3IUBA

Crystal structure of pantothenate synthetase from mycobacterium tuberculosis in complex with 5-methoxy-n-(5-methylpyridin-2-ylsulfonyl)-1h-indole-2-carboxamide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
286
structure length
286
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 96
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iubA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iubA01
2CYAA 1H3NA 3ZXIA 4DDMA 4MW0A 5FNZA 1JIIA 1KAQA 4EG6A 1O95C 3BL5A 2V0GA 1N77A 3SZGA 5JBNA 2H29A 1IQUA 5DB4A 2WSIA 2D5BA 1I6MA 1K4KA 3A05A 4MUFA 2C5SA 4R2MA 2QUJA 4I6JA 4OJMX 2RD2A 2CSXA 1GLNA 4BWVA 4JXXA 3N05A 4YP7A 4KR9A 1WQ3A 3SEQA 2Z09A 5EKDA 3AIIA 3IVCA 3H99A 3A2KA 1K4MA 1KQPA 2IJGX 4AQ7A 4MUIA 2DERA 4MW5A 4KPUB 2Z3VA 4MW1A 4UZEA 4YMIA 4F3RA 4KKVA 2YXNA 1WY5A 1KP2A 3RBAA 1MRZA 1U7XA 1YIAA 2A4MA 1MAUA 1JEEA 3LOQA 2QJOA 2ZP1A 3OP1A 4XFJA 1GN8A 2A1UB 3CVXA 3E27A 1RQGA 1N2EA 1PFUA 3H05A 2R5WA 1XNGA 1G8GA 1J1ZA 3H97A 1OBCA 2DEUA 3ZJTA 3COZA 3ZIUA 4MQ6A 1OWMA 3CLTD 1KKUA 3S3TA 4R2LA 3HL4A 2CV2A 1VLHA 1EXDA 4MWCA 2DLCX 4JXZA 3KFLA 3MLAA 1OBHA 4DLPA 2JA2A 4ZT4A 5LM3A 1T9GR 1TYAE 3SP1A 1NUQA 1N3LA 1N78A 3ZXSA 4DNXA 1MJHA 3OTWA 2B7LA 2YY5A 3P0HA 5IHXA 1YUMA 4NDAA 3IMEA 4UZFA 1QU2A 4PBRA 4KR7A 4ARCA 4YP6A 1EFPB 1EFVA 1M8KA 2G36A 5F23A 2GKSA 3CLTC 1D2RA 4MW7A 2X0KA 4TS1A 1LI7A 4EGAA 1JMVA 2VTBB 1WXFA 3CVYA 2A88A 3M5WA 4MWDA 3TQOA 2J4DA 4NX2A 4L2IB 1IQ0A 1B6TA 3PRHA 4ZCSA 3N9IA 3KT0A 1U0BB 1EUYA 2CT8A 5DK4A 3CA8A 4MUGA 5H7XA 1FYDA 4DDHA 1G8HA 3ZJVA 1WXHA 3IMGA 2DETA 2A7XA 1F4LA 3CVUA 2AKEA 2D54A 2QJTA 4AS1A 4ND6A 1ULHA 1M83A 3NBAA 3COVA 4DE5A 3G5AA 3IOEA 1S4MA 4U63A 3TNJA 4ZT6A 1QJCA 4I6GA 1O96A 5DEOA 4FZJA 3IH5A 1ZJWA 2J09A 1O95D 3COYA 1JZQA 3G6KA 3CLUD 1NZJA 2QTNA 1H3EA 4NAHA 1QRTA 3IUBA 1J09A 2HMAA 1TYBE 4MUJA 5J58A 1JIKA 3NV7A 1NSYA 3CVWA 1NI5A 1XNJA 1OD6A 2RE8A 4MW9A 2HGZA 3FG9A 4MUNA 4KPUA 4WSOA 3CLSD 4EFKA 1J21A 3FNRA 3KT8A 2E0IA 1TYCA 4MW4A 3X1KA 1EJ2A 2X1MA 2CFOA 3SZ3A 1R6UA 1X8XA 3CLUC 3QTBA 1VBNA 1T9GS 3QE4A 3A4IA 3TQIA 3D6VA 1JGTA 1TYDE 3IDFA 3N8HA 3GLVA 4X0EA 5HUHA 2VXOA 3P0JA 3LCJA 2OQ2A 3CLSC 1P7PA 3QTTA 4ZT5A 1U7DA 2AG6A 3MLBA 4ZCRA 1H3FA 2HZ7A 3L92A 3NBKA 4NZPA 1KH3A 5KHAA 4Q93A 1LI5A 1WQ4A 2A1TS 1SURA 3AL0C 1F9AA 3FI0A 4WNYA 1M1ZA 1EFPA 1MAWA 3JXEA 5TS2A 3ND7A 1O97D 4EF6A 1R6TA 1V47A 3MMXA 3ELBA 3G59A 4U7JA 3COWA 2YWBA 1Y42X 3SDBA 4K0RA 2PZAA 1GTSA 3UK2A 3UC5A 4QBTA 1NUUA 5K0SA 1XNHA 2JANA 1J1UA 3AG6A 3TZLA 2IP1A 3DLAA 4EG3A 2ZUEA 2IELA 4MAFA 4MVYA 2XRZA 4G5YA 4I6EA 1GZUA 1PG0A 2A86A 4E1AA 1O97C 1O0CA 3SYTA 1NUTA 2DPLA 4MVXA 1N2JA 3H9BA 4P2BA 3CVVA 1QQTA 4PBSA 4OUDA 3N2YA 4QREA 1HYBA 1ZH6A 2O5RA 4Q16A 1YIDA 1F7UA 2J08A 3KT6A 3FH0A 3FDXA 1OWNA 1PFVA 3PNYA 2E18A 3I05A 3MUEA 1NUSA 1WOYA 1WXIA 4EG1A 4CQNA 2PFSA 3FY4A 4ZCTA 2JAXA 4HJRA 2WB2A 3PXUA 3FIUA 1LW7A 1YUNA 3VGJA 1MC1A 2PIDA 3CLRC 3RK1A 1ZH0A 2XRYA 2ZUFA 3IOCA 4GRIA 1JZSA 1NYLA 2PZ8A 1JEDA 1I6KA 3D6UA 1QTQA 4PBTA 1KQNA 1WXEA 1EE1A 2V0CA 1TEZA 3IVGA 1QRSA 2EL7A 4H3SA 4GU5A 3U1VA 1MB9A 2PXHA 5LFAA 4ZT7A 3P0IA 2YWCA 1A8HA 2D13A 1OWOA 1N2BA 4RPIA 4HJXA 4YBRA 1IFXA 1KR2A 1M8FA 3PNVA 3MXTA 4F4HA 3KT3A 1ILEA 2DR2A 4MUEA 1J20A 3DPIA 1WKBA 5FO1A 4ZCQA 4ZT2A 1N2HA 1YULA 4HPWA 1JECA 3UY4A 3P52A 4JYZA 1YI8A 4RUKA 5LLTA 2DXIA 1VBMA 1IRXA 1EFVB 4EG4A 1N2IA 1KORA 1U3DA 3IUEA 1VL2A 2O8VA 3FHJA 3C8ZA 3ILVA 1PFYA 1Q15A 3HV0A 4U8HA 2WQ6A 2A1UA 4MW2A 3TZEA 1QNFA 4XFDA 3DO8A 1OWLA 1N1DA 1CT9A 2DUMA 4A91A 5J59A 4MVWA 1KH2A 3Q4GA 1IVSA 4J75A 3Q12A 1KP3A 4J76A 1NUPA 1O6BA 1IHOA 3ZGZA 1X6VA 2BYTA 4MULA 4DDKA 3FWKA 1XJQA 1ZUNA 4ZCPA 3UOWA 4ZT3A 1T6ZA 1G59A 4XSVA 4EG7A 1F7VA 4NAUA 2QTMA 2X1LA 5HG0A 1O0BA 2TS1A 1GPMA 2EJCA 1OWPA 5K0TA 1O96B 2OV4A 3FETA 2CV0A 4R0NA 4QRDA 2VTBA 4G5FA 3HMQA 3ZUGA 4MUKA 3GMIA 3X1MA 4L2IA 1BS2A 3IOBA 3HGMA 5IJXA 3RHSA 3K32A 4MWEA 1UFVA 2E89A 1O5TA 4G6ZA 1QRUA 4S1OA 1JHDA 1Q19A 3ISJA 3FOCA 3CR8A 3UMVA 2QJFA 1JIJA 4MVCA 1NP7A 1T6XA 1R6XA 3PNBA 2J07A 4YP5A 1PFWA 2QUHA 3L93A 1EUQA 3CLRD 4MLPA 3ND6A 1K92A 1WJGA 2X3FA 2QTRA 2CV1A 4K03A 1Q77A 2BTEA 3DV2A 3INNA 1U3CA 5FO0A 5J5AA 1K97A 2QUIA 3RJZA 3IMCA 2AZXA 3H9CA 1VBKA 1DNPA 5TGTA 5AHWA 5TEVA 4CDNA 3X1JA 1FFYA 3ZJUA 1T6YA 1N75A 1M8GA 3F3MA 4PY2A 4CDMA 1V8FA 3AKZA 1QU3A 2CUZA 2NSYA 3AG5A 2QUKA 3AFHA 1Q11A 4JFAA 5DASA 3RFFA 1M8PA 4EG5A 1MBZA 1N2GA 1MOPA 1MB2A 3IODA 2H2AA 3A04A 2I1LA 3HFJA 2A1TR 3Q10A 5BNZA 2GOYA 4MWBA 3VU8A 5KCMA 1KQOA 4ND7A 1O94D 1COZA 3IVXA 4ARIA 1IQRA 3TS1A 1GTRA 4CT0A 5TEWA 1J70A 1TQ8A 2PG3A 4JZYA 1JILA 1WXGA 4HK4A 1NURA 3RK0A 3VRHA 2J5BA 4KR6A 2CYBA 2PZBA 4OUDB 5HUJA 1IH8A 2CYCA 3K9WA 1H1TA 3GUZA 3SEZA 5H16A 1I2DA 1O94C 3ND5A 1GAXA 1I6LA 4NATA 2Z08A 1WZ2A 1M8JA 1N2OA 3LE8A 4MUHA 4MW6A 4EG8A 5KWVA 2NZ2A 2E21A 3HZRA 1G8FA 1KH1A 4DJAA 1TFUA 1PG2A 2A84A 2GM3A 2WQ7A 1KAMA
chains in the Genus database with same CATH superfamily
