3ITZA

Crystal structure of p38a mitogen-activated protein kinase in complex with a pyrazolopyridazine inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
357
structure length
357
Chain Sequence
HMLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Part 2: Structure-activity relationship (SAR) investigations of fused pyrazoles as potent, selective and orally available inhibitors of p38alpha mitogen-activated protein kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 357
sequence length 357
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3itzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3itzA01
4D9TA 3ZLWA 4FR4A 4WD5A 3UZTA 2EXCX 2VWVA 3LMGA 1QPJA 2EU9A 4WO5A 2LAVA 4DFXE 5FWKK 4QTCA 3RCDA 4EBWA 2W9FB 2H34A 4IVAA 5HVKA 5E8YA 2YDJA 3WF7A 4BDCA 3DCVA 5A4EA 4S33A 3HV4A 5CSPA 4LGGA 5BVWA 2I0VA 4BDEA 4DITA 3QTIA 2UVXA 2PVNA 4EJ7A 4O21A 1J7LA 3HV7A 3WOWA 4BKZA 3W18A 2P0CA 2YAKA 3M42A 4FNYA 5KO1A 4FTOA 3PG3A 4NEUA 3OCSA 2V7OA 3GU5A 3ODYX 4NFNA 4R3PA 3RGFA 4ACMA 2GHLA 1Y8GA 2YCSA 5EDQA 4XLVA 2ITTA 3F3WA 2PZRA 3SRVA 4O7TA 4UMRA 4YC8A 4Y46A 4C3FA 2UW7A 3QTWA 4LOOA 5K5XA 2QONA 3EQFA 3ZXTA 4K1BA 4KS8A 3MH0A 4WG3A 4G3GA 5I9ZA 4LG4A 1TKIA 3U4UA 4FZAB 1DS5A 4C61A 4NTSA 2NRYA 4ID7A 3ZLXA 4KS7A 5EYMA 4RJ6A 3QRUA 1FGKA 4NSTA 5EI6A 3AC5A 3FQSA 3ORNA 2GQSA 5HE1A 2Z7QA 4FTKA 5E8UA 2RFDA 5FEDA 3E87A 3QQJA 3G0FA 3LXLA 3PVBA 3P7AA 3ZFYA 4PMMA 4KAOA 4Q9SA 3UO5A 4B99A 1HCLA 4JBQA 2ERZE 2C3LA 4K0YA 4QMSA 5IQEA 4NZWB 4NL0A 3P7CA 4ANMA 1H25A 5M44A 1LEZA 2GNFA 3N4VA 4GU9A 5M4UA 3V04A 1NVQA 1RJBA 2ONLC 4KSPA 2O0UA 4MQ1A 4TT7A 5AR7A 4EZ7A 1XO2B 4NH1A 3OY1A 4FNZA 4QYHA 3DV3A 5FQDC 1K9AA 3CTHA 3QAME 4QMVA 3FC1X 3MTLA 1NXKA 4BTKA 1H24A 1W84A 1OI9A 2FA2A 5EHOA 5GHVA 3QQKA 2YJSA 5JGBA 4DT8A 3VF9A 3HMOA 2HXLA 3PY1A 4PRJA 3OWKA 4QYFA 5G1XA 1SVGA 4CQGA 1JLUE 3TEIA 4RIXB 3AC8A 4ASXA 1PXPA 1JNKA 3I60A 2PL0A 3E3PA 5KHWA 2VX3A 4FSQA 2WKMA 5IMXA 3ZEPA 4DC2A 4WRGA 5KMOA 2XKDA 3MTFA 3PFQA 5DWRA 4BZNA 2Y6MA 2J90A 5F95A 3QZFA 4CVAA 2FO0A 2JIIA 4F70A 2B7AA 5IQGA 4O38A 3VIDA 4G3CA 4UB7A 1AGWA 4XV1A 1STCE 2VWBA 3ORXA 4I23A 1KWPA 4JNWA 2OU7A 3R8VA 3Q53A 1OPJA 1UA2A 4OR5A 5EFQA 3LFDA 5K0KA 5EI8A 3A62A 3OBGA 1JKTA 3KA0A 4IBMA 4MD8E 2QR7A 4E6CA 1P14A 4M3QA 4IWOA 3ROCA 3PA3A 3QUEA 4HYHA 4Y8DA 1CM8A 4DH5A 4MXOA 3UVPA 4DGOA 2RFSA 4CKJA 4FKGA 4PDYA 5I4NA 2RKUA 3LCDA 4H39A 4O0UA 4QD6A 5M09A 3A99A 2J6MA 1XHAA 3BHUA 3E3BX 3HMPA 3P7BA 3R22A 5KZ0A 3CQWA 4EK5A 1H4LA 3P9JA 3EL8A 3KEXA 3PXFA 4TRLA 2JD5A 3ID6C 2CJMA 2Y9QA 2JEDA 5BUEA 4Y5QA 3Q60A 5I9YA 3BQCA 4BCJA 2W96B 4HYUA 3SLSA 3WYYA 5DMZA 1XBAA 3BYMA 2W5BA 3NYXA 5ANJA 4U41A 4BI2A 5FDPA 5ACBC 1ERKA 3LW0A 2WAJA 4J53A 3GU8A 3DDQA 4FVRA 4ZIMA 4O84A 4DEGA 4NTTA 2HW7A 5J9YA 3BE9A 4OBQA 2VTRA 3RM7A 3ORZA 4L7FA 4W8EA 4AF3A 4EK4A 5AP3A 4JR7A 3ANQA 4XMOA 2F2CB 4YMJA 3KFAA 1PKDA 3NUSA 3ZUVA 3GU4A 4OTHA 2E9OA 3VRYA 1ZWSA 3R02A 2GU8A 1J1CA 3EN5A 4FK6A 4FTCA 4I92A 4RWJA 3PVUA 3RPYA 4L67A 5FG8A 3LXNA 5AJQA 4D2VA 3ORMA 3DKGA 3HECA 5E8ZA 5LVMA 5GINE 3COIA 4FKSA 3BE2A 3H9FA 3QQUA 5AR5A 2BAJA 2R3OA 4UWBA 3UG2A 3VAPA 1PMUA 3WZDA 2F57A 3IGGA 4AGUA 4ZTNA 3SX9A 3C9WA 5IZFA 3F2RA 3RNYA 1BKXA 4HGSA 4YPSA 2PVJA 3ELJA 2YM6A 2ZDTA 3QWKA 5D7AA 4BBFA 4CFFA 4ASZA 3VS2A 4RIXA 4V01A 5HE3A 5I9UA 4R1VA 1W0XC 4FYOA 3VS5A 4RWIA 3G51A 2RL5A 3KRWA 3VHEA 5ETAA 1ZRZA 1JOWB 3WZKA 4D4VA 2GNJA 5AIRA 1Q41A 3FDNA 3FI3A 4GL9A 1M2QA 5CSXA 5K5NA 3D5VA 4TTHB 1Q62A 4W4VA 4D4YA 5HGIA 2QOHA 4BGHA 1FBNA 2XK3A 4FV8A 3MVMA 5ICPA 4MWIA 2JKQA 4IM3A 3DS6A 3LLTA 2OGVA 4FIHA 2UW4A 3OHTA 3M11A 4UMTA 3QHWA 3RP9A 3MVLA 4WA9A 1E9HA 3QRTA 2CCIA 4RWKA 4DFNA 3WYXA 3F2NA 1Q3DA 1XH8A 3TNPC 3UIMA 4CFWA 4ZZOA 1DM2A 3SVVA 3AQVA 4IX3A 3D9VA 3LQ5A 2R5TA 2WFYA 4EORA 5EQYA 4GJ2A 3U6HA 4OTGA 3OZ6A 3FYJX 4YJRA 4RC2A 3WZUA 4U81A 4MXXA 3UP2A 4QMLA 1VJYA 1YDRE 3ROYA 4TYJA 4ZY5A 4IC8A 2PY3A 2JAVA 4PPBA 4WSYA 4HVHA 3KCKA 1U59A 5EHLA 4AFJA 5AP4A 2R3RA 2XNPA 3NUXA 4L3LA 4Z9LA 3ZS5A 3LQ3A 2UZEA 3BV3A 4JT3A 3A2CA 4FTRA 4YHFA 2OK1A 5CVGA 2FYSA 5L8JA 2RFEA 2XYUA 4TKSA 4U44A 4IZYA 3OWPA 4FNXA 4QMYA 4DEBA 4TXCA 3D94A 4G9CA 3WBLA 1OL7A 1X8BA 2W06A 4GYIA 2QO7A 4BDBA 2V62A 2VV9A 4PNIA 3NMUF 5ETCA 3RTPA 5H3QA 3U9NA 3Q2MA 3QLFA 3ANRA 4CMOA 3JR1A 1UKIA 2OI4X 4ZLOA 3KF4A 3R1YA 4DGNA 5LCKA 2HAKA 4GFMA 5LOHA 3QYZA 4IMYA 5HG9A 3Q3BA 3VNTA 3GI3A 3O2MA 3PSCA 4R6VA 3FXWA 4Y95A 4W4XA 3ZEWA 4KRCA 3W33A 3ZSIA 4IB3A 4UWCA 1GY3A 4FZDB 3I1AA 4J99A 5ETFA 1F3MC 4JBPA 3SW4A 3R8LA 3FMHA 3NDMA 4TN6A 1GNGA 4EYMA 4CRSA 5EM8A 3QXOA 2H9VA 5HBJA 3D15A 3PXKA 5DR9A 5HD4A 3MA6A 3JXWA 4YNEA 1H1RA 3GP0A 2YM5A 4BIEA 1V0PA 4P90A 5JK3A 4DLJA 3OF0A 3NCZA 4QMPA 4W8DA 2WMAA 5FRIA 3ZMMA 2ZMCA 2OIQA 3F5GA 3NCGA 4KBAA 4NM7A 2HZ4A 2J0MB 4IFGA 3UODA 2W99B 4ACHA 1BMKA 3DJ5A 3I5ZA 4NU1A 3W2RA 4PX6A 4O0YA 2B52A 5LJJA 3HUBA 1SVEA 4DF3A 5IQCA 3VUMA 2BAKA 5K4IA 2B55A 2C5XA 3THBA 3O23A 2W1CA 2YIXA 4O6EA 4GIIA 4EH6A 3VUKA 4BCQA 4J1RA 2HIWA 2BFYA 2J4ZA 4O0TA 4AW0A 4FV7A 3BHTA 2B53A 2J5EA 3LCOA 3NRMA 4AN9A 2ZM4A 2JITA 2PE2A 4R8QA 4I6FA 4ZY6A 3QRKA 5DHJA 4ZS0A 3DK7A 1M14A 