3IUEA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(5-methylpyridin-2-ylsulfonylcarbamoyl)-1h-indol-1-yl) acetic acid
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 94
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iueA01
2PZBA 3FY4A 4DDHA 2WQ7A 1KH3A 4UZEA 3CLRD 4NX2A 4CDNA 3I05A 4JZYA 3IOEA 2A84A 2QUIA 1PG2A 2A1UB 1IH8A 3CLRC 4ZT3A 4YP6A 5KHAA 2PFSA 1M8FA 5LLTA 2QJFA 1VBNA 5FO0A 2XRZA 3P0IA 1I6LA 3CLSC 4CT0A 3UY4A 1VBKA 4DNXA 4ND6A 1VL2A 3KT8A 3COVA 3ZXIA 4ZCQA 3X1MA 3IUBA 4JXXA 4L2IA 1KQNA 3H9CA 1KP3A 1IQUA 1JHDA 1WJGA 5IHXA 4ZT2A 4EG6A 3PRHA 2QTRA 3HFJA 4MVWA 1MAUA 1ULHA 2J4DA 1O96B 2QJOA 3FG9A 3L92A 4RPIA 1KQPA 3GLVA 1PFYA 4EG7A 1KP2A 5LM3A 3NBKA 2QUHA 4WSOA 1F7UA 2AKEA 4J75A 1H3EA 1OWMA 5H7XA 2QTMA 1K92A 2BTEA 2E21A 2CYAA 3KT0A 1OWLA 1HYBA 3ND7A 1MB2A 4CDMA 3CVUA 3IMCA 4Q16A 2VTBB 3N2YA 1EUQA 1YIAA 1GTSA 3ND6A 1YULA 4KPUB 1GTRA 2DETA 4OJMX 4MLPA 1G8HA 4AQ7A 1MC1A 1TFUA 2ZP1A 2ZUFA 1EUYA 3A05A 1A8HA 3X1JA 4EGAA 4KR6A 2G36A 1FFYA 3MLAA 1EXDA 3D6UA 1KQOA 1K97A 2A1UA 4NAHA 4EG1A 1IQ0A 2IJGX 3A4IA 4MW5A 3ZJTA 5DEOA 4JXZA 5J58A 1M8KA 4TS1A 3ND5A 3SZ3A 1N75A 3PNYA 1CT9A 3PNVA 2DUMA 4MW9A 2EL7A 4ZCRA 1F7VA 1JZQA 4U8HA 1V8FA 4I6JA 3ZJUA 3U1VA 1ZUNA 2QJTA 1JMVA 3H99A 3K9WA 3P0JA 4J76A 1EJ2A 4MAFA 3IUEA 1KH2A 3ZUGA 1H1TA 1TEZA 4PBRA 3TZEA 4ZCPA 5TS2A 4U63A 2DEUA 2CYBA 1PFUA 1QNFA 1LW7A 1TYCA 1QRUA 3MUEA 2WQ6A 1YI8A 2CT8A 3C8ZA 2ZUEA 1J21A 5FO1A 2WSIA 1NUQA 1O96A 4KR7A 3UMVA 4MUKA 1M83A 1XJQA 4YP5A 5J5AA 3S3TA 3AL0C 1O97D 2QTNA 5EKDA 1MB9A 1J1ZA 1EFVB 3G6KA 4MWDA 2HGZA 2V0GA 3KFLA 4MVYA 1KAMA 2PIDA 4HK4A 3FDXA 4MQ6A 2I1LA 2PG3A 5DASA 1O95C 4WNYA 1MBZA 4JYZA 1F9AA 1GZUA 2O8VA 2GM3A 1M8PA 2VTBA 2NZ2A 4OUDA 2JA2A 2Z09A 3FHJA 1EFPB 1KH1A 2AZXA 1B6TA 2GOYA 1KR2A 3DLAA 1COZA 3PXUA 1X8XA 1T9GS 3X1KA 1GAXA 3F3MA 3SEQA 3NBAA 1NUPA 4MUGA 2RD2A 1Q19A 4JFAA 3RJZA 1KAQA 3TQIA 2OV4A 3DV2A 4XFJA 2WB2A 4MUFA 4Q93A 4ZCSA 3TQOA 1JIJA 3KT6A 5DB4A 1JZSA 4DDMA 2YWBA 3FIUA 1XNGA 1OBHA 2E18A 4MW7A 3DO8A 4ZCTA 5BNZA 4KR9A 1WOYA 2V0CA 1WXHA 2X1MA 1M1ZA 4BWVA 1MJHA 2EJCA 3Q12A 3HGMA 3FH0A 3HV0A 1H3FA 1NSYA 3COZA 2C5SA 1NUTA 4CQNA 2H2AA 3IVCA 2GKSA 1M8JA 4DE5A 2CV0A 1GPMA 1MOPA 3LOQA 2J5BA 2X1LA 4QBTA 2TS1A 2DERA 3JXEA 2HMAA 3H05A 1QRSA 2QUKA 3FETA 3AG6A 1TYBE 2OQ2A 4KKVA 1LI5A 3A04A 2BYTA 4NDAA 2J08A 2XRYA 4ZT5A 3AKZA 1K4KA 1WXEA 3H9BA 3COWA 1EFVA 1WY5A 3SP1A 1XNHA 1QJCA 2A7XA 4UZFA 1WZ2A 2NSYA 3AG5A 4I6GA 4EG8A 4MVCA 3FWKA 4MW4A 3SEZA 4PBTA 3CVWA 1EE1A 4G5FA 3UOWA 1EFPA 4XSVA 3RK1A 3P52A 3IMEA 1PFVA 1YUMA 2D54A 4I6EA 4R0NA 4L2IB 4DJAA 3N9IA 4MW1A 2Z3VA 5J59A 3OTWA 3AIIA 2RE8A 1I6KA 4EF6A 1LI7A 1I2DA 1PG0A 3IH5A 3FOCA 1T6YA 3IVXA 3GUZA 4G6ZA 1N77A 3L93A 1IVSA 1WXIA 1V47A 4S1OA 1T9GR 1N2EA 1JEEA 1Q15A 4DDKA 2PZ8A 1G8GA 4U7JA 1N1DA 4E1AA 1D2RA 1PFWA 1VBMA 2A1TS 1O97C 3IVGA 4GRIA 5LFAA 3MMXA 2HZ7A 4MWCA 3ZJVA 2E89A 3P0HA 2DPLA 4PY2A 1O94D 1QQTA 3IOBA 2A88A 2IELA 1TYAE 1X6VA 1U0BB 4ARCA 4MW6A 4K0RA 2CFOA 3CR8A 3RBAA 1R6TA 1O94C 2VXOA 4QREA 3TS1A 2QUJA 3N8HA 1N2BA 3H97A 4G5YA 1U7XA 1N2GA 5AHWA 4KPUA 5K0SA 4ND7A 1JGTA 1IHOA 1IFXA 1U3CA 4AS1A 2PXHA 3CVXA 3LCJA 1N3LA 1WQ3A 5KCMA 4YMIA 5HUHA 2JAXA 2X0KA 4ZT4A 2DXIA 4MUNA 1KKUA 4YBRA 3SDBA 3CLUD 1N2JA 4MVXA 1TYDE 4RUKA 1JIIA 3CLSD 1NUUA 3Q4GA 3E27A 3RFFA 4A91A 1WKBA 3VU8A 4R2MA 1K4MA 3CLUC 4NZPA 5HG0A 5K0TA 3HZRA 1J09A 4EG3A 2A86A 3Q10A 4F4HA 5TEWA 1U3DA 2PZAA 4HJXA 1N78A 2CYCA 3LE8A 1MAWA 1TQ8A 2R5WA 1N2HA 5TEVA 1Q11A 2CV1A 1ZJWA 1O5TA 4MW0A 4EG4A 1O0CA 1G8FA 1KORA 2YWCA 3DPIA 3INNA 2DR2A 4ARIA 1S4MA 4FZJA 4QRDA 4XFDA 1IRXA 3ELBA 4P2BA 3ZXSA 1NP7A 3IDFA 4EFKA 1F4LA 4MW2A 3IMGA 3K32A 1ILEA 1FYDA 5FNZA 4MUIA 1OWNA 1OWOA 2YY5A 4MUJA 1DNPA 4MWEA 1H3NA 3VRHA 1T6XA 1JECA 4MULA 2E0IA 4MUEA 2CSXA 1NYLA 3G59A 1J70A 4YP7A 3A2KA 1WXGA 3AFHA 3FNRA 2D5BA 3HL4A 2D13A 3D6VA 1Y42X 4OUDB 1IQRA 2CUZA 4K03A 1NI5A 1NUSA 3COYA 1XNJA 4PBSA 4HJRA 2H29A 4MUHA 1O6BA 3RK0A 3ZIUA 4GU5A 4NAUA 1SURA 1QRTA 1VLHA 1JIKA 3UK2A 1NURA 3CVVA 1R6XA 1U7DA 3MXTA 1QU3A 3QTTA 1T6ZA 3CVYA 3PNBA 1R6UA 2A1TR 3QTBA 1N2IA 2J09A 4HPWA 3SZGA 3M5WA 1YIDA 1WQ4A 3ILVA 2B7LA 2IP1A 1P7PA 1YUNA 1QU2A 3HMQA 2YXNA 5HUJA 5DK4A 2O5RA 4R2LA 1Q77A 1UFVA 3GMIA 3N05A 3ZGZA 3MLBA 2JANA 3G5AA 3OP1A 5H16A 2CV2A 1I6MA 4F3RA 2Z08A 3BL5A 3ISJA 3SYTA 3CA8A 3QE4A 2DLCX 1QTQA 1GN8A 2AG6A 5TGTA 3IOCA 3RHSA 1NZJA 1GLNA 1RQGA 1BS2A 1G59A 1JILA 1JEDA 1O0BA 1MRZA 2A4MA 1OWPA 4DLPA 4X0EA 1M8GA 1N2OA 3UC5A 5KWVA 5IJXA 4ZT6A 1WXFA 4EG5A 2X3FA 1ZH0A 3FI0A 4ZT7A 4NATA 3TZLA 4H3SA 3NV7A 3CLTD 3TNJA 1OBCA 1ZH6A 1J20A 1OD6A 3VGJA 4MWBA 5F23A 3KT3A 5JBNA 3CLTC 3IODA 2J07A 1J1UA 1O95D
chains in the Genus database with same CATH superfamily