5JCOC 5EXDA 4EEKA 4GMGA 5B57C 4NL4H 4G3XA 5FAXA 1SKYB 1G4HA 1YA8A 1KNQA 4E21A 1XMSA 2P7IA 2Z0MA 4YRSA 3NT5A 4ZC8A 1ADGA 3QE9Y 1JB1A 3PICA 2JIPA 3SS8A 2J3LA 2XIJA 3WO0A 2J4CA 5FA6A 4QUIA 4LDNA 4JI5B 1NF9A 3BS4A 5KYGA 1TECE 5A4MS 1E2KA 1G5QA 1YB5A 5LP6C 1N8KA 4G1UC 4DL9A 2EKPA 4XTRA 4F2WA 2JEZA 1K86A 2YRWA 8ADHA 4N1AA 5TJ9A 2HF8A 5JXIA 2HL6A 2PYZA 5K0FA 3V8EA 1YDGA 1R5BA 4OOFA 1N92A 2CLIB 2JFHA 3FWPA 4PHTA 5AVYA 4KI0A 3IJ5A 2YVKA 5LLSA 2YHAA 3OQIB 3FSJX 1QYCA 4B2IA 1O0SA 4NONA 3UJ8A 3BHJA 5D6NA 1PJAA 1TRKA 1U6IA 1KIFA 3L1KA 5CT4A 5L3ZA 5T4EA 2PKQO 1R6DA 5KSWB 4OX9B 4CIVA 3I6MA 3GQVA 4J0EA 3TX6A 4P7GA 4QPPA 4MW5A 4W5HA 1LPBB 2HV9A 3DNMA 4ZYLA 1WS6A 4MW1A 2P8JA 2BMAA 4NENB 2AFHA 3KQTA 3KOUA 5CDGA 2H7XA 5JPCA 3ZHXA 4BWFB 4TLBA 2F8MA 4JC0A 1TD9A 5CA0A 4O2LA 2PXCA 2FMKA 2G82A 3WYNA 4AROA 2XITA 5HR5A 2Y2VA 1MQAA 2O3QA 3CGWA 3I0ZA 1USIA 3MD0A 4WOCA 1KDYA 4OQFA 5K4HA 2I2BA 3KQMA 4MV5A 1KMIY 3O6VA 4A36A 1A9XA 2C57A 3BGOS 2BGLA 3BORA 5FUVA 5AVRA 3ZDZB 1TU4A 2FQQA 3F46A 3HL4A 3O1JC 1VLHA 4Q7KA 4RACA 2IHTA 2XYVA 3X1DA 1KZ6A 1TW2A 2M1ZA 2RDMA 2O54A 3HBNA 4UCWA 5JHGB 4PRKA 1EX1A 4US1R 3GP5A 3ASYA 4K6KA 3GAMA 2LRHA 3NUGA 4D9HA 3ZXSA 4CYMA 3TG8A 1ISFA 5FLXA 1VIVA 5HF9A 1ZUNB 5A3VA 2JHGA 3TEMA 4I5GA 5TF4A 2PKWA 3T0GA 4W1RA 3RYCB 3QF4A 2C00A 3ONVA 2WM3A 1ESNA 3R7WA 3EQ8A 1SR8A 3OD1A 1D2MA 5DHTA 4EKYA 1TM3E 4OHYA 1ZCBA 1XVTA 4ED9A 5ENVA 4P84A 1KI2A 2Y99A 1RP1A 3O2SB 3OJLA 4LMRA 4BEJA 2CD9A 1K75A 2FDCA 5KYTA 1WXFA 4BV8A 1SBCA 5LYJB 5LDDC 3PC7A 4ZQIA 3WMEA 1SQ0A 1E1MA 2QTZA 3UAVA 3UJPA 1RAEA 4C08A 3HVRA 4L2IB 1B6TA 1T8TA 1ID1A 2XZPA 8ABPA 1K98A 4QM7A 1C81A 1B41A 3H83A 1IG0A 4KGDA 1Y3BE 4MAMA 4YCDA 2PVPA 3FCUB 1BE1A 1DIAA 3BHMA 3GVPA 1JDBC 2AN1A 4M0FA 3C7KA 4EF5A 4RKRA 2R6AA 3GL9A 1LNQA 5SY4A 4KXLA 5TDHA 3TM5A 1W6UA 2VBFA 5M2QA 3KO8A 1GZ5A 1X1QA 3TRIA 2JZOA 2QSYA 4K6MA 3NBAA 4REOA 5LJLA 3COVA 1UMDA 1E9CA 1K68A 2I4LA 3RVJA 4OLFA 4B8WA 1MAAA 4M99A 2A9FA 3TOZA 1SIWA 4Y1FA 4CKCB 1KO8A 4YJ3B 1WL8A 3E5HA 2IIBA 1U2PA 3DC7A 1YS9A 2CVZA 1P91A 3JQDA 3Q9LA 4FGZA 2VP2A 1PVVA 3N2IA 4DAEA 3WLQA 5HXAA 4HRYA 1BHO1 1SQGA 1WUTA 1G3QA 3CLUD 3K2BA 1GKUB 2Q2OA 1H3EA 2FETA 1QRTA 4Y2PA 1CLEA 1XQ9A 4Y6LA 1SOMA 1II8A 2XNCA 4GKVA 4ZJPA 4M55A 4X60A 2WWXA 3WJ1A 4WBNA 4IJQA 5EKUA 3HCEA 3CLSD 4ZVMA 4F3CA 4EFKA 2A4KA 2AQHA 2DKFA 1Q1GA 3DV9A 1L3IA 3Q2OA 4GR9A 2Q9BA 3LP8A 1DFHA 1JA9A 2CFOA 2OP1A 3P9QA 1OJ7A 4X6XA 4J3NA 2QDKA 2IH4A 4R0MA 1P5ZB 1O89A 4OL0A 1F60A 1MQ8B 4Q4LA 5LQSA 5BR4A 1BGXT 3I39X 3EIHA 4HNHA 1T9KA 4UHDA 1SRRA 4HXYA 4RV4A 5AT1A 1H0RA 2WYWA 2H3HA 2O50A 2OO5C 2OZKA 2Z8YM 3FHCB 3THWA 4L02A 4F2GA 3GLVA 5F1KA 1FSPA 3RR2A 3ZXUB 3AETB 3WLJA 1L7RA 3FJOA 2ZSAA 3FF4A 1E0DA 4E5MA 2BWJA 3QU5A 2NLOA 1A82A 4FCCA 4X63A 4RK0A 5CA0F 5M5BA 3H75A 2C3YA 3VHQA 3MLBA 4AT1A 1QO9A 3ABZA 1ADBA 4PCVA 3N0XA 4JGGA 3AQIA 3MB5A 1M0SA 4HB0A 1D6MA 1Y1PA 3I72A 4ZEVA 3QQ5A 2NW6A 5IANA 3DL0A 2VP3A 3H8SA 1XZHA 2PX0A 2YHIB 3I61A 2H7YA 3RRNA 2EX4A 3C4VA 2B37A 2Y68A 4HDNB 2PNJA 1M1ZA 4NBTA 4AJNA 1VL5A 5SV2A 5LKAA 1EVEA 1CSEE 2QL7A 2RGUA 3GOHA 2L19A 1UM9A 3ZVRA 4Z9FA 3L0SA 1D7OA 4P4LA 1RR6A 3UKJA 2BM0A 3U7IA 4TVOA 1HE1C 2X2OA 2DUWA 4K9NA 4ICIA 5KDDA 3AG6A 5GV7A 1UWLA 3DFKA 5U4XA 3RAPR 3DLAA 4DDTA 4HDSA 4PYMA 3ORRA 1LVUA 9GPBA 2ECQA 4DLUA 3GBPA 2AXQA 4JBXA 4RY2A 3DP9A 1NSFA 3JYOA 2ZVQX 3EFOB 5DM4A 2YZGA 9ABPA 2NAFA 3IXLA 5EE0A 2YTZA 4LKOA 4YGYA 3WFZA 4F3NA 3H9GA 4WEQA 4ARVA 5KYNA 2D5LA 1I4DD 1YE3A 2CKDA 1PWXA 1W2HA 3C87A 2NSDA 3DTYA 4JK3A 3LA8A 5LP6B 3L8GA 4E03A 2VXBA 2DTDA 2WSYB 1Z6YA 4RDHA 4YRTA 3EXEB 3KR2A 1EK5A 2HSEA 1MO6A 2Q0QA 3LUHA 3RVNA 4FCVA 2YZ2A 2QRLA 5E9QA 4MQ4A 1GGJA 5DBFA 3KQHA 3KUUA 2N47A 3DE1X 3OUTA 3Q3JB 1SCJA 5LWHA 3T1TA 2PUBA 2N1BA 3K4QA 1BDMA 2XMGA 1PS9A 1VMAA 2C9DA 2E18A 3GDOA 3IKLA 4M22A 4RMIA 3UPTA 2HD4A 1P8AA 2FWJA 2H54A 3OMWA 4IS2A 3S6JA 3GPCA 3IILA 3RRJA 2R86A 3T99A 5GIPE 5BVGA 1N32B 1E2JA 4HYTA 5BURA 1E20A 1B73A 4QUJA 4XKJA 5K3OA 3PUJA 4A2PA 5P21A 4B3CA 4MB6A 3LVFO 1FRFS 1T1RA 4FFBB 3NAZA 3FAKA 4HX2A 4R7GA 5EP3A 1DX4A 2WM8A 4L6IA 5AXDA 2HU5A 3TX2A 5BN5A 1T1SA 3F4LA 3PXXA 1Y5IA 1ESMA 4DLBA 4M1SA 5FADA 3QBTA 4NYMR 4FLFA 1TZ2A 2EFEB 2X6QA 4Y2HA 4XJXA 4J2HA 2FQ1A 4EFMA 1JZSA 3DLPX 4KQHA 1QQAA 2ANCA 3HXPA 3N5CA 5CYFA 3JYQA 3ZHSA 2FSGA 1U2DC 1SOUA 1NI4A 1SVLA 1QWSA 4S0XA 1Y7LA 4OK5A 2BSAA 2BFPA 2P35A 3V00A 3T3EA 3PL1A 1VKOA 1ST2A 1OLSA 3E23A 4AMVA 2XUKA 3NHSA 4H3SA 1G64A 1SCUA 2BZ1A 2BMDA 2BP7A 4BKOA 1E94E 4WBNF 5IWCA 5AJXA 4HBGA 2W93A 4DS3A 3D7NA 3GVIA 2IEGA 1EDZA 3MSCA 1A4RA 3RVBA 4HPJB 3TL6A 4B43A 1XZQA 2A9OA 2AN5A 5KJEA 4DPLA 2OORA 3EZ2A 1N2HA 2A0WA 3AESB 4E5NA 3WQRA 2JDIA 2ACKA 1CW2B 3B53X 2YVUA 5B53A 4RUKA 5GTDA 5LLTA 2B8JA 4PSDA 4JJIA 1AGPA 2OECA 2R44A 1IRXA 3IP1A 3M34A 1TF7A 3VISA 4CKEB 1N2IA 4ZQGA 2XBLA 4WZAB 2ZUDA 3KU4A 1U3DA 4HN9A 3IUEA 1RXCA 1W75A 2BMFA 5TVKA 3WK4A 3O8OA 2IV2X 1FJXA 2HJ9A 3A14A 4IF4A 4JL8A 1GZVA 3KZCA 1M3SA 2AWNA 3AUXA 4LSZA 4MRPA 3LCMA 3SKYA 3TDKA 4B71A 3GUHA 2A58A 2YFHA 2D1SA 1WEHA 2I6FA 3RHZA 2YIJA 2OGUA 3SC2B 3AEKA 2QIPA 2D7JA 3AB8A 2DY1A 4GR5A 4UTNA 3JZDA 3QELB 2BFMA 1EFTA 1FTQA 2VT2A 1E18A 5JCXA 3KYDB 1NLUA 1JDBB 4PSVA 4J75A 1KP3A 2ODQA 5E6UA 3DVSX 4JQCA 2X2FA 2GCOA 3G68A 3SOZA 1LTQA 