3IULA

Appep_wt1 opened state
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
682
structure length
669
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl endopeptidase
molecule tags Hydrolase
source organism Aeromonas punctata
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
total genus 199
structure length 669
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iulA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iulA01
4E15A 1ZGCA 4PV7A 1ORWA 4X71A 5K3EA 5FKJA 5JADA 4PQEA 4BVKA 5HKAA 4HS9A 1GXSA 3WK8A 2IITA 2WFZA 4MQMA 2BKLA 3W05A 2JGFA 2AJLI 1LNSA 2FJPA 2HADA 4DMFA 4HAIA 3PF8A 5EIHA 3BL8A 4QDXA 4N8SA 3H2GA 5K3FA 4HRXA 4EY7A 5AKKA 4BCDA 1WM1A 1UK6A 3H18A 2B61A 1BU8A 2BUBA 5A7GA 1AMNA 3ANSA 5CT6A 5ALVA 1Q0ZA 1SFRA 2WJ3A 5HCUA 3CN9A 2WJ4A 4BRSA 5E4YA 2X8BA 1Z68A 4FOLA 2FJ0A 5FLKA 3G02A 4ARAA 4IQ4A 4BDTA 2PM8A 1EVEA 1QIJA 3PICA 2RIPA 5KWJA 1MT3A 1ZIYA 4DSAA 1UFOA 4QA9A 3DKKA 5KREA 3DEAA 3V9AA 2WUDA 2WUFA 3C70A 5DTJA 4PSDA 5HF5A 5DNWA 4N8EA 1G42A 5HFNA 5K3FB 2VQ6A 4OD0A 2I3ZA 5JAPA 3M83A 4BDSA 4B85A 1H2YA 2WJ6A 3WZMA 3DS8A 3H1AA 3LCRA 1GPKA 4KRXA 1H2XA 1VA5A 2JGMA 2D5LA 2RGUA 3D0KA 3LS2A 2V96A 2R8BA 2DQZA 3G0BA 4BP9A 1YA8A 2ROQA 4J0GA 1EDDA 2GYWA 4K6GA 2BFNA 3FYTA 5CT5A 2ZYHA 3QVMA 4WFIA 2K2QB 1WOMA 1YA4A 1KEZA 1N5MA 3NGMA 3A2MA 4DIUA 4QDUA 3STTA 3WA6A 4KACA 2QS9A 2XUPA 3TRDA 1XQWA 5JD5A 1P0IA 1EXWA 3VKFA 3BIXA 2ZYSA 4UBIA 1WB4A 2EEPA 4LXHA 2AJDA 2HRRA 3RK4A 3NUZA 3E3AA 3W04A 3VVLA 3R41A 3WL7A 1XKTA 3FCXA 2RHWA 1QTRA 1XZHA 1P0QA 3T52A 2WU4A 4L72A 2OCKA 4UHEA 1IMJA 1JI3A 4KE8A 1YB7A 3EQ7A 4JNCA 3ZWQA 5AIAA 4IH1A 4F5ZA 4Z49A 1EX9A 1EI9A 5AH0A 4J0HA 1AZWA 2HL6A 4X85A 3GBSA 1CUUA 3ZI7A 5ALDA 4DTCA 1LZLA 2XMDA 3W9UA 4Q3OA 3IBTA 2XUAA 1Q0RA 1CUBA 4MEAA 1QIHA 1LPMA 2VSQA 2Y1KA 5E4JA 2YH2A 3AINA 3MUNA 4F21A 1CUFA 1UKCA 1QJ4A 3KWJA 5BWCA 2G5TA 1DX6A 3E1GA 4XIIA 4WCVA 5AI9A 2XUKA 4X6YA 3G0DA 1GPLA 5ALWA 3HRHA 3R40A 3GFFA 2OAGA 3IIIA 2VJDA 1GPNA 5IVHA 1GKKA 1H22A 1QIIA 2HHAA 3WKCA 3GZJA 2QJRA 2J3QA 1DU4A 2WU3A 4FBMA 4JEIA 4X00A 2WILA 1XZGA 5IVDA 1JT2A 2XQKA 2BGNA 4DNOA 2Y6VA 1WB5A 5AOBA 4IH9A 2C58A 1QGED 5ALJA 2HIHA 4G4IA 2X76A 3DOIA 1RP1A 1VXOA 2WUGA 4MYDA 