5HE0A 4U7ZA 2BKZA 2WTVA 3PSDA 1YXXA 2UUEA 4HGLA 1ZZLA 2UVYA 1H07A 3LJ1A 4XOYA 5AV2A 4AOTA 1UWJA 2QVSE 4RIWA 5DH3A 3SA0A 4XG6A 5GIPE 3DTWA 2PZIA 4JJRA 4RX7A 4EC9A 2HENA 2VWIA 1Q5KA 3T3UA 4EOIA 4ZTLA 3FL5A 5FBOA 3V5JA 5HIBA 5L6PA 3BKBA 3PXQA 4D4SA 3BGPA 4IWDA 5D10A 2C6KA 2WTWA 3A7FA 4IACA 4GVJA 3RWPA 4YLLA 1WAKA 3E88A 1SYKA 4ALUA 5IQIA 4J97A 4M0ZA 3FMMA 3IG7A 1Z9XA 3ZM4A 4E1ZA 3COMA 2ITVA 2OXDA 3NIZA 3QTZA 4NKAA 2Z60A 4BIDA 4FE2A 3DB6A 4L53A 4BB4A 4AQCA 4ZZNA 4DG3E 2NNWB 2XP2A 2ZVAA 2WMXA 2FGIA 2G2FA 2QODA 1H00A 1WBSA 2UZNA 3FKOA 3IECA 3NAYA 4V0GB 5KUPA 5EDRA 4E5AX 3M2WA 4FKOA 4DFZE 4IZAA 5IH4A 3S4QA 3AC3A 5AIKA 2ZDUA 4TWPA 4DTKA 3UC4A 4RC4A 4DG2E 2Q0BA 2YERA 1BX6A 3L1SA 4EOLA 5AP2A 5L2IA 3L9PA 3RNIA 1OL6A 2XF0A 3F88A 4FV4A 4RRVA 4ZJIA 3AMYA 4FKIA 4RWLA 4IEBA 1OIQA 1PMNA 4RJ4A 4X0MA 1R39A 2HWPA 2V22A 3CS9A 3W2QA 4LL5A 2RGPA 3TKIA 4Y73A 4CKRA 1YI4A 3GCQA 4FZFB 5AUXA 2H6DA 4H3QA 1OL1A 4IJPA 5ANDA 3T3VA 4UMUA 4LL0A 4MHAA 2JFMA 2XMYA 3Q4CA 4DINA 4EQMA 4O7WA 5EM5A 4FV2A 3NNVA 4BDFA 4LRKA 5IISA 3QGWA 4O1PA 2X9EA 3DBDA 4AW2A 3DBQA 5IA1A 2LGCA 4KRDA 3OW3A 1B6CB 2P33A 2QCSA 5JFWA 1L8TA 2XK7A 4BHNA 1H08A 5HO6A 1PW2A 4D2WA 1JKKA 4O27B 2OH0E 5CEQA 1IAHA 4H36A 3NZ0A 4NKSA 4CZUA 3FV8A 3OT8A 4C4EA 3LFSA 4XX9A 5KKRC 3Q6UA 3I5NA 4YJQA 5CSHA 4NJDA 3PTGA 3QZIA 4I22A 4RBLA 3VBTA 3DAKA 3RPOA 5ANIA 1YQJA 4PP7A 2Z8CA 3FMKA 2OIDA 2BAQA 4E93A 5KCVA 3R7EA 4NK9A 2WTKC 2XKEA 2BCJA 2EWAA 3CD3A 4QMUA 4QPSA 4FV1A 4X6RA 4YZNA 4F9WA 5LMKA 3F5XA 4I6QA 4FIFA 4X3FC 5JMSA 4Y5HA 3O71A 3V8TA 2VTQA 3OXZA 4FKRA 4BDKA 3QC9A 3KXXA 3DZOA 4F6SA 3HVCA 1APME 3FL4A 3GENA 4DEIA 2ITZA 4BCFA 4O7LA 2ETRA 2OZOA 3HL7A 4JVGA 1H1QA 2XKCA 4PF4A 4QP6A 2VGOA 4KIOA 4A9RA 2VTPA 2ZAZA 1OL2A 4MX9A 3R71A 4NM5A 3KMMA 5HI2A 3LE6A 4XNEA 5BUJA 5HX6A 2QOOA 3EQHA 4DEEA 2BHHA 4G6LA 1OUKA 2J50A 4YJTA 3BBTB 4KNBA 3OD6X 4XHKB 1Z5MA 5CAOA 5BVNA 3R9NA 3RPSA 4BDDA 1UNLA 2ETMA 4I5PA 2JDSA 3IO7A 2GTNA 5F4NA 5I5ZA 1MRVA 1QPEA 1YXSA 5LVOA 1P4FA 3RHKA 5A4QA 4FGRA 3Q04A 3FPQA 2QR8A 3P23A 4FTTA 4BBMA 3F82A 1XBCA 4N0SA 2BDWA 3E63A 4W4YA 4DH7A 3WF9A 2JIUA 2I0HA 4U5JA 4ZSLA 4F63A 2I6LA 4WNKA 2PMIA 4FKQA 5CXHA 4C8BA 4XYFA 3SXFA 4V05A 3FUPA 5E1EA 2I40A 3MDYA 2PUUA 3ULIA 2E9UA 4BWPA 5KMKA 3ZC5A 3A7JA 3D7TB 3CR0A 3PJ8A 1YW2A 4FV5A 3G5DA 4JR3A 4ZTSA 4EHGA 2QHMA 4BZOA 3FQEA 4FKVA 1REKA 4QMWA 1OPLA 4QO9A 5CANA 4N57A 4ITJA 4RLKA 4CMUA 4YJVA 3CKWA 2UV2A 2CLQA 2IZTA 4E73A 3MY1A 2O5KA 2ITYA 3FWQA 4DBXA 2VO3A 3AGLA 2BVAA 2IO6A 3KCFA 3VUHA 3E92A 4FVPA 4PY1A 2BFXA 3G15A 2XA4A 3MA3A 4EZ3A 3BI6A 3K2LA 4M12A 4M66A 3SXSA 2VN9A 4JXFA 4E26A 4EOPA 2PMNX 2EUFB 4F9YA 2O8YA 3W2OA 2ZV8A 5E8WA 4F08A 5IQHA 4HNIA 3QFVA 1KE7A 3C4WA 4HPTE 4AFEA 3ACJA 5DBXA 2ETKA 4G34A 5JN2A 5HCYA 2VTIA 3PPJA 2RFNA 5C27A 1Z57A 1XKKA 3W32A 4DGMA 3QZHA 1GJOA 2XZSA 1OPKA 3U51A 3AD4A 4DGGA 5CSVA 5HG8A 4CFNA 4Z16A 4DG0E 4HZRA 3FXZA 2CKEA 1YDTE 4MBJA 4XG4A 4RFMA 4ZJJA 2ITQA 4A9SA 4C02A 4C4HA 3MY5A 3TKUA 4O0VA 4YJOA 4ERKA 4PPCA 4TWOA 3RBWA 5D1JA 3H0ZA 1H26A 4IW0A 4DFLA 2QLQA 3GBZA 4H3PA 5FUTA 4IB1A 2I0YA 5CU2A 2R3GA 3MFTA 4D5HA 3FHIA 2RIOA 4R77A 3ODZX 3QD4A 5AM6A 4IDTA 5IQBA 5LWNA 3V6RA 3RAKA 3VC4A 2VU3A 1GOLA 3DKOA 2G1TA 2R64A 3TNIA 3PWDA 3KL8A 3R28A 4U42A 2PVYA 3KN6A 3EOCA 3DB8A 4Q9ZA 5ANKA 3NW7A 5CAUA 3FJQE 3OS3A 5DT0A 4FEUA 4L8MA 1CTPE 5TO8A 4S34A 2G2HA 4A7CA 2QD9A 2VO6A 3GCUA 4PP9A 5JRQA 2X7GA 3LCTA 2UW3A 3KK8A 3PPKA 4FV9A 3SXRA 3ZU7A 4F4PA 4K77A 4QQJA 4I21A 4FTAA 5DG5A 4EH7A 3PA4A 4BCNA 5KBQA 2CPKE 4TYGA 4WUNA 3RINA 4BIBA 2OLCA 2XBJA 4DFUA 1GIHA 2BMCA 2C3KA 1E1XA 1JKLA 2E9VA 3LFNA 3BGZA 5A4TA 3D7TA 4IANA 4U3ZA 5FEQA 2IJMA 4UY9A 2GNLA 2XCKA 4FT7A 2I7QA 4KKHA 4E6AA 5M51A 2CGVA 2C1AA 2JGZA 2C3JA 4FYNA 4OBPA 3F7WA 4IJ9A 1AQ1A 3M1SA 4D1ZA 5IQAA 4N6YA 4ALVA 4CMTA 3GC9A 3I79A 1S9JA 2GS6A 3DFAA 4O0SA 3C0GA 3E8EA 3EN6A 2C68A 1LP4A 5DGZA 1F0QA 1JQHA 3OROA 3EH9A 3EFWA 3OXTA 3MW1A 4WIHA 3ZZEA 3VVHA 4WG5A 3LFAA 3UPXA 4CRLA 3PA5A 3PRIA 2WB8A 1KV2A 3W8QA 2ZOQA 3WIGA 3NLBA 3LPBA 2R4BA 2B1PA 3BYVA 3LM5A 4X2FA 3R83A 2GPHA 3UO6A 5L2QA 4GIHA 4MYGA 4IXPA 2C6EA 2VGPA 3BHHA 5AR8A 2XJ0A 3FY0A 1NT2A 5CF4A 3PJ1A 3PG1A 4MKCA 5L6OA 4X2GA 5D7VA 5IF1A 4ZMFA 2XJ2A 2CHLA 1OKWA 3OP5A 3T9IA 4BC6A 4IVCA 1UU7A 3FQHA 1JSUA 2BZIB 2GS2A 2WTDA 3OOGA 4IWPA 4O7ZA 3RK7A 5J7HA 3AT3A 3VBQA 4TYEA 4QQ5A 5BX0A 3DQXA 2ITXA 3QWJA 3QCQA 5H8EA 3QX2A 3Q2JA 3IW8A 4YC3A 5BNJA 5BPYA 1UNGA 5CVHA 5JGAA 5CF6A 3TZ7A 3VQUA 2UVZA 3P86A 4M7IA 3O7LB 5JT2A 4I5CA 2Y8OA 4U3YA 1A06A 1TQMA 3ORTA 1O6KA 4HW7A 1G8AA 2PVHA 4CCBA 2GTMA 2W17A 3FKNA 4JX3A 2E9PA 4IVDA 4RFZA 1VZOA 2WMWA 4RG0A 5LMBA 3DK3A 5M06A 1YWVA 3NSZA 4KD1A 2ZM3A 2CGWA 1PRYA 2VTJA 3MB6A 4K2RA 5AM7A 4RLLA 4ANOA 5F94A 5L2WA 2P2IA 5A6OA 4N4SA 2J9MA 3MB7A 4FTUA 4OBOA 3W10A 3KXGA 2W4OA 3FZ1A 3G6GA 4JDHA 5FEEA 5C26A 5AAFA 5JZJA 1O9UA 3NVKI 4E6QA 3ZDUA 3ZBFA 3DKFA 4QMQA 1U46A 3Q4UA 1PXMA 4AOJA 2ERKA 3O51A 3V5QA 4ENYA 4M67A 5L2SA 3DGKA 1GAGA 3QA8A 4NIFB 4WSQA 4D4RA 3HP5A 5D12A 3UO4A 5K9IA 2OBJA 2WTCA 3PWYA 5I9XA 4AA4A 2CLXA 2UZUE 3TNWA 4BCKA 2X8IA 4ZSGA 2JBPA 4A9UA 4KKGA 2R2PA 3I6UA 