4A8TA 4D3YA 1FC0A 1NVFA 1SU4A 4JJZA 4C5AA 4F60A 4RQTA 3CWQA 5CDFA 1XZKA 2PLFA 1A76A 3PDWA 4NJEA 3WWEA 2VKTA 2CHQA 3TW8B 2G72A 3OKAA 4FR0A 1Q1AA 2WF8A 2ZJFA 2GLUA 3PE4A 2HWKA 3MGBA 1QIEA 1XQ1A 2CD7A 4ZI7F 2IH2A 3H4IA 4BN0A 4XH9B 5DGCA 2OCGA 1EXWA 3HJBA 4YDQA 5K99A 4AXBA 1ORRA 2NVUA 3C3XA 1PJLA 2XRFA 3HJRA 2R00A 1C3EA 2EJCA 1GPMA 1V7QA 1OWPA 1NOIA 4Q4JB 2WU8A 4KGVA 3CGGA 1CUBA 5JANA 5KREA 1JN0A 2OKCA 1IUNA 2W0MA 1EFLA 1JJFA 2EEPA 2ZIXB 4YO8A 4Z0TA 2HXSA 3KYJB 3TD6A 4N5IX 2RFLA 2YIVX 1A8IA 5ERGB 4J1TC 1I0IA 2R2GA 3IOBA 3HGMA 4RA9A 3T1VA 1AKWA 3HCOA 4TKMA 2VN8A 1J8MF 1DBVO 1DWQA 1XVAA 3LLSA 4F7DA 1ZGCA 5CB4A 1YQQA 3EFBA 4MWEA 3CUEF 3EXG1 3KELA 2UVQA 4JIGA 4Q1DA 1ZUD1 2G9QA 2PMBA 1EK6A 2BC9A 1H4SA 4YWHA 2Q3CA 1Z2CA 3QBDA 5H1YA 3P2MA 2QJFA 1Z0ZA 2C3OA 4LK2A 5JI2E 2E1PA 3DD5A 1P2VA 1Z6AA 2WE8A 2QM3A 3KLPX 3L6CA 5ERYA 1D1SA 5GOTA 3V7FA 4DLXA 1RC1A 4PC3A 4PR3A 2P9TA 1H8ED 3T7KA 2R3SA 1WU8A 1ZN7A 1Z39A 4ACAA 4CVNA 4INJA 3DTVD 3O73A 3E7XA 1HK7A 2IY7A 3HLTA 3RUFA 3W05A 4FMCB 1SCAA 5THXA 3W5IA 3TLXA 3K9FC 5KJ6A 3ANYB 5E6RA 1YVEI 1XXHA 2G83A 3KQPA 5DW3A 2R6HA 5TEVA 5JS2A 4BGEA 4B76A 1N36B 1FFYA 2JCYA 1X0VA 2QN9A 4AKGA 4UFNA 1LBQA 2REQA 3FCAA 3UWMA 4CKBA 3R9XB 1C50A 4TXNA 3EZ7A 1CY1A 1WSBA 2CUZA 5BWMA 3TFWA 3AG5A 4WJKB 1KC3A 4D3XA 4LF4B 1FRZA 2ORWA 2ROQA 4JYCA 4C3ZA 1O4WA 3M81A 2PLWA 2Q3LA 2ID8A 3TW6A 2CWWA 3PV0A 1L3BA 4TWAA 4OYHA 1N6KA 2NU6A 3GFVA 4LGVA 2Z58A 1TTTA 3ETHA 3AHEA 3LK7A 1JA0A 4G4JA 4HGRA 2H00A 5EIBC 3TTWA 2E5LB 1ZA1A 3SLRA 3DEIA 3HB5X 3R76A 2BDEA 3MTEA 4BVFA 3IVXA 1J56A 1CR0A 1E58A 3VJRA 3GLIA 4XDYA 1AC5A 3VAZA 4E46A 1X92A 4XE5A 4D8WA 1UBCA 3GVXA 4OBBA 1PS8A 3PGMA 2CNBA 1BDHA 3GNSA 4MYHA 4O2AA 4P92A 3SQNA 5CBPB 3DKVA 1JILA 1PWEA 1V16B 1WXGA 2GEKA 3X3HA 2C9BA 3GLRA 1HRKA 1RWVA 5JWOA 1T5LA 4A1FA 3EVTA 1B3RA 1E5VA 1G98A 4EO9A 4KR6A 2ZE6A 2VYFA 1DWOA 1HLGA 3H17A 3SE7A 1R6AA 1IBLB 5HE9A 2PMKA 1AXGA 3JZIA 1IH8A 4A0HA 4M8SA 4REQA 2YFKA 5K20A 3P0FA 2YY6A 1XEFA 1S8AA 1XDUA 3AFIA 5EJ8A 1S89A 1WUIS 2VP5A 2ZRFA 2WFAA 3LT0A 3TXXA 3V5NA 3UYKA 2X15A 3AUFA 4NATA 3RPEA 3FZGA 4UM5A 1C9MA 3UHPA 4AKHA 2OY0A 4NBRA 5CFRA 1HZZA 3FPHA 1M8JA 2IXFA 2REXB 1P7ZA 1VSUA 1NJFA 4WXHA 1GXSB 4D99A 3I73A 2QRQA 2WD9A 3KSZO 1Y9AA 4FNGA 2C2MA 1W1UA 2I33A 5JNUA 4C2TA 1SEPA 2QR2A 1BCRA 2BZ0A 3KC2A 2RONA 3KJNA 5JU6A 1TFUA 4OJTA 4NV3A 4QKQA 2BZGA 1KAMA 1T8SA 2NO9A 3KUKA 3N5KA 1RADA 1L5RA 4FBLA 2QP4A 1Z0JA 4I9HA 1XZGA 1OASA 3DEJA 3DAYA 4I4TF 5JJIA 2O4UX 1WD7A 2ZE8A 2PTGA 1UDBA 1T34A 1O6ZA 3DHWC 1R8SA 4ZICA 4XD2A 1X7ZA 1JZTA 2A0FA 1OLXA 3GJZA 4FDUA 3B3AA 4X44A 3GZNA 1Z45A 1DQYA 4TYWA 4A10A 2J0QA 1H6BA 2DY0A 2NNLD 1L8QA 1DCMA 4P38A 3U7FB 3GLGB 1WNTA 4I50B 4N8SA 4FJ0A 4NEQA 4AWXA 1NDUA 5E6SA 4XASA 3U19A 1H5QA 1XALA 1GNRA 1C4KA 4ZVLA 4IP0A 4H1VA 3N05A 5DXJA 4OHKA 1DBRA 2P9JA 2YWXA 3TEJA 2WLSA 3CPEA 4D80A 3HB0A 3N3BC 3R3UA 4URFA 1WQ3A 2Z09A 1A2OA 2X3YA 5CHYA 3IVCA 1YJXA 2GZAA 1M2GA 3CF6R 1TLFA 1FFGA 1FTNA 2VF5X 3FPJA 3R0IA 5L53A 2C5BA 3VMMA 3U7EB 3NWJA 4KPUB 1G8JA 4RPHA 4ZQHA 3MQ2A 3JTEA 2YXNA 1AZTA 1MIOB 2XWPA 4HADA 5BRAA 1ZSNA 3P4UA 1MAUA 3ZY4A 4AG3A 2YOHA 4U7DA 1VJRA 2GESA 3O92A 2GBIA 4ZTUB 3E3MA 3UHFA 4GPBA 2DPGA 1PZGA 3K0EA 3OZDA 4PRYA 1PFUA 2P91A 3SHFA 2JATA 4UC0A 4KVAA 2XB9A 1S02A 1EX9A 1X7WB 2VQFB 3WLMA 1Q83A 2JGDA 2VDOB 3CUTA 1P33A 4Z7NB 1ZISA 1B0AA 5D3ZA 2FQXA 1FP2A 4TKVB 3G13A 4R2LA 3NPAA 3LI2A 2RGWA 1US8A 2VK1A 4HD8A 6PFKA 5EHXA 4UNIA 1NOKA 3TSCA 5LM3A 4ZT4A 1DHRA 5AXAA 1EWKA 3V7NA 3D3QA 3OT4A 3QRWA 4LJ4A 3RVLA 1E9DA 2Z9BA 1YS4A 4ZKDA 3GFBA 2B5OA 1XWWA 1JJ7A 3E15A 4I4IA 2SKDA 5H3HA 2YY5A 3AVPA 3I58A 2GPYA 3IHWA 1QYXA 2H5JA 3RYHA 3TE7A 3TIIA 1JT9A 1RM0A 3GAFA 3HNPA 4JP8A 5HF6A 5BORA 1LPPA 4WKBA 3D5EA 3BFKA 2ZJ6A 1EM8B 3ON5A 1GPJA 4PLVA 1PCXA 4N7MA 2BHLA 4TGLA 2F1OA 4JU8A 5DI9A 3V9AA 3GDHA 3TTSA 3RARA 3VYUB 4D9GA 1YZLA 4JUBA 3LRXA 1MHTA 2J9YB 3CNEA 2WILA 3ZG6A 2PLAA 4XARA 3A58B 4N48A 3P9YA 2YJZA 4CLOA 3CJQA 4BC1A 1C7IA 5KBYA 1CVIA 4F12A 4KO8A 1Z3CA 1U0RA 2EKLA 2QRVA 3OUZA 5H02A 3G5MA 1NR5A 1QUFA 2QTLA 4PXYA 1VB3A 1CB7A 3E2PA 4NG4A 5CNIA 3WGNA 4E94A 2VNAA 3E8SA 3LMKA 2X4IA 3QEKA 4G5SA 5DGDA 3ZZ1A 3QVLA 1UM8A 4MKGA 2O3SA 4D45A 1MB4A 1GCIA 3MFQA 3WGMA 1DGQA 3CG0A 1VI6A 3TW4A 3R7LA 2HA0A 2QJTA 4K86A 2DH5A 2I9KA 5GGYA 2RBEA 3FMPB 2OGSA 2CZQA 3CEAA 3IQWA 4ZQBA 1A9SA 2I91A 1PLLA 2EDAA 4MQEB 4RMGA 1OZAA 4BIMA 4B34A 2WFLA 2VHQA 3BA6A 2JLBA 3DKPA 3Q15C 4DMCA 5ITZA 1TUBA 1ZG3A 3UAZA 4CMIA 2GBCA 4Y2VA 2JFGA 1DFGA 1T5SA 1H1LB 1QH0A 4FGSA 4NYIR 4UNPA 2UXBB 2ISSD 2J1LA 1X9IA 4AB1A 4MGEA 3NI2A 1S96A 4I2VA 3TR6A 4YLEA 3QEAZ 1ZD4A 2QY6A 2YWJA 2FEAA 2VSYA 3DLCA 2GXUA 3GEPA 1S3FA 3C3JA 1TYBE 3KRTA 4RK7A 4U6SA 3WGZA 1VP9A 3FNIA 2QRPA 5LQUA 3B20A 1U7TA 2AJLI 4FGWA 1FF9A 1OYOA 4F2HA 2RE8A 4EI9A 1O2DA 1Q0PA 1HUQA 1USGA 4UATA 3DWEX 3JQFA 2XKJE 3HN2A 5K3FB 5JAUA 3SC3A 4EX7A 3V1LA 4B82A 2ZS9A 3CSUA 4GL4A 2OXTA 1U1FA 1X3LA 2QQGA 2ZSUA 3DZDA 3L4BC 1S7GA 1GUDA 1H4TA 3B85A 4IDDA 1QSGA 2JCBA 4EARA 1BC5A 5TPZD 1TCUA 1D5WA 4LDPA 2FP4A 3U7GA 5HCUA 3VO9A 3BMOA 5G53C 4NZOA 4JUIA 