4KAJA 3FSGD 2XI4A 3WIBA 1K63A 1CLEA 1ODTC 4C6HA 5AI5A 5ALFA 3DOHA 1DINA 1CVLA 5A7FA 5HFAA 5AIBA 1CIJA 3GUUA 1DQYA 3DDUA 2CUTA 4KAFA 3MVEA 5T4EA 1YCDA 3WKEA 5AKYA 3C87A 5FOQA 2WHPA 1CUDA 2AJBA 1BEZA 3DJYA 5ALXA 5FPQA 3RLIA 1MTZA 4ITVA 5E2IA 4AB1A 1LZKA 5IH7A 3IB3A 5JANA 4X95A 1IVYA 1UXOA 1HDEA 2AJCA 1I6WA 2E3JA 3OPMA 4PSCA 1O6FA 1AX9A 2HA4A 3F9CA 4W1SA 4A16A 1GT6A 3B3QA 4NVRA 3WIOA 1QFSA 2PX6A 3N2ZB 2XUIA 4PNZA 3O9VA 3KXPA 2DHCA 3ZPXA 4OUKX 4BC1A 3WK5A 4QDTA 1C7JA 1CUWA 1U2EA 2OGZA 1CUJA 5ALQA 3WK9A 1PJAA 5K3CA 4NS4A 2JIDA 1Q83A 2HA2A 3OTQA 5AKZA 4Y2QA 1HKHA 2XQFA 4X97A 5I8PA 3IUNA 4I4CA 3L1HA 4ETWA 1XZMA 5K3DA 2ZVDA 4I3FA 3HXKA 4ZI5A 3H2IA 4LYEA 1ZI6A 2HA3A 1NU8A 3C6XA 3U1TA 5AM2A 1ISPA 1B41A 3KOOA 5EGNA 3FYUA 3R3YA 4UUQA 4L0CA 2PSDA 3X3HA 4G8CA 4QWMA 4DMKA 1P0MA 4LIPD 5JATA 5CXUA 2C5GA 4C01A 4PSUA 5CH5A 5I9IA 4EB0A 4Q1VA 4EHBA 1MNAA 3W06A 1P0PA 3IURA 3DL4A 4N5HX 2WFLA 3IDAA 3C6YA 5FDFA 4WJLA 3DQZA 1EH5A 1FFAA 3QITA 1JJFA 2CZQA 1PFQA 4DMHA 3K2IA 1E8MA 4JYPA 3BE8A 3C8HA 2XMRA 4XJVA 5AK6A 1FJ2A 5DYWA 5LZ7A 1USWA 3A2LA 3T4UA 3STUA 2QUBA 1BRTA 5HF8A 3D2BA 1QTIA 3L1IA 3AZPA 3DKRA 5FXMA 2HA0A 4G1FA 2HU8A 4H7JA 4P92A 5HKBA 1Y7HA 2WKWA 2WQZA 2HA5A 4QWWA 1THTA 2GYVA 2XMQA 5LKAA 4UFOA 1IUOA 4EY6A 5CT8A 1EB9A 1G5FA 5ESRA 5CXXA 2B4KA 1MJ5A 4OB7A 1VE7A 5ALHA 2O7VA 5EHNA 3I2GA 2ZYIA 1CRLA 3D3NA 4QNNA 1M33A 1JMKC 1XQVA 4JH0A 3GROA 1VA4A 3PF9A 3MUOA 1N8SA 4MYSA 2OQIA 3FVTA 4H7DA 5D6OA 4C88A 2PUHA 3A2NA 1X70A 4L9AA 1N5RA 3OOSA 3G9ZA 5ALKA 3DYIA 3C6BA 1JMYA 1XRRA 3OM8A 2JGEA 4B9AA 1VKHA 3F67A 2WG0A 5CTAA 2HRQA 1YAJA 1FFBA 2H1IA 5AOAA 5T4BA 3W9BA 3F98A 5ALOA 1VZ3A 5LZ5A 3ICWA 3ICVA 3NOXA 4GWLA 5JZBA 2CB9A 4C4XA 3H2HA 1MX9A 5CH3A 4UHHA 2C0QA 4D9JA 4FLMA 5CRIA 2X5XA 5AKLA 3ESDA 1R88A 1DT3A 3O0DA 5AP9A 3WLAA 3C43A 5AKIA 4X6XA 1CUVA 5HZGA 4INZA 1TCCA 1XRMA 3D2CA 5AICA 1XZAA 1XROA 1WHTA 3TJMA 4DYHA 1E3QA 2HM7A 3QH4A 4XWGA 5KBYA 5D3ZA 2JEZA 1ZD5A 1XZLA 3I1IA 2XQJA 4CIBA 1J07A 2JGLA 4E11A 4FMPA 1KU0A 3HSSA 4B83A 2WHQA 3O4GA 4B82A 4MWTA 4UBMA 1ORVA 3SX4A 4OU4A 1ZD3A 5A7HA 4UHFA 5DTIA 1TRHA 1WCYA 5ALRA 1SCQA 4K5QA 1N1MA 2PU7A 1XRLA 3QBJA 3HEAA 2G5PA 3VJMA 1BS9A 4XVCA 3NWOA 2LIPA 4KJXA 3WYNA 