1PYXA 3UBDA 1WBPA 3KKVA 4YSJA 3RAHA 2OH4A 4G17A 2DUVA 2BDJA 2YM3A 3GCVA 2XK8A 2BROA 2WELA 4W9WA 3SQQA 2WGJA 4I0RA 4MXAA 1FPUA 3AMAA 2R7IA 4BCIA 2NRUA 4RVTA 1H0WA 3R9DA 4EWQA 5E8TA 1XH7A 4P7EA 2HXQA 3IONA 4M84A 4J8MA 3W55A 4R78A 3VJOA 5HCZA 3B8QA 4UN0C 4ZTQA 4HGEA 1P5EA 3W2PA 4F9AA 2BRGA 4QMNA 3EB0A 5HO8A 1YXVA 4FC0A 1YDSE 3NNWA 1EH4A 3O0GA 4BI0A 4BY9E 3O8UA 1MRYA 3QTQA 3DBCA 4ANLA 1R1WA 2XK6A 2WQBA 3UOJA 2VZ6A 5EM7A 1JSVA 2JKOA 1IA9A 4IE9A 3LZBA 1ND4A 5BYZA 2G15A 4ZY4A 3DXNA 4ANNA 2CNVA 1T46A 3A61A 4RVMA 2BRBA 1S9IA 1R0PA 2AUHA 2XIZA 4J96A 4FT5A 5AV3A 3UNKA 4NT4A 4ENXA 3C4ZA 5DT3A 4Z3VA 2R3FA 3OWLA 3PY0A 4TZRA 5IPJA 2WQOA 4AE6A 2HYYA 3BQRA 4IADA 2GS7A 3MJ2A 1KE8A 3RZFA 5LARA 1HCKA 4FOCA 2I1MA 2CDZA 3LFBA 4FKUA 3CKXA 3VO3A 2O2UA 1BUHA 2NP8A 2R9SA 3EKNA 3P79A 2GFCA 5CI6A 3V8WA 3ZRMA 5HNIX 2CNUA 1JWHA 1WFCA 5I9VA 4GRBA 4KINA 2W4JA 2F49A 4OTPA 4YPDA 2WEIA 5TR6A 4S2ZA 5FP5A 4ZZMA 4MXYA 4PQNA 4RMZA 5FM2A 4YBJA 3H0YA 2FB8A 2W5HA 2C6MA 3VBVA 4BWXA 5KMLA 3ZH8A 4R3RA 2Q83A 3TV6A 1OITA 5DEWA 4C7TA 4L7SA 4JRVA 4GFOA 4F7NA 3DXQA 1J3HA 4PDOA 3HMMA 2PZ5A 2Y4PA 5CAVA 4EH8A 5DOSA 5AR2A 3D5UA 1GIJA 5HTBA 1GIIA 2WMUA 1ZOHA 4PL3A 4CFUA 5B7VA 2C5YA 3BEAA 2Y7JA 3HGKA 4F7JA 4ACGA 4MTAA 1OKYA 4YTIA 2R3LA 2SRCA 3AG9A 4EH3A 2J51A 4NIFA 3DPKA 2XNOA 4O0XA 3AMBA 5HBEA 5L3AA 1ZAOA 4OAUC 1O6LA 1TVOA 2AC5A 1UU3A 4AW1A 2ACXA 4NCTA 4D0WA 1M7QA 4EH9A 2J5FA 3MWUA 2IVUA 4K33A 1U5QA 5DA3A 3R9OA 3EQIA 2OIBA 2OZAB 3UZRA 4FEVA 2PU8A 2Y4IB 3E7OA 5ITAA 5H8GA 2XIKA 1CDKA 1WBNA 2Z02A 3C13A 4A06A 3FLZA 4ZSEA 3TIZA 4R7HA 5JKGA 4WNPA 3QUDA 3QRIA 1V0BA 2WEVA 4GS6A 1IASA 3TIYA 4JOAA 3R6XA 3BEGA 5FD2A 4JQ8A 3QXPA 3KY2A 5EK7A 1DI9A 3R2BA 4XBRA 5CEOA 1IRKA 3SW7A 5HVYA 3QCSA 4DLIA 4C58A 4F7LA 1Q8YA 2F2UA 5GNKA 3AGMA 4M0YA 3UMWA 3VW6A 1F5QA 4CSVA 3OXIA 3QD0A 4WOVA 3ZO3A 3KXNA 4L52A 3OCBA 2OJIA 4K9YA 3ZO4A 2YWPA 5AP5A 4CGAA 3F61A 3R73A 4BDHA 3MI9A 4QOXA 4LRJA 5T6KA 3UNZA 2IW8A 3N4UA 4TNBA 2EXEA 2ZB0A 4AGDA 3R7IA 4IVBA 4R5SA 3DLSA 1NY3A 4E7WA 3TDVA 3FEGA 3EQCA 3C50A 3DAJA 3NW6A 4G2FA 4XG3A 5GJGA 4HVGA 3VF8A 2VAGA 2GHGA 2OJGA 4PNKA 4YZCA 4FUYA 4IC7A 1Y57A 3CC6A 3HA6A 4YP8A 3P1AA 5HTCA 4AZWA 1BLXA 3OVVA 1YHVA 1K3AA 5AP6A 3C5IA 4WBBB 4PDPA 3QALE 4FICA 2WQNA 4GCJA 4WBOA 1BI8A 2J0JA 3MFUA 3UIBA 1G8SA 3FMNA 4RIWB 5KMMA 2PVKA 4L3PA 4BGGA 2PPQA 3I81A 4ZEGA 2C5VA 3EMGA 4GSBA 1PKGA 2QG5A 1TQIA 5DT4A 4AU8A 1JVPP 2C6LA 3C7QA 5CEMA 2PULA 2X0GA 3VS1A 3BCEA 4EC8A 2BHEA 4A4LA 3FY2A 4AZTA 3U4WA 4D55A 4YO4A 4EI4A 2OW3A 4FMQA 3VUGA 5BYLA 1JKSA 3OMVA 5L6WL 3LXKA 3CSVA 2E9NA 2JDRA 3CQEA 2WOUA 4MF0A 2BKKA 3H4JA 4E3CA 3OOMA 5M56A 3LFFA 2BIYA 1BL6A 5FBNC 4GT5A 3TV4A 5J8IA 3ALNA 4IIRA 3HUCA 3KMWA 4CFMA 4L42A 2CKOA 3PZEA 3R7UA 4BI1A 1XH9A 1WMKA 4B7TA 5CEIA 3PLSA 3BWFA 5LVPA 3Q96A 1Y91A 2OZAA 2UW5A 2YJRA 5AUWA 5CNOA 3LHJA 4IZ7A 4TL0A 4MQ2A 4FF8A 4IX5A 2KULA 2IZSA 2QU6A 3MH2A 3NW5A 3R9RA 4FUXA 4K18A 1YVJA 4QP7A 3OTUA 4PTGA 4BBEA 4YJSA 4DBNA 2IVSA 4QP8A 5JFVA 4XJ0A 5J1WA 4Z55A 1CMKE 2XCHA 1PMEA 4GYGA 5E92A 4C57A 1W7HA 4GV1A 3UIUA 5AV4A 4FIEA 4CLJA 5FTOA 4JIAA 2UZLA 3ULZA 5HZNA 4I93A 3NUNA 4FV0A 2GSFA 2JDTA 2I0EA 3CCNA 3FAAA 2C3IB 2J2IB 3BYSA 4WNOA 1CKIA 2GMXA 1M17A 1FVRA 3VRZA 3QUPA 5HIEA 3DA6A 4TYHB 4JIKA 4DA5A 2YCFA 2BRHA 3CIKA 2JKKA 2QQ7A 3R21A 3KK9A 1VR2A 2WTIA 2B0QA 3R7YA 3DAEA 4FGBA 3ZSHA 4F0FA 2BRMA 4XCUA 3GC8A 5CNNA 2OFUA 5E1SA 3HA8A 4YTFA 3CQUA 3S3IA 2O3PA 5C01A 3FMDA 1YHWA 3PIZA 2W1DA 2QO2A 4RJ7A 4YHTA 2W4KA 5CF5A 4Q5HA 4A07A 2BZJA 2VO0A 1FGIA 2ONLA 2WMTA 3ETAA 5HNBA 1ZARA 2WXVA 3ZFMA 3S2PA 3PVGA 4JS8A 3U6JA 4FTMA 3F6XA 2QOKA 3D7ZA 4RVKA 4R7IA 4EYJA 4BHZA 3A4OX 4E4NA 1OKZA 3UJGA 5CU6A 2IW9A 3TACA 4QT1A 4QTAA 4FSRA 4RA5A 2G9XA 1LUFA 2YZAA 3IGOA 3SC1A 5KBRA 2YIQA 4F1MA 4B8LA 2B9HA 4JDIA 4BTFA 4BZDA 3PJ2A 1DI8A 4QMXA 2UZTA 1OBDA 5FLFA 4CZYB 4CFXA 2CGUA 2HW6A 3TKHA 1GZNA 2WMQA 2F4JA 3POOA 3DY7A 2QC6A 3R7VA 5L4QA 4Q5EA 3KXHA 2P55A 3E5AA 2CNQA 4TPTA 5C1QB 3GUBA 4JX7A 2ZV7A 3FZSA 3C4FA 4YZDA 1SVHA 3HRCA 3K54A 2GNIA 4AN2A 3N4TA 4LUDA 2R3QA 4AT4A 5CWZA 5KZIA 2W9ZB 3ENMA 4EK8A 3S00A 4FODA 1MQBA 3REPA 2YIRA 3IW7A 4LFIA 5IA2A 3KVWA 4E4LA 3SG9A 1PXOA 4FT3A 4LYNA 3UE4A 3TTJA 2EXMA 4B4LA 4DGLC 3II5A 1XH6A 2IW6A 3HLLA 3TM0A 1KOBA 4C3RA 3UMXA 5M07A 4XOZA 3AT2A 2H8HA 4PMTA 3DDPA 3BIZA 4YHJA 4C33A 4ASEA 2RSVA 1H1SA 4YR8A 3VBXA 4CG9A 4U97A 4G3EA 2XKFA 2XEZA 2R3PA 5FM3A 3JY0A 4ZMEA 4FV3A 4NM3A 4C34A 4JBOA 5IG1A 3QHRA 3PPZA 4NUSA 2BR1A 3AOXA 3GB2A 3MBLA 3GC0A 4KSQA 5K3YA 3KXMA 5AADA 3LQ8A 2VX1A 4J95A 2DYLA 2QOBA 5CU4A 3IW5A 3VS0A 1WVYA 4IAFA 1OGUA 3GGFA 4YZMA 2BTRA 3MYGA 3ZLYA 4TYHA 3EN9A 3VWAA 2XK9A 1I09A 3OW4A 4X2NA 3RPRA 2QG7A 2CMWA 4NFMA 2YM4A 3U6IA 2VTSA 2XNBA 3Q6WA 4YJNA 4ZTHA 1OIUA 3A8WA 3I0QA 3UDBA 4P2KA 3ZC6A 4XUFA 4C4GA 1Q8TA 1ZOEA 3D5WA 4JAIA 4MXCA 2JFLA 3R1NA 1YI3A 3D83A 1U4DA 4WKQA 4RIYB 4APCA 1KE9A 1H1WA 1ZMUA 5FP6A 3EHAA 3PZHA 3OUNB 4C2WA 5K4JA 2V55A 5TOZA 2VNWA 4ZS4A 3D14A 3EQPA 3NX8A 3I0OA 2ZYBA 4USEA 4UX9A 2KTYA 4FG7A 5JQ5A 1OIYA 2V0DA 3Q9ZA 3R04A 1B38A 2FSMX 4G5JA 2V5QA 3DZQA 3SKCA 4BFMA 2C4GA 2XRWA 2YM8A 5JSMA 