4QICA 1N5IA 3V1LA 3WDKA 2A56A 5EZ6B 1L5ZA 1IONA 4ZCLA 4ZANA 3ZKWB 4DV1B 1FUUA 1RAGA 3CCBA 1ONPA 2I03A 3NPMA 4RSRA 3UUFA 1CDDA 1E7QA 2CD9A 2ZAGA 2ZYUX 3K15A 5KHAA 5CFRA 5JATA 3UFBA 4RHTA 1VBNA 4BEJA 2JJQA 2PX5A 3T5PA 4TQ9A 3FGZA 3NO4A 8GPBA 4P80A 3LG2A 4GBED 1FX0A 1N3YA 3D8SA 3P0RA 1UWVA 3S27A 4BIIA 5IN5A 2FMHA 3S1AA 1E6KA 1XAJA 3KT8A 3LT2A 3C3DA 4R51A 1I30A 1EHYA 3MTEA 4V1CI 2GRUA 4Q1EA 3OOHA 4ZCQA 4JXXA 5KTRA 4J1NA 2DUJA 1C4WA 1KY4A 1NMZA 3AL3A 4MICA 2FEKA 4PRYA 1JB1A 1ZVJA 3U5TA 2C5LA 3CGGA 3HFJA 4PG6A 3O2NA 1L5YA 4UNQA 1D1QA 3U7IA 2YS6A 4DZTA 2QN7A 1YQEA 2WD9A 2O8BB 2VJAA 4FC7A 1DAEA 4PZCA 2C58A 5AQEA 3B48A 4GZMA 2Q45A 5IDXA 1NNUA 1XTJA 1W2GA 3DFKA 2A4KA 4INZA 1RSZA 2OD2A 5C4MA 4Q05A 3ZVRA 3DE4X 1BROA 2C4UA 5AKYA 4UCWA 4WADA 5E3IA 2GBFA 3DOIA 4WSOA 4QUDA 4CL0A 5BWNA 4NU5A 4RD6A 4RIFA 1N0UA 1OPXA 1MABB 2O0JA 4JLNA 5EXSA 3CNHA 2WM9B 2VQFB 3NHRA 2XMDA 4NS1A 1BXRB 1GGMA 4R3UC 3HVRA 1FYEA 1M2KA 1FNDA 3X2EA 5B58C 1PQWA 2QD1A 5E95A 1NJ5A 2AFHA 3T1OA 4FTWA 2QB5A 5FJIA 2QYOA 4EHHA 1TTTA 1ONSA 2JZNA 2GPNA 3MD9A 3OCZA 1GPLA 2EBHX 3HKBA 2NU6B 3DFMA 4BMVA 4KE7A 4Z7OB 1NDHA 2FPRA 3LQKA 4WLUA 1OHHA 3GFQA 3M1IA 2HSGA 2YICA 4K1XA 1LBHA 3WIVA 3EEYA 2DFVA 3AVPA 4Y9TA 1H8HD 1GPDG 2OYSA 4JI7B 4PX9A 4XGNA 2DQSA 3WK9A 3GA5A 4A0GA 3F71A 2VZ9A 1IZYA 1SWVA 2KI5A 2WHRA 2XGGA 3I9NA 1BMQA 3TAXA 3FCEA 2M6LA 4DLTA 2XUJA 4TVSA 2XYRA 1JHZA 4BLSA 4UCQA 1QK3A 3DL2A 1JKJB 2SKEA 1XEWX 3C8DA 3HN7A 4IX9A 5DHTA 3S2ZA 4U6QA 3W9SA 4DSTA 4E94A 3SHQA 3P9CA 3MT0A 3PYMA 1QP7A 5D3ZA 1WCIB 4KTTE 3SEFA 1L5SA 3K70B 2GLUA 1EZ1A 5BVGA 1W5EA 4NZNA 4A2QA 1USGA 3GBSA 3UCXA 3EZFA 1X39A 2ZS7A 3EXG1 3IAUA 4A82A 2EP8A 1GD1O 3WQRA 2O7NA 2XNJA 1RJGA 3JQBA 1HY3A 3SZ3A 5LOVF 3HY6A 3V97A 1H2ZA 2UYHA 4ENVA 5F2EA 3UHAA 2ZCJA 1BDMA 2FUCA 1PVDA 2VAWA 4IF4A 1OYOA 2H9YA 5AO9A 2R8XA 4EABA 1CRLA 5WRFA 3S7ZA 5L3QB 2GTPA 3NTVA 1MDBA 1E3IA 4S2EA 3RRZA 3UH0A 4E3ZA 3RFUA 4PHCA 2C7QA 3RUIA 2PGJA 3OM8A 3PQDA 4OHBA 3ZS8A 4YRBA 4IXJA 3HDYA 2VUUA 2ORWA 3NHKA 4B46A 1G38A 1ZC3A 2J85A 1WTCA 4G1FA 5TMEA 4R1NA 3F98A 2QE7D 3D2AA 4GEKA 1J21A 5FO1A 1UDWA 1PF7E 1D09A 5LQDA 1XVUA 3GJ6A 3ZHSA 3QG5A 2O20A 5EIFA 5HQTA 2OGWA 2B69A 4U7GA 3W5BA 3AL0C 5KTKA 3FOFC 1RLUA 4BCCA 1U0RA 3EEIA 1MB9A 4KLRA 1REQA 4PSKA 2QJWA 4Z1MD 4D7AA 2XXBA 4KQCA 2VRNA 1EK6A 2RGWA 3DZDA 1NPDA 1QDUA 4ILEA 4RF2A 3R7BA 1KAMA 3VNRA 1N9GA 3W1WA 5DASA 3RAPR 3UAXA 4CMIB 1Q83A 2IEIA 2HRZA 1XD2A 2W2MA 3LT4A 2B1IA 4UXIA 3KVNA 5DTIA 4JI4B 3BTOA 1H2AS 1T36B 4RZUA 1DPGA 1ZKMA 5ADWA 3OCJA 4PO1A 3DC7A 1B6RA 1ZL2A 4O8ZA 5GGYA 4OUDA 4R81A 4C08A 1T26A 2P4SA 4DQ0A 2PRJA 3WL7A 2LWIA 4IR7A 3BA1A 4QYTA 1GQFA 3WMGA 1UKYA 2AL7A 4MYSA 4YHHB 5BWMA 3SR0A 5AM1A 1T9GS 4RKQA 1Y3CE 3NDRA 1FPQA 5EJMA 1C7ZA 1P6UA 1VCNA 2IYUA 1T2VA 1A2BA 3D43A 2RJNA 3AESA 4RTNA 1TMOA 4MUGA 1AUVA 4Q37A 4OCZA 2WB2A 1LBTA 3EF0A 3AW8A 2L19A 4P83A 5FWYB 4RQAA 3C4VA 3IAAA 4NV0A 2ZJYA 4E4TA 6REQA 4YFVA 1GZ6A 3IR7A 3OOEA 1YDWA 4I8XA 3TPFA 4PU0A 2NXEA 5LQKA 4HUQA 1T34A 3FNQA 5BW4A 2Q5IA 3F4LA 3H5LA 3NB0A 5DBEX 1JDBC 2LUOA 3I76A 4YWJA 4CM8A 1R0CA 2FHPA 1E18A 2XWSA 3DT6A 4WUTA 1WXHA 3V8RA 4C1NA 6LDHA 4JI0B 1OFIA 4ES6A 1EB8A 1WVIA 4XE5A 4CLDA 4MA4A 1Q0ZA 4XM2A 4AY5A 3HKEB 4KQ1A 2C0PA 4RCYA 5C46F 5EJ8A 2Q1YA 2ZE8A 4CQNA 2FAXA 4ZYUA 2B4TO 3HB7A 4QXPA 2C1XA 5KX5F 1GRVA 1M7HA 2JEOA 3NG1A 3PDIB 3DZGA 3ROPA 1JEYA 4QYWA 1X80B 2WAYA 2XVXA 4AZ0B 1I94B 4KDEA 4R1TA 3IBSA 2OZVA 2NUTB 3B89A 3LO5A 4OQZA 3H05A 2VHWA 3MF4A 2AOUB 1IHPA 2XQIA 1L5FA 1QX4A 3PQ2A 5EE5B 3EA0A 5LNK6 3M89A 4EFNA 4HDMB 1RWPA 4HQ0A 3QKSA 3IIJA 4KKVA 5B1DA 4JOCA 4FZ3A 2FEWB 4OM8A 1LI5A 1E2PA 3ZWVA 5DHPA 1Q7GA 2WD7A 3GJZA 3DYIA 2XB6A 1ZD8A 1EWKA 4W8OA 1W1UA 1D0SA 1JVNA 2GDZA 3LX6A 4L5CA 4NQRA 4PAMA 5FBWB 3AKCA 3PI7A 4ARUA 4EB6A 1KDVA 5DP1A 2HV9A 3SLRA 2ZSFA 3QQ5A 2D0OB 2BZ0A 4U2GA 1Z17A 1GAWA 1TQ4A 2YWFA 3S99A 2WWGA 1KJZA 2VZLA 1CJTC 4LHVA 3EGXB 4BRWA 3NIDB 2PMKA 3A1TA 3LX8A 2XXAB 4KR0A 3RT1A 5CR9A 1GIAA 2Q7DA 5ANRB 3UOWA 4C76A 1Z82A 3AF0A 1W85B 3D9QX 3KJNA 4WE3A 5ALXA 1YRLA 4KQ6A 4DYDA 2ZTSA 1IXKA 2BF4A 2JFFA 2PMDA 3HCCA 1T3LA 1N7JA 3LYUA 4Q12A 4R0NA 3ZJ4A 1OXTA 1TUGA 4BCDA 3GJSA 4B85A 3ZNQA 3AWDA 4XWYA 4H7PA 2XHEA 4TSRA 2JPDA 2X1VA 2GZRA 3ZE1B 2IYNA 1ETHA 1ZMRA 2YFKA 3C8UA 3D3QA 3FVVA 4GLJA 2XMPA 1JQLB 4LWZA 5FD8A 3FOCA 1T6YA 3QIVA 4O6VA 5L3RA 1GGEA 5HFNA 2R2GA 4GR4A 1RXEA 5IKOA 4PRKA 3V55A 4WAUA 4G0ZA 4J6FA 4QUAA 1DDOA 2AMLA 3K0SA 3SQXA 4PQEA 3TW8A 1A96A 1A9XB 4ZOEA 2RI1A 1OAOA 1Y8AA 2TRSB 1U8YA 3P2MA 3JQAB 4KYVA 2RCYA 2O8DA 2O2EA 2PLNA 1MIOA 5DM0A 4G9GA 1XCOA 2IGBA 3CRNA 3M9LA 2WPDA 3FYUB 3NNNA 2XMQA 4IDCA 4J16A 4M1OA 4I8IA 1FBTA 4E1AA 1Z4NA 3V1MA 2F3UA 4PGHA 2GBIA 3CSSA 4X63A 3ABSB 3IVGA 5ELMA 2R68A 1KO1A 1BNCA 1T3TA 2GHRA 1YU9A 5LQUA 1GP2A 4D74A 1S9DA 1LX7A 2G09A 3C87A 3M3HA 4HAOA 1Z5UA 5DSZA 1OAAA 1RFGE 4B4UA 4IWXA 4DR2B 1WG8A 3WV4A 5KKCA 2J0QA 1YOBA 3JD3A 4MW6A 3GVCA 4K0RA 1KK3A 3O95A 1MB3A 4IWNA 4AJEA 5BWOA 3GGGA 1W5SA 5JI3E 2IPAB 3IEKA 4L8GA 3TTTA 3WQBA 2FEAA 4PPGA 2EKQA 1S2DA 2J7KA 2YHUA 3FRJA 3KVOA 4OL0A 1RM5A 5D3MB 5FF9A 1KSGA 4B81A 2Q27A 4N03A 2XCTB 3FCAA 3HK2A 4JJIA 2CW5A 4QHSA 2H85A 4B4DA 2O7SA 1BHO1 3F74A 2IZ7A 4KQJA 2GJ8A 4TX1A 5MN6A 5JJ5A 4CKEA 1HBJA 4M3NA 4UVGA 3H3JA 1E20A 2FG5A 3ETHA 1XTTA 3GPBA 3U48A 1VHTA 4EX7A 3J80A 2DQYA 1XMQB 2R60A 5KCMA 3TSZA 3VU0A 1TEVA 1TJYA 2B9EA 2ID7A 4YMHA 4MB0A 