1DX4A 4ZREA 2DCMA 2CMFA 1QIEA 3V1LA 4AMYA 5EI5A 2OCIA 4UBJA 2AXEA 4QLAA 5C8XA 4FTWA 4B0PA 2CBGA 3PFCA 1NX9A 1UK8A 4CCWA 4QE3A 5ALNA 3DLTA 4PW0A 5J3JA 1F6WA 3I2JA 1UOQA 4U2GA 2WTNA 4UFPA 4AZ3A 4BP8A 2JF0A 4RGYA 4Q3KA 5CURA 1WB6A 1HPLA 5DJ5A 5ALEA 2QMQA 1AGYA 3WK7A 3W2TA 3V1MA 3TEJA 1UT6A 2HA7A 2PU5A 3I2IA 2QXTA 5AKXA 2XMGA 3H19A 1CUAA 2VJCA 5HK9A 3L1JA 4CG2A 4HVTA 4BZWA 3JWEA 2QR5A 3HACA 1FFDA 1J1IA 2Z3ZA 1E89A 5KWIA 3QZUA 1CUZA 1TCAA 2YXPX 1A8QA 1F0NA 4G8DA 2XUGA 5AI0A 3UUFA 1CUEA 2PBLA 2XUJA 3WI7A 3PFBA 5ALUA 5JD4A 2JGIA 3QMWA 4J0DA 4OB8A 2WG1A 1Y7IA 2ACKA 3VXKA 1A8UA 4Q3LA 1LPAB 2PSEA 2JGKA 3TGLA 1MN6A 1A7UA 3FAKA 3PE6A 5AKEA 3G8YA 2BAGA 4BZZA 3LIPA 4AQDA 5ALZA 1U4NA 3ZLVA 5AKGA 4H7HA 2ZJ7A 4EY4A 1XZJA 5DLPA 1LPNA 1B6GA 2QT9A 3OURA 1U65A 3KD2A 2GBGA 4GBGA 2WUEA 2XE4A 4M0EA 5ALIA 5AI4A 3C8DA 3AJAA 1ZJ5A 4IHAA 3WKAA 4XX1A 5C81A 2JEYA 4LHEA 3G9XA 1IZ8A 2YYSA 1QFMA 4Q05A 2OAEA 1X2BA 4AN1A 4E14A 1DWPA 3D5EA 3U0VA 3RARA 3WZLA 1S8OA 4K6HA 5LZ9A 2XUOA 3M82A 3M81A 3O9MA 4BE4A 3YASA 1VJ5A 1QIDA 5A2GA 1JU3A 5HQ3B 3DNMA 1L7QA 3BWXA 2V98A 2BGRA 3HC7A 3AIOA 3FBWA 3O4JA 2I3DA 4O08A 4P9NA 4DM7A 3RKSA 4AO7A 2WIDA 2GBCA 4ARBA 4BC0A 3ZLTA 2W6CX 3DL7A 1L7RA 3QMMA 4A23A 4HXGA 4U2CA 3WQHA 5SYMA 2QKYA 3EQ8A 5LP1A 2XUDA 2OCLA 4BVJA 4G9EA 2DHEA 3SC2A 3EQ9A 4Q34A 2PUJA 3LLCA 4FHZA 4J03A 4LXIA 5AI6A 4G9GA 2H7XA 3BJMA 3HABA 5ALPA 1QIMA 4X91A 4MQLA 5AOCA 3CXUA 5BOVA 4EBBA 1ACJA 4OYYA 5I7UA 1W4LA 1CUYA 1YB6A 4BAUA 3LP5A 5ALSA 4BAGA 3SWWA 4BTLA 1E8DA 3I1YA 3R0VA 4V2IA 1X2EA 4YK7A 1K4YA 1YS2X 4J0KA 4QDOA 3WKBA 3I2FA 5AK4A 1LPSA 1W52X 5DNUA 4C4ZA 1CFJA 4AX4A 5LKRA 4ZGBA 2JGJA 3ESAA 4Q82A 5EHXA 4B9EA 3WK6A 4GXNA 1BN7A 4M0FA 2PSHA 5K3AA 3HLKA 1Y37A 2QVBA 4EUSA 4EY8A 1CUGA 1XRPA 5A62A 5LZ2A 5AK5A 4OU5A 4C87A 1ETHA 4BYMA 1NU6A 2HFJA 3IUMA 3F97A 1CUIA 3PI6A 1LPPA 4YX9A 4BB0A 3H17A 4W63A 3VJKA 3FYUC 3M3DA 2QJWA 3FLAA 4G4JA 3VDXA 4DSZA 3FLBA 4RPCA 1R50A 2JBWA 3QYJA 2IX9A 5IVIA 2R11A 1LBSA 5K5EA 1YASA 3C45A 5AHXA 1T2NA 4CCYB 1QONA 3LIIA 1MU0A 1WPRA 2NW6A 1XZFA 3KDAA 2ZYRA 3D4LA 1IUNA 1MO2A 4X7BA 3R3XA 2OQVA 4HXFB 1R1DA 4KEAA 1QE3A 5AO9A 2OGTA 2D0DA 2GBIA 5AM1A 4J3JA 3O95A 4MXDA 5LYYA 1VOTA 1E5TA 2XT0A 