5C1PA 1PK7A 2IYYA 4H27A 4MV4A 3LBFA 4CLRB 1J90A 4H3KB 4DXDA 2B6HA 4AVYA 1YRAA 2HDHA 4IJUA 1YFZA 2O2EA 2WG2A 1MAHA 4Q3DA 4D96A 5K0JA 5LZ2A 4LFBB 2PBLA 4HZIA 3H8JA 1XCJA 3NP9A 4OGLA 4F1JA 4CEIA 1OXBB 3IAXA 4ZGWA 2WA1A 2YJNA 1FPQA 3NWEA 2IUTA 4K26A 1TJPB 5LA6A 5IJAA 3PJRA 3QBVA 3ABQB 5ALIA 3I9FA 4IVPA 4ATNA 3NIWA 1P9OA 3UXEA 3SFTA 4MDHA 2EBWA 4PSCA 4DIKA 4JBHA 2XHEA 4KW7A 4AZ0A 1YJ5A 4AECA 5KYUB 2JFPA 2QZPA 2FJUA 3AEZA 1Y1KE 3MJTA 4R2XA 4KNWA 4QU9A 4MS3A 4B7UA 2WJWA 3F3YA 1G9XA 1QPBA 3UMGA 3SDBA 3ZZMA 3QJYA 3OZVA 4B80A 1SC1A 1TM2A 1XZFA 2IYLD 2BI7A 3L0BA 3PR1A 5D7BA 2LV8A 2VDQB 1MO2A 2E4AA 2Q4BA 1NW4A 5CLHA 5FYDA 1Q7BA 3KKMA 1PEKE 1CG6A 3VTZA 2XQKA 3ZV4A 2C2ZA 4YYZA 4QBIA 5KOJA 1YDHA 1FZQA 3DTNA 1D2HA 3E6AA 3RS7A 1RM3A 2RGRA 3V8VA 2XRZA 2F43B 2MDTA 1VPTA 1ICIA 1W76A 4M9SA 4D9MA 4DUZB 3K0SA 1MU0A 1DAKA 2QOEA 1BEUB 4JIMA 1D09A 1PWZA 2KBEA 2RK3A 2J46A 4QSHA 3OCZA 3PC4A 3HKBB 4MR9A 1QHEA 3DOIA 3GR6A 1U1DA 5CCEA 1B8VA 2VAWA 5IT9A 1Z6QA 4QOGA 5DMXA 3LFHA 3N2YA 1U9CA 1E8MA 3SSMA 1C7JA 2IDJA 1P0MA 4MUAA 2B20A 4O33A 4LRUA 1EPUA 1OX4B 2YJ3A 4TXMA 1UMKA 4HMOA 5KNDH 2WU3A 3EUAA 3ANMA 1OX6A 2PO7A 1Z12A 4KWIA 1XLWA 2X8WA 2WIDA 4JYPA 3L5KA 5IEJA 3ZDBA 1UZMA 2EZUA 3PI7A 3Q2IA 2ZUTA 1E64A 3F6CA 4NYMQ 2VSFA 3ZDRA 3H2ZA 1DO8A 4NE2A 1IONA 4BQIA 1RPTA 1H8EA 2W6MA 3NW9A 4D9EA 3EPHA 4BV2A 2WD7B 4LXQA 5B4VA 2AKYA 3MTBA 4TS9A 4KRFA 1W73A 5CEFA 3DTVA 1B1CA 2O2GA 3CH6A 3VDXA 3MN1A 1Q0RA 3LF4A 3LX4A 2GM4A 4GXNA 5GJWC 2KBFA 3E9CA 3HXLA 1U6KA 3M4YA 4X94A 2WRZA 3TJZA 5KTPA 3KLOA 3HLYA 4ND1A 2GR7A 2UZ0A 3JASA 3REFA 2QTAA 1XIVA 2QN2A 1VPLA 1OXSC 3LC1O 3R40A 4JX9A 4Q3OA 4L15A 2IF2A 4V0OA 2ZR7A 3EQ2A 3RLIA 5TC4A 3U7HB 3CKYA 1TEZA 1BFKA 2C88A 2FZ4A 2EL7A 4LJ9A 3U1VA 2UUPA 2PXHA 1DC8A 1Y3IA 4Q1CA 2IBMA 1C0PA 2QGNA 1CF2O 3GHYA 2Q7DA 1RJFA 5IF3A 3DEYX 2GM9A 4G8DA 4AAYA 2WY2D 4DV6B 2C5AA 2V7WA 3T5TA 4LJKA 1QCZA 4R2KA 3AERA 4AIIA 1U04A 5FPPA 3P9CA 4RXMA 4OUKX 1P4GA 3DBHB 2ZJ0A 5AW2A 1WB6A 3FJYA 5I7VA 5LZ8A 1RYZA 1Y63A 3LX5A 4R1PA 1ORWA 4JYZA 1XAJA 2J6BA 1HORA 3OIVA 2YN2A 3FDJA 1GYRA 4TQAA 4QD3A 4EO7A 2FZLA 4I3FA 3QUCA 5CK5A 5IC5A 1SRQA 3VJMA 4R6WA 2VPWA 1P17A 4C05A 4AYXA 2EJVA 5KKAA 5K0ZA 1RBMA 1I33A 3B5JA 5CM8B 4WT7A 3ZWVA 2AC7A 2ZM5A 4U6QA 3W4IA 2HSGA 3UMFA 4WY8A 1LQUA 3CRVA 5ALLA 4MVJM 1NV9A 4OA5A 3KHKA 2FPSA 5G1NA 4HUQB 4RJ2A 1QP7A 4B6EA 4OVKA 2GN6A 3HXOA 3E4DA 3FWZA 1SVSA 5CVDA 3UBMA 4AZSA 4DA7A 1EWQA 3LUCA 2BMJA 4OI0A 3CCCA 4YXWD 2YVAA 4UAJA 5C8YA 3NUZA 2WV9A 4L76A 4C0XA 3FWKA 4N47A 1RWPA 2W2XA 3MCZA 3WDMA 1Q7EA 2IHVA 2XUJA 1PKXA 5REQB 3F6SA 3K94A 4PNEA 1KHHA 1T25A 5DHSA 5IBCA 4K6GA 5JJ5A 3LTEA 1NUHA 5ADVA 1BVRA 2Q8PA 1HX7A 4AMZA 1P0PA 2F9LA 2YDYA 2DQSA 2CE7A 4XDZA 4EHNA 4ZZ0A 3D3KA 2XDAA 3QVXA 4YHBA 3FETA 2OGZA 3L7JA 3PEVA 2ZQZA 3CN9A 3QPCA 1FYWA 1T2NA 1QQ5A 4FC7A 1XFDA 4LI0A 4N0DA 5DOZA 2AYYA 3ZOZA 4ECAA 5LL6P 1JQ5A 2EZ8A 1KEEB 4P3YA 4EDHA 4RVOA 2VA8A 4TTVA 4CM5A 2UZ4A 4KB5A 5FTKA 3HWX1 4FT4A 1XCBA 1JXAA 3BMCB 5DLQC 1FU8A 3ERCA 3VKGA 1E8DA 1XP8A 3HEAA 3GJ4A 1M6NA 6AT1A 2B9EA 5FTMA 4BLOA 3Q5GA 2IPOA 1UC9A 4B1FA 2YBEA 3PKZA 3ECCA 3NBXX 1RAIA 2R65A 4WFIA 1GM5A 4JA0A 2FRDA 4LRWA 2BFAA 2LXNA 4TQ9A 5GAJA 1QGOA 2H2FA 4IF6A 2BFCB 3GNLA 1Q50A 5AK0A 1MA3A 1R0BA 3EC7A 3ZNPA 1STOA 5JQGA 2GPWA 2PS3A 2M9MA 4NARA 3UT5B 3K5HA 4Z4QA 2CVPA 3DUFA 1RQ7A 1H66A 2ZUUA 2BPOA 4UKDA 3QVMA 2VDMB 2TMDA 2M6KA 4E2WA 2CCJA 2BVNA 2QRNA 1G7TA 4TV8A 4KXXA 1Q77A 2JJ1D 3E84A 3KALA 3SLKA 2HF7A 3G5TA 5JHHB 1M7HA 1V8ZA 4DSNA 5DTEA 4Q82A 2OVFA 1KE2A 3QHQA 3RBZA 5E1BA 1W46A 2ZJ4A 3B7WA 4AKTA 5LQNA 3HO8A 1JFFA 3SN6A 1NJ1A 5FV4A 5J1TB 3DOUA 4ZO9A 2B4YA 2JGRA 6REQB 2MSKA 4PINA 3CPJB 4RO0A 3EH2A 1KOLA 3ED1A 3F3MA 3OT1A 4KITB 3DVLA 2HTFA 4DW8A 4H7PA 3L84A 1SCKA 3VOBA 4F9FA 3ROFA 4YMSA 5DF1A 2Z1MA 4MKRA 4WOBA 1C0EA 2UDPA 4N7JA 4Y9SA 2GW4A 1M2OB 2RH5A 1QGED 3HRIA 2HMTA 4U39A 4BGDA 4KDCA 1YQGA 5CA0B 4YBZA 3G1TA 3U3DA 4MDEA 1YB7A 2QVYX 3PUWA 1OB2A 1G7SA 4GPAA 3A04A 3EJ6A 3HK2A 2BI8A 1FFHA 3VAAA 4FM9A 1P0QA 2NUTA 2CLCX 4BQFA 4WUVA 2XECA 2AX3A 3IAEA 1RHQA 3VU8A 1DCTA 2QXYA 5F3WB 3UKOA 4GL2A 2WHEA 1GR1A 1O94D 4AG5A 5DPMA 5EZ6B 4PHGA 3K0KA 2NPOA 4IHJA 4UEKA 1KSGA 3G2NA 1ENZA 2C5FA 2FSHA 3WJ7A 2DHQA 2WUWE 3M6UA 2H57A 4XTCS 1HRDA 4Z86A 3W5BA 1ID8A 4XEHA 2G1KA 1FQOA 3RW9A 1MJGM 2AOUB 1H65A 2CKMA 4FHCA 2E55A 3J80A 1RLUA 2ADOA 4IHKA 3KOXA 5HKLA 3QF4B 2YWRA 2OORC 2YY7A 3VR4D 1TMYA 4DCTA 5LD2C 3R7WB 2BGKA 4Q01A 2JAOA 4ZAXA 3TLEA 3AI7A 1KZYC 1FLAA 1DRJA 1TLLA 2WHYA 4F6RA 4QGBA 1PN3A 2ZUWA 5H70A 3W1EA 2FW7A 1RYMA 1CTQA 2J9RA 4LJ6A 1T8UA 3IHKA 2B1RA 4NH4A 4V1CI 1QK5A 2BRUC 3DFFA 5C8YF 3HWWA 4PGGA 1GLGA 3DBVO 3D5TA 4NMHA 1WNFA 1O5OA 1XU4A 3KKQA 4HL6A 1U31A 4NRDA 2P79A 2FV8A 3RIXA 1XB2A 3SXJA 3HZRA 1H22A 1P81A 4E11A 1KH1A 4KP7A 3UPUA 4PNPA 3ED5A 4GZ6A 1U9IA 4X45A 2FG7C 3FMFA 5FT9A 1RXWA 4NBNA 3IVAA 1WP9A 3N28A 1JDNA 2FEXA 4LBZA 4GS5A 3CRZA 4M0LA 4U9IS 5CNMA 5LJIA 2AOVA 4ENVA 3HABA 4MPPA 3KPYA 2P9HA 3DZHA 1TC2A 5FNZA 4IX9A 4KQIA 1ZHHA 3VVBA 1Y1SA 4P4UA 2XCRB 1SD1A 2HLNA 2OUIA 1E6KA 4MQMA 4Q4HB 4UVGA 4A4DA 1RAAA 