1V11B 1Z68A 4DZZA 1E5VA 5IC6A 4A91A 1TI7A 1HSZA 2N9UA 4AULA 1E3DA 3ZHBA 1WKBA 1YHZA 1YZNA 2WIKA 4NZPA 2M6RA 4EO7A 3UJNA 2JATA 4PHHA 2R8EA 1KY3A 2C9ZA 2ZRCA 4PQFA 2QMUA 3WGYA 3S5JA 4V02A 2CYCA 2KHZA 4D79A 2QR3A 4FW9A 3WO1A 5CDGA 1AQJA 4UPVA 3QSGA 3KKZA 3RRYA 1YMVA 4RAQA 2AOXA 4WLVA 1TL7C 2DCMA 3ZS9A 2EDAA 2ZYRA 1H4TA 1WSDA 2J87A 2WMNB 3A32A 1QOQB 1SK8A 2HW8A 1C0KA 2J5RA 5B6IA 1WQ1R 2QW0X 4YJGB 3F2IA 1PR4A 4BGIA 3SKVA 2FDCA 3ELBA 2YDXA 5EPUA 3F5DA 3PNSA 1F8FA 4Q03A 3OX4A 2XOEA 2AQKA 3FOAA 5CVVA 3U9LA 2PJDA 3EIWA 1JFLA 1F4LA 1XZMA 2VF7A 3IA2A 1TU4A 3K32A 2BFBA 1HE8B 2AJDA 3WDLA 1WPRA 4UD2A 3B82A 4IFEA 1FJ2A 4OOEA 3R41A 3RRXA 2NSHA 3R7AA 4ACBA 1K88A 2G9UA 2OECA 3FWHA 4MYHA 3FUVA 3HSYA 2BFFA 3VRHA 4CEJB 2VT2A 3DOJA 4FOSA 2HQBA 1X0XA 1H5QA 5FTJA 4AG3A 4C4AA 1E7MA 2YIVX 2OCAA 3TINA 4GQAA 4X3CA 1R9JA 3FTNA 1M73E 2CD7A 3TNFA 4EHIA 2PX0A 2O2YA 3I9OA 4KO3S 4Y0VA 1HRDA 3D6VA 4PSCA 1TZCA 1R5BA 1C1YA 2CFSA 2CUZA 3M83A 4HEHA 4C05A 3L40A 4CL2A 1CDEA 1XKXA 4HJRA 1X70A 2QTLA 4XR9A 3RK0A 3T3HA 4CGYA 2A52A 2IUYA 5AXDA 4C87A 3A3NA 1JXOA 3EOAI 2O6HA 4WX2B 2P9EA 1PT7A 4WEOA 5FPQA 5JQGB 1QRTA 1OF1A 3DHVA 4ZYYA 3CVVA 2O8FA 3EOBI 3HKCB 4P3PA 2NYAA 1WZCA 3FGOA 4KR2A 2JAHA 2F43B 2P2CA 4RZHA 3H87A 4KHZA 4Q7EA 5EP3A 2XTMA 3PYLA 4S2UA 2O3SA 2P4QA 4LXQA 4PG5A 4QDTA 4QPCA 4WKNA 2ZI7A 1VCIA 1P72A 2BR3A 1YCFA 2GUWA 2JFHA 2ZJOA 2H1IA 4W5WA 1VKOA 1BMDA 1PJAA 5IJ0B 3DAGA 5DU2A 2PMFA 4BVAA 1RDFA 2FWMX 2NO6A 4CLXA 2YXNA 3EXIA 2J45A 1VHJA 3I8OA 2GA8A 3W1EA 2R85A 4AKGA 2VJNA 2PVPA 3UK1A 3ESDA 4BKMA 3B53X 4W9RA 5TPWB 3LWZA 2AK2A 3D3WB 3PNLA 4PX3A 3PR3A 2EATA 1GUBA 3SG0A 3FLAA 4JFRA 4BV8A 5CD1A 3RCBA 1L1FA 4WN9A 1X94A 1KHHA 3P19A 1MJFA 3E1SA 3E7XA 4O4JA 2PZJA 4TXJA 1DEHA 1VXRA 4YJ3B 3ZX5A 1SRQA 5JD4A 2DLCX 1A4XA 3DEIA 2FP4B 3DZBA 1Z06A 3OFVA 4O4LA 5EGSA 4DA4A 1UFKA 4KIFA 4KU4A 2FDXA 5U4QA 5CLGA 1J2JA 5EIAA 4HBGA 2PANA 2DSTA 3WGUA 3IEUA 1AMOA 1NNEA 4YN3A 2H1SA 2I67A 4P4LA 3C6YA 4WXHA 4Y6RA 5K0BA 4EA8A 4W5RA 3DEZA 3IUNA 4Q3BA 4ZT7A 5H70A 2D6FA 2J3MA 2YJ5A 1HQKA 1ZSVA 1N34B 5H5JA 2GEBA 4ENPA 2IUEA 3ER8A 3NHFA 1QOPB 4O4HB 3EW7A 1DC5A 5C3UA 2BFCA 3GOHA 3V1KA 1JG7A 5ALQA 3IV7A 3TRHA 1E6LA 4EVSA 1G66A 4TM8A 1ZK3A 1DI0A 1IVYA 1J25A 1WOMA 1J49A 3T12A 1JLLB 3RIXA 4ZK6A 4DDHA 3DMTC 2X58A 4KXVA 5E4JA 5CT8A 5B4TA 3LHDA 2X0RA 2QMZA 1ESDA 3CX4A 3NP9A 3G1TA 1V5EA 3M2PA 1CF2O 3KO8A 2G2SA 3LPCA 4YRCA 4A1FA 3WS7A 4CT0A 2O7QA 2II6A 1NOKA 2NX2A 1DAMA 1BXKA 1YB5A 2C04A 5T3YA 1UADA 1OXMA 2EWWA 2QJFA 2EBWA 2QN9A 2PXXA 3KQVA 3NXKA 4NHEA 1V43A 1XFDA 4YPFA 4JU8A 3HG7A 2GAIA 3BCRA 3KL2A 2O2CA 3DBVO 2XCUA 3PFKA 4LMRA 5LR6A 3I73A 2GVZC 4MKXA 2KB0A 3G88A 1QVAA 4OXIA 1NVFA 2GX6A 2XDYA 1NU6A 2ID4A 3N6XA 4B6RA 4DGQA 4WBNA 2ECKA 3D1LA 3V4VB 1Z7BA 1OFUX 5CAEA 1OUMA 1FYWA 2ORYA 4NZMA 1C3OA 2WPDD 4PO3X 1PFQA 3CSDA 1HRKA 2Z1NA 3B13B 1QONA 1V45E 2WA1A 2R1VB 1KQNA 3RRFA 2WKRA 3N59A 3USCS 2PGAA 1E32A 1LWNA 4EG6A 4CDRA 5IAJA 4X7RA 1XMPA 4DHWA 2PSFA 2WZBA 5K4GA 1YNOA 4WVFA 1NATA 4FS3A 1ORVA 4E5UA 3O4HA 3NVDA 2EP5A 3V33A 3HKDA 5AW1A 1BO6A 4Y0AA 3L46A 4J0GA 4B31A 1QHHB 2GN9A 4GPAA 1TK3A 1B74A 2HDHA 4ME6A 5DTQA 4AG5A 2R8BA 5IC4A 4H4EA 3OQNA 5KTMA 4JB8A 2AKEA 4FHCA 3JYOA 2RK4A 3PGXA 4ECAA 1JZTA 4EFLA 2E37A 3W0LB 1YTUA 5KPJA 1E0KA 1IM2A 4D0NA 4DVGA 1U1EA 3IJPA 1D6JA 3HU5A 5JSZA 3MJVA 2HGSA 3QEMB 4XUCA 3V4SA 3IP7A 3WYNA 4E31A 1PUJA 4DR3B 3H1PA 3X0DA 3BWVA 3CVUA 1WABA 4GC9A 4BMXA 4ZN6A 2PAAA 3L0SA 4MDFA 3ADDA 2B5OA 5JS2A 1M54A 1QPBA 4MTCA 3P9SA 4O5AA 5H02A 2IIQA 4RADA 2QL6A 2BFMA 1PT6A 2AI1A 5EIBC 2PFGA 2VZ8A 1DINA 3E5HA 3MMSA 4QBGB 2OD9A 1UXGA 2Y05A 1DCMA 3QEKA 4R2JA 1NW4A 3NM5A 3PKJA 3KQLA 5LKAA 2HLPA 3ISTA 2CNNA 3PEVA 4IEIA 1J0EA 4JZKA 2FZ5A 4R7ZA 1K3FA 3W78A 3X1JA 4QVKA 2CHGA 2GO7A 4LKOA 1ECPA 5IUNC 3TDNA 3GLHE 4B17A 1MENA 4IS2A 2GEFA 1MAVA 1I36A 1Z5WA 2DOKA 2EFHB 1NV9A 5AHKA 2CXSA 4G09A 4FW8A 3K9LA 4IEFB 4OHOA 1G63A 5K0NA 3T7JA 6AT1A 3EQ9A 3PYXA 4B76A 5LDHA 4EZBA 2PYDA 4DMCA 1HOXA 1Y4AE 1KI6A 1MX3A 3MQ2A 2YN2A 4XQ0A 1NZFA 4CE6A 4Q02A 3ZJTA 1ZKDA 4HGRA 4G1BA 4AP6A 3THXB 4TVOA 1AK2A 2VDKB 3EHDA 3TBKA 2WKWA 3CR7A 4IDOA 3CH5A 3OIYA 3C4JA 3C6ZA 3OLWA 4HGOA 2I6FA 1WSBA 2DUMA 4Q4HA 4G0QA 5E8RA 5SZHB 3WYEA 4D3YA 4WJLA 4PQGA 5PGMA 5EIEA 3PNOA 2FUKA 2WJZB 2NPIA 2WIDA 5J2UB 1Q0LA 3U1VA 4EW2A 5I9NA 2J6HA 1XXLA 2IOHA 2IU4A 4J76A 4JXJA 4ZRMA 1KH2A 2QSUA 5LA6B 3GYBA 2J5XA 4U00A 5C2JB 4I36A 3SS9X 3P96A 5HKLA 1FU8A 2GASA 3B6EA 1JT2A 4WNIA 1FMTA 2BMFA 4AAYA 1T0BA 4DANA 5HWSA 4IDAA 4IIYA 2C94A 4KDCA 2GGSA 4FDUA 1NG9A 3ORSA 3EISA 1JPNA 3WKDA 2W0MA 3GG2A 1OI3A 3T0IA 2ZUEA 1KARA 3L8EA 5IAGA 4PZYA 4Z86A 3KKMA 2RHOA 2HRBA 2LVBA 3G9XA 5CVDA 1M83A 2FUNB 3DWEX 3HCNA 3TRIA 4TLDA 1O97D 4DC9A 4N54A 5IANA 4JASB 4FR2A 2SBTA 2R97A 1QGED 2P9YA 4AMGA 5AH0A 3NHBA 5ALFA 1BN6A 1R0YA 1YCGA 3D7KA 2G9QA 4BMYA 4TT3D 3JASB 4WY2A 5ITZA 1J2TA 3RO7A 3V1UA 4CKZA 1R8YA 2NTYC 3IQDB 1MO3A 3EE6A 4KPGA 3SYLA 1RVV1 4IDPA 1ID8A 4A2WA 1SVLA 3FHLA 3EDRA 4Q7LA 3WLSA 2BELA 2H0QA 4NOJA 4A6DA 4FCWA 3DLCA 4JYZA 4EM6A 3A6KA 2XA2A 4EEZA 