3DCNA 4F0JA 1ZD4A 3FNBA 1GQSA 2WFLB 4J0JA 1LBTA 1GZ7A 4EA6A 2XDWA 4OB6A 3FWHA 5JALA 4FNGA 2EDAA 4B0OA 5ALYA 1ZICA 4JUIA 3QM1A 4NZZA 3G0IA 3F8SA 3IUJA 5D3KA 4Y2XA 3CCCA 1QIGA 4KE6A 4ZXFA 4KAAA 3R3VA 3G9UA 4LKOA 1ZOIA 5T4HA 1BN6A 4PO3X 4BATA 3ZLUA 3OG9A 3QMVA 3WL6A 4X93A 3I6MA 1OCEA 5LLSA 4DNQA 4L3WA 4B81A 2DFPA 3SK0A 1DWQA 4K2AA 5E4TA 2BUCA 5IVKA 5H3HA 4CCYA 1XZCA 5AM3A 1W1IA 2Z8ZA 4H77A 3I28A 5LZ4A 1LGYA 1R9NA 4AMZA 2YASA 1XQYA 1BCRA 2WFMA 3IULA 2Z3WA 1XLWA 4H7EA 2XMSA 4DLNA 2ZSIA 4S0XA 3CN7A 1BE0A 4HZGA 1UWCA 3D7RA 2Z8XA 2RHTA 1F8UA 3VJLA 4AO8A 1VXRA 2FX5A 3WWCA 3K9BA 4BRZA 2XMZA 2OG1A 1EINA 2P8SA 4Y2UA 1AKNA 2VJBA 4K6KA 4LYDA 2EDCA 5JZSA 4AXBA 4ZV7A 4OSEA 5JAOA 3IUQA 3AFIA 3STXA 2VA9A 1FSSA 3FVRA 4LXGA 4J0CA 4FWBA 1CR6A 1ODCA 1XZIA 1TQHA 1THGA 3H2KA 1CQWA 3AIKA 2QZPA 1XZEA 2XLBA 2O2HA 2VAXA 3AILA 1XLVA 2O2GA 1LLFA 1FFCA 1K5PA 3QPAA 1SC9A 1YSCA 1MAAA 5T4FA 1TIBA 5IKXA 4UPDA 5JYCA 1A8SA 2H7YA 2WLSA 3PDCA 3ANTA 4GW3A 5HF9A 2H9YA 5ALLA 4U2EA 2CJPA 4A5SA 1C7IA 4TVKA 3WL5A 4M0MA 5JIBA 1U8EA 4JYMA 3P2MA 1H2ZA 5AKJA 4C89A 4BCBA 2WHPB 2CKMA 4UBNA 4AN0A 1ZIXA 2Q0XA 1LPOA 2OGSA 4N5IX 5AM5A 2FUKA 3ED1A 1UOPA 1JFRA 1R3DA 3D59A 5F4ZA 1J2EA 4IH4A 1XZDA 3S2ZA 2ZJFA 5SYNA 1HBJA 4BAZA 4UFNA 4QZVA 3R3ZA 1AURA 2WG2A 4HXEB 1MX5A 4W9RA 1SCIA 2GYUA 4Y7DA 2C7BA 3VVMA 1CV2A 1A88A 5FV4A 1XQXA 1EA5A 3HYSA 1AC5A 5ALTA 1JJIA 4TPKA 5AK3A 2DHDA 1MNQA 2Y2UA 3WWOA 1XZBA 3H2JA 3WWDA 3V1NA 4UHBA 1R4ZA 2Y6UA 1CPYA 2H7CA 5CT9A 1EVQA 3B5EA 2G4LA 4U2FA 4DNFA 2ORYA 5FP0A 4X6UA 5CBKA 4WY5A 3IA2A 3H0CA 2DR0A 2C0PA 5JAHA 5D7BA 3HZOA 5JD6A 1IZ7A 4X3CA 2B20A 1VE6A 3D2AA 1G4HA 5JASA 3UUEA 4WY8A 2DQYA 1OXMA 3FYUB 2VF2A 4E46A 3JYHA 1WHSA 4ZRDA 2VEOA 1DTEA 2O2IA 1YAHA 3GELA 4G8BA 4BE9A 5ALMA 4OPMA 4H18A 6YASA 3STVA 3ESBA 5FRDA 1EDBA 2QXUA 5DYYA 4CFSA 3A6ZA 1CUCA 4EZIA 4WDRA 3WL8A 1R9MA 1XRQA 1DT5A 3Q0TA 3EF3A 2PL5A 2BCEA 1JJBA 2VTVA 1MPXA 4WDQA 1W6RA 1ZJ4A 5EIAA 4OCZA 2CEKA 3MGAA 3WWEA 2XQGA 4DNPA 3H04A 5C7YA 4KR0A 3WWPA 3DD5A 3KSRA 1EHYA 4QDZA 1XZKA 2GZSA 3OC0A 1QO7A 3G9TA 3PUIA 4Y2SA 4GECA 1FFEA 1UKBA 2WIKA 4P93A 5FUMA 4U2BA 4NMWA 2VATA 4AZ0A 4FKBA 3R3UA 2ECFA 2HDWA 3V48A 1UZAA 2PSJA 3G7NA 4MEBA 5AM0A 1RWQA 