1BQ3A 1IVYA 1XTUA 4UVDA 3R24A 4MI6A 1X38A 5IAOA 5JBNA 2G6TA 1A7KA 4KXFB 4NH0A 2NXEA 3A05A 3IOMA 1YJBA 3PDHA 4WW0A 1NP3A 1Y6FA 2CSXA 3DC2A 5CFOA 1JIXA 4NLLA 4UXIA 1N9GB 4ZO6A 1Z5OA 4QDZA 3CX6A 3LDAA 3PFHA 3QVUA 2H5IA 1JH8A 5CH5A 4YRAA 5TPZA 3WZ2A 4ENSA 5TX7A 2B1QA 2K4MA 3RSFA 1XTBA 2RH8A 1W36C 3GHHA 2HUNA 3CRMA 4DBVO 5AW3A 1F8UA 2A9JA 2HMSA 4DPMA 1TVKA 1YR1A 2GN1A 3ABSB 1II8B 3NTUA 1O08A 2O2JA 4HY3A 4IKOA 4Z4HA 3G0IA 2QENA 2W2MA 2XDQA 4XGRA 1W34A 3BCSA 1F4PA 4WBNB 5F4BA 2P67A 3IUMA 4TV8F 5EFZA 2IS4A 3BQNB 2XF2A 4X7MA 4YFVA 2JVIA 3RBAA 3ROGA 2NZWA 4PLCA 4ARSA 3STWA 2C77A 3K35A 5T6MA 3WBFA 6YASA 3CW8X 3SAJA 1R88A 1UJBA 2FUCA 3OP1A 3MF4A 2E4XA 4WZZA 2G4LA 3H97A 4C5BA 1U0HC 5J2TF 1G55A 1UCFA 4PPQA 1OXKB 3S28A 4H7KA 3THWB 1ZJZA 1NRIA 4RPLA 1DLJA 2PLRA 1R9JA 2VWHA 1DU4A 4MQ6A 1NBAA 1OYYA 2ZBGA 4PZZA 5EJGA 3ACCA 3CURA 4GSKA 1ZMBA 1YFKA 2QY9A 2C95A 3WBJA 2XQVA 4NXMB 1EVYA 4B6RA 4H0FA 3CEPB 5FI5A 3D4LA 4FEYA 2WQZA 2WJ4A 1N8SA 4J0JA 3PQ6A 1YF3A 2IECA 4GQIA 4ANFA 2V6JA 3BWMA 1P8JA 3SBDA 4EVSA 4BGUA 3CNHA 5L7YA 2IGBA 4FEEA 3D7SA 1YB4A 2RAPA 3EIQA 5DBOA 2ZTSA 3INTA 3WGKA 1GA1A 1SBYA 1UM9B 2H0QA 3JVEA 2HF2A 3PQ8A 1L1RA 5DDIP 4B0OA 5B7GA 5M04A 3WGUA 4ZOEA 1MJ5A 3OEED 1P18A 3TQRA 1XVUA 3LRTA 4HAWA 4DBZA 2PK3A 1YKGA 3PHLA 4JQOA 5EIWA 5KOIA 5KQPA 5KWIA 1PUJA 1AHPA 2WMOB 3TQOA 3H3XA 1GR0A 5K8UA 1Q57A 4HDSB 4JKOA 2QMYA 3IL2A 3PC8A 2R1UA 4O0MA 4LHZA 2IV7A 4YAGA 1PTJA 2PYIA 3U4QA 3B60A 3CBQA 2W71A 4LTMA 3B1XA 3CA8A 3LAWA 2MMCA 4FGLA 4I1YA 4ZCIA 1SU8A 1P0IA 3C6BA 4H3HB 4N0QA 2GHRA 5TQ2B 5TY0A 2DETA 4PAGA 1GITA 1VLMA 4EFNA 1CR4A 2YWEA 4KUEA 2QNIA 3TLMA 1ULHA 4OD0A 3JQ8A 1JAIA 1MDFA 3EYAA 3OFSA 4LWOA 4A2QA 4CM4A 1QVAA 4GOOD 1T0IA 3BWBA 1AHHA 1RZ3A 5E1DA 1Z6ZA 3V6MA 3NGMA 5EHNA 3U61B 3FPBA 3QZUA 5E38A 3WTBA 3S8EA 4GM4A 1LEHA 1GPWB 3AWIA 1DMSA 1VPEA 5D7NA 5IVHA 4K8RB 3LA6A 3BF8A 3R6DA 1CU1A 3EJWA 3FNEA 3PNKA 3WADA 1PI3A 2FUEA 4YQFA 1Z4QA 1CVLA 3LWNA 4NABA 4BNHA 4FFNA 4HVLA 4J2OA 2ZDQA 5KSZA 4D41A 5IAGA 5BVGB 5ISMA 4Q6BA 1J09A 3LH5A 2WJJA 1YASA 1HZZC 1T3GA 1BXGA 1E2FA 1MTZA 2PMFA 4OMDA 4MW9A 4TWBA 3D4PA 5BN5B 2Q7XA 1ZICA 1LX6A 2PUJA 3BXGA 3E2MA 2YHUA 4XXHA 4BQSA 1UBEA 3FPCA 4BMYA 3IDQA 5DEIA 1J5EB 1H6DA 2JBAB 3LUBA 2AMFA 1EGHA 3FNRA 3A26A 1QHXA 1RPNA 4IIGA 5J5CA 5JADA 1EQ2A 1IAQA 5KJFA 3G9XA 1P2UA 2P1DA 3GGDA 1CR1A 1JNYA 1FP1D 1GQSA 1NI4B 2FWRA 2I03A 2PL9A 2X0JA 3CLUC 1XO1A 1T9GS 2Q1SA 4RU1A 4CCYA 3PGVA 2DB3A 4ZZIA 1OGYA 2G0NA 5KOHA 2Y77A 4M46A 2ZEJA 5AM1A 2G6BA 1SCUB 2B1IA 1NBOA 2OD9A 3I45A 1QO0D 3R6GA 4ZVSA 3MJHA 4DSAA 5HUHA 2D3TA 2VTEA 2VXOA 3I2JA 4QSMA 1YOVA 3NB0A 3L2OB 4URWR 4ZRDA 3V1UA 5BMVA 1PVOA 2X1VA 1SK9A 4HGNA 1E1RD 3CLSC 3ETEA 1RLMA 4INAA 2VCYA 1CY7A 1U7DA 3LYUA 5HFAA 4RSRA 4KK4A 5LD2B 4TRJA 1ZAYA 2EW1A 1K4YA 1ZUHA 2GAAA 3PC6A 4RGYA 5K0NA 3PKIA 4P0QB 1UBFA 2DHDA 1GRVA 3QPDA 2P2GA 4HDOB 1C7RA 2Y1CA 4MIKA 3UUFA 1XF9A 4PTZA 2CGEA 2JI6A 4YDSA 4WKGA 5I9MA 4B3HA 4JOBA 4UXJA 5BWLA 3NFRA 2CVHA 4NCAA 3PHGA 4YXWA 3T7CA 3WKAA 3NU1A 2QBYB 4EJFA 3M2TA 1S2GA 5IVKA 3NHLA 1E96A 1GFZA 4QYMA 2GA8A 4AIRA 1HDXA 3U16A 4DLYA 1FSSA 5B58T 1Q1EA 1A88A 3AEKB 3IP7A 1L5QA 5TMPA 2XCQA 5HK8A 3PYXA 5KVSA 3L8HA 2R47A 1QYWA 2Q5OA 1QVZA 3I2FA 3AC0A 3CNQS 3PHHA 5E6UB 4QLBA 1PG0A 4GRAA 2XWQA 3ITKA 2GCOB 1FMFA 1AD2A 2WKWA 1Z22A 4GMKA 4P58A 2IY9A 1KQ3A 5IJ9B 4FSXA 1W5BA 1CRPA 1J0AA 1X9GA 3JPWA 1Y33E 2GSDA 5K7SA 1VG0B 1YZKA 1H05A 3E4CA 4YCBA 2I4IA 4S2EA 3CBGA 1OH6A 3VSDA 3R3YA 3DWFA 1W29A 3FPFA 4U1RA 3NEYA 5A1JA 2CHEA 3CFIA 3KT6A 1IJKA 1O77A 3FDXA 5HGJA 1TKBA 5A9TA 3ASVA 3VC7A 1I13A 4J16A 1W36B 3PNYA 2P3QA 4RFSA 3GLTA 4DV2B 3EGIA 1VSBA 4R4JA 2H1HA 4I4TB 3WGJA 3QFCA 4LNUA 2HOQA 2QHXA 3W0LB 4QOHA 4PQYA 3VV2A 1UJCA 5H9WA 1RRMA 3E0QA 3FLBA 5I4IA 2XMDA 1Y8QB 4ZCTA 5HQTA 4KBYA 3UTDA 5AH0A 3RC7A 3TSWA 2M1XA 4NCNA 1OTXA 2G80A 2ODBA 1I1NA 2IQIA 4KV9A 1E5TA 1RM5A 2ONZA 3CZPA 5ESXA 1UBOS 2JJ1A 3G82C 1USWA 2GH1A 5FNVA 1EQUA 3UAXA 1RRPA 4MB2A 1S8OA 2VBGA 3RIHA 1X2EA 2ET6A 2GM5A 3VSBA 2NU7A 2JFNA 4UDYX 3ZWXA 1X7XA 4TLLB 1PKEA 4FOLA 4MRMB 5LKRA 2ECOA 2VHYA 2Z5LA 3AH8A 3OO0A 1E1DA 3H9JA 3O3CA 5ES4B 4B75A 3B5IA 1ISJA 3RSCA 5T4HA 3NIFB 4A7PA 4YRKA 1RWQA 2Q4RA 3OFND 2AJTA 3IVMA 1A8HA 1N0UA 2ID4A 2X5KO 3QU4A 3R5XA 4L5CA 4Y6GB 4FB5A 5C51B 2Z1DA 3VVCA 4OHRA 4Z9BA 4EABA 1UAYA 2JIRA 1J0EA 4EY3A 1N0WA 2C5EA 2GS9A 4ZVUA 4BFXA 3RWMB 3LUAA 2PQ0A 1ZVVA 2X13A 5A2GA 1JE1A 1PYGA 2VYND 3DPIA 3VZDA 1XXHB 3WV5A 5BSHA 1RXEA 3QMVA 4PC1A 4ID9A 4XQGA 1NU8A 2WTNA 3QHAA 1DARA 1EA7A 1CE8A 2H92A 2OGWA 2Y0CA 1YGPA 2REQB 5LCXA 3T3MB 1L1EA 3G6WA 3ISVA 4CKBB 1EWYA 2VHTA 4B8YA 1YMUA 3HDTA 4EZEA 1P1RA 2ORYA 1VZ3A 3I52A 1VBMA 1DKUA 1RI1A 1LZLA 2KX7A 2I3GA 1XJCA 4RDCA 5BMVF 2QB5A 1WG8A 4ITVA 3ZDXB 4RGQA 2GN8A 2H2WA 1YZFA 1JU3A 2NOAA 2NU6B 3P9SA 5ULLA 2PZLA 3BQMB 4BL5A 1G21A 4Q66C 2C83A 1Y3AA 2BGUA 1R9GA 3GRRA 2GNOA 3M4JA 4UTXA 3DO8A 4EH1A 5A4KA 5JSKA 1EFAA 3VR4A 2Q99A 4PGMA 3IBYA 1QNLA 2IPLA 3I4FA 1BO6A 3I4LA 3Q4GA 4FFOA 3AINA 3TNLA 2WHRA 2VHCA 3M49A 5LQAA 3W9UA 4EHBA 2OT3B 1EGQA 2CBXA 2EFJA 1IHOA 1FRQA 1XTQA 