4O2RA 4HDNB 3NHJA 2NXWA 2NZ2A 4PN7A 4ZDJA 3NAMA 4Q3AA 5CD9A 4RTKA 4BTEA 3G49A 5BR4A 1XTVA 2YWJA 2UYOA 4KFSA 1TCVA 2I76A 3KQWA 2OMKA 4P93A 5KYUA 1M2JA 1TDJA 1ZGGA 4RMJA 3I34X 1IEWA 4B43A 1RHJA 4C5AA 2CJPA 1KHTA 5IM4A 2GSWA 1EVLA 1BOFA 3TGLA 1EM8B 1ZRHA 1SVIA 1YE5A 4I5EA 4B7XA 2QPTA 4V3BA 4KREA 2ZJBA 4ALKA 1TO2E 2WU4A 4IYJA 3M9WA 1OAOC 3RJ5A 1SVMA 1NX6A 3LLSA 3MN1A 4HGPA 5FT9A 2I80A 4J16C 3HUTA 5FOWA 3GGOA 2YWBA 1HE1C 4RK1A 1W88A 4OI0A 4MW7A 4CNQA 2Q9AA 4P4TA 3PNPA 2W98A 1BGWA 1Z2PX 3R1IA 3FHCB 1WVMA 2FWBA 3I4CA 3PPIA 1M1ZA 4F11A 2VBFA 4U2EA 2WFLA 2EJCA 1J33A 4HHEA 2OHIA 2PX2A 2ZJ4A 1ZCAA 1QJ4A 1KSJA 1H69A 1PWEA 3F5QA 4UQPA 5ULLA 2AFRA 1SXJE 5A3VA 2ONCA 2PDAA 4DB4A 1ID1A 1UMDA 4LGCA 1KDZA 3KUCA 3TVTA 3JTMA 4E7OA 3HMKA 1MOPA 3M6MD 2HBYA 4EARA 5JS1A 2X1LA 3ZCPA 1RU3A 2ISQA 1IOZA 3C5EA 4FGJA 3RYTC 2OO3A 2ATEA 1N5LA 4FOPA 2DTDA 4XQ9A 4H17A 2C5FA 2KWIA 1V39A 3DZJA 1LEHA 3QV2A 3ECSA 2AN9A 2RAPA 3ELYA 5IN4A 5MFZA 3DE5X 4OH1A 2B25A 4REQB 3FBGA 2O3TA 2IY9A 4BZWA 3LA8A 1D5CA 3LY9A 1KI1A 1F2VA 1Q6YA 3GUCA 4DVJA 4HLDA 5JY1A 3U44B 1IMJA 4NYIQ 1WB4A 2YXDA 2P6RA 1VYVA 4B71A 3JAKA 4IRMA 4I55F 4A10A 1FDSA 3A04A 4B3MB 1G0OA 4NXNB 1WS6A 4CIVA 4H3HB 3U4QA 4W5NA 3W6UA 2IRWA 3H9BA 1KI3A 5DYTA 4MWGA 4EW1A 2P69A 1M5TA 4JP8A 1XI2A 4IHQA 3E9EA 3DPUA 1H2FA 1Q1AA 3OE1A 1PSWA 1WDWB 1QJCA 1R15A 2A7XA 2ZJ5A 3Q9UA 3QOFA 1IATA 1ZONA 2NSYA 1VKHA 3CCFA 4FFWA 4LYAA 3BORA 1N6RA 5LZ2A 3GA7A 3ZV3A 5KNCH 1LF5A 1POWA 1RHKA 1R0LA 3Q7IA 5TMPA 3WK8A 2NACA 3CVWA 1JF8A 2H8KA 3ESBA 2EZ9A 5K45A 2QVBA 3ONFA 3V8EA 2XX3A 2PUDA 5IXYA 4DWOA 3RJTA 4GMGA 3S2IA 3P52A 3HP4A 4C7VA 2Q50A 3BMOB 2QNBA 3VKGA 1R0SA 2P30A 3L1HA 4IGEA 3U61B 4RLSA 2V6FA 4KCGA 5J59A 1S9HA 1TC1A 2GNOA 3G9ZA 4MWTA 1JDSA 4EP1A 2VDWB 4Q4CA 3ZWWA 4IY1A 3ZHOA 2GZ2A 2IT1A 2PSJA 3ZEAA 1VJCA 1LDBA 3L7IA 5EJ7A 4PICA 1FQKA 3BWXA 4AMVA 4ZZ3A 5B1EA 1KKLA 4O29A 2BKLA 5BOVA 3RVRA 2C92A 1FRQA 2G07A 1IUKA 3NDIA 1N77A 1IVSA 3AU9A 2WLTA 2JCBA 4X6XA 2Z6QA 2AZ4A 3A9VA 5FEMA 1A69A 3V8QA 1UH5A 3K09A 5CXSA 3RKSA 1WA5A 2ZAMA 3PQCA 4NBRA 4RTPA 2RARA 1GTMA 4PIPA 2C5BA 5DNCA 4NP6A 5DHUA 4O25A 4XIYA 3EXFA 5E8JA 1UIRA 1FSPA 3GEBA 2QQGA 1O97C 1RPAA 2Q9CA 3BXZA 5J4KA 4CEIB 1P17A 2YL2A 4A8TA 4X60A 5LD2B 1B2RA 3HSSA 1UXHA 2M98A 1X9HA 2B94A 3HY3A 3ETCA 3UHJA 1JJVA 3AHDA 4KVAA 3VNBA 4MRVA 4HNAB 3OZ7A 2RI6A 3R6GA 5C1OA 4BQSA 1DHRA 1C9MA 3C5WP 1EAMA 1GNQA 3PHLA 1YDFA 4KQ2A 2OAGA 4KAXA 4WZZA 1YC5A 4YYEA 2QUJA 1HT3A 1PP4A 2C7BA 1PR5A 3P2KA 4H59A 4L6IA 2JFWA 5TQ2B 2OMEA 3OZTA 4YR9A 1RIFA 3I1FA 5DN6A 2C00A 1LS1A 3I04M 2BMAA 4XWTA 2X0JA 5B7GA 2HPHA 5JECA 1RLIA 2JHPA 1H5UA 4JGGA 5KNDA 4Z4HA 3NUQA 2ET6A 1AK1A 5BRJA 2PXHA 5J4YA 2QRQA 5DYGA 1E5DA 3ZLTA 1UBEA 1ZXLA 5BNWA 4TTIA 4WZBB 1ZD5A 2VYQA 1E63A 1M34A 4KX3A 5BRNA 4PNPA 1MH9A 1DTWB 3PDUA 1H6AA 3RASA 4D4GA 1CUIA 1UT5A 5HF8A 1E66A 3DAPA 4L74A 3O8OA 3I09A 4R1PA 4LF4B 2QL5A 1N5KA 2G1UA 2X8JB 4ALIA 2F4NA 5HG0A 1T9HA 2WK1A 2BHLA 1PBTA 2R79A 3LNCA 4OB6A 2OUIA 1QYCA 2HN9A 3CH7A 3LRXA 5EQTA 3O94A 3PPYA 4BEVA 3HRIA 3Q7RA 3AJ9A 5DTEA 2O8EB 5JSHA 1Y6JA 3WSTA 3EQ8A 5A3QA 1N2HA 4EPXA 3GJTA 2NSDA 2BFEB 1AHIA 1GXSB 2IWHA 3X2SA 1L7DA 4WCVA 5E4TA 2HAEA 4V0KA 1UWKA 1JA0A 5F1OA 1YZGA 1MPXA 4ZAGA 3RUAA 3LY5A 3ZI7A 3AFNA 1G8FA 1KORA 2QT0A 3BXOA 5HMMA 5CA0A 1IWPB 1SM4A 3DR3A 4FZJA 1ST2A 1GFZA 4HRYA 1G5QA 3W9BA 3VPHA 4ZI3A 3FUCA 1FJXA 4J7XA 1C8KA 4J3NA 4JENA 1G0NA 1WNFA 1FLNA 2DPGA 2G17A 2HF9A 4HX9A 3W9UA 4XQGA 3UM9A 3KQHA 4K9PA 3GX1A 1M72A 2ZJ1A 3RVSA 1X3LA 1E8NA 1YJXA 4G5XA 4GWGA 4RTJA 4B6JA 2XSZA 1E92A 5CFOA 5FJJA 2EX4A 4AN0A 4QGHA 1V7QA 5FORA 3U81A 1LPMA 4GZLA 1T13A 1CUGA 4KO1S 5A06A 2FSUA 4TWZA 4HEA1 3I23A 1U2EA 4MIOA 1XTKA 3QE0A 2X8BA 1PHRA 5JFTA 2F55A 1KEUA 1IQRA 2HO4A 4CCYB 1SPBS 1B0ZA 5FOTA 3IXMA 1BDIA 3K4QA 1GGFA 4B2IA 4XYGA 5KBYA 3LPMA 3PC8C 1XQ9A 3O1JC 1SOVA 2R1TA 3F7TA 2BKXA 4DT1B 2GYUA 3WTBA 4CN9A 3NBFA 1EP3B 3ZLBA 2WICA 4ALJA 2ZIUB 2GN4A 3MXTA 3EEFA 2ZB2A 3GFGA 1Z28A 3IAHA 1QAMA 1TE2A 2HXSA 4NBKA 3T4UA 3DZKA 4IZOA 1KJIA 2TMGA 1MRNA 2J4CA 2YVKA 3FSEA 3PX2A 4FMPA 1E6UA 4PNEA 3P9XA 5F1YA 1R64A 4EYEA 5AKGA 3VVLA 1OLXA 5HZGA 5LQJA 1P0MA 4HDCA 5HCNA 2NP7A 5AUOB 1PLLA 2OC4A 3BSSA 1DB3A 4W9NC 4Q3OA 1YIDA 1OMOA 1E1KA 5EHQA 5I9SA 1CNMA 4MS3A 5JYDA 1QU2A 2ZQ5A 2B99A 2RBEA 4BB0A 5C37A 4JV5B 3E4CA 2INGX 1CUFA 2AE1A 5A3SA 3CFFL 1M7BA 3AR7A 5EWMA 1QG2A 3G5AA 2ZRJA 3HA5A 4R8MA 1V5WA 7YASA 1L7BA 1G6Q1 3BMQA 5DIFA 5LC1A 3MB8A 3Q9SA 1S5PA 3G79A 2VF5X 3BKXA 4WL0A 2FK8A 1BS2A 2EXXA 1YRHA 1W581 2VYFA 3H5VA 3P9KA 1X8LA 2VAPA 2RGBA 1G2IA 3GLHB 3KZCA 1WB6A 3K3PA 4F86A 4ENRA 3OSZA 4XUEA 3QVXA 3G1UA 4GOKA 4DC0A 4Z7NB 4ZHQA 3KLBA 1KY2A 5UKDA 1BEEA 1EGMB 1ZSYA 3EARA 1Q0RA 4GC5A 3OCUA 4H3SA 4R01A 1RYMA 1XA3A 4QU5A 4A8JC 4BJ1A 1C3EA 3GUYA 3TTYA 5HS4A 2OFXA 3FPGA 1J20A 2UZ4A 1GKLA 1SKYE 3GPCA 3INTA 1MV8A 1QFJA 2AOVA 3MTAA 5JE8A 4BX3A 4KSBA 3ZU4A 1J0AA 1YWGO 2O2XA 2JIDA 3ORRA 4XR4A 4JP5A 3W2HA 1RHQA 1A04A 3KQOA 1DLIA 1IULA 1TUBA 1XQWA 4LV5B 4MMXB 1DMRA 1EBBA 5AHXA 3DMDA 4FGZA 1T0PA 1FUYB 3CLRD 3MJRA 2BBTA 