3A70A 1XRNA 5K3BA 3KWFA 1XKLA 1TAHA 2QRUA 4HTAA 5AJHA 2XUFA 1GKLA 4MWSA 1EK1A 2O7RA 4W1RA 1UKAA 5BV7A 4B7ZA 5CT4A 3C5VA 3WMRA 4FBLA 4FDMA 5DNVA 2UZ0A 3QPCA 2WSLA 2ZJ6A 2Y2VA 2HFKA 1ZGBA 3VISA 4X90A 5C8VA 5LIPA 5A6VA 3C6ZA 2WTMA 2HA6A 4FFVA 2XUHA 2VAVA 3WKDA 4MJ3A 3F96A 3WK4A 2V9ZA 2DSNA 2WIFA 4FLEA 2HU7A 4Y2RA 5LZ8A 5ISMA 7YASA 1ACLA 4Y2YA 2G63A 1YR2A 5BWBA 1G66A 3I6ZA 5EHQA 4F60A 4QLOA 3ESCA 3PUHA 1MAHA 1UOOA 5CW2A 1D07A 3E4DA 2I78A 4B80A 4H35A 5AKHA 5HK8A 1BEEA 1BROA 5C8ZA 1TKRA 3FSGA 4OYLA 4FFWA 3IVMA 5EFZA 4RE6A 5A71A 1C4XA 2GBFA 2ES4A 1J06A 4FNMA 1SOMA 3ILSA 4Y2TA 1EDEA 1F0PA 2J4FA 2B9VA 2PPLA 1GQRA 2W22A 3STWA 4UBLA 4ZWNA 4DGQA 4UHDA 1K6EA 3BJRA 2QUAA 4Y9SA 3AIMA 3K6KA 3G0CA 4I19A 5JAUA 4EY5A 5CMLA 1DQZA 3GA7A 4CIAA 4WFKA 4B84A 3BF8A 3HJUA 4RE5A 2XQIA 4U2DA 2QTBA 2OPHA 4GDMA 2VT7A 1EK2A 1AQLA 3EBLA 4KRYA 1VZ2A 1KU6A 4Y2JA 4GHWA 4WFJA 4UBKA 4Y2VA 5EIEA 4QEKA 1DWOA 2GZRA 1GGVA 5HQ3A 4FLFA 4IO0A 2HU5A 1UK7A 3WJ1A 2RAUA 3V1KA 1K8QA 1TK3A 1QZ3A 2QM0A 4CG1A 4W1QA 2WIGA 2PKYX 2C5FA 3EIOA 2RI6A 4ROTA 1CUXA 5HF6A 2Z5GA 2OLEA 4H0CA 1QIFA 3AZQA 1VLQA 4B6GA 5JZ9A 1PV1A 1JKMA 2XMCA 4W1PA 4H7IA 4N8DA 1T4MA 1EB8A 1HLGA 1LPBB 1E66A 4ZV9A 1JU4A 1XFDA 2WM2A 2I03A 2QOEA 2V97A 5JARA 1YS1X 1BCSA 3O4IA 4CI9A 3AUKA 1ZI9A 2BJHA 5AM4A 2WHRA 2RONA 1HL7A 2J4CA 4UBOA 3BDVA 3Q8WA 4PF1A 5AI8A 1QLWA 4GI1A 4J7AA 4P08A 4H7KA 4X94A 4YASA 4HRYA 4H7FA 1SCKA 1WPXA 2AJ8A 4KYVA 3I2KA 4J0IA 3RM3A 2XMBA 4KE9A 1QO9A 1W76A 2PSFA 5FPPA 5CH8A 3FCYA 2BUAA 1ZI8A 2IIVA 3N0TA 2C4HA 1TCBA 3I2HA 4GLBA 3JW8A 1W75A 1IUPA 1O6GA 1HQDA 4C4YA 3FLEA 3WA7A 5DWDA 2OCGA 4BTVA 4AO6A 3WJ2A 4RNCA 4YPVA 5YASA 4UHCA 2J3DA 3CCBA 1AUOA 2ACEA 3B12A 3ZV7A 2ZSHA 3BXPA 4X92A 1CUHA 1ODSA 1CQZA 3AZOA 4BVLA 1H2WA 4BCCA 2PVSA 3R3WA 3I6YA 2WIJA 2OXEA 4DMCA 1ZD2P 3BDIA 3E0XA 5DYTA 1UK9A 4Y2PA 1CUSA 1QIKA 2XB6A 1OILA 2VT6A 3STYA 4GEGA 3HI4A 5EHZA 3C5WP 3S8YA 4G4GA 3DYVA 1Q84A 2XUQA 4BBZA 1L7AA 1MX1A 2XLCA 4TGLA 4G5XA 4KE7A 1E8NA 3BIWA 3BF7A 1CEXA 3FOBA 3O4HA 3QPDA 1QOZA 3G0GA 1H23A 2ONCA 3H1BA 2VJAA 3WYDA 1XLUA 5ALGA 4CG3A 3UMJA 1RYYA
chains in the Genus database with same CATH superfamily