2GNGA 2OICA 3N9XA 4JQEA 4J52A 3EQGA 2WOTA 4KUJA 3RCJA 4L44A 4F0GA 4GK3A 4RQVA 1W8CA 5EYKA 4AP7A 4L3JA 4CT2A 4GMYA 2X39A 4JLCA 4GK4A 5H8BA 4ACDA 2XVDA 3TL8A 1A48A 3G9LX 3DXPA 4QTDA 1L3RE 3LFQA 3NR9A 4KIKA 1Q8WA 5J87A 2JC6A 2YCRA 4I5HA 1H28A 2B9FA 1DAWA 4F99A 2XIYA 3QZGA 4QMTA 3A7HA 4QTBA 4RJ3A 5EH0A 4E5BA 3C0IA 4CD0A 2YEXA 4EUUA 4LV5A 3HX4A 3ACKA 5EKOA 3EQDA 2VWXA 4XV9A 4V04A 5M53A 1BYGA 3OFMA 4UYNA 3P78A 5A4LA 5JZNA 1HOWA 1U5RA 5HVJA 4FG8A 2CCHA 3POZA 2VWYA 4FG9A 5HG7A 3UP7A 5IEYA 2IPXA 3NUPA 3TN8A 4TW9A 2V7AA 1M7NA 3NAXA 3H9RA 4L68A 1IA8A 4PDSA 4IH8A 3CTJA 4C36A 4X21A 4ANBA 1G3NA 1FMKA 3IS5A 4JDKA 3U54A 3PVWA 4YC6A 2OF4A 4CNHA 4QQCA 4QTEA 3HAVA 5JQ8A 5EQPA 4FZ7A 4OTWA 5H2UA 5I0BA 4D0XA 3QKLA 2Y6OA 2WHBA 4I20A 1LEWA 3AC4A 4S31A 3UC3A 3UNJA 2XYNA 1DAYA 3D2KA 3U55A 4BCPA 3RWQA 2YWVA 2X2LA 3JPVA 3Q4TA 3TUBA 3TUCA 2IG7A 3GFEA 5DRDA 4FSTA 5IA3A 4DFBA 3E7VA 3UIXA 2YHVA 4FTLA 5KNJA 3SHEA 2O65A 3PP0A 5A6NA 4B0GA 3BU3A 4I41A 4PUZA 3DQWA 3SV0A 4BGQA 3PLAE 1FMOE 4DH3A 2F7ZE 3O50A 3ZM9A 4BCMA 5J9LA 4DH1A 4C37A 3LLAA 4HYIA 4OTIA 1UWHA 5CZIA 3ZDIA 2UZVA 4XP2A 5BMSA 5HLWA 1J7IA 4LGDA 4ZJVA 3JY9A 4FEQA 2UZWE 3QKMA 3R8UA 5AUYA 5TE0A 2PUIA 3EN4A 3KC3A 4O0RA 4FT9A 4TWCA 4II5A 4DTAA 3O17A 5DPVA 3NS9A 3KB7A 1PMVA 2EVAA 3EFJA 3S0OA 2QI8A 3E8NA 4RIOA 5C9CA 1XR1A 4I94A 4RIYA 4MCVA 1WCCA 4PPAA 4F6WA 3OBJA 3RM6A 3R9HA 5KMNA 4CXAA 4BL1A 3RK9A 3L9NA 3QQGA 3UGCA 2OKRA 5HQ0A 3BZ3A 3D5XA 4F9BA 4P5QA 3W2SA 4FEWA 4BCOA 4QP9A 3FLQA 3V6SA 5M4IA 2XEYA 2YFXA 5A4CA 3T8OA 3I4BA 4B6LA 4F9CA 4YLJA 1Q97A 3OEZA 3I7BA 1OIRA 2PUNA 4QPAA 3C5UA 1UU9A 4JG6A 4UMQA 4CEGA 2GCDA 5D11A 3HMNA 2CKPA 1QPDA 4QRCA 5JEBA 1YRPA 5CXZA 5LXMA 2VTOA 4ITIA 4EKLA 3VW8A 4EQUA 1OBGA 3VUDA 4Q2AA 4QP1A 5GZ8A 4IDVA 4EHVA 5E90A 4O22A 4NCTC 3TWJA 2ZMDA 5A46A 3PE2A 4OT6A 4FTQA 1ZYDA 3BX5A 3VBYA 1SZMA 2GQRA 1UV5A 1W98A 2G2IA 4IWQA 3UOHA 3HRFA 4GJ3A 4FL1A 3S1HA 3RI1A 5CTPA 1Y6AA 1J91A 4H58A 4I24A 4AW5A 5BQ0A 3R30A 4LOPA 3ORLA 3KRXA 2YAAA 4FSNA 3Q9WA 2F7EE 2A1AB 1ZYCA 3IDBA 4BYJA 4DE4A 2XIXA 2QOFA 4AAAA 4ZLYA 5AA8A 4FNWA 2X7OA 5CS6A 2CSNA 1ZYJA 1W82A 5HU9A 3E62A 1LR4A 2A2AA 4HPUE 4OTRA 3G9NA 3FZTA 3PSBA 3QA0A 2PK9A 5HHWA 4JG8A 2GFSA 2UZOA 3NUUA 4I5MA 4I0SA 1J1BA 1ZY5A 4KIQA 4FKJA 3ORIA 2BPMA 5L8LA 3WARA 4QP2A 2C30A 2R0UA 3CD8A 3NUAA 1H27A 5BVKA 3PXRA 4TWNA 5BVOA 3HP2A 3KRRA 4ERWA 4D1SA 3F5PA 4OT5A 5AFVA 5M57A 3B8RA 4YNOA 5HBHA 3MV5A 1A9UA 4NM0A 4U80A 3UTOA 4J98A 4JDJA 4L01A 4MNFA 4NJ3A 3ZSGA 4U8ZA 1OZ1A 2Z2WA 2OWBA 3FBVA 4G3DA 5HLNA 3H10A 4D2TA 3ET7A 4PTCA 3QYWA 1UU8A 1KE6A 5TF9A 5DI1A 3LVPA 2QOCA 1GZKA 4IAKA 4MEDA 4EK6A 5AUUA 4J7BA 1MP8A 1URWA 2J7TA 3P5KA 4DTBA 5HO7A 2R3HA 5HG5A 3G6HA 4BDGA 4BVUA 1SNXA 5IA0A 1M2PA 3KF7A 1PF8A 4HVDA 4M13A 3DOGA 5IMEA 5E4HA 3EKKA 2YIYA 4FVQA 5IQFA 3GQLA 3VS4A 3R2YA 1XWSA 4J71A 5HD7A 4CLIA 4HZSA 4EZ5A 3VJNA 3PDTA 3JVSA 3MJ1A 1H0VA 4LQMA 4AGWA 1H1PA 4IAZA 4OTQA 4PMSA 5GZ9A 5BVEA 3GC7A 2VWWA 3Q5IA 2YACA 5FXSA 2XIRA 5AX3A 3C4XA 3TNQB 3MIAA 2BIKB 3UQFA 3CY2A 3GNIB 2C0IA 4GKIA 2QOLA 1Q24A 2JAMA 1ZYSA 3B2TA 1PJKA 3Q32A 3O8TA 1G5SA 5EYCA 3UQCA 3RZBA 3DBEA 3E8DA 3MSSA 3UYTA 1YOJA 2X2MA 3R1SA 3QF9A 1RW8A 1CSNA 4AX8A 4RZVA 3QTUA 2X4FA 3PY3A 1OL5A 3BU6A 4UWYA 3ATSA 3QD3A 3I7CA 3FHRA 4UXQA 2OJFE 5IA5A 3R8MA 3PRFA 4FSUA 3ZHPC 2PUPA 5F9EA 1XQZA 4FI1A 4RGJA 4EKKA 5DNRA 2R3NA 5ANOA 4BTMA 2Y4IC 1PHKA 2UW0A 3MS9A 5DVRA 1JPAA 4NW5A 4QPMA 4HCUA 5HOAA 4O91A 4AT3A 4BF2A 3MPAA 1IEPA 1ZXEA 5C4LA 3GT8A 4RVLA 3ZZWA 4EOQA 4IAIA 2WPAA 3EN7A 4QP3A 3PYYA 4L46A 2PSQA 1P4OA 3HYHA 5HESA 3FLNC 3TNHA 4EOMA 3FI4A 3OWJA 4X3FA 2Z7SA 4U0IA 5D9HA 3AC1A 3SAYA 5C8KA 3TUDA 3COHA 1KV1A 4EH4A 4EBVA 1UKHA 2ITWA 2ZM1A 2XRUA 2YABA 4EH2A 5AAEA 5JFXA 2VWZA 3QX4A 2Z7LA 1BL7A 5J7BA 3CJGA 2OXXA 5HCXA 4DAWA 4WT6A 3NVMB 1I44A 4Y85A 3P08A 4A9TA 3G0EA 3E64A 1REJA 2C6TA 3EIDA 3WI6A 4C59A 5E8VA 3SG8A 3BHYA 4JL9A 2O64A 3VS7A 5AUTA 4AOIA 3NYOA 2VTMA 3WIKA 2QOQA 5IA4A 5AP0A 4B9DA 2A27A 4W4WA 5KX8A 3IDPA 4FK3A 4IB5A 3UPZA 4TYIA 3TI1A 3ZO1A 1YHSA 3EFLA 3BBWA 5CZHA 4JG7A 4AUAA 5A54A 5JH6A 2VTAA 3GXLA 4L00A 3WF5A 5EQEA 2IZUA 4HYSA 5EHYA 4FSMA 5FXRA 4R7BA 2WMVA 4KKEA 2WMBA 2ITUA 2X8DA 4AXAA 4ZOGA 3BYOA 4D5KA 4QMZA 5CSWA 4IM2A 4RA4A 2AC3A 4PV0A 5FXQA 2CN5A 4KIPA 2VD5A 2JBOA 3BU5A 3PE1A 5DR6A 3RKBA 3ZUTA 1QCFA 5ANGA 2ITPA 3LIJA 4AE9A 4CQEA 5J5SA 1GZOA 5LCJA 1P2AA 4RFYA 1JBPE 1XH4A 2Q0NA 4BDJA 5M4FA 2YISA 3ZUUA 5FDXA 1OVEA 3HZTA 1W83A 5BUIA 2WQMA 3LM0A 5EYDA 5AR3A 3DNDA 5CEPA 2EB2A 3A60A 5CF8A 3KGAA 4DT9A 2IVVA 1YWNA 3AXWA 3FXXA 3ORPA 4MH7A 4WRSA 5E8SA 4HCVA 3TG1A 3CXWA 2HZIA 4AG8A 4AGCA 4U79A 3LJ2A 3OUKA 4GEOA 4XH6A 3R8ZA 2VTNA 4XG2A 2DS1A 3DBFA 3R63A 4KA3A 4QNAA 4ZSJA 3VS6A 3L8PA 2YIWA 4EK3A 4IM0A 4QYEA 3DU8A 3IK3A 5L2TA 4EL9A 2XS0A 1PYEA 2OF2A 4F64A 3CJFA 4FX3A 3C0HA 3EZVA 1R3CA 3QD2B 3TZ8A 5I9WA 1QPCA 5T3QA 2ZB1A 4DEHA 3IPHA 1JAMA 4FSYA 3KXZA 3NIEA 3OY3A 3BPRA 3FMLA 3HV5A 1ZLTA 2W1EA 3MH3A 4H3BA 2WZJA 2WO6A 3LOKA 3ZYAA 4LRMA 4F0IA 4IAAA 3A8XA 3R00A 5AX9A 4GT4A 4G9RA 4S32A 4C38A 4OGRA 1Q3WA 4XV2A 4FTJA 2XNEA 2YZLA 3WF8A 2P2HA 3MIYA 4BWKA 3DT1A 