3U3DA 2LNDA 2L17A 2WVGA 4H6PA 2A84A 3QUBA 4JLDA 4C07A 4MJ7A 2I2XB 3AL2A 2BJVA 2O7VA 1DXYA 5C81A 1KU6A 1JQDA 2Q1UA 2BSQA 4LDAA 3V2UA 3W2FA 2O0LA 1YKSA 1VECA 1PJSA 2QAIA 2FOXA 1VGVA 3A2LA 2R6R1 5T67A 121PA 1JR6A 1NN1A 3G8CA 1LPNA 4AS3A 2HKIA 1U8UA 4OH7A 4OHUA 1I0ZA 4OLBA 1YQTA 1TLLA 3RM3A 4C22A 3W5DA 5EKTA 1FVHA 4E6EA 1ZG3A 1ULAA 4KWTA 4RTMA 4P0TA 3OPXA 2LCQA 2X4IA 5LYYA 2GCNA 2H4XA 4FCTA 3ZGXA 4LC1A 3H9UA 1M1XB 5BT8A 1P0IA 4XVRA 2KLHA 3RUHA 1SB8A 5E9QA 1V16B 3HB9A 3KB2A 2Q07A 3NT2A 3T4XA 3H9CA 2X3UA 4BAGA 1EK2A 5G0UA 1YZKA 3AERB 3VC3A 5IHXA 4ZPXA 3TZQA 2W6OA 3A14A 2QTRA 1GPUA 3RC7A 1E69A 4JUCA 3NYQA 5L51A 3HQ4O 1M1NB 3ID6C 3TRKA 2Y1OA 2CVFA 4IAOA 2GW4A 2YYYA 5AJZA 5DTMA 4BP9A 1FUKA 3E5NA 3Q72A 2D7DA 1UBNA 2Q1XA 2R9VA 1E94E 1ECBA 3N0VA 4UTRA 5CB4A 4K87A 4QELA 4RYLA 1XO1A 2JNWA 2JLBA 1F4VA 1KP2A 2XE4A 1BA2A 1YS1X 2OXIA 1G4UR 4M89A 4YJHA 2FX2A 4HRAA 4B7AA 1EX7A 3BM5A 4BX0A 5DN6D 3GGPA 1Z22A 4M6WB 4NU0A 3UV7A 1KO4A 4IUBS 3T54A 4WWHA 2NLOA 5DBIA 2ZIZA 4M98A 5ALEA 1QHNA 1TVKB 4J9VA 4RQTA 1M1YA 5DLPA 3WLLA 3G85A 4GPZA 1FVFA 4RPHA 1S7CA 5HDQA 3UPDA 4A4DA 4C7JA 2VG8A 2JGJA 2JFUA 5GINE 4KW7A 3RSZA 4UATA 4DJTA 4AIRA 4UMDA 1IBRA 2FJUA 4FKBA 4IIDA 1ULBA 1PX2A 1P77A 2OGSA 3TTUA 4DARA 3FRHA 1W52X 4C4SA 3CZMA 3G2HA 2HOQA 3DE2X 4URWR 4PGAA 1EQ2A 4X3OA 4E5PA 3LZDA 4HMPA 1QIEA 1TFUA 4EI9A 4GAEA 1NVGA 1R74A 3AR5A 4ZJYA 2Y1EA 1WZNA 4DLVA 1FW6A 3JQ9C 1FX1A 2AFHE 3SJAA 1SXJB 1XJ5A 2PKEA 5KMGA 1QP4A 2VO1A 2FE1A 1JBQA 3FZEA 2WIAA 2JCXA 5EHNA 4ER7A 5ILOA 3K9FC 2NNLD 1ZOIA 1NMYA 1ZQ1A 2UVPB 3L82B 2Q4RA 1CFZA 2FQ1A 3NEPX 3CB4A 4LHSA 1U3VA 3GEMA 2KBEA 1IHXA 1P45A 5M04A 2F8LA 1ISSA 3W8NA 3AUFA 1OPRA 1ZJZA 3BWCA 2I2DA 3ML1A 5CVUA 1JQBA 5K8LA 4YHBA 3T0GA 1RYZA 3PR1A 3V1NA 1II8A 3AO0B 2FSIA 2PX8A 2X1HA 3KYBA 3PNVA 4RV4A 4TS3A 1MOSA 5BNIA 3OCCA 3OE5A 5EG5A 2YWGA 1LC0A 1T0IA 3MTJA 3UJ3X 3QWBA 2X8LA 1IY0A 2XSZD 3CRMA 1PK9A 2PJZA 3K1YA 1D3AA 3P0JA 1EQAA 5JJBA 3QY9A 1P5RA 2C5GA 1TJ5A 4KZPA 4MKIA 3VR4H 2DEUA 4TYWA 1I1OA 4RCVA 1WMEA 4LOIA 2FKNA 4KODA 3C3XA 1L5RA 5AKJA 2FLKA 2VHTA 2LMEA 3MZ0A 3JYHA 2VJOA 3QPAA 3D6JA 3G17A 1X7YA 3R24A 4QPPA 4I1VA 1A82A 2I8CA 2A5FA 5JDCC 3MXOA 4DFDA 4KV9A 4IQ8A 2XCQA 2EQBA 4UASA 2FMXA 4MIKA 3RYCB 5KOHB 4B3CA 4LHXA 1LTQA 5DNUA 1GUDA 1Q1EA 3BB4A 1CFJA 1RKXA 2OV3A 3HVUA 3GDWA 3ENVA 3WE7A 1K9VF 2XV1A 3H2YA 2ZCVA 3L5KA 3Q7QA 1CNFA 1JBKA 4AF6A 4HK4A 4KUHA 3TZBA 2FPGA 4AIIA 4MINA 2I1LA 1SAYA 4B5KA 5B53A 2JGEA 3BJZA 4UBLA 1IB6A 2Q1SA 3L04A 1ETUA 2NT3A 1KE2A 4DMLA 4Z1OA 5A5VA 5L8VA 2DMRA 3TQTA 3UW3A 5JVDA 1GRQA 1HFKA 2Z30A 1K1EA 2OBFA 3OOJA 3VPGA 2IHVA 1XRQA 2E4YA 2H9AA 5IVPA 4C21A 4HUJA 4KJXA 3GEEA 1GUYA 4XKJA 1XD8A 3JR3A 3GLRA 3ZY2A 4E2YA 1JG2A 1T2EA 2XE7A 4UCXA 4UE2A 1XDBA 3SS8A 3LQQA 3EVFA 3OWXA 5GONF 821PA 5KTTA 4G0VA 1K8YB 4IYRA 1CLEA 1RZVA 1A2QA 2DG2A 2EBUA 2HRRA 2L69A 5DHSA 3SNKA 1Y89A 3WDMA 4YRKA 1PEAA 2M6SA 4OI2A 5LB2A 4H1WA 1KAQA 3GNSA 1DUIA 1RPZA 2SNIE 3CX7A 1EM6A 3KUDA 2YIMA 4OHWA 4ZCSA 1P6QA 5IK2A 2SECE 3VZSA 3PL1A 1JIJA 4MS1A 5E4FA 4OREX 3LYLA 3W2GA 1V4NA 5ER9A 3FIUA 4DDMA 1RXSA 4E32A 1U65A 3AI3A 3OU2A 1XVLA 2VT6A 4KLAA 4PSVA 1ZVVA 2AXPA 3STYA 3P4UA 2QT1A 4FNAA 4QPDA 3KLMX 3KV3O 1F9EA 4O63O 5EIHA 4C30A 4B3RB 3FDZA 1FXWA 2B1JA 1UBHS 3CWZA 3DCIA 3RVPA 3UA0A 4C29A 2C9YA 2F1RA 2H06A 1QWSA 3EDYA 4UPDA 1XWIA 5H83A 5I7AA 2VQSA 5KQGA 1MX5A 2JLQA 1I2ZA 3SFVA 3VFDA 2R7LA 1F6WA 2ZZKA 1ZOSA 1JDJA 2ERXA 4N7RA 4UBMA 4ZO4A 4Q9KA 3V3TA 1H66A 3D3EA 2KS6A 3G0OA 3H5IA 4U4AA 5CTJA 721PA 1X7XA 4Y7CA 3NALA 4ASUA 2QUKA 1CQXA 3MPUA 2OVFA 3CNEA 4FIZA 1OREA 3UC9A 1SKQA 1TM7E 1PLJA 2WJPA 3TOVA 3OBIA 2J3LA 2YC2C 4KX5A 2GO1A 3HRKA 3JYNA 4TTAA 3ZGNA 2PYZA 5C8YF 2WTEA 1G8PA 1QQ5A 3WV5A 2ZK7A 4MKHA 4AP9A 4GECA 1SHZA 4UUQA 1GGKA 3FUUA 3BEOA 4NDAA 4P6VF 3UFXB 1ZCJA 4EJSC 1CUHA 5A2QA 2QD4A 4EFDA 3S8EA 1L4FA 2C77A 3COWA 4X1KA 4CUZA 1PWHA 3CNLA 1IJEA 2WILA 3BFPA 2IP2A 3KEGA 4HB2A 4RANA 5TF4A 3S1SA 4OQDA 4R54A 2J3KA 1FFXB 2CY0A 2E4UA 2X19A 1XRSB 3G1WA 3IE0A 3TDKA 4B6QA 3ULKA 3NIBA 3TL6A 1MIHA 2XQKA 5HM8A 2H1WA 2E4VA 1ISRA 1KIMA 3D7MA 3G82C 3H17A 1XRRA 3OZBA 4TXNA 5FNVA 1UC9A 3LPDA 4G5FA 1RTTA 3TUIC 3NOXA 5KO2A 1UKCA 2DCUA 4GPBA 2W2KA 5EWLB 2H7XA 2D54A 4I6EA 6Q21A 2C2GA 3E5MA 4MRAA 5C1DA 4U7DA 4INJA 4URXR 3FTEA 4M1WA 2P6MA 2P3QA 3T99A 4IVPA 3A3KA 4V3CA 3AZQA 2I65A 2OV1A 3P9NA 5B36A 5EZYF 5ADVA 1XMSA 2BP7A 4H15A 2IEBA 4HADA 4F6RB 4UBKA 1SG9A 2JFOA 1NBAA 3N28A 3RU7A 2AXQA 1E4YA 4TWRA 2O2GA 1A1SA 1VCHA 2G1KA 3N0RA 3MSCA 4IVNA 1XKLA 2V65A 2C7PA 3A0UA 3KUUA 1U0EA 1T9GR 2B8NA 2W6IA 2OO7A 3VH1A 2GPSA 1T24A 4JX9A 3TB4A 4LC9A 5HJEA 2R00C 2YIJA 1KOJA 2CB9A 3EHEA 1SMKA 1FS6A 1JA1A 3R3XA 1A4RA 1ABBA 5CIWA 1CY8A 2QL7A 4E03A 3BZBA 4DSNA 1VJ1A 3LPNA 5EUQB 2PMBA 3Q2IA 4L78A 3ZW9A 1B1CA 3QUTA 1M2HA 1QMPA 1YD7A 4TTJA 3VJLA 4ARCA 2W8BA 2CJWA 1SELA 1SR8A 3ABQB 1FNSA 1LC3A 2YOFA 1YHNA 4WFQA 5E1MA 3RBAA 1MVOA 3ZU6A 2G6BA 1OTHA 2J3IA 3FCXA 5JPCA 2QI9C 3GLQA 3GLIB 5ELXA 1PG5A 2JI6A 2BGUA 3QPDA 1KMHB 1S2OA 2ID8A 4H6VA 4X85A 4XYBA 1YS9A 5FTKA 3ZHRA 