5FFNA 3KAKA 1OLOA 1QO0A 4JVNA 4RD4A 5I5GA 1IBCA 4X71A 1ZFNA 4M8LA 4W5OA 2DLCX 3CIKB 2IPMA 2KQUA 1YIDA 5F3WB 5JADA 1D0IA 4S35A 2IU6A 1M2EA 4I0WB 1QTQA 1L8LA 1QC5B 3SNKA 2NYVA 3DMTA 4ID9A 3H16A 5DEIA 4WKBA 5HKAA 1UBFA 1GXSA 3R0QA 4KG7A 4AI6A 1N2BA 1PO7A 3LZDA 1QJCA 3MTIA 3VPGA 3FNRA 4ZO4A 2JFVA 1VSQA 3MXXA 2AUNA 4WN3A 3MIZA 2BKLA 3EPKA 2WF8A 3O03A 3RUCA 3V8VA 5B5SA 1XTRA 3CVYA 1RPJA 3EFOA 2D74A 1TE2A 2YJ4A 1L8QA 2GKGA 4WADA 5BW4A 3U6BA 5B2EA 1DIHA 3I7PA 1FRZA 4G5RA 3BL8A 4PXSA 5BSHA 1L5SA 2YWJA 4N8SA 5DULA 1YMQA 4A0RA 4FXPA 1O94C 2BFDA 4BEWA 1XGKA 4EY7A 5HG0A 3U4AA 2IOFA 2NUAA 4BCDA 2ZRNA 4D9SA 1NXWA 2C3YA 5K8JB 1LA2A 3ZY6A 2CBZA 4QUKA 1U8ZA 1W2WB 3L07A 1WM1A 2DFVA 4F9GA 1HZZA 3GL9A 2PR7A 2X4LA 4F6RB 4MS3A 1A8IA 1T3LA 1BU8A 1X8XA 5EZ6B 2DZDA 3TH5A 4CLXA 3UK6A 3D8RA 3OD5A 7REQB 4RCVA 2V7WA 1HFWA 2PA3A 3GU3A 5DHRA 4ZJUA 3B9QA 2I5PO 2IOQA 2VK8A 1XJ0A 3CR3C 2Z43A 4BRSA 1QTNA 4HYEA 1Z68A 3D43A 4Q5IA 4H6WA 4YS6A 2FJ0A 5FLKA 2FN8A 2HQRA 2GVNA 1E0SA 4DAEA 1Y6QA 1S96A 5CG1A 1IOZA 4E54A 4ARAA 3AYXB 4WZBA 2Y1LA 1WX1A 1XN1A 1R10A 3OCZA 5FPKA 2BMWA 4IQ4A 1G3RA 1DEOA 2EIBA 1JQAA 4EMTA 5BWOA 1ZD1A 3OIYA 4L0QA 4LHYA 3ZE1A 3IVAA 1MT3A 1IYZA 1ZIYA 3H9BA 3IP1A 1PG5A 1JN0A 3LKBA 4DT1A 4QA9A 2PLNA 4ZEWA 1F14A 4PC7A 2UYOA 4QUEA 4U9HS 2NNWB 4MGIR 5KREA 4YAWA 5CFLA 1X7XA 3TFQA 4IDEA 3W6NA 5CLHA 2OM2A 3KBBA 3RC1A 4AM8A 4ZT3A 2B5MA 3AY6A 1P80A 2WUVA 4FD3A 4JWTA 3AF6A 2FSSA 2XE8A 1Y4ZA 1E4VA 3V9AA 2W2NA 5E95A 2GAOA 4AU1A 5JCZA 2DCUA 6LDHA 2IELA 4OHMA 5M2QA 3EVNA 2V0NA 4KQJA 4P0PB 3VH1A 4F4FA 2J41A 5JFOA 4PSDA 3HJRA 3OUTA 2JGDB 1FUIA 2PWPA 2VUSA 3F5MA 3JTEA 4ZAGA 1GKYA 4MMZA 2CNBA 3EMVA 2X3UA 2QW1A 2VN8A 1WKCA 4FOSA 5DBOA 5FO0A 3ZGLA 2GNPA 2QTLA 4YRKA 2GLXA 5DT2A 2VQ6A 1GTJ1 2AVNA 2WAMA 1J90A 4DJFC 1CRPA 4GSLA 2I3ZA 2FFHA 3FB1A 3K0AA 4NE7A 4P33A 3W7VA 1XYVA 4BWYA 1JFFB 1QHYA 2LTAA 4HH0A 3EDOA 2G0AA 4QVGA 4B85A 4E4RA 2WJ6A 3T4XA 5IJ9A 1OBHA 1O6BA 4XDGA 1C9LA 3RS4A 3H9EO 2FF7A 4M4SA 1IWBB 1X80A 1RQ7A 4U7HA 4D4HA 1OZHA 2VT3A 4GGOA 1KI3A 5DVZA 5H70A 5T6MA 3CNQS 3S6JA 2OCAA 4AJLA 2UKDA 3H1AA 3HZHA 4PPNA 2J57G 3A1CA 5F7OA 4JLOA 2HF2A 2HLDA 1XEAA 4KX3A 3IQIX 2XR1A 3GJ3A 5JS7A 1JHAA 1H65A 4B3TB 1AUXA 4A09A 4V24A 3G1WA 3RUEA 3V1TC 4RVSA 3OFND 