2VO7A 5T68A 3ZBXA 3AD6A 2RG5A 3ZTXA 2B54A 2ITOA 5CX9A 4Y83A 5HKMA 4XRJA 4K11A 1B39A 2R0IA 3HNGA 2VRXA 4AA5A 3UOLA 3IQ7A 4M14A 4QYGA 2XJ1A 2HWOA 4FL3A 2B4SB 4DH8A 2X4ZA 2XNNA 3UZPA 2YN8A 3QQFA 3F3UA 4JBVA 1OUYA 4HNFA 3V01A 2W05A 2VNYA 4M97A 4GFGA 4XS2A 4U40A 5LMKC 4N6ZA 2WNTA 2VTLA 3F5UA 3JYAA 3L8XA 2XH5A 4QMMA 5M55A 4D1XA 5E9EA 5J79A 4F65A 1WBWA 4OTFA 3EQBA 3NPCA 4XP0A 5EM6A 4FKWA 1SMHA 1YOLA 2P4IA 4EHZA 2QLUA 4YLKA 5DRBA 4EOOA 3DJ6A 4RX9A 2J0IA 3D2IA 2OXYA 2XK4A 3NUYA 2PYWA 1IAJA 4NWMA 4FIGA 4O2PA 3HRBA 2REIA 3MH1A 3ZOSA 3VHKA 5D41A 1YWRA 2PZYA 4DFYA 3HDMA 2WIPA 2QKWB 5CYIA 2W1ZA 2WIHA 1VYWA 3AD5A 5AV1A 3FE3A 3FZPA 3EYGA 1PXLA 3NNXA 2ZV2A 2X81A 1PXJA 3FSFA 3TJDA 3CGFA 2FVDA 4MBLA 3E8CA 4XBUA 5ACKA 3F9NA 4G16A 4GUBA 3QRJA 2PHKA 4N70A 4RT7A 3A7GA 3FMEA 5EW3A 2OSCA 2R3KA 1RDQE 2PE0A 4LV8A 3V5TA 3UG1A 3PIYA 1KOAA 4FA2A 2B9IA 4JQ7A 4TNDA 4FKPA 4XV3A 4M15A 4AZEA 4JRNA 4AZSA 4FV6A 3Q52A 2BILB 4ZTMA 1FINA 4FBXA 2WD1A 2J0LA 1VYZA 3TJCA 2YDKA 5I3OA 3O7LD 2X6DA 4OLIA 2ZJWA 5KE0A 2QURA 4A9YA 4HVIA 4RPVA 4USDA 3A7IA 3ZXZA 4BCHA 3AT4A 3FZRA 3OG7A 4CCUA 3ENHA 3F69A 1MRUA 1WVWA 4X3JA 4LI5A 3ZRLA 2YITA 1KSWA 4ZP5A 1WVXA 5EW8A 4RSSA 3I6WA 2QKRA 1OECA 4GK2A 1R78A 3C4CA 4MWHA 3BLRA 5DYJA 2AYPA 1YXUA 2WMSA 3F7ZA 3V51A 4PL5A 3SOAA 1NW1A 1IR3A 3V5WA 4YBKA 3FC2A 3H9OA 1E1VA 4BKJA 5EOBA 4CV9A 4GVAA 5IUIA 2HZ0A 2HY81 4BKYA 5E8XA 3EJ1A 4X2KA 4CTCA 3TCPA 5DFPA 5DLSA 5IQDA 4YJUA 3WZJA 2VTTA 4C62A 5HEZA 1OM1A 2YA9A 5HLPA 5BMMA 3NYVA 3V3VA 4O7RA 5CEKA 2WMRA 5HICA 2HY0A 4O96A 4AZVA 5C8NA 2R3JA 5KHXA 4MVFA 3L8SA 3MFRA 2A4LA 3U8WA 5GZAA 5AR4A 3EWHA 3BHVA 4ZLZA 1SNUA 2VX0A 5IEVA 2X1NA 4BN1A 3T9TA 2IVTA 2EB3A 3IW6A 3UYSA 4RC3A 4F6UA 3IKAA 4BCGA 5AAGA 4GU6A 1NVSA 4ANSA 1PXIA 3CPBA 4X2JA 3RVGA 5IUHA 5HU3A 3OTVA 1VEBA 3DK6A 3P4KA 3W2CA 2CGXA 2E2BA 4G6OA 4FIIA 2C6OA 2QO9A 3BGQA 3PJCA 5GJFA 3SOCA 4M68A 3K5UA 3F66A 3E93A 4USFA 2B9JA 3KN5A 3R7GA 3ERKA 4E20A 3ORKA 4ORKA 4ZTRA 4FT0A 4RJ5A 3C1XA 4GKHA 2C0OA 4XP3A 5LVLA 3TZMA 3ZCLA 5M08A 4FTIA 1ATPE 1QL6A 4H05A 3ZFXA 2P3GX 4F1OA 2BRNA 3EYHA 4TY1A 5HORA 4RQKA 4O83A 4KB8A 4YU2A 1M52A 3GCSA 2QOIA 4M8TA 4QMOA 4YJPA 3F3TA 1NVRA 1V1KA 4GW8A 4ZXTA 4DEAA 3GOPA 3PJ3A 4WUAA 5J5TA 4QYYA 3MPTA 4DHFA 3DLZA 5K0XA 3VBWA 5J9ZA 5ANEA 3FSKA 2YLEA 2JDVA 2JIVA 4PWNA 4R1YA 4RX5A 5JRSA 2NPQA 4UV0A 3W8LA 4UALA 4X6QC 3R7OA 3W1FA 5KMJA 3JS2A 2YLFA 3KRLA 4O0WA 4XG8A 1FOTA 2Y0AA 3QU0A 3LAUA 4GT3A 2X8EA 5TT7A 5CALA 2FSOX 4DN5A 5CQWA 2VTHA 2PWLA 4MF1A 4O7VA 4KIKB 4ONAA 1FVTA 3UVQA 2A19B 2OJJA 4YTHA 4EOJA 3KULB 2XNMA 4C2VA 3QTXA 4G5PA 3ALOA 4P4CA 3N51A 2F9GA 3NEWA 5DR2A 1U54B 3L9LA 4IB0A 4YSMA 3TZ9A 4PMPA 4E4MA 2R7BA 4YUQA 2W7XA 5IKWA 1RE8A 1PY5A 2Z7RA 1K2PA 3QCYA 4KBCA 4MXZA 3TDWA 1WBTA 4GUEA 5J1VA 2IN6A 5J95A 3R8PA 4PL4A 5EOLA 1V0OA 3H30A 2G01A 3DFCB 4IAYA 2PVRA 2GQGA 4C4IA 1OKVA 4G3FA 4O86A 2W1FA 4EQCA 1H8FA 2CN8A 3FMJA 3F3ZA 5F20A 4FSWA 2XNGA 2UW9A 2OG8A 4F7SA 4X7QA 3MY0A 4CFVA 5AA9A 4OTDA 3CGOA 3K3JA 5CASA 2BUJA 5AP7A 4U6RA 3IOPA 3V8SA 1J7UA 3HV3A 2JKMA 3LXPA 1YOMA 4YTCA 4UXLA 3AC2A 4YURA 4E5WA 2GDOA 3Q9XA 3Q5ZA 5G6VA 3K3IA 1ZMWA 3UOKA 3QBNA 4O1OA 3KRJA 2BZHB 3OCTA 4RJ8A 4O82A 4EONA 3D4QA 2JDOA 3NNUA 4EH5A 4L45A 3IW4A 5HTIA 5DIAA 3FKLA 4O7NA 2C69A 4I3ZA 4FKTA 4D28A 5AEPA 3RALA 5GIOE 3GCPA 4YGAA 4C0TA 1LPUA 5LMAA 1FQ1B 1YI6A 4C4JA 2QNJA 4IZ5A 3SD0A 3FLSA 4FEXA 3QGYA 2XM8A 3FI8A 4FIJA 4HOKA 3FZOA 4FKLA 4FTNA 5E7RA 5BVFA 3MPMA 1URCA 5CENA 1JSTA 4MAOA 2OJ9A 1Q4LA 3V5LA 4KWPA 4C35A 5EKNA 2UW8A 5LWMA 3MESA 3C51A 3CPCA 3NWWA 2OFVA 4F1TA 3B2WA 2PTKA 4H1JA 2UZDA 2DQ7X 1QMZA 3F2AA 3O8PA 3KVXA 4YO6A 3HKOA 4A4OA 4B8MA 3P0MA 3TXOA 1GZ8A 4UYAA 5A3XA 1Q99A 3FYKX 5AV0A 3BELA 4I6HA 3PXYA 3EQRA 4LMNA 1PXKA 4GG5A 5EI2A 2C5OA 2IWIA 2W1IA 3G90X 4EOSA 4UZHA 3TTIA 3RJCA 4C4FA 4CT1A 2ZV9A 3VUTA 5JGDA 3ATTA 3BLQA 5JFSA 4D2PA 1Q8UA 4XRLA 2JLDA 3BV2A 3LFCA 5CQUA 4CG8A 3RHXA 5DEYA 5HX8A 4HCTA 4EHEA 3EFKA 1WZYA 3UVRA 4LUEA 3CP9A 1RQQA 1ZOGA 3KULA 3H3CA 1Y8YA 3CTQA 1UNHA 4I1ZA 2C5NA 2WTJA 5CU3A 4CYIA 3GEQA 5AUZA 3IOKA 4ALWA 4E4XA 4MK0A 3FLWA 2QU5A 1U54A 3EZRA 3RMFA 4CYJA 4FOBA 4E8AA 2PVMA 5IU2A 5FTQA 4QNYA 2RG6A 3LMHA 2HK5A 4O7YA 2BTSA 3Q9YA 1PXNA 4UEUA 3LMIA 1MUOA 3TV7A 4W9XA 1H01A 3Q4ZA 4M69B 2NO3A 3DKCA 2XUUA 3EL7A 4I6BA 3L8VA 4YZ9A 2BDFA 4AT5A 3R0TA 4G31A 4LGHA 4NW6A 3R01A 4KBKA 5I3RA 4L6QA 3VQHA 4LOQA 4HVSA 3LKMA 3QLGA 2XBAA 4EEVA 4ASDA 1TQPA 2X7FA 4R5YA 3DJ7A 3OEFX 4ZK5A 4HGTA 5CT7A 4WHZA 5TKDA 1UVRA 4XG7A 1FVVA 4JAJA 5ETIA 4XG9A 2PVLA 4G1WA 2FH9A 4K6ZA 1XBBA 3PIXA 4V0GA 4HJOA 4AACA 4ARKA 3DNEA 2HZNA 3RK5A 1SM2A 2UZBA 4IFCA 4EOKA 4FZ6A 2W1GA 1Q61A 2O63A 4L43A 2W0JA 4E6DA 4D2SA 2HOGA 3GVUA 2IZRA 4I0TA 3BWJA 3QCXA 4FL2A 1XH5A 3O96A 4QQTA 3W16A 3C4EA 2W5AA 3GQIA 4XEYA 5BVDA 4D2RA 4O7SA 3FLYA 2PMLX 5L8KA 3WE4A 5IH6A 4RX8A 3PP1A 3HEGA 5C8MA 1Q8ZA 2WQEA 3V5PA 5EW9A 2W1HA 1R0EA 3ZRKA 4BYIA 4D58A 5IH5A 1Y6BA 3CEKA 5H9BA 2GHMA 3QC4A 5EDPA 3WILA 4CV8A 2WU6A 5IEXA 3L9MA 2PVFA 3COKA 4O6LA 5E91A 2C47A 4IX6A 4DYMA 1OMWA 3G2FA 3KMUA 4XLIA 5DE2A 3VULA 3BYUA 4NYEA 3TT0A 4Z7GA 1YXTA 2J0KA 2QHNA 