4KR3A 1DDGA 3BD8A 3PVSA 5KREA 2AB0A 3HWSA 1Y63A 4XYMA 2V1XA 5FQNA 2W70A 4H0FA 1WVGA 2FU5C 1QE0A 1JGTA 1Y3DE 2P75A 5L3SA 3RYIB 2A9JA 3L5OA 4IO1A 2WYIA 4JI3B 5BOSA 1THMA 1N3LA 1YSCA 1VXOA 4NRDA 5BSKA 2QVCA 1NXPA 3U3MA 3DMGA 4MDEA 2NP6A 3W5AA 2P78A 1SBYA 3EJWA 4UMEA 1MTZA 2XVYA 3Q6NA 3STHA 4BJHB 1JQ5A 1PZGA 3KCNA 3VZPA 1ACJA 1Z4LA 2PNFA 4N6OA 4FYKA 2PZGA 3OF2A 3SNHA 1K5DA 1T9KA 2B0JA 2AIRA 1GKUB 2G88A 1U63A 1EVQA 5BY2A 2XR1A 1CJUC 5EFOA 4X1YA 4XWOA 1C3LA 2G04A 2QBYB 2RBGA 3Q10A 4YCMA 4KVGA 3FF4A 3LM8A 3PDCA 5C1IA 2FFQA 3UBMA 2ODQA 3A1FA 4C3ZA 1JI3A 4ZEOA 1R4MA 5AJWA 1PTKA 2LBPA 2VDMB 4MV0A 1IDN1 3VH4A 4WKPA 3QMWA 3GLFB 3GT3A 2YWCA 4BLUA 1N8TA 1AUPA 5H68A 2K2QB 4Y30A 5AR1A 2DR2A 1JAHA 1S4MA 4QRDA 4WZ6A 5H9VA 1NVKA 2FWNA 3ZNNA 4BVHA 2VOEA 5E0OA 2J9XB 2D8AA 1IEQA 2ZU0C 3H65A 1VMIA 1AE1A 1UL1X 3CJRA 1C1HA 3R3JA 3NYWA 4EFKA 2ZETA 4PYRA 3IPRA 3ZGOA 5DT2A 4ARVA 3BS4A 1I33A 1Y7IA 1C7QA 1E0DA 3QI7A 1KP9A 4PHFA 2IXFA 3Q41A 2CSXA 3A70A 4BBAA 4R9NA 1KBOA 4F3KA 4B4WA 3PA6A 1BC5A 5IK2D 2CJFA 3ZLJA 2JGAA 4HVAA 2Q29A 4IIVA 4LC0A 1S8AA 1B26A 1NQUA 2QGFA 2WU1A 4P4UA 4FFPA 1R6VA 4G0NA 5BW0B 1TM4E 3ZK8A 3HJUA 2A6PA 1FYXA 1F60A 4GPEA 1KK2A 2ZAYA 4XUGB 5F7JA 1VSUA 3PEUA 5ESWA 1FX0B 5J4VA 2Q1WA 1BE1A 1YQQA 4XDHA 1L5HB 1CY7A 1TM5E 4BHTA 2VQDA 5G3ZA 3S1AB 1AXEA 1PV1A 3H84A 4ZAXA 4ZYWA 5K03A 3DF7A 4G0YA 1R6XA 1TUIA 2IFTA 3RU9A 2FWPA 1I3MA 2JHFA 3QTTA 4HEJA 1T6ZA 4JP2A 3R7LA 4BAZA 4CM7A 2CVZA 4Y2XA 5T4EA 4AUNA 2O4CA 4ZOLF 3N2GA 4B3TB 4FB5A 4C89A 1XYVA 1MC4A 2ZKLA 4RWEA 13PKA 3OHPA 4PFJA 5EVJA 1WQ4A 1UJNA 3N86A 3C7KA 3LWBA 1MEJA 2GK4A 1RRCA 2OK7A 1RC8A 1S3IA 2ST1A 4YY3B 5ISMA 1AS0A 3B7PA 3DB1A 1ZN7A 4OP2A 4ROTA 4TRJA 2ZUBA 4F5DA 4ASUD 3O8RA 4ZODA 1MQSA 1F48A 2VZEA 3FDFA 3JYQA 4IXNA 2JH8A 1V1RA 3DOCA 2UXBB 1Y9JA 1SVKA 1R6BX 2BI8A 2PUHA 2OZEA 2WTXA 3NHPA 4QX6A 2ZJ6A 5E1BA 3UW1A 1WUHS 1KDOA 1M1UA 1QRRA 3SYTA 3KTAB 1PNOA 1X8JA 5CEFA 3IKVA 3TLJA 1PJTA 3SC6A 3JZIA 4G5RA 4QO7A 5BW6B 4BQRA 5KTYA 4LXYA 2OEPA 2V7GA 1FDUA 4PFKA 1FFHA 1ZUHA 2AFHB 1LUAA 2WZDA 3EVCA 4EENA 5A7GA 4Z49A 5J3JA 2IEDA 2QN3A 4OA5A 1N0VC 1W1WA 3VXKA 3H2ZA 1PZFA 4O3FA 4PGMA 1PL0A 1G2QA 3VYRB 1MX1A 3HKBB 4WOPA 3K7EA 1A27A 1SUBA 1R5NA 4UHCA 2Q4OA 2BHSA 3HFRA 3GQVA 3UMRA 2Y77A 2VT7A 3ZWAA 3H4MA 3DOFA 1ZH6A 1IWBB 6ADHA 4ESOA 2BEVA 5JBNA 3TTXA 4TV8F 1XLVA 2XI4A 2AG0A 3KSDO 2XWJI 5KJEA 2O8CA 3K9HA 1NP6A 4ARAA 4U9UA 2WYHA 3B9RA 2VQ3A 2DFTA 2LPMA 4XEUA 5DYIA 1IZ7A 3ZG6A 1Z4OA 2WQ7A 4UZEA 1Z15A 2UU9B 1Q1NA 3K1TA 4MUBA 3TXAA 4BFYA 4Z9FA 4IIJA 2NV0A 3DW1X 2QUIA 3T3NA 4X90A 3DS8A 3M0EA 2XKBA 4ZQCB 1QR6A 1NJ2A 3W5JA 2ZBFA 2SCUA 3U7QA 5BVGB 5IG2A 1YA6A 1B16A 4JJ4A 5LLTA 2BM8A 3PD7A 4PF1A 3OPVA 3E7FA 4KH1A 1PW5A 1I5EA 1M2OA 1ES9A 1EHCA 2IQ5A 4I5IA 1SCBA 3Q7PA 4HNRA 4O8CA 4TWIA 1W5TA 2ZYWX 2HA4A 4YREA 3I2IA 4BO6A 2EGUA 3GJRA 3SJBA 5CXQA 5L6LB 1UXJA 1O89A 2PNJA 3W79A 2W6ID 2GUGA 3A36A 1GTG1 2ZQZA 3JATB 4OQEA 1H2WA 4D9JA 4DYHA 4AT1A 4XWKA 5COAA 2OCGA 3B85A 1UKEA 2VWPA 3GRKA 3SR3A 2WSLA 1FDOA 3ISVA 1Z38A 5E6UA 5G53C 3VGPA 1WJGA 3U7EB 1CRPA 3U6BA 4NG5A 4RFSB 3PRHA 1G41A 2BBOA 1JT9A 4AZWA 4DEXA 4BEWA 1EA7A 2RDMA 3BC1A 2PMEA 1VMKA 1W8IA 2MSNA 4G65A 3TW6A 1KJWA 1ESNA 1TFRA 2VFAA 3UT0A 4OBXA 3JQ6A 1Q5PA 3NZEA 4TTVA 1YQWA 2KPOA 3GLVA 1E2DA 4ARSA 3OZIA 4FE7A 4DLZA 1YFKA 2ZBQA 4DPMA 3EFBA 1REQB 4ZV4A 2WNIA 1CF9A 4X91A 3K1AA 4J75A 4RDHA 3RVMA 3USES 5C51B 5DGHA 3QGMA 3OX2A 5GM1A 1N9GB 3T61A 2Q2VA 3LIIA 3T7KA 4DIMA 3OSUA 4DPLA 4LBYA 3H1EA 4G23A 4Y18A 4XFKA 1XD2B 3BB1A 4ALNA 2BTEA 4LDRA 4YRSA 5COQA 1U6JA 3OZWA 2ATCA 2C59A 4HNGA 4DCUA 3NTOA 3IAS6 3Q9LA 4EUEA 3MD0A 5CEEA 4JI8B 2AXEA 5EY5B 3PC7A 5CEJA 4M9ZA 1LSUA 3L1VA 2J4FA 4M7PA 2G9NA 3DHEA 2ZSBA 4KH0A 4PYIA 1IZ0A 3OURA 2VRWA 4IZIA 1H8EA 1NYQA 3DKPA 3HYCA 5I4BA 3EUAA 5CYPA 5JAPA 1D2EA 1G6OA 2VCHA 2XBLA 4OV6B 3AESB 2ZP1A 5LP6A 3PRKE 2O23A 5DM2A 1DAOA 1N33B 1R7RA 4Y2HA 5EJ9A 4JL6A 1EUYA 5B6JA 1A8HA 3QWHA 2GCOA 4CMKA 4GOOD 4NJEA 4HVCA 1DEAA 5A0VA 4ZO8A 3C3BA 4ZQGA 2YFQA 6REQB 2CZQA 4BLTA 2J9RA 4X71A 5KYYA 2GAAA 1O6FA 4HWSA 5IF9A 1O94A 3ZTYA 4ZAFA 3BK2A 2IDMA 1TKCA 3L0BA 4HUQB 5SY4A 3HO8A 3QX9A 4XEHA 1MGOA 4TXLA 3VR3A 3HBMA 3Q1LA 1WETA 4ZMRA 4LVUA 3RADC 3TZCA 4N40A 3WC4A 4RORA 2GN0A 2P3LA 3IEPA 4FP9A 3DL7A 4WDQA 5CDYA 3ZVNA 2L42A 4LDJA 3UN1A 1XNQB 1XKQA 4QUEA 4BZPA 4MW9A 4FJ2A 3VU3A 3LCRA 1LFAA 1P9OA 3WFZA 3AKYA 4HDKA 4KUEA 1N8NA 2WR8A 1R4NA 5KYTA 1QH8A 621PA 3KJXA 1WXDA 3PUWA 1AKQA 3DXFA 3H19A 3OC0A 2EKLA 3AB8A 3IUEA 4W1RA 2P90A 3B20A 3R5JA 3ZUGA 3M4XA 2RKWA 3CEAA 3JSXA 3KZNA 1X1CA 2Q5LA 2RIPA 2VP4A 2Q46A 3ZDAA 4Q3CA 1Q0QA 2QTZA 1YR2A 3L4JA 1G42A 1ZCBA 3O74A 4H9GA 4IIBA 5L40A 3MTIA 2QV7A 2P3OA 1W5BA 3QKSB 1JR2A 1QB7A 4CFZA 2ID9A 4JA2A 5I47A 3VR1A 1SD2A 2IHKA 3N8IA 1BD4A 4BO5A 4QXOA 4KR7A 3RC8A 1RKVA 1WZEA 2WD7B 3PENA 4FEEA 5DSTA 3RF6A 3RV4A 3AIOA 4L9SA 3HCWA 1VG0B 4LNHA 1N0IA 2R4UA 2K2WA 3FGNA 3GEIA 3OLCX 4PLTA 2FE4A 2H6EA 3LUBA 5AI0A 4EB6B 4EBFA 1H4VB 3IYLW 4H1UA 4JJ6A 3VSCA 2XCOA 1YR3A 2A50A 3CF4A 1F5SA 2OB2A 1CYDA 4B09A 2P62A 1S2IA 4H6XA 