3W5IA 3FFTA 1WHSB 2G9UA 4N3AA 4FK8A 3WGMA 1TM5E 2RGUA 2D5LA 3LS2A 1O95C 2QQGA 1NVFA 1VJ1A 2R8BA 2REOA 3R1IA 3KX2A 5TDHB 1HETA 2A57A 4LQDA 2OM6A 1C8VB 2XDYA 1IQ0A 3QVLA 2ROQA 2CLDX 3HNPA 3EQ6A 3IMCA 2V1UA 3ZDZA 2HJWA 4R8SA 2I6UA 4C4SA 4EJMA 3M1LA 4LNUA 3ENWA 1DDIA 4BWGA 2BFNA 1ICEA 1S4QA 1FYDA 1VG0B 3FYTA 2D3TA 3QE2A 4O4LA 5EMMB 3QVMA 4L5AA 5CT5A 5D3MA 7REQA 3ZZ0A 1JIIA 1U31A 1YA4A 2A2ZA 1H5NA 4LEIA 4F4CA 2B21A 3OT1A 1BQ3A 2E4YA 3HCBA 2FN3A 3DXFA 2R8YA 3A9RA 3WGUA 3GN2A 3GBVA 5H81A 2XWSA 3T5MA 1P4HA 2G7MC 3IOEA 4GVLA 1XCMA 3JAKB 3P9NA 3QF7A 3ICPA 3CEPB 3MWJA 4L1MA 1PT7A 4ETIA 2COUA 3FCOA 4KACA 5C92A 1J0EA 3ZWAA 3KEQA 4RBNA 5CITA 2EICA 1O5TA 5KCZA 1KK0A 1NKTA 3UJDA 4ONEA 3Q88A 2YVUA 2PVCA 5EY5B 2QN7A 3BIXA 5JNUA 2ZYSA 3KZVA 2OUKA 2LCFA 1FTWA 3LY5A 4MULA 4IDPA 1P2SA 3HVJA 1R8JA 3PFIA 1GG2B 3GF4A 1BX3A 5M5UA 2GRUA 2J55H 2HRRA 3D4PA 1ZONA 3EQ2A 2PL1A 3L1UA 4FDLA 1N6IA 4TTRA 3S2FA 5JDIC 1DEAA 2F62A 5FR2A 3W04A 4DEVA 2O1SA 1S8FA 3VVLA 3WL7A 1JHMA 2DOKA 2VF7A 1WY7A 2ZYUX 3FCXA 2EFYA 1QTRA 3O21A 1BRMA 3M4XA 3AHDA 3DW3X 4IZOA 3M5CA 4KFSA 3ICEA 1P0QA 4Q1FA 1V26A 1CDEA 3QU5A 2ZU6A 3A9WA 1TC2A 3EWAA 4RA9B 4M1YA 4WOJA 5DBEX 5TVKA 3WGLA 4RTJA 1EFPB 4UHEA 1NLYA 1IMJA 3OWXA 4RF5A 2ZTVA 3FF1A 2YJTD 3KKOA 2PGLA 2GPWA 5P8WA 1NMZA 4JNCA 1I13A 2YJ3A 1BX0A 2H2IA 2DPHA 1R18A 2QIPA 2YXBA 3DB1A 2JW5A 3F3KA 5FPTA 5GPBA 4C08A 4Q02A 3A8TA 2AYZA 1IWOA 1RMYA 5BSRA 1DPGA 5LIRA 3OEYA 1EX9A 3C3KA 3W2EA 5KTKA 4YRLA 1NIPA 1QYCA 5AH0A 1P5JA 5C7OO 2EFDB 2J0EA 2B5OA 4GICA 1RLOA 1QK5A 2QVZX 3T3NA 1KZ7B 4L95C 3S5UA 3LC7O 2WRZA 3H8WA 5HKOA 4HDKB 1SG6A 1X80B 2BFMA 2NUPA 5JWOA 1ZRHA 2CCGA 1BD4A 2XMDA 4PX9A 4BLTA 2D54A 2J7PA 3HKCB 4BZPA 1E62A 4QHTA 3U26A 4XGQA 2JPDA 1OAKA 1IBLB 4HQOA 3CKKA 1WBDA 3GDGA 1RQPA 5TEEA 1FXUA 2EJWA 3V8MA 2BKAA 3PJRA 4MLPA 3CNLA 3DEYX 3FGPA 3OU6A 4I55B 2O8BB 5EG5A 1QIHA 1Y63A 3D1VA 2JFFA 4H5IA 4QL1A 4LTDA 4PLPA 4G5HA 1SOVA 1DCTA 1J25A 2RJOA 5A05A 1HDZA 5TDHA 5EJ2A 1U0RA 2GCOA 4AZSA 5E4JA 3CUWA 4Y6OA 4GGMX 5D5HA 1RYZA 2GLTA 4QREA 2DWPA 3DXYA 2QVXX 1XVLA 4WCFB 4IZIA 1WDLA 1GZVA 3USES 1QX4A 3BEDA 4HAZA 2ET6A 3IIWA 1UC8A 4LYYA 1D4AA 1T15A 2GAFA 1FLAA 3GDHA 4U7TB 2YOHA 3KWJA 1K7XB 1SQJA 