2DWBA 1ZY4A 3BLHA 4GH2A 3WZEA 4AA0A 3NYNA 4AS0A 3ZLSA 3FI2A 3QL8A 4OW8A 4AWIA 4G6NA 3F3VA 3MFSA 5B2MA 5FTGA 5IDPA 4U45A 4MNEB 4AZFA 3WE8A 2H96A 3HV6A 5CY3A 5KMIA 3CLYA 3ZO2A 4ITHA 4O2ZA 2VWUA 2X2KA 2ESMA 3JVRA 2FSTX 2UW6A 4IQ6A 3JUHA 2HELA 4EUTA 1CKJA 2CKQA 3UQGA 4EWHA 4R3CA 5DN3A 2C1BA 3U9CA 4DEDA 4GG7A 5AP1A 5B2LA 4IX4A 4CZTA 3HMIA 4MBIA 2ITNA 5AWMA 5AUVA 2C0TA 2PZPA 1KE5A 4F09A 4K8AA 4I4FA 4BR3A 4BRXA 3U87A 3R1QA 1IG1A 5A9UA 4IHPA 5CAPA 4BTJA 4JI9A 3SDJA 4CTBA 4QP4A 4FSZA 3KQ7A 5EG3A 4Z7HA 3QQLA 3QKKA 4S30A 5CI7A 3CE3A 5LQFA 4BDAA 4ZSAA 4DCAA 3ZONA 4MD9E 1WBOA 2X9FA 1YKRA 4UZDA 3SRVB 4AN3A 3OCGA 5B2KA 4RZWA 3QTRA 3QTSA 2C6DA 4OUCA 5CLPA 4LM5A 5HE2A 3LFEA 5KKRB 4U43A 3A4PA 3KREA 2FUMA 4J8NA 4OAVB 4M69A 2X6EA 5GJDA 4A4XA 4O81A 4APPA 1KUTA 2R3IA 5FGKA 2A0CX 3CY3A 4Y72A 2XM9A 3VUIA 2F7XE 2WTKB 4UBAA 1WBVA 5F1ZA 3LCKA 3LCSA 1M2RA 4X3FB 3KU2A 5M4CA 4EJNA 4D9UA 1BI7A 2VUWA 3D0EA 3DTCA 4WNMA 3WF6A 4PTEA 4UMPA 2WU7A 2OO8X 2PE1A 3MGYA 4I4EA 3RPVA 3GFWA 3VN9A 5C03A 3SGCA 3QQHA 3FPMA 4BDIA 4ANQA 5B0XA 3OT3A 4ZAUA 5CAQA 2XB7A 3BRBA 2PMOX 5CU0A 3PUPA 3MVJA 1MQ4A 4BICA 4ACCA 3LJ0A 1CKPA 3GOKA 1XJDA 2R3MA 2YDIA 5HIDA 3S95A 2GNHA 3K5VA 4LMUA 5AMNA 3HDNA 5CVFA 2HCKA 3OC1A 2RF9A 1T45A 2C6IA 2YCQA 3GU7A 4H1MA 5A14A 5IUGA 3RAWA 1O6YA 1OB3A 3CBLA 3ITZA 1AD5A 4DCEA 2FSLX 5BYYA 1ZYLA 3MVHA 3G33A 3PXZA 5LVNA 5CT0A 1ZZ2A 2BALA 3IDCA 3GU6A 5C4KA 4CKIA 2BZKB 3HAMA 3RAIA 3MN3A 3NGAA 4P5ZA 3VS3A 1ZMVA 4YZBA 5HNGA 4L9IA 2YM7A 4C3PA 4WG4A 4MNEA 5IDNA 1NA7A 4KABA 4U9AA 4MD7E
chains in the Genus database with same CATH superfamily
4D9TA 3ZLWA 4FR4A 4WD5A 3UZTA 2EXCX 2VWVA 3LMGA 1QPJA 2EU9A 4WO5A 2LAVA 4DFXE 5FWKK 4QTCA 3RCDA 4EBWA 2W9FB 2H34A 4IVAA 5HVKA 5E8YA 2YDJA 3WF7A 4BDCA 3DCVA 5A4EA 4S33A 3HV4A 5CSPA 4LGGA 5BVWA 2I0VA 4BDEA 4DITA 3QTIA 2UVXA 2PVNA 4EJ7A 4O21A 1J7LA 3HV7A 3WOWA 4BKZA 3W18A 2P0CA 2YAKA 3M42A 4FNYA 5KO1A 4FTOA 3PG3A 4NEUA 3OCSA 2V7OA 3GU5A 3ODYX 4NFNA 4R3PA 3RGFA 4ACMA 2GHLA 1Y8GA 2YCSA 5EDQA 4XLVA 2ITTA 3F3WA 2PZRA 3SRVA 4O7TA 4UMRA 4YC8A 4Y46A 4C3FA 2UW7A 3QTWA 4LOOA 5K5XA 2QONA 3EQFA 3ZXTA 4K1BA 4KS8A 3MH0A 4WG3A 4G3GA 5I9ZA 4LG4A 1TKIA 3U4UA 4FZAB 1DS5A 4C61A 4NTSA 2NRYA 4ID7A 3ZLXA 4KS7A 5EYMA 4RJ6A 3QRUA 1FGKA 4NSTA 5EI6A 3AC5A 3FQSA 3ORNA 2GQSA 5HE1A 2Z7QA 4FTKA 5E8UA 2RFDA 5FEDA 3E87A 3QQJA 3G0FA 3LXLA 3PVBA 3P7AA 3ZFYA 4PMMA 4KAOA 4Q9SA 3UO5A 4B99A 1HCLA 4JBQA 2ERZE 2C3LA 4K0YA 4QMSA 5IQEA 3NFFB 4NZWB 4NL0A 3P7CA 4ANMA 1H25A 5M44A 1LEZA 2GNFA 3N4VA 4GU9A 5M4UA 3V04A 1NVQA 1RJBA 2ONLC 4KSPA 2O0UA 4MQ1A 4TT7A 5AR7A 4EZ7A 1XO2B 4NH1A 3OY1A 4FNZA 4QYHA 4O4FA 3DV3A 5FQDC 1K9AA 3CTHA 3QAME 4QMVA 3FC1X 3MTLA 1NXKA 4BTKA 1H24A 1W84A 1OI9A 2FA2A 5EHOA 5GHVA 3QQKA 2YJSA 5JGBA 4DT8A 3VF9A 3HMOA 2HXLA 3PY1A 4PRJA 3OWKA 4QYFA 5G1XA 2ZFYA 1SVGA 4CQGA 1JLUE 3TEIA 4RIXB 3AC8A 4ASXA 1PXPA 1JNKA 3I60A 2PL0A 3E3PA 5KHWA 2VX3A 3ML1A 4FSQA 2WKMA 5IMXA 3ZEPA 4DC2A 4WRGA 5KMOA 2XKDA 3MTFA 3PFQA 5DWRA 4BZNA 2Y6MA 2J90A 5F95A 3QZFA 4CVAA 2FO0A 2JIIA 4F70A 2B7AA 5IQGA 4O38A 3VIDA 4G3CA 4UB7A 1AGWA 4XV1A 1STCE 2VWBA 3ORXA 4I23A 1KWPA 4JNWA 2OU7A 3R8VA 3Q53A 1OPJA 1UA2A 4OR5A 5EFQA 3LFDA 5K0KA 5EI8A 3A62A 3OBGA 1JKTA 3KA0A 4IBMA 4MD8E 2QR7A 4E6CA 1P14A 4M3QA 4IWOA 3ROCA 3PA3A 3QUEA 4HYHA 4Y8DA 1CM8A 4DH5A 4MXOA 3UVPA 2X0PA 2RFSA 4DGOA 4FKGA 4CKJA 4PDYA 5I4NA 2RKUA 3LCDA 4H39A 4O0UA 4QD6A 5M09A 3A99A 2J6MA 1XHAA 3BHUA 3E3BX 3HMPA 3P7BA 3R22A 5KZ0A 3CQWA 4EK5A 1H4LA 3P9JA 3EL8A 3KEXA 3PXFA 4TRLA 2JD5A 3ID6C 2CJMA 2Y9QA 2XAOA 2JEDA 5BUEA 4Y5QA 3Q60A 5I9YA 3BQCA 4BCJA 2W96B 4HYUA 3SLSA 3WYYA 5DMZA 1XBAA 3BYMA 2W5BA 3NYXA 5ANJA 4U41A 4BI2A 5FDPA 5ACBC 1ERKA 3LW0A 2WAJA 4J53A 3GU8A 3DDQA 4FVRA 4ZIMA 4O84A 4DEGA 4NTTA 2HW7A 5J9YA 3BE9A 4OBQA 2VTRA 3RM7A 3ORZA 4L7FA 4W8EA 4AF3A 4EK4A 5AP3A 4JR7A 3ANQA 4XMOA 2F2CB 4YMJA 3KFAA 3AKLA 1PKDA 3NUSA 3ZUVA 3GU4A 4OTHA 2E9OA 3VRYA 1ZWSA 3R02A 2GU8A 1J1CA 3EN5A 4FK6A 4FTCA 4I92A 4RWJA 3PVUA 3RPYA 4L67A 5FG8A 3LXNA 5AJQA 4D2VA 3ORMA 3DKGA 3HECA 5E8ZA 5LVMA 5GINE 3COIA 4FKSA 3BE2A 3H9FA 3QQUA 5AR5A 2BAJA 2R3OA 4UWBA 3UG2A 3VAPA 1PMUA 3WZDA 2F57A 3UDZA 3IGGA 4AGUA 4ZTNA 3SX9A 3C9WA 5IZFA 3F2RA 3RNYA 1BKXA 4HGSA 4YPSA 2PVJA 3ELJA 2YM6A 2ZDTA 3QWKA 5D7AA 4BBFA 4CFFA 4JMQA 4ASZA 3VS2A 4RIXA 3BL7A 4V01A 5HE3A 5I9UA 4R1VA 1W0XC 4FYOA 3VS5A 4RWIA 3G51A 2RL5A 3KRWA 3VHEA 5ETAA 1ZRZA 1JOWB 3WZKA 4D4VA 2GNJA 5AIRA 1Q41A 3FDNA 3FI3A 4GL9A 1M2QA 5CSXA 5K5NA 3D5VA 4TTHB 1Q62A 4W4VA 4D4YA 5HGIA 2QOHA 4BGHA 1FBNA 2XK3A 4FV8A 3MVMA 5ICPA 4MWIA 2JKQA 4IM3A 3DS6A 3LLTA 2OGVA 4FIHA 2UW4A 3OHTA 3M11A 4UMTA 3QHWA 3RP9A 3MVLA 4WA9A 1E9HA 3QRTA 2CCIA 4RWKA 4DFNA 3WYXA 3F2NA 1Q3DA 1XH8A 3TNPC 3UIMA 4CFWA 4ZZOA 1DM2A 3SVVA 3AQVA 4IX3A 3D9VA 3LQ5A 2R5TA 2WFYA 4EORA 5EQYA 4GJ2A 3U6HA 4OTGA 3OZ6A 3FYJX 4YJRA 4RC2A 3WZUA 4U81A 4MXXA 3UP2A 4QMLA 1VJYA 1YDRE 3ROYA 4TYJA 4ZY5A 4IC8A 2PY3A 2JAVA 4PPBA 4WSYA 4HVHA 3KCKA 1U59A 5EHLA 4AFJA 5AP4A 2R3RA 2XNPA 3NUXA 4L3LA 4Z9LA 3ZS5A 3LQ3A 2UZEA 3BV3A 4JT3A 3A2CA 4FTRA 4YHFA 2OK1A 5CVGA 2FYSA 5L8JA 2RFEA 2XYUA 4TKSA 4U44A 