2PCJA 2ZJ8A 1UOPA 5A6SA 5BR1A 1KEKA 2AV6A 2ICAA 1U1CA 2EZ4A 3Q5EA 4HNTA 4RSMA 4EUKA 1C4KA 2W2VA 4JR1A 1Z0DA 3KQKA 1SUDA 4XQCA 3EZNA 5K8CA 4R2XA 1K9SA 1F4PA 4Q9IA 4B3IA 1MJNA 3N1UA 2WVHA 1C9NA 5JAMA 4J49A 2AZXA 1Y8CA 3WHKA 2FLWA 4NOLA 2JK0A 1YO6A 1JTEA 1C4OA 1N6HA 1O58A 2OT3B 1P7WA 3QVTA 5A5FA 5B2ZA 4F46A 5HXAA 4MR7A 3BJRA 3PK0A 4G9EA 2A0WA 3MUNA 3U1TA 1GPNA 3AZOA 3KDPA 4NR0A 1H2YA 3AVUA 3LKVA 4KFCA 3UICA 3R0XA 2AUMA 2HIGA 1PL7A 3HYNA 4JCOA 4Q93A 1I8TA 5J4LA 2JRLA 2Y4OA 1NNI1 2GVDC 2YX1A 3RIHA 4ZKDA 5JI2E 4ZVVA 1G20A 3REQA 2B9VA 4I46A 5JEDA 4R84A 1FMCA 5FR2A 2P7HA 4JJKA 5TIIA 3U60B 5LOVA 1AJEA 3WRYA 3N2EA 4TL7A 4ZVNA 3A06A 3SBXA 2O1EA 5HZKA 1JJBA 1DAKA 4KR9A 1KVSA 3IA7A 2FZ4A 1OJ7A 1OGIA 1E60A 1HT2E 3HR8A 4GE3A 1MIOB 5CLLA 2O8DB 2AYZA 3TSYA 5D7BA 1OH8A 4RENA 3FFBA 3F5FA 3CNNA 4DJJA 3HGMA 4WCFC 3UJDA 1ONNA 4QLBA 3P7MA 1SZPA 1NUTA 1SCIA 2BDUA 4N49A 5J40A 2H2AA 4YRPA 1GPWB 3Q6IA 4A6PA 2CV0A 5DT9A 3UMGA 4ZD6A 3LOQA 2PBLA 3WJ2A 1EWRA 4QYXA 1M75A 3F8TA 2IH4A 3AV0B 2XZDA 1ZUD1 2COKA 4NZZA 4PAGA 3QKIA 4PC2A 5KDOA 4B7CA 5DK6A 3G3EA 2PUVA 1OIVA 3CNQS 3X1XA 2AH5A 2J5KA 4CI0B 2IF2A 1NW8A 2C4WA 3GBVA 2G9ZA 1E2UA 4K88A 3VR6A 4BFTA 1MQ9A 1BH6A 5IM5A 3W06A 3UXMA 4ZIRA 3CKMA 4N76A 3H1GA 3IURA 3WWPA 1RPNA 3DM9B 1XTRA 4PCAA 5EIOA 4KDRA 4PEVA 1ZNYA 4X24A 3BT7A 2W6JA 1Q6ZA 1PNRA 2FNAA 4F1KA 5B55A 2J08A 2R4QA 3WGKA 2WUWE 4D8WA 2I52A 1KKMA 2DPHA 2AR7A 3TQHA 3ROZA 2GEVA 4ENWA 3R77A 4OGKA 1G2OA 2JIPA 1YR6A 2OORA 4DXDA 2WW8A 3CG0A 3SC4A 2EFDB 3L7KA 2G76A 3ND9A 4E0BA 2AMJA 3ORHA 4I6GA 2O2SA 5FPSA 3G9UA 4NYJR 1UXKA 4G5GA 1MORA 4MVCA 3UAZA 2B92A 4PBTA 4DCJA 3IGFA 2VEOA 3QUSA 2P2LA 2CXNA 5DTRA 4Y9DA 2P41A 2JBWA 5IABA 4XIFA 3CZAA 2BE9A 4TYQA 2HJVA 2WVJA 4JBHA 2ZITA 4CKWA 4MI6A 3KTOA 2MMCA 3V2IA 1TD1A 4BBPA 2RGUA 1N2CA 3W8FA 4QUGA 3QIAA 4FYMA 3VYWA 4JYMA 1L6RA 1KEVA 2OO5A 1YDHA 2IXDA 3F6YA 4QPZA 5AM2A 2CF5A 4C4RA 5ADUS 1PZMA 2UUPA 1UJ2A 1BRTA 4WASA 5CW2A 3VDRA 3BHNA 3QMMA 1VQ1A 2PCLA 3CUEF 4CEHA 2YZ2A 3IVXA 4KIJA 4F4CA 4G6ZA 5ETJA 1ELOA 1F0YA 2QM3A 4AYWA 2BFBB 3IXLA 3GDFA 1TU3A 4YROA 3KYJB 1E5QA 3OM9A 3FX2A 4LHZA 4IUYA 4RVOA 5DGCA 2NXCA 1WXXA 4B2PA 4F85A 5KX5A 1H8ED 4LF6B 2BFFB 4YP0A 2CUNA 4D4IA 5DX1A 5DNAA 3MJFA 3E4DA 1AKEA 3AT1A 3PHGA 1YFZA 4U7JA 1LV8A 3B70A 4BO1A 1W19A 1ZICA 3RVNA 1HR0B 3QA9A 2VLIA 5LL6P 4RTSA 3QY0A 1TGVA 2O50A 3GP8A 5C5IA 1EFTA 2RJOA 4PTZA 5B2FA 2QORA 1W46A 3CMMA 2CXHA 3OPNA 2IYTA 2VSFA 4UBJA 1CHNA 1ZQ9A 5KJ1A 1ZK0A 1O94D 1QQTA 3IILA 2A88A 3AR6A 1K63A 4R0VA 4XFDA 3RV3A 1O77A 2GFHA 4M46A 3VR3D 1XMVA 3W3AH 2K5UA 3UTDA 4CU2A 5G0WA 2JGIA 4LRTB 3AVTA 4PW0A 3RE1A 3VKFA 2WAAA 2VXOA 2QG6A 4GI7A 2PKYX 2BOVA 1KTIA 4B6GA 4I08A 4KBFA 2O8FB 4HWTA 4YAEA 4IHAA 4S1TA 5AHWA 1IBCA 2OBBA 3DEYX 1QQAA 3GJQA 2UXDB 1JH8A 4AKSA 4F9EA 5BRAA 3WGOA 3A1UA 2BEJA 1XFAA 3IIEA 3OUTA 3MFYA 1IFXA 4PN3A 4UTVA 1M7GA 1HMPA 1WF6A 2WSSA 3QOYA 4C0XA 5M2QA 1A9YA 1HDXA 2YDYA 3DZFA 4K3UA 4RX1A 1X7HA 3HI4A 3EXIB 3B6MA 4UXJA 2BEUA 4BC0A 3PDHA 1OFUA 3B5IA 4MVXA 4KLNA 4LQCA 4AQYB 1NUUA 1DZIA 221PA 1NW9B 3JD0A 4HVTA 5FUWA 3UAOA 3HXKA 4MLCA 2NYUA 4I1IA 3L1UA 1JKFA 5BNFA 1L5MA 3KB8A 3HZRA 1PFKA 4JBLA 4RA9A 3I6QA 3GLTA 4WN9B 2NO4A 1ZO8A 4O4JB 5EC8A 3NR2A 2QEQA 4JLWA 1X1BA 1GTL1 2QZ9A 2VBIA 4GI2A 4O4LB 4OJTA 3S2FA 3WNCA 4F4FA 4GL4A 3KVVA 1M34E 1Q11A 1JX6A 4JU9A 3WP1B 4C9BA 3PVZA 2E87A 2WJHA 3HDQA 3OA2A 4R2IA 5TQVA 3CVJA 3BXHA 1ZGZA 3DVQX 2ERCA 2J9ZB 2QROA 2ZQYA 5DYWA 1FCJA 3X2FA 3W77A 3ESRA 4GYWA 3X3HA 2I3ZA 2FETA 3GA0A 4BKQA 2VC2B 4IIFA 3EX7C 1IRIA 2BFCB 4NSNA 1QZUA 1M2VA 1NLMA 1UMCA 3AM3A 3V2GA 1JPUA 2AG8A 2JI8A 1HQDA 4MDYA 5F7ZA 1PL8A 4IGIA 2GVNA 4KXXA 1LQTA 5B1SA 4B82A 1T6XA 3OJCA 4IV5A 1QSGA 1JWBB 1XCJA 4DV2B 1YS6A 1HK7A 2CVHA 1PWYE 1ZLXA 2OLJA 4YP7A 1XTSA 3SMVA 2YYZA 3RBZA 4RMGA 1BU8A 4LYFA 3ZK7A 4WVLA 2ZPAA 4ZTUB 4Q3DA 2D5BA 1NVMB 2XODA 3CXUA 2OBMA 2XVZA 3M6WA 1ZISA 5ENVA 3I5XA 2WYWA 5FUXA 1KO7A 1MNQA 4MHTA 1AKVA 4OXYA 3LCCA 4OTZA 2AUTA 1Z0UA 5I7HA 4UVHA 4AJ2A 1L7MA 2H29A 1R1DA 1HXHA 1SJ9A 1RAFA 3VSDA 3WHPA 4CUKA 5A5GA 4WBNB 4HAWA 4OL9A 3HVJA 1JIKA 3DV0A 3UK2A 4YNBA 5CAEB 4BJ3A 4JN6B 4G86A 2PS9A 2OAEA 1C3OB 3F1KA 5EUCA 5C18A 4OQLA 5JNRA 2JLUA 1QIKA 2O05A 1PZXA 1U0TA 4INOA 4MO9A 4R1LA 2FPLA 3B1JA 4F2DA 3LBFA 3PUHA 3UAGA 4GLOA 4IP0A 1RACA 3UA3A 3QTBA 2PUWA 3STTA 1N2IA 3PA8A 4RBNA 4BN4A 1IC6A 2RJ3A 4G85A 4N5LA 4EATA 4CFSA 2GI4A 2ECOA 3UAYA 4J0CA 4EMSA 5FOQA 1H0HA 4S1WA 3ZWNA 3HKDB 3K94A 4AY2A 4IUDS 3IEMA 2QQ0A 3ABRB 4B0OA 3DHNA 5DXAA 2H54A 3VR6D 3I9JA 1I6MA 3BUSA 4G89A 4WXRA 3AETA 2X22A 4KFTA 1JJ7A 2GS9A 4KN8A 4DUZB 3DJYA 4LVCA 2AG6A 1SQFA 4P84A 3MMZA 3PGJA 4XCQA 5C8DA 2NN3C 1NZJA 1GLNA 3ABOB 4PX5A 1E2FA 1MRZA 2X5NA 4EUFA 2P6NA 2HO5A 5C7LO 2PUGA 1AF7A 4IHJA 2ZYHA 2RI0A 3V4LA 1AA9A 3WISA 1KVRA 1ZD4A 5JRZA 5KDDA 1WPQA 4FMCF 4WMLA 2X3FA 3UKJA 2QD2A 5D86A 3ECAA 2WUDA 3MA0A 3O93A 3OECA 4UW9A 1EB9A 3QW2A 1ZM9A 3SCZA 4B34A 4CMAA 2V3CC 1G6HA 4HH0A 3ZXYA 2FWRA 3LY8A 3MAJA 5CX1A 4OMFG 3N8DA 4B74A 1KI4A 4NFYA 1F38A 4UFPA 2XZLA 1M2GA 1FYVA 2JHCA 3FTCA 3F6BX 