3NHAA 4ZVTA 1A50B 4XX0B 3OSUA 4MULA 1L5FA 2WAOA 1NXQA 3K15A 2F3TA 3FTQA 3PE6A 4I8DA 4R8VA 2I52A 5DHRA 2FE4A 5BQPA 3KTOA 4RHFA 5LDHA 4JCOA 3S2FA 4FYKA 4U9HS 4NAUA 2C04A 4BTVA 1V3VA 1ZEMA 2ZWPA 1L1QA 3EQ7A 4UBIA 3VQTA 3KB2A 1N33B 1JHVA 2G3DA 1LDMA 1OC2A 3U5ZB 1V95A 3BIOA 4H7JA 5BQ3A 5JDIC 3G0CA 3MWJA 4LS3A 1Q0LA 4G41A 4K87A 5E3IA 4C7MA 4EY6A 3OLVA 5A9SA 4B7ZA 4TM8A 3SLGA 1AOXA 3ASZA 1L9XA 1OSNA 1ZGHA 3FOWA 2AYZA 4N40A 4BAZA 2Y1KA 4FWTA 2IZ1A 3AL3A 3RS9A 1JEAA 1V5IA 2A92A 2KM1A 3KTFA 4RZ3A 5F7XA 4H7DA 4KXWA 4KYIB 3P0RA 1U0LA 3B1JA 3NKVA 3PLNA 2V7PA 1PDVA 1RLTA 4GBGA 3VPCA 4MUXA 1E3WB 3CZMA 1JLLB 1YQ9A 3ACDA 3CMCO 2D2EA 4CF3A 4DLTA 3R3SA 5CEEA 3FOCA 4BZPA 1Z5UA 5EVCA 4JI1B 5KOYA 2PUWA 1X7ZB 3G2QA 4HTAA 1OLXB 2YJGA 3GZNB 3ZVMA 1N6NA 3B9RA 4DF3A 1XN1A 3WKCA 5DYIA 1PFWA 1UXKA 2VPPA 2HJVA 3D1VA 2XQGA 1J6UA 4MI1A 4S1TA 3I62A 4MA5A 4ZZ2A 1INLA 1LK7A 5KYVA 3S29A 4UUOA 2PUGA 4S2UA 4G25A 4TSRA 1UBHS 5IBRA 3QPVA 3FKQA 2NPIA 4RLSA 2CY0A 2IOQA 3O8QA 4ER5A 3CX4A 2AQIA 2BBTA 4OAPA 4IUYA 3JD3A 5FIUA 4FK8A 3M5DA 4NC9A 1Z4KA 3L6DA 4JBNA 3VPSA 4OYRA 3BJIC 3TYXA 1RYYA 4MP3A 2BR4A 4YO7A 4X1YA 2ON6A 3VJKA 3FNGA 4HKTA 5EMKA 3SZLA 3QEJA 4URYR 3W3ZB 4D57A 4MTCA 1Y5RA 4R41A 1E66A 1MNAA 1RTTA 4L3OA 4QJ4A 3T12A 3VU9A 1Z07A 3NOOA 4UMVA 3SQDA 3S7ZA 2QTBA 4FILA 3MBOA 3AFHA 4NHOA 1H5NA 2Z4RA 1KFCB 4WACA 5K0CA 2VCHA 4WDRA 2RGYA 4G0MA 5LB2A 1MC4A 1XVLA 2X2PA 3GJYA 1LQ2A 4IPTA 4ZEOA 2VUTA 1E1QD 2A9RA 3UICA 2W43A 1H2FA 3THXB 3A4LA 3UOGA 1HE4A 1R9NA 1VC2A 3R77A 4LDRA 3W5AA 4MWSA 1W59A 3LT1A 1VRWA 2ZYDA 4ISBA 5JAMA 2VP6A 3AEYA 4MWBA 1QLWA 4WIAA 3ZVKA 1IN5A 2F4VB 2JGDB 4F4JA 4ND7A 3EUWA 4I1OA 4ARIA 1NW7A 3PGA1 3TG2A 4S04A 3OI7A 4O4JA 5GGXA 3ZD8A 1TVCA 1AXRA 1LXCA 1OBFO 1Q22A 3GZTB 3HCWA 5TEWA 1P1JA 3ZJ4A 2KI5A 1US8B 1S9HA 2OV1A 2VDLB 3OEEA 2FK7A 3WGHA 4F06A 1ZFNA 2WC1A 4G0VA 3MT0A 4HK4A 4RPJA 1NURA 1JHUA 2BEVB 5DBIA 2PTHA 2NIPA 1V26A 3CPSA 2G7ZA 1FVFA 4FDLA 4G1FA 4DMRA 3AUAA 3ZKAA 5T3UA 1CUEA 5EE5B 3FZNA 4O4LA 2VNKA 4AN1A 1O9HA 3ANXA 5SZKB 4MKZA 5BV2P 5L7WA 1EP2B 3A27A 4ME6A 4U7PB 5EA2A 3T7SA 5ALNA 2P6NA 4UARA 1G6OA 3WWYA 1MLDA 1CP2A 4PGAA 1N8TA 2J3KA 2EYUA 5BUZA 2YHSA 5KU7A 4MKFA 2P2CA 1QF6A 3PL5A 2GPTA 3ORFA 1E6UA 5TRTA 2QTGA 1SC9A 1WZNA 2OV2A 3C6XA 4GOXA 5I9IA 4PF1A 2YC2C 3DVRX 1AU9A 2X0RA 5BYBA 3EISA 3ZW7A 4D9CA 3HACA 2GM3A 3ENNA 5LXTA 4DQVA 4OB8A 3DE2X 4OPMA 1PYDA 5ELLA 3OE7D 4KFUA 4K2HA 4LXTA 3B1ZA 3JWHA 1SVOA 1HPLA 4EJ2A 3MQ4A 3MOSA 4E22A 3F5QA 1WABA 2DJ5A 1PGOA 5HJEA 2AEJA 3GLSA 1I8TA 2C2YA 4NEGA 4AP6A 1Q2UA 2XA9A 2XEXA 2LNDA 3LIIA 1UZNA 2ECFA 3PNLA 4QLOA 4LSGA 3R7DA 3A1VA 3V8QA 1U2TA 2Y9PB 5ITZB 3N59A 3QKUA 3D64A 3MTAA 3M4NA 3N7TA 4CMIB 2J45A 1P75A 2FNAA 2XMPA 3SNKA 2FEMA 1CYDA 1MT3A 1R0LA 1XHEA 2ZROA 2XZDA 4R5HA 2HMVA 1P7WA 3RUIA 3SS7X 4BIIA 2OFOA 2C7QA 2YXLA 4J7CA 5IN5A 4BWGA 1MX3A 2ZULA 1YZTA 3AIIA 4HDKA 3IXMA 4A23A 4DM4A 2XF8A 3MWFA 1GG8A 1XEAA 2CBZA 1Z37A 1WA5A 2YWFA 4OI4A 3A6DA 2EIXA 1QO0A 3GG2A 1ZD8A 3C6YA 3GFRA 3NM5A 3ZI4A 1YJCA 1ZU4A 2QAGA 2Z3VA 3BK7A 1SXJC 3KHUA 4GM1A 4NDNE 2XUHA 2PQMA 5E7IA 2QVCA 2DCUA 4HN2A 1E1RA 1W96A 1EMDA 4CU5A 1SBNE 4C0BA 1U7UA 2GF9A 3FCSB 3EF1A 3O2JA 3NX4A 4IKEA 2NXWA 2ZP1A 4FFSA 4IOLA 1HYHA 4F5DA 1CRLA 3BEDA 4M1MA 4B7CA 1DTSA 3B1YA 5IPFA 2R8XA 2AR9A 3LKVA 4U2BA 4Q4CA 1PJ3A 2CZGA 2CF6A 2KWIA 3LFTA 1NVKA 4B3SB 1ZO8A 2YN0A 3GWZA 2O57A 4BQOA 4HNTA 2BGGA 3UATA 3BB4A 1T0JB 2H51A 3LUPA 5AICA 3ER9A 1JIVA 2EKDA 4RANA 3UA3A 3W8RA 2AN4A 4BCBA 4F1KA 5B30A 2DLNA 4M1OA 1FW6A 2ERXA 1OBHA 4DLPA 2PA0A 2ZR0A 4HNVA 2HJGA 4M3NA 2HBYA 4RSGA 3TKAA 3VO1A 1RABA 1XC7A 2PBRA 3JVDA 4WZAE 5COQA 5LBUA 2NPFA 4C87A 4CG0A 1EK0A 1MJHA 3OTWA 5AVUA 3RU2A 5CLJA 4K9MA 1RHKA 4V0KA 3KK0A 5DTJA 1NN5A 3KV1A 3NHPA 3OD5A 4IGFA 4W7IA 4ZOLA 3TDNA 3L6BA 3IEVA 4UZFA 2HN9A 2E4ZA 1BTOA 1VRCA 2IUFA 4JHXA 3BZWA 4O4JF 3C7CB 5F78A 1QYDA 1ND6A 3TLYA 5ALWA 4CMJA 3VTAA 1L5MA 1D2RA 1Y7IA 2I2WA 2ZBDA 1SQSA 4D9KA 4C0SA 2XB4A 4WD3A 5AFSA 1KO7A 2XE7A 1SZCA 4NS1A 1JAHA 4JBYA 4V2UA 3VM6A 3ONFA 3Q7RA 3R3VA 4MWDA 1VE7A 3DBRB 1PFGA 1ZIDA 5JWHA 3U40A 3THYA 2H9YA 5FUQA 2RHLA 1L7XA 5KOJB 4W9MC 1U8YA 3KEGA 4XUDA 3CC8A 1NDQA 1IK6A 1U3GA 2VH5R 3K5WA 4V24A 1RMTA 3U81A 2LW7A 1CK4A 2GNPA 4XR9A 1KR5A 2IYEA 1TJ4A 3K05A 3QW2A 2HJHA 2PR2A 2Q3MA 3QE2A 1VLQA 5DNYB 5ALMA 5KVQA 1YRLA 2B25A 2D1FA 2YV3A 1HKUA 3PWSA 2V54A 4MR9B 1LLUA 1M83A 1P7CA 1G9SA 4NPCA 4Q5IA 5EIXA 2NTYC 2FMUA 4CV1A 1CIPA 2AK2A 5DGIA 1AF4A 3WMFA 2AYXA 1E9BA 1HXHA 1PHRA 2FEKA 1RQRA 3AY0A 3IALA 2ACWA 3BB3A 4BP3A 4E4RA 4I6GA 5ENZA 3HU5A 4G9GA 4IW3B 4F2DA 3PEFA 4RZUA 1I0LA 3G6KA 4UTOA 4BFCA 1DQNA 4E31A 2QLBA 4Z3KA 3X2EA 2RKBA 4N8EA 1LTKA 2EKBA 2HMAA 4LGYA 4LBVA 1R0RE 3NAMA 3QYAA 1BXRB 3CF4A 3ESBA 4HQNA 3OFNA 2QTCA 1E1KA 4HB4A 4RQBA 4J6EA 2VOJA 2XKBA 3E82A 2FLWA 2C3PA 5ADUS 2VS1A 2VUSA 1T3HA 1OGIA 3UB4A 4DCNA 3ZWKA 2V3CC 2WU0A 3LCUA 1EK2A 1WMDA 3SVLA 4LDQA 2VYNA 1KK1A 3PFBA 2RHRA 1BSVA 1HDZA 4JS0A 4KH0A 3SZ3A 1C7FA 1GZ3A 3JASB 1GGVA 4MDYA 3QTBA 3RAFC 2GKOA 2QI9F 3KHSA 4A8PA 4AJJA 3TQIA 4DJ5X 3LV8A 3H5RA 3OICA 2Q46A 5MHTA 2OEPA 