4IZYA 3OWPA 4FNXA 4QMYA 4DEBA 4TXCA 3D94A 4G9CA 3WBLA 1OL7A 1X8BA 2W06A 4GYIA 2QO7A 4BDBA 2V62A 2VV9A 4PNIA 3NMUF 5ETCA 3RTPA 5H3QA 3U9NA 3Q2MA 3QLFA 3ANRA 4CMOA 3JR1A 1UKIA 2OI4X 4ZLOA 3KF4A 3R1YA 4DGNA 5LCKA 2HAKA 4GFMA 5LOHA 3QYZA 4IMYA 5HG9A 3Q3BA 3VNTA 3GI3A 3O2MA 3PSCA 4R6VA 3FXWA 4Y95A 4W4XA 3ZEWA 4KRCA 3W33A 3ZSIA 4IB3A 4UWCA 1GY3A 4FZDB 3I1AA 4J99A 5ETFA 1F3MC 4JBPA 3SW4A 3R8LA 3FMHA 3NDMA 4TN6A 1GNGA 4EYMA 4CRSA 5EM8A 3QXOA 2H9VA 5HBJA 3D15A 3PXKA 5DR9A 5HD4A 3MA6A 3JXWA 4YNEA 1H1RA 3GP0A 2YM5A 4BIEA 1V0PA 4P90A 5JK3A 4DLJA 3OF0A 3NCZA 4QMPA 4W8DA 2WMAA 5FRIA 3ZMMA 2ZMCA 2OIQA 3F5GA 3NCGA 4KBAA 4NM7A 2HZ4A 2J0MB 4IFGA 3UODA 2W99B 4ACHA 1BMKA 3DJ5A 3I5ZA 4NU1A 3W2RA 4PX6A 4O0YA 2B52A 5LJJA 3HUBA 1SVEA 4DF3A 5IQCA 3VUMA 2BAKA 5K4IA 2B55A 2C5XA 3THBA 3O23A 2W1CA 2YIXA 4O6EA 4GIIA 4EH6A 3VUKA 4BCQA 4J1RA 2HIWA 2BFYA 2J4ZA 4O0TA 4AW0A 1OGYA 4FV7A 3BHTA 2B53A 2J5EA 3LCOA 3NRMA 4AN9A 2ZM4A 2JITA 2PE2A 4R8QA 4I6FA 4ZY6A 3QRKA 5DHJA 4ZS0A 3DK7A 1M14A 5HE0A 4U7ZA 2BKZA 2WTVA 3PSDA 1YXXA 2UUEA 4HGLA 1ZZLA 2UVYA 1H07A 3LJ1A 4XOYA 5AV2A 4AOTA 1UWJA 2QVSE 4RIWA 5DH3A 3SA0A 4XG6A 5GIPE 3DTWA 2PZIA 4JJRA 4RX7A 4EC9A 2HENA 2VWIA 1Q5KA 3T3UA 4EOIA 4ZTLA 3FL5A 5FBOA 3V5JA 5HIBA 5L6PA 3BKBA 3PXQA 4D4SA 3BGPA 4IWDA 5D10A 2C6KA 2WTWA 3A7FA 4IACA 1VLRA 4GVJA 3RWPA 4YLLA 1WAKA 3E88A 1SYKA 4ALUA 5IQIA 4J97A 4M0ZA 3FMMA 3IG7A 1Z9XA 3ZM4A 4E1ZA 3COMA 2ITVA 2OXDA 3NIZA 3QTZA 4NKAA 2Z60A 4BIDA 4FE2A 3DB6A 4L53A 4BB4A 4AQCA 4ZZNA 4DG3E 2NNWB 2XP2A 2ZVAA 2WMXA 2FGIA 2G2FA 2QODA 1H00A 1WBSA 2UZNA 3FKOA 3IECA 3NAYA 4V0GB 5KUPA 5EDRA 4E5AX 3M2WA 4FKOA 4DFZE 4IZAA 5IH4A 3S4QA 3AC3A 5AIKA 2ZDUA 4TWPA 4DTKA 3UC4A 4RC4A 4DG2E 2Q0BA 2YERA 1BX6A 3L1SA 4EOLA 5AP2A 5L2IA 3L9PA 3RNIA 1OL6A 2XF0A 3F88A 4FV4A 4RRVA 4ZJIA 3AMYA 4FKIA 4RWLA 4IEBA 1OIQA 1PMNA 4RJ4A 4X0MA 1R39A 2HWPA 2V22A 3CS9A 3W2QA 4LL5A 2RGPA 3TKIA 4Y73A 4CKRA 1YI4A 3GCQA 4FZFB 5AUXA 2H6DA 4H3QA 1OL1A 4IJPA 5ANDA 3T3VA 4UMUA 4LL0A 4MHAA 2JFMA 2XMYA 3Q4CA 4DINA 4EQMA 4O7WA 5EM5A 4FV2A 3NNVA 4BDFA 4LRKA 5IISA 3QGWA 4O1PA 2X9EA 3DBDA 4AW2A 3DBQA 5IA1A 2LGCA 4KRDA 3OW3A 1B6CB 2P33A 2QCSA 5JFWA 1L8TA 2XK7A 4BHNA 1H08A 5HO6A 1PW2A 4D2WA 1JKKA 4O27B 2OH0E 5CEQA 1IAHA 4H36A 3NZ0A 4NKSA 4CZUA 3FV8A 3OT8A 4C4EA 3LFSA 4XX9A 5KKRC 3Q6UA 3I5NA 4YJQA 5CSHA 4NJDA 3PTGA 3QZIA 4I22A 3P5JC 4RBLA 3VBTA 3DAKA 3RPOA 5ANIA 1YQJA 4PP7A 2Z8CA 3FMKA 2OIDA 2BAQA 4E93A 5KCVA 3R7EA 4NK9A 2WTKC 2XKEA 2BCJA 2EWAA 3CD3A 4QMUA 4QPSA 4FV1A 4X6RA 4YZNA 4F9WA 5LMKA 3F5XA 4I6QA 4FIFA 4X3FC 5JMSA 4Y5HA 3O71A 3V8TA 2VTQA 3OXZA 4FKRA 4BDKA 3QC9A 3KXXA 3DZOA 4F6SA 3HVCA 1APME 3FL4A 3GENA 4DEIA 2ITZA 4BCFA 4O7LA 2ETRA 2OZOA 3HL7A 4JVGA 1H1QA 2XKCA 4PF4A 4QP6A 2VGOA 4KIOA 4A9RA 2VTPA 2ZAZA 1OL2A 4MX9A 3R71A 4NM5A 3KMMA 5HI2A 3LE6A 4XNEA 5BUJA 5HX6A 2QOOA 3EQHA 4DEEA 2BHHA 4G6LA 1OUKA 2J50A 4YJTA 3BBTB 4KNBA 3OD6X 4XHKB 1Z5MA 5CAOA 5BVNA 3R9NA 3RPSA 4BDDA 1UNLA 2ETMA 4I5PA 2JDSA 3IO7A 2GTNA 5F4NA 3W0OA 5I5ZA 1MRVA 1QPEA 1YXSA 5LVOA 1P4FA 3RHKA 5A4QA 4FGRA 3Q04A 3FPQA 2QR8A 3P23A 4FTTA 4BBMA 3F82A 1XBCA 4N0SA 2BDWA 3E63A 4W4YA 4DH7A 3WF9A 2JIUA 2I0HA 4U5JA 4ZSLA 4F63A 2I6LA 4WNKA 2PMIA 4FKQA 5CXHA 4C8BA 4XYFA 3SXFA 4V05A 3FUPA 5E1EA 2I40A 3MDYA 2PUUA 3ULIA 2E9UA 4BWPA 5KMKA 3ZC5A 3A7JA 3D7TB 3W0PA 3CR0A 3PJ8A 1YW2A 4FV5A 3G5DA 4JR3A 4ZTSA 4EHGA 2QHMA 4BZOA 3FQEA 4FKVA 1REKA 4QMWA 1OPLA 4QO9A 5CANA 4N57A 4ITJA 3VONA 4RLKA 4CMUA 4YJVA 3CKWA 2UV2A 2CLQA 2IZTA 4E73A 3MY1A 2O5KA 2ITYA 3FWQA 4DBXA 2VO3A 3AGLA 2BVAA 2IO6A 3KCFA 3VUHA 3E92A 4FVPA 4PY1A 2BFXA 3G15A 2XA4A 3MA3A 4EZ3A 3BI6A 3K2LA 4M12A 4M66A 3SXSA 4AQKA 2VN9A 4JXFA 4E26A 4EOPA 2PMNX 2EUFB 4F9YA 2O8YA 3W2OA 2ZV8A 5E8WA 4F08A 5IQHA 4HNIA 3QFVA 1KE7A 3C4WA 4HPTE 4AFEA 3ACJA 5DBXA 2ETKA 4G34A 5JN2A 5HCYA 2VTIA 3PPJA 2RFNA 5C27A 4DHJA 1Z57A 1XKKA 3W32A 4DGMA 3QZHA 1GJOA 2XZSA 1OPKA 3U51A 3AD4A 4DGGA 5CSVA 5HG8A 4CFNA 4Z16A 4DG0E 4HZRA 3FXZA 2CKEA 1YDTE 4MBJA 4XG4A 4RFMA 4ZJJA 2ITQA 4A9SA 4C02A 4C4HA 3MY5A 3TKUA 4O0VA 4YJOA 4ERKA 4PPCA 3PFYA 4TWOA 3RBWA 5D1JA 3H0ZA 1H26A 4IW0A 4DFLA 2QLQA 3PUFC 3GBZA 4H3PA 5FUTA 4IB1A 2I0YA 5CU2A 2R3GA 3MFTA 4D5HA 3FHIA 2RIOA 4R77A 3ODZX 3QD4A 5AM6A 4IDTA 5IQBA 5LWNA 3V6RA 3RAKA 3VC4A 2VU3A 1GOLA 3DKOA 2G1TA 2R64A 3TNIA 3PWDA 3KL8A 3R28A 4U42A 2PVYA 3KN6A 3EOCA 3DB8A 4Q9ZA 5ANKA 3NW7A 5CAUA 3FJQE 3OS3A 5DT0A 4FEUA 4L8MA 1CTPE 5TO8A 4S34A 2G2HA 4A7CA 2QD9A 2VO6A 3W0MA 4DDGA 3GCUA 4PP9A 5JRQA 2X7GA 3LCTA 2UW3A 3KK8A 3PPKA 4FV9A 3SXRA 3ZU7A 4F4PA 4K77A 4QQJA 4I21A 4FTAA 5DG5A 4EH7A 3PA4A 4BCNA 5KBQA 2CPKE 4TYGA 4WUNA 3RINA 4BIBA 2OLCA 2XBJA 4DFUA 1GIHA 2BMCA 2C3KA 1E1XA 1JKLA 2E9VA 3LFNA 4AXEA 3BGZA 5A4TA 3D7TA 4IANA 4U3ZA 5FEQA 2IJMA 4UY9A 2GNLA 2XCKA 4FT7A 2I7QA 4KKHA 4E6AA 5M51A 2CGVA 2C1AA 2JGZA 2C3JA 4FYNA 4OBPA 2XAMA 3F7WA 4IJ9A 1AQ1A 3M1SA 4D1ZA 1XMMA 5IQAA 4N6YA 4ALVA 4CMTA 3GC9A 3I79A 1S9JA 2GS6A 3DFAA 4O0SA 3C0GA 3E8EA 3EN6A 2C68A 1LP4A 5DGZA 1F0QA 1JQHA 3OROA 3EH9A 3EFWA 3OXTA 3MW1A 4WIHA 3ZZEA 3VVHA 4WG5A 3LFAA 3UPXA 2IEWA 3PA5A 4CRLA 3PRIA 2WB8A 1KV2A 