3CLTC 4QYIA 5FEUA 1I1HA 4YRIA 3CI0I 2OL4A 1JNXX 2QTFA 1U3FA 1RXVA 1IE3A 1QUEA 2I4NA 3IP1A 2IV7A 3FYHA 4BN0A 1NXTA 1CR6A 1HDEA 3MB5A 5KPDA 2WUEA 1GAEO 4LE0A 1K8XB 2PEYA 2XMZA 5JNSA 1KA9H 2IPXA 3FZNA 3VPDA 3GVHA 5AESA 3CISA 4RCZA 4WK2B 3MAAC 2FW6A 4TMKA 4WH0A 4XIIA 4MAAA 1KI6B 4GNRA 1VHDA 4PNZA 4BFXA 2ZJ0A 4BYGA 1L0BA 4IIGA 4BMZA 1YASA 3IR5A 3OCWA 5FO0A 2ONJA 2XRZA 3JWIA 1UMBA 2QAGC 4N1AA 4NMXB 1U8XX 2PO7A 2YR0A 3OZUA 1BX1A 5D2CA 5IXJA 1LZLA 3WYFA 3EZ6A 1RS0A 1J2YA 1G98A 3A1VA 1SXGA 4H16A 4K2AA 4P86A 1NWCA 1X1DA 4A16A 2I34A 1YDEA 2ZAOA 5F35A 2CK3A 3RPEA 2P1ZA 5TV2A 5FADA 1DS6A 1UPFA 2YW2A 1RHUA 1M0WA 4GPD1 1XHLA 5JD6A 1JE1A 1IQUA 3EBLA 5KVCA 5KQMA 4RACA 1E64A 2JBHA 3MCAA 4LTDA 2GPWA 3MOIA 4HXYA 3SJUA 1R0ZA 1NRWA 2GMWA 4FDTA 1MC5A 2VCEA 1AS3A 4Q4JA 1LQ2A 1EVJA 1UBOS 2J4DA 3EW9A 3O2JA 3HU2A 5CH8A 4DMGA 1YB6A 1NBWB 3FCUB 2R751 4MQ5A 4U8GA 1WHTA 3CW9A 4FMDF 1JXAA 2PRSA 2OV6A 2YC4C 3BCSA 3O4GA 1C2YA 3SFTA 1EZZA 3NHUA 3ZCRA 2GWRA 5F76A 4J8PA 4M1ZA 1B3BA 2JS7A 2Q1TA 1F3LA 3VR5A 4RMHA 1VB5A 5ITZB 2OESA 4HTFA 1E2MA 4IGKA 1IWOA 1IVNA 1J9EA 1DUSA 2RGNA 1CU1A 2VIIA 4JT8A 5DHFA 4DV4B 1Z75A 2WSSD 1KYYA 4E21A 1LDYA 1ESZA 2CE2X 3C15C 2FVYA 3HB1A 4QLAA 5BO5A 4RVFA 1VC2A 4NMHA 2JD0A 5FXMA 4WW0A 4CLEA 1EGHA 2A5JA 2HA6A 3N2YA 3PB3A 1UBMS 2GNPA 3PTLA 1VPEA 2BGIA 1U0HC 4LYEA 2DU8A 3NH6A 3NKLA 4MKGA 3MWFA 3TKAA 1NULA 3CJTA 4AJHA 5GTDA 1X7WA 1NTOA 4FR0A 1RC1A 1E9VA 4JEIA 4TYNA 1XZIA 1MPTA 3M1AA 3PC2A 4OJMX 5AOAA 3QLUA 4GP6A 4YMVA 3SIRA 3BWYA 4J43A 1N6KA 2OG2A 4FT2A 4TLMB 1Q7RA 2VP0A 4DR5B 1IU9A 2ZUFA 1NUAA 1G8YA 2FOLA 1NIPA 4WLEA 1ZDMA 3P1JA 5HVNA 3RU2A 4GSKA 2E3JA 2JLWA 2ZRLA 2BC9A 5A0FA 1UK7A 2PGLA 3B2QA 4GEGA 4WRRA 1W88B 3QFRA 4FC6A 4HL6A 5EE0A 2R87A 5EHIA 1BGVA 3ASVA 2NYVA 3I62A 2NOAA 3EA4A 1HDGO 3RIGA 4CV1A 1HT0A 3PWKA 2Z4RA 3NHYA 2QMEA 1IQ0A 2QQFA 3CNOA 4JXZA 2ZUUA 3CIOA 5J58A 1M8KA 2WFLB 1JDTA 3GC6A 3JQPA 3S81A 2Y0BA 4FHEA 3LW8A 5LDDC 3NONA 4N3BA 3NDBB 2M1ZA 3K0FB 3MCTA 4NCBA 4EGJA 2GAJA 1YGYA 1UMDB 3AFGA 1GTZA 1X87A 5I7OA 3JARA 4RKEA 3VPAA 5IS2A 3NYIA 3ADBA 2GD6A 4L3VA 4WY8A 3ZD8A 4JB3A 4G4SO 1TEZA 5KJFA 4Q00A 4L3OA 2EWMA 4LFBB 2J5QA 5JR3A 3KXIA 3U31A 3IVAA 4V2IA 4B3GA 2BE7A 5TQ0A 3R9WA 3HVIA 2GD2A 2IF0A 4C1BA 2GF0A 1XK6A 3ETNA 2ISSD 2E85A 4LVOA 5LCXA 1OE0A 3GR6A 1ZGCA 3R7FA 8LDHA 1D2AA 1OZ0A 1GA6A 2YZGA 3JAKB 4B45A 5CG2A 3MCWA 4F96A 3C39A 3PQEA 4I4CA 3GZ4A 3ILYA 4UE3S 5EUMA 4MUMA 4JJGA 5HGXA 4B73A 2DUNA 4Z0HO 3U4QB 1U8EA 3FUWA 4FE4A 2E2WA 1ZJ6A 2DHEA 5FOVA 4MWDA 2JFGA 4KBGA 2XQFA 5EKXA 5F7OA 3OM1A 2XMRA 4MJ3A 1A5AB 1Z63A 3G2JA 4REOA 4HWOA 1DBWA 1WTAA 2PZEA 2W58A 3QVGA 1SXHA 4QNRA 4TKZA 3JD4A 1TVCA 4WNYA 4B7UA 2BSAA 1MBZA 2G8NA 2R8PA 3FM9A 4JBWA 2EHJA 3ZY5A 1M8PA 1G7TA 3H9GA 4AXBA 4DIEA 3KZMA 5B12A 4B87A 2JA2A 5C3MA 3CH6A 1JL3A 2XKKA 2QLFA 2N1MA 4OJNA 3O0TA 1BYIA 2QUAA 1QYVA 4HAXA 3KYCB 1A5ZA 2GPTA 1GKYA 3HE3A 4XYEA 1I10A 3KHSA 1Q50A 1MX9A 1YOVA 4BO7A 3SYRA 3BWEA 4WBXC 1WEKA 2HCBA 5AW2A 4RZSA 2OZLA 2UYQA 3KJGA 2JGDA 1J97A 1H93A 4HAIA 4AJNA 3H2JA 4X6UA 4RH1A 5GZ1A 2GYWA 1JEYB 3GYGA 3RABA 1YBAA 3L3BA 4L5JA 1EEXB 4YCSA 5DPMA 2YBDA 3KOXA 2VJDA 4G36A 3E2MA 3WBJA 2IV2X 5K6TA 4F8YA 5ALTA 5DV9A 5C7OO 2Y4NA 5BQFA 2LKCA 4Y98A 5EZSA 3K9GA 5P21A 4OMCA 5A9SA 3O9ZA 3H2HA 5HIAA 5CB8A 2NVWA 5F5XA 5LQRA 1AD2A 4XDZA 1MJHA 3Q12A 2QD3A 3GFOA 4E5DA 3EXFB 5CCEA 2GZHA 1Q3TA 3HV0A 3U4GA 2NZ8A 3AXTA 2VWGA 3EVEA 1PTJA 2WF8A 4JJ7A 1N6OA 4G56A 2RETA 3WWYA 4GI1A 3IUJA 1UODA 3DZCA 2RG7A 5DLEA 1S8NA 2ORVA 2J5BA 4WESA 2FYTA 4JITA 1GQSA 5CK4A 3WWZA 4ZP1A 4RA6A 5EUBA 4KQEA 3CUWA 3GLUA 2HWYA 2QYSA 4O4LF 3ESQA 2Q6LA 4QDKA 3WNVA 4EIWA 5AW4A 3OKPA 1Y7LA 4EDHA 2A14A 5LZ7A 3R20A 1G3QA 2JI7A 3IQGX 3P9YA 3TBHA 2V74B 4NF2A 3P0EA 1CY1A 3NHAA 1JFFB 5AI6A 4LI0A 2FRDC 3G0CA 1IXYA 4C5BA 2CHQA 2I7TA 2VUIB 4XM1A 2EWVA 3L7LA 3A6DA 1K5HA 4OVKA 3ANNA 2Z43A 3V8PA 4BVLA 3LBYA 1B1AA 4IDFA 5AVQA 5JMWA 5IW8A 1MO2A 1WXEA 5I4IA 2X42A 3JQ8A 5K8TA 4N5DA 2CK3D 3KPVA 1M34B 4Y6GB 2D2XA 4IIXA 1X42A 4HAYA 1W4RA 1WW8A 4NPAA 3D0OA 1QQ6A 4FXOA 1NVVR 1L1RA 4IJMA 1LNQA 1K89A 1UANA 1PBNA 2J3HA 2IYLD 2IECA 4RPCA 2BGJA 1Q84A 1C4XA 2ORED 4O3MA 3ZY4A 1TMGE 3DVLA 2ZBGA 4IDGA 4KXYA 5EXXA 3FWKA 1NJ1A 2G5PA 3H8VA 3K5PA 4Q9NA 4UUOA 3OM0A 2PMCA 3DDWA 3RRJA 4ZJPA 4KXWA 3N9IA 3QBVA 1XUOA 2Q9UA 2ZRIA 3DE6X 4RZQA 1PS9A 2WHQA 4LJKA 4M1MA 3DEHA 3QITA 4X45A 5DXFA 3VR5D 2RE8A 1I6KA 3SZUA 4Z7JA 5CA0B 3LXXA 4HGYA 2RK3A 5T41A 4EZEA 5C7IO 5FFMA 4ZZ0A 5LLSA 1BFKA 3R6DA 2XAUA 3OCVA 4ZVLA 3RIMA 4EI2A 4TLCA 2PT9A 1BYUA 1WDTA 2XH8A 4YB8A 1EVKA 2CL7X 1NDUA 1BJRE 3ICCA 2GHIA 2GPBA 3F9RA 2FR1A 2EU8A 2OHFA 1V8PA 3M33A 4O33A 3VSBA 4D92A 5ICGA 1B4DA 4OXKA 5ERXA 1VKRA 5FQOA 3B36A 2H11A 2WWTA 3WLQA 1IY2A 1DQYA 2VRCA 1MG0A 3KVRA 4LPSA 5CA1F 4GM0A 4EVRA 1M0EA 3H1AA 5FTLA 1QGZA 1GU0A 3S7TA 1N1DA 3I5UA 5KTNA 1VG8A 3JVUA 1D2RA 1CNEA 1P5FA 1VBMA 3RVBA 3WGVA 2WWWA 5B1HA 3UTCA 5CCXA 1YFJA 3BQMB 2Z04A 3MIZA 1HMYA 1XAGA 3FROA 4BO8A 4Q9AA 3CC8A 2QTVA 1OQAA 1ZN8A 3R6WA 1E3WB 4I55A 3AK4A 4PLYA 4MGKR 2YWDA 4DADA 1S8OA 2H4WA