2WJIA 3AVYA 1AIPA 1DRUA 2XLCA 1J5XA 2FVYA 1TPYA 3OH8A 3O8NA 1E63A 3B2QA 3OE1A 1Y6QA 5AQEA 4BN5A 1TF5A 3V55A 1SHJA 3OO1A 5LP1A 1XN4A 1IU9A 3PQEA 1X0XA 3EVBA 3I9V6 4A82A 1IM5A 1BA3A 3SIWA 4AP9A 1JFLA 2G63A 4WESA 4WX2B 4ZT5A 5BNWA 4OHWA 3KVOA 3QE3A 4FB4A 1DTEA 1EEHA 2COEA 2XXJA 3DYIA 3FZQA 3H1PA 3NBKA 4I66A 1EXMA 3TVTA 4CRWB 1N7JA 1VMEA 1UQTA 1J24A 3T4XA 3S99A 1IAVA 2RJ3A 5ARBA 7YASA 1SHKA 2O7SA 3HUTA 1EP9A 5JLAA 6GPBA 1EVQA 2BGWA 3AL0C 1KI1A 3LC7O 2I4OA 4WN3A 5EOVA 5TQVA 2I0FA 2PS9A 2ZIEA 4B3MB 2O8BA 2XYQA 2D8MA 4OQLA 5F33A 3CXUA 3TPCA 2P2LA 2QTVA 3RTCA 2X1HA 3ZTYA 1KAGA 3QVOA 2CEKA 1YWGO 2P9QA 3W2IA 1MB0A 1HLPA 4KI7A 3VZSA 3WGVA 5JS1A 1Y4UA 1Q3KA 1L7OA 1QHHA 3DS8A 4IRMA 2E4VA 3L7YA 3ADBA 2WTUA 2HCTA 3CEHA 3Q1KA 4F3TA 1BE8A 4TYNA 4IXNA 2V3VA 1L4NA 1XZMA 5JSQA 2V8BA 4DA0A 4AJ4A 4FKMA 2ZAYA 2A59A 4OMUA 2DBQA 2XVAA 5ALHA 4BBJA 1ZEJA 3NR2A 5B12A 4DLLA 4CUKA 1XA0A 2JHCA 3E7PA 5ITWA 4HYEA 2COUA 1KFBB 3IPAA 3LBHA 3EPLA 5AJWA 4NE7A 3SDSA 1WU7A 3GROA 3H42B 1XL1A 5C8YB 2NO1A 1L3CA 1WPXA 4H18A 3H9BA 1QZ3A 2FYTA 4IDGA 3OQMA 1C9KA 2Q45A 2ZJZA 4XAQA 4OUDA 5I7EA 3CPHA 4WINA 1IEXA 3I64A 4Q16A 3V4VB 4EW6A 5ES3A 2J08A 1UINA 2GEFA 1MDBA 3LL4A 2D74A 3L8ZA 3LWBA 1GU7A 3FCOA 4QARA 5D1HA 5L95A 5LNK6 1ZIOA 5JXWA 2RG7A 1FLNA 2ZBQA 3K96A 4QBFA 3ET5A 3I23A 4DIBA 5I8WA 3P4YA 2QJWA 1R3UA 1T9BA 3PRYA 4R7ZA 5ICGA 5FWAA 3GK3A 2WMDA 4KQMA 2VZLA 2OM2A 1SXJB 3B1FA 2IDKA 2JAXA 2XT0A 2G70A 4NF2A 4LX0A 1M6VB 1NXPA 4X1IA 4FDVA 3WBKA 2C7PA 4ZVRA 4Z51A 4DTCA 5L51A 2O19A 2CMDA 2QWXA 2FPLA 2MOKA 2B9VA 3AONB 5BPFA 4UNSA 3RUEA 3C5CA 3CLRC 4RENA 1DL5A 4BJ1A 3GLGE 1GGHA 1TJ3A 3DWGA 3PC8C 3TFQA 5F2EA 2ECKA 1PTJC 2Y9MB 2ZS8A 4M8IA 2HB6A 4UBJA 4WGFA 2FEOA 5DHFA 5ESDA 3WK8A 3PVSA 4C4RA 4G63A 2WBLC 1ZW1A 4DLKA 1CJCA 1PD0A 3NTXA 2OB2A 3WYEA 3ODPA 1L7PA 1QWOA 3JCZA 4KDFA 4TPKA 4A3SA 3SI7A 4EGFA 4UHKA 5JJKA 2PD4A 2C4NA 5TF0A 1OU4A 2O0HA 1K7SN 2LUOA 4P82A 4XVRA 2K5UA 3TDMA 3AM4A 4PC7A 1KY2A 4E33A 2X5OA 3L02A 3NLLA 4TV8B 2ZYRA 2J3QA 4A8JA 1E1QA 1M8FA 1VG9B 5EJ6A 5EP1A 3PNVA 4F4HA 5MGBA 1OROA 4DLNA 5HZGA 5IU6A 4G5QA 3C85A 4C30A 3GJXC 1UKEA 2DHCA 1WVIA 2B4RO 4TWZA 3W7BA 3WTCA 1TEVA 1WD5A 3FBWA 4MK4A 1ITZA 2XBUA 3LTNC 4J7XA 2GD6A 4POAA 5J2TB 4XDHA 5FPYA 3GRKA 3FTFA 4DREA 5LU9A 1HQKA 1MV8A 2BLNA 1EX6A 3DAGA 1P4HA 3EGDB 4G4SP 3G89A 1XZJA 4JC8A 4MRRA 4RTJA 3T5AA 4Y6PA 1TTPB 4H4EA 1GUZA 3KWFA 1O1YA 4LX8A 3W5UA 3U9LA 1RE0A 1LK5A 1IJBA 1SBQA 1VL2A 3T95A 2GXAA 2OQIA 1TYZA 3GF4A 4OHVA 3RRZA 5CB0A 2GZ2A 2FW6A 1JBKA 1FFDA 4OL9A 3RFTA 3A2NA 1LPOA 5L6LB 2Z04A 3D1LA 3Q5EA 2K2WA 3DYVA 3SMQA 5B6JA 2SECE 3G9QA 5HJ2A 5D00A 1H2EA 3ORYA 2ATVA 2OFFA 1OH7A 3NQ41 1LLDA 4A91A 3BSSA 2XMRA 5FFMA 4FOTA 1KH2A 2Z2JA 2W2PA 5FULA 1AMNA 5C53B 4IHJB 1XELA 4B2PA 4BCCA 1NUPA 4BJ5A 3KAPA 1Y6ZA 2KJQA 4JVNA 3RYIB 4CR8A 4D46A 1JG1A 4GLOA 1MD9A 3LP5A 1E9VA 4EATA 2JJ2D 2OHXA 2GZSA 2H59A 3OX2A 5IKXA 1OZHA 3TE6A 3GLHA 4F46A 1L5SA 3I01A 1KAHA 1N4AA 3OP4A 1E4OA 1U4OA 5CA1A 4G23A 4BVJA 3B12A 1KMCA 1XJQA 2OGTA 5SY6A 1MQSA 2P0AA 1TAGA 1YCHA 1QV7A 2H1IA 4Y67A 4WL0A 4PN3A 3DDNA 4B4UA 2G4CA 2I8AA 2X9LA 3PC3A 4AJIA 3OE7A 4OK6A 3OHPA 2BFDB 1LJ8A 4P54A 1TM4E 1YAJA 3WLTA 4BLPA 3A4VA 4QVKA 1GZ4A 3U3RA 4DLSA 2GFHA 1S9DA 3KXIA 4GR4A 4Q18A 3EOAI 4WLNA 4QDOA 1G63A 3JYPA 1G2IA 4NPAA 2PPVA 3ZDQA 3E9MA 3EB9A 3HCAA 3YASA 1QG2A 2Q4OA 2DOKA 2ORVA 1LNSA 3Q72A 1N5JA 1ZD5A 1DINA 2IS1A 1FTSA 3AHDA 1HM5A 3IEIA 2WYHA 3CZQA 1LF5A 3JVVA 1LSOA 1C3LA 4G85A 2JLUA 1C41A 1B8OA 1ECGA 1JLRA 3V7YA 3FHTA 2BJHA 4YUAA 3W79A 2ZQYA 3ZE1B 2UYCA 4KOEC 4S1OA 4WBSA 1JHDA 3R7SA 4FFDA 4UU1A 5FRDA 2GRJA 3ROZA 1SNYA 2EFHB 4E0BA 5MF6A 1T6XA 1DAGA 3UJ3X 4B31A 3EQ6A 4KNVA 4GKBA 1IY2A 4OXKA 1BWPA 3MHTA 1M34A 3F96A 3HP1A 3WL8A 4CCAA 5AKGA 1FRVA 4N54A 2QX9A 3SQOA 4KYUA 1FNMA 2PMCA 2P5TB 4F5WA 1K92A 4Z54A 1WJGA 5HKOA 4DNQA 1XNQB 3AF4A 4YA6A 4KZPA 3WICA 4UUBA 1TOAA 2OD2A 3INNA 1EGVB 4OBXA 3W2HA 3UFXB 4RKYA 1QE0A 4IO1A 3P9RA 4J16C 3H9CA 1GKYA 1QFZA 1RS0A 1SCNE 3O1IC 5AOAA 3S2ZA 3UTCA 4EJ0A 4H0NA 1XTKA 2TSYB 3SE0A 1T8PA 4LMPA 3DDOA 4MZXA 5D3KA 1N75A 2QX8A 3BE6A 4C14A 2P41A 1Q7GA 4KREA 3AKZA 4K6OA 1PNTA 2WIJA 4ZXFA 3R5JA 4BVLA 2XDQB 1ENYA 1PF7E 2WTEA 3UM9A 4AZTA 2J31A 3ABOB 1U5BB 1ZM3A 3IVRA 1JMKC 3DMRA 5D3MA 3T9FA 3VTFA 3TECE 4KR2A 2NMVA 3PYMA 3G8DA 1MB2A 2CJXA 2X9VA 4G5XA 2IWHA 1WDTA 3SIPA 3ZWQA 4BMPB 4PG8A 4Z7OB 1U63A 1EP3B 2AWOA 4P80A 3FTDA 3L8CA 1O3YA 3UCEA 1SXQA 3HFJA 3BEOA 4C7XA 3L8EA 1IJEA 1LH0A 2HJWA 4YP1A 2BFFB 5THQA 1IY0A 2D2XA 4IXDA 1GTG1 1I4LD 3G8BA 2A52A 2OBXA 2IZ7A 1PL0A 3HNRA 3BXHA 1XTTA 4F5EA 5K0GA 3GLFA 1CQIB 2WUGA 4XYEA 2KYRA 1RJ9B 1KEZA 1SXGA 1YS1X 3IEXA 1ZESA 3Q9UA 1JTVA 3DQQA 4LOJA 4DG8A 1P2SA 3KQLA 4NBWA 1ISMA 5E1MA 1REQA 2FG5A 2J9FB 4LW8A 2FN4A 4MS4A 5F7ZA 2CYBA 2BEKA 1CZLA 3GVHA 4QHSA 4LRTB 3O8CA 1RC8A 2YW2A 1QIIA 4X1KB 1SUPA 1R0CA 2YDXA 1C30B 1P29A 3O83A 5DXFA 1H42A 1ACLA 1JPVA 3CEJA 5ABPA 1I2DA 1O94C 4CI0B 4CLHA 3VZBA 4P93A 4D4IA 1DBIA 2B5WA 3NOQA 2QSUA 3BJZA 3ISTA 2IHZA 2RB4A 1JVNA 2IDMA 2WD8A 3M5CA 4B6JA 2A9KA 2Q6LA 4ZANA 3WYDA 2BFBA 4BMZA 