3W8QA 2ZOQA 3WIGA 3NLBA 3LPBA 2R4BA 2B1PA 3BYVA 3LM5A 4X2FA 2XALA 3R83A 2GPHA 3UO6A 5L2QA 4GIHA 4MYGA 4IXPA 2C6EA 2VGPA 3BHHA 5AR8A 2XJ0A 3FY0A 1NT2A 5CF4A 3PJ1A 3PG1A 4MKCA 5L6OA 4X2GA 5D7VA 5IF1A 4ZMFA 2XJ2A 2CHLA 1OKWA 3OP5A 3T9IA 4BC6A 4IVCA 1UU7A 3FQHA 1JSUA 2BZIB 2GS2A 2WTDA 3OOGA 4IWPA 4O7ZA 3RK7A 5J7HA 3AT3A 3VBQA 4TYEA 4QQ5A 5BX0A 3DQXA 2ITXA 3QWJA 3QCQA 5H8EA 3QX2A 3Q2JA 3IW8A 4YC3A 5BNJA 5BPYA 1UNGA 5CVHA 5JGAA 3W0NA 5CF6A 3TZ7A 3VQUA 2UVZA 3P86A 4M7IA 3O7LB 5JT2A 4I5CA 2Y8OA 2IF8A 4U3YA 1A06A 1TQMA 3ORTA 1O6KA 4HW7A 1G8AA 2PVHA 4CCBA 2GTMA 2W17A 3FKNA 4JX3A 2E9PA 4IVDA 4RFZA 1VZOA 2WMWA 4RG0A 5LMBA 3DK3A 5M06A 1YWVA 3NSZA 4KD1A 2ZM3A 2CGWA 1PRYA 2VTJA 3MB6A 4K2RA 5AM7A 4RLLA 4ANOA 5F94A 5L2WA 2P2IA 4EUUA 5A6OA 4N4SA 2J9MA 3MB7A 4FTUA 4OBOA 3W10A 3KXGA 2W4OA 3FZ1A 3G6GA 4JDHA 5FEEA 5C26A 5AAFA 5JZJA 1O9UA 3NVKI 4E6QA 3ZDUA 3ZBFA 3DKFA 4QMQA 1U46A 3Q4UA 1PXMA 4AOJA 2ERKA 3O51A 3V5QA 4ENYA 4M67A 5L2SA 3DGKA 1GAGA 3QA8A 4NIFB 4WSQA 4D4RA 3HP5A 5D12A 3UO4A 5K9IA 2OBJA 2WTCA 3PWYA 5I9XA 4AA4A 2CLXA 2UZUE 3TNWA 4BCKA 2X8IA 4ZSGA 2JBPA 4A9UA 4KKGA 2R2PA 3I6UA 1PYXA 3UBDA 1WBPA 3KKVA 4YSJA 3RAHA 2OH4A 4G17A 2DUVA 1G8KA 2BDJA 2YM3A 3GCVA 2XK8A 2BROA 2WELA 4W9WA 3SQQA 2WGJA 4I0RA 4MXAA 1FPUA 3AMAA 2R7IA 4BCIA 2NRUA 4RVTA 1H0WA 3R9DA 4EWQA 5E8TA 1XH7A 4P7EA 2HXQA 3IONA 4M84A 4J8MA 3W55A 4R78A 3VJOA 5HCZA 3B8QA 4UN0C 4ZTQA 4HGEA 1P5EA 3W2PA 4F9AA 2BRGA 4QMNA 3EB0A 5HO8A 1YXVA 4FC0A 1YDSE 3NNWA 1EH4A 3O0GA 4BI0A 4BY9E 3O8UA 1MRYA 3QTQA 3DBCA 4ANLA 1R1WA 2XK6A 2WQBA 3UOJA 2VZ6A 5EM7A 1JSVA 2JKOA 1IA9A 4IE9A 3LZBA 1ND4A 5BYZA 2G15A 4ZY4A 3DXNA 4ANNA 2CNVA 1T46A 3A61A 4RVMA 2BRBA 1S9IA 1R0PA 2AUHA 2XIZA 4J96A 4FT5A 5AV3A 3UNKA 4NT4A 4ENXA 3C4ZA 5DT3A 4Z3VA 2R3FA 3OWLA 3PY0A 4TZRA 5IPJA 2WQOA 4AE6A 2HYYA 4DHIB 3BQRA 4IADA 2GS7A 3MJ2A 1KE8A 3RZFA 3O5AA 5LARA 1HCKA 4FOCA 2I1MA 2CDZA 3LFBA 4FKUA 3CKXA 4DHZA 3VO3A 2O2UA 1BUHA 2NP8A 2R9SA 3EKNA 3P79A 2GFCA 5CI6A 3V8WA 3ZRMA 5HNIX 2CNUA 1JWHA 1WFCA 5I9VA 4GRBA 4KINA 2W4JA 2F49A 4OTPA 4YPDA 2WEIA 5TR6A 4S2ZA 5FP5A 4ZZMA 4MXYA 4PQNA 4RMZA 5FM2A 4YBJA 3H0YA 2FB8A 2W5HA 2C6MA 3VBVA 4BWXA 5KMLA 3ZH8A 4R3RA 2Q83A 3TV6A 1OITA 5DEWA 4C7TA 4L7SA 4JRVA 4GFOA 4F7NA 3DXQA 1J3HA 4PDOA 3HMMA 2PZ5A 2Y4PA 2X0QA 5CAVA 4EH8A 5DOSA 5AR2A 3D5UA 1GIJA 5HTBA 1GIIA 2WMUA 1ZOHA 4PL3A 4CFUA 5B7VA 2C5YA 3BEAA 2Y7JA 3HGKA 4F7JA 4ACGA 4MTAA 1OKYA 4YTIA 2R3LA 2SRCA 3AG9A 4EH3A 2J51A 4NIFA 3DPKA 2XNOA 4O0XA 3AMBA 5HBEA 5L3AA 1ZAOA 4OAUC 1O6LA 1TVOA 2AC5A 1UU3A 4AW1A 2ACXA 4NCTA 4D0WA 1M7QA 4EH9A 2J5FA 3MWUA 2IVUA 4K33A 1U5QA 5DA3A 3R9OA 3EQIA 2OIBA 2OZAB 3UZRA 4FEVA 2PU8A 2Y4IB 3E7OA 5ITAA 5H8GA 2XIKA 1CDKA 1WBNA 2Z02A 3C13A 4A06A 3FLZA 4ZSEA 3TIZA 4R7HA 5JKGA 4WNPA 3QUDA 3QRIA 1V0BA 2WEVA 4GS6A 1IASA 3TIYA 4JOAA 3R6XA 3BEGA 5FD2A 4JQ8A 4LV7A 3QXPA 3KY2A 5EK7A 1DI9A 3R2BA 4XBRA 5CEOA 1IRKA 3SW7A 5HVYA 3QCSA 4DLIA 4C58A 4F7LA 1Q8YA 2F2UA 5GNKA 3AGMA 4M0YA 3UMWA 3VW6A 1F5QA 4CSVA 3OXIA 3QD0A 4WOVA 3ZO3A 3KXNA 4L52A 3OCBA 2OJIA 4K9YA 3ZO4A 2YWPA 5AP5A 4CGAA 3F61A 3R73A 4BDHA 3MI9A 4QOXA 4LRJA 5T6KA 3UNZA 2IW8A 3N4UA 4BJJA 4TNBA 2EXEA 2ZB0A 4AGDA 3R7IA 4IVBA 4R5SA 3DLSA 1NY3A 4E7WA 3TDVA 3FEGA 3EQCA 3C50A 3DAJA 3NW6A 4G2FA 4XG3A 5GJGA 4HVGA 3VF8A 2VAGA 2GHGA 2OJGA 4PNKA 4YZCA 4FUYA 4IC7A 1Y57A 3CC6A 3HA6A 4YP8A 3P1AA 5HTCA 4AZWA 1BLXA 3OVVA 1YHVA 1K3AA 5AP6A 3C5IA 4WBBB 4PDPA 3QALE 4FICA 2WQNA 4GCJA 4WBOA 1BI8A 2J0JA 3MFUA 3UIBA 1G8SA 3FMNA 4RIWB 5KMMA 2PVKA 4L3PA 4BGGA 2PPQA 3I81A 4ZEGA 2C5VA 3EMGA 4GSBA 1PKGA 2QG5A 1TQIA 5DT4A 4AU8A 1JVPP 2C6LA 3C7QA 5CEMA 2PULA 2X0GA 3VS1A 3BCEA 4EC8A 2BHEA 4A4LA 3FY2A 4AZTA 3U4WA 4D55A 4YO4A 4EI4A 2OW3A 4FMQA 3VUGA 5BYLA 1JKSA 3OMVA 5L6WL 3LXKA 3CSVA 2E9NA 2JDRA 3CQEA 2WOUA 4MF0A 2BKKA 3H4JA 4E3CA 3OOMA 5M56A 3LFFA 2BIYA 1BL6A 5FBNC 4GT5A 3TV4A 5J8IA 3ALNA 4IIRA 3HUCA 3KMWA 4CFMA 4L42A 2CKOA 3PZEA 3R7UA 4BI1A 1XH9A 1WMKA 4B7TA 5CEIA 3PLSA 3BWFA 5LVPA 3Q96A 1Y91A 2OZAA 2UW5A 2YJRA 5AUWA 5CNOA 3LHJA 4IZ7A 4TL0A 4MQ2A 4FF8A 4IX5A 2KULA 2IZSA 2QU6A 3MH2A 3NW5A 3R9RA 4FUXA 4K18A 1YVJA 4QP7A 3OTUA 4PTGA 4BBEA 4YJSA 4DBNA 2IVSA 4QP8A 5JFVA 4XJ0A 5J1WA 4Z55A 1CMKE 2XCHA 1PMEA 4GYGA 5E92A 4C57A 1W7HA 4GV1A 3UIUA 5AV4A 4FIEA 4CLJA 5FTOA 4JIAA 2UZLA 3ULZA 5HZNA 4I93A 3NUNA 4FV0A 2GSFA 2JDTA 2I0EA 3CCNA 3FAAA 2C3IB 2J2IB 3BYSA 2XANA 4WNOA 1CKIA 2GMXA 4QDVA 1M17A 1FVRA 3VRZA 3QUPA 5HIEA 3DA6A 4TYHB 4JIKA 4DA5A 2YCFA 2BRHA 3CIKA 2JKKA 2QQ7A 3R21A 3KK9A 1VR2A 2WTIA 2B0QA 2AQXA 3R7YA 3DAEA 4FGBA 3ZSHA 4F0FA 2BRMA 4XCUA 4FJVA 3GC8A 5CNNA 2OFUA 5E1SA 3HA8A 4YTFA 3CQUA 3S3IA 2O3PA 5C01A 3FMDA 1YHWA 3PIZA 2W1DA 2QO2A 4RJ7A 4YHTA 2W4KA 5CF5A 4Q5HA 4A07A 3TMOA 2BZJA 2VO0A 1FGIA 2ONLA 2WMTA 3ETAA 5HNBA 1ZARA 2WXVA 3ZFMA 3S2PA 3PVGA 4JS8A 3U6JA 4FTMA 3F6XA 2QOKA 3D7ZA 4RVKA 4R7IA 4EYJA 4BHZA 3A4OX 4E4NA 1OKZA 3UJGA 5CU6A 2IW9A 3TACA 4QT1A 4QTAA 4FSRA 4RA5A 2G9XA 1LUFA 2YZAA 3IGOA 3SC1A 5KBRA 2YIQA 4F1MA 4B8LA 2B9HA 4JDIA 4BTFA 4BZDA 3PJ2A 1DI8A 4QMXA 2UZTA 1OBDA 5FLFA 4CZYB 4CFXA 2CGUA 2HW6A 3TKHA 1GZNA 2WMQA 2F4JA