OA 5AVUA 1U2QA 2XE4A 4AUEA 5KYYB 4DAOA 1EHCA 1ADGA 1KJ8A 1XTBA 7GPBA 1S89A 2R65A 3LUBA 4OK5A 2R7AA 1CZNA 4PHFA 3BMQA 2ID4A 3VBEA 3F8TA 3WWCA 4ZCLA 1ZOOA 1PSZA 2ZETA 4XD2A 3KTFA 2R00A 5KYXA 1VSVA 1KAQA 1UMKA 3SSAA 4BFZA 3JSAA 1P2UA 4CM4A 3FH0A 4PR0A 4DRZA 1FZTA 4BAZA 2RH4A 1DXOA 1GQYA 4X61A 4OX9Y 2NSDA 1AURA 1U2RA 5DP1A 1P7YA 1FFWA 2AMLA 2H0QA 1P44A 4CMAA 3UMYA 1O4VA 2X9LA 2Q99A 2Q3HA 1E9CA 4I4CA 4OGFA 3SF8B 1H0KA 3QA3E 3L05A 4YJ2A 5K6TA 2OCLA 3P26A 4DV1B 2BIFA 4Z3OA 1DHRA 4JUIA 3KQYA 4HQFA 4W5NA 4LQDA 5G1PA 3KZVA 4AQ7A 1PI3A 2R6CA 2CDRA 4O8ZA 1I0IA 1ENZA 1JHXA 4F3CA 1JDSA 2ZBFA 3K9GA 4MRNA 3FE2A 4S1OA 1UBTS 4FU0A 4M2LA 4FBGA 5HCIA 3IB6A 4QYIB 3P9IA 4ZQIA 4BO7A 4BVBA 5CB4F 2XA2A 3ZYCA 1QBKC 3OLQA 1V2HE 2PAFA 4K6FA 3PRHA 1RQGA 5JRDS 2ATIA 3C5VA 3QXHA 3W2TA 4AG3A 1GTRA 3VHLB 4L7QA 1S2LA 1UODA 4XLTA 2V3WA 3IAFA 1SKYB 4IM7A 4IRMA 4KGZA 2YXNA 4CHTA 3O2NA 3KEFA 4AKEA 5JD5A 5FOVA 2IOFA 2P9GA 1DIBA 3KQKA 1DADA 2X0IA 2XNDD 3WO1A 2VHYA 3KQSA 3J81k 3DW3X 3KPJA 3PPYA 3GFQA 2JJ1D 3SWWA 3NDIA 1WPQA 3FZGA 3HI6A 3SS9X 2JNWA 3AWDA 3CSUA 4XUDA 4EI7A 1RP7A 1IXZA 3UGJA 1SD1A