4DG5A 4F2PA 2FPMA 4OV6B 3VNVA 1AGRA 3LPAA 4KAXA 5G0TA 5CA1F 3RRFA 4KN9S 1RFGE 3OT5A 3FHOA 5BV8A 4LVNA 4DJAA 2WFZA 1YVDA 1H5UA 1YSCA 2FP3A 1KBQA 2I7DA 4JVSB 4TSFD 2AN9A 2G40A 4RY9A 1E7QA 3U4QB 3ZXIA 2Q1XA 3EMVA 2BKXA 2GD2A 3GXBA 4M76B 4UBMA 2X0FA 1WM1A 2QVZX 3N2EA 1JIIA 1P9RA 5CXQA 4EQ6B 3P1JA 2ZUBA 4L4RA 1NHGA 2BEWA 1GGNA 1DG9A 4BQNA 2OZEA 4CM4B 2H29A 1ZX1A 2B7CA 3ELWA 5DB4A 3ZY3A 4INZA 4RPGA 1I6MA 4F5YA 4NE9A 2D7CA 1HF3A 1NR7A 1KXZA 5ALPA 3REOA 5L4SA 1A2QA 2CUTA 4OJMX 5IJWA 1V39A 3R5SA 1WPQA 2ZZMA 2A0YA 4RY0A 1C3OA 3AVWA 1T0HB 3OJXA 2OZPA 2YMPA 4G01B 4LISA 3VI4B 4H1HA 1XCOA 4RF5A 1CQJA 1V11B 1D4OA 2G9UA 3H19A 5B1SA 4BO3A 2UVPA 1Z8NA 5B3JA 1OFTA 4JYBA 1H2YA 1T35A 4G0OA 4LMBA 1L1FA 1THGA 2WMYA 4RAOA 3P26A 1K8ZB 5H68A 2AG5A 2IS6A 3JYLA 3P9ZA 3D6NB 3L07A 2ID7A 4MLDA 1K1EA 4EY8A 4RJTA 3OM8A 2Y6VA 3B82A 1QH9A 2PUCA 1Z62A 5MFZA 1I7NA 2V1XA 4MV0A 3BERA 5HJ7A 3O8LA 1D1PA 5A5FA 3DEZA 2LTAA 1N6RA 1K8YB 5LZ4A 4FYYA 1NASA 4XFJA 2F9FA 4UEQA 5H8WA 4LY6A 3DHYA 2HK9A 1SVMA 4R1QA 5DFAA 1GN8A 3CVXA 5IH3A 1T3SA 1DXOA 2BZSA 2W6CX 4KN6A 5JXJA 1QP8A 5CT5A 2P4HX 4D9NA 4NOLA 1XJ0A 1RI4A 1BE0A 4E2YA 5IJ0B 3RU7A 2AMYA 4NULA 1I6WA 1BH6A 3S81A 4HDQB 4UTPA 5BMVB 2YXBA 4D3FA 2BR3A 4D8YA 1KKLA 2VDRB 4F3YA 3KD3A 4HEJA 1NUQA 4Y7DA 5JAIA 1II9A 4WEOA 4KXUA 1QRRA 3R8XA 1K7FB 3RHFA 3QKRA 1I94B 2B7LA 4GYWA 1EUZA 2X6RA 3JQ9C 1U1IA 3EAFA 4MV8A 5FV7A 2V7XA 2FN7A 3W8NA 3L0PA 4NDAA 2IW1A 5DJ5A 1MX9A 5JXHA 4KR7A 3KV3O 1B1AA 4TMWA 2E4UA 3DMTC 1UKVY 3U4GA 2GKSA 3QKIA 4L74A 4RF4A 1W87A 2X0KA 4Q3KA 4I3GA 2DUUA 1AS3A 1GG5A 2IYQA 2O4CA 1LI7A 2EW2A 1VJGA 1DJPA 1QLJA 2MSEB 2OLJA 1I9GA 3D3EA 3RUCA 4BP9A 2VTBB 2Z57A 4CMKA 4TZ6A 2A3NA 2EP5A 4RS4A 4XYMA 2ZCVA 3PUIA 1XCGB 4L5AA 5T64A 2JLVA 2F48A 4PG5A 4PFJA 2VYVD 2FR8C 1DQPA 4HS9A 1WKVA 1AK1A 1QM5A 1S2IA 4GP6A 2FW9A 4JR0A 4MS1A 4MAAA 5LB4A 3N9IA 3KT0A 4E15A 1FP4A 3KEMA 4UD6A 2EZTA 3D8RA 3QVTA 1X1BA 2NUAA 3EOBI 4WY2A 5GZ1A 1G8HA 1CEYA 1NDHA 2UUOA 1MZPA 3IMGA 4TTTS 3UMBA 1GG9A 3GFOA 3C74A 5HBGA 5LC1A 1NL3A 3HKCA 2D54A 5B6IA 2GETA 5CP8A 5K8JB 5C1BA 2PJUA 4QX6A 1JP7A 1Z0UA 2CNKA 2RARA 3PPYA 4QFBA 4FP9A 4E5DA 3CRQA 4JENA 4A27A 1RPAA 2JB9A 1OFUA 1FXWA 2BEJA 4WCDA 5J4HA 2OCIA 1OPRA 2WPDD 1MZVA 1WUKS 2C4VA 4G07A 4ZTZB 2XW6A 3V80A 1E9AA 2G25A 2O7RA 3DZBA 1KRWA 1IDOA 1QRAA 4LNUB 5H4HA 1XZLA 4KSCA 4BXOB 5KHOC 4MWGA 1H2ZA 5JS6A 5E9WA 5MN5A 1M2FA 1XRPA 2AI1A 4ECEA 2WKSA 1EBBA 2SBTA 3PWZA 3QUQA 1HFJA 1E6LA 1OFHA 1RBQA 1THTA 2DT8A 2IYTA 5FBRB 1P1FA 4BJ6A 4C2AA 5JYEA 5HP4A 1LLQA 1R27A 2B4KA 2HA5A 3B52X 4MUNA 2MR6A 2O1XA 3C1TA 5CVVA 2PMEA 3WB2A 4DR2B 2QF7A 3K9BA 4YQEA 5KYWA 4P83A 3EXHB 2PSJA 3DE6X 1I30A 2OXEA 3Q8XB 4J2TA 4OQ4A 1IN8A 4YAOA 3MJ4A 1X7XB 5C1DA 3EW9A 1COWD 1YU6A 3AB7A 3F8TA 1W4LA 1X8XA 5CX1B 3WB1A 2IHKA 2FW8A 1BIFA 2NZJA 2HSDA 5EYPA 3A4IA 1XV5A 4L27A 3DW3X 1L7DA 5CRIA 1F6WA 1LCIA 2JIDA 4ER0A 4OP2A 8AT1A 4D6PA 1OZ0A 4F97A 5EIEA 1DE0A 2P2SA 1BHJA 2ZJAA 3NATA 3QEOA 3R3XA 4WTOA 4B3BA 3VYWA 1E4YA 4DV4B 2Q0HA 1M2KA 2IUYA 3BRCA 121PA 4RH3A 2GA9A 4KWTA 1Q1QA 1YR6A 3U3JA 1E89A 2EG5A 2AFHE 2ZRQA 3O91A 1EE9A 4HFRA 2AG6A 3PYLA 4NU0A 4Q1BA 5BSRA 3VPBA 3WYCA 4B3XA 2IYUA 1N2CA 2FX5A 4F1WA 1G2QA 1M1YA 1DJLA 3FYHA 4HAOA 4I5IA 1SIOA 4UAGA 1SURA 2ZKLA 4BHTA 3B3GA 4PAOA 3IQHX 4Y8VA 1K6MA 3AGQA 1VL6A 2XNDD 2QTTA 4DHWA 5U1PA 1TO1E 1T0PA 1ZOIA 5LUAA 2JJ2A 4JLPA 2UXCB 4O4HA 3WKBA 1M10A 3WRYC 5DNDA 2G8LA 4QT0A 5JMOA 4JLOA 5K03A 2PGXA 5KKCA 3G59A 1GV0A 3HWRA 1NJ8A 3DDHA 3OWHA 3PF8A 2ZYWX 4UTVA 4ZYVA 1GTSA 2HCJB 1E60A 2OWDA 2PCJA 4D97A 4V0MA 4Q9HA 3STHA 3HVIA 5L40A 2Y67A 2CNLA 2ZYIA 2IELA 3SHQA 1XYVA 1ZKMA 2E6UX 4CR7A 1U3UA 1GZUA 2FVXA 3BJMA 1C8BA 4ZVNA 1RACA 3HRKA 2FFQA 1ZZGA 3B48A 3JY6A 4EB3A 3QLJA 3U1TA 1KJWA 4NZMA 4ZVOA 4BKPA 4OJYA 2GDZA 4X3CA 3H5WA 3KNZA 2H63A 2CLEB 1SU7A 2Z95A 5D86A 3SF8A 5DBGA 4DSUA 1YOBA 4II3A 3KQWA 5HF5A 4BRUA 1IHDA 2GZRA 3H7IA 3V4ZA 4BS9A 1DJMA 1C3VA 3BYZA 4DR6B 4PO3X 2OKGA 2JFWA 3HCPA 1EUCB 3I2IA 3N6VA 3VC3A 3VSAA 3C15C 4QAQA 2X5NA 3DGFC 3RGWS 1E7RA 4L72A 2CBGA 3NAGA 4UNQA 3KUDA 1QAMA 3IT3A 3MTDA 3K92A 3AF0A 2FDRA 1NPDA 4PZPA 4CMEA 2Y66A 2QPLA 1ZOOA 2Q4TA 1F2UB 3LJKA 1WMSA 5IC6A 4CFSA 2XUZA 1M6HA 1TM1E 2YX1A 1QVRA 1C4WA 1OVMA 3L7DA 1M33A 3NRJA 1KVUA 1VKHA 4C89A 4EZBA 3AUSA 1FXWF 4TN1A 4Q39A 1UDWA 1MXFA 2HX1A 3AIMA 3KBBA 4MMYB 1ZH0A 2ZB4A 1XEWX 1MVOA 1S1MA 3AFOA 4P5PA 5AHKA 3VPGA 4IZHA 4KIFA 1ONSA 2PZ8A 1NYLA 1R8YA 5HQ3B 3RVPA 1S2NA 3OIGA 1MF7A 1XJWA 1C8VB 2F62A 2C8LA 2X4DA 4KRYA 4PBTA 1ELOA 3IT1A 3RRMA 3U44A 3ADKA 1PAUA 2V0CA 4HEHA 5EJMA 1N5KA 4LRSB 3RS8A 3HA3A 4L9WA 5EGNA 1J33A 3K2QA 1N7GA 3A6EA 2YWCA 2D13A 1CS4C 1PSZA 2CNWD 2O8NA 3L49A 3NETA 3P0IA 3W5JA 1J8VA 3K31A 3PITA 4RKWA 4L0CA 3S1SA 2V7UA 3MUFA 3RSLA 5H59A 3C7TA 2H1OA 1UXIA 4OQDA 4K9RA 4B3FX 1V1JA 3QVGA 4AMYA 1QRSA 1L5OA 1J20A 1NYQA 2H65A 3TIGA 3U4CA 4F4FA 4HPWA 1JECA 2WJHA 5FOTA 1PV2A 3CZRA 3RB8A 1IPFA 1P3Y1 4FHZA 4YV7A 1IHPA 3MILA 4OHXA 1J39A 3KYIB 3OZGA 4MO2A 4FGKA 4AZ0B 2H4JA 2J5XA 2JBWA 2PV7A 2XNHA 3PSHA 5CITA 4U3JB 2XYGA 3CB2A 4GECA 4JSRA 1L7MA 1ZBDA 3JVUA