2G5TA 3D4BA 3LPNA 1ENYA 2AGXA 2J9ZB 3IVXA 4O6VA 4XIIA 3Q3EA 1PZGA 3OMLA 5A3VA 2VEDA 3I4LA 1LRKA 4WA7A 3ZBTA 3ZTYA 4F7WA 4X6YA 2YHSA 3NHBA 3HP1A 3MJTA 2SECE 2O1XA 4OF4A 1Z26A 3PPWA 4QULA 1GPLA 4JGBA 5ALWA 3W78A 1Z47A 4UVHA 3T1HB 3HRHA 4PCLA 2C5BA 5FQOA 2OAGA 3IIIA 5TGTA 1N2XA 2H6QA 4NECA 4GBJA 2P6MA 1E4OA 3KU4A 1M10A 3P2YA 1XL1A 2QYOA 1EKXA 2BDTA 5IVHA 1YS7A 2Q5CA 4YUXA 2MYPA 3P2EA 3KPVA 4KB5A 5K0LA 3CVVA 1WB9A 2OWDA 3EODA 1S2GA 5FTWA 5C51B 4NAHA 4AMGA 3HCAA 2YQ4A 3INNA 2NP6A 4ALNA 1F2VA 3MZKA 3GVPA 2A0WA 2DUWA 1FS4A 2Q5LA 2E85A 4CRWB 4PTYA 3RF6A 5HOEA 4ARUA 1UWVA 5CB0A 3KHTA 3GZJA 4AQ7A 1YUMA 3JPXA 2Y0PA 3EDCA 4LHSA 2CBXA 4XDHA 3GX1A 2REXB 3L7JA 2RH5A 1A3CA 3JZIA 3MWKA 3OZBA 4PFJA 2IVFA 2WPNA 5E38A 4BIMA 5A4JA 3T5TA 5K4HA 4B6QA 2ZYAA 3D4IA 4FU0A 4H17A 4PPFA 4X00A 3QBEA 1XZGA 1Z62A 2E9SA 4J4BA 5EL0A 4I1RA 2JFYA 2I9PA 3BH0A 2IF0A 4XEHA 2BGNA 1MC4A 4WCDA 2W2KA 1Y7TA 1OLSA 3CEHA 4OHWA 2FPIB 4IH9A 4O3MA 3G0OA 5JQGB 4N5MA 2QTMA 3NAGA 1J00A 1V7ZA 4LVNA 3SLRA 1QGED 3K71A 4GPTA 3B9PA 2W9XA 2OPBA 2GWRA 3DBRA 4A2PA 4C20A 4E1VA 3O91A 4YJ3A 3ASVA 4QOHA 5I6DA 3UWKA 5I48A 3WDSA 2X8JB 5L3ZA 4K3JB 5BQXA 3DOIA 1E6KA 1VXOA 2X77A 4BLOA 2FPMA 3E9DA 2FW6A 4QUJA 5D84A 3AI7A 1D8TA 2CB0A 3IBCA 3HBAA 4N5LA 3ZWKA 2XI4A 2HWXA 5EPUA 2VUTA 4GMDA 4X60A 3UPDA 3WIBA 3KYCB 2XF2A 3QOFA 4LV8B 5JYEA 4QT8A 4NENA 2Q99A 5FBLB 3ELYA 1BO6A 4JLBA 3TPCA 3DAFA 4F4HA 1Z0UA 3DOHA 3O8QA 1N7IA 2ZBPA 1XNRB 3TDMA 1RZRD 5KNCH 5AIBA 3DMYA 4TWRA 3HCEA 1BA3A 2EF1A 1M34E 5AVXA 2R5NA 3Q7RA 5CUQA 3JVDA 1DQYA 3TJRA 3UJ8A 1NXVA 1XO1A 4JBWA 4YEDA 3DDUA 3K8QA 1NVBA 4DDUA 1J7KA 4M76B 3EHEA 3NALA 4KAFA 4NYJQ 3DXMC 1RXSA 1X8KA 3CISA 3WKEA 1TAQA 1I2DA 4NLLA 3BA1A 3ZOKA 5FOQA 1CUDA 1D2AA 1Z5WA 2BI7A 1KIFA 1OBOA 2Y3IA 2Z08A 3C8MA 4KV7A 2QRZA 4XD7A 2R751 4ERXA 3ZJ4A 4FB5A 1XA3A 3E8MA 4EHAA 3AB3A 4QSHA 4AB1A 4ITVA 2CXPA 3GRYA 1USGA 1ECBA 2IYAA 3Q7PA 1M6WA 1Y9AA 4GI5A 4JELA 1Q1EA 4JUFA 1Z5GA 3LA6A 4V38A 2OV8A 3RRFA 4DHEA 1JHYA 3AUJB 1DXOA 4LG9A 4FI3C 4PZ0A 2C9BA 5BRJA 1VFNA 3PB3A 4BMPB 4BU0A 4OHOA 2J3MA 3DCIA 1UXOA 3L7BA 5D00A 1AG9A 4BNDB 2JGRA 4TKLA 2AKEA 4RQUA 1LSOA 5T8KA 2FK8A 5DDIP 4Z9YA 4LE0A 5KU1A 3A06A 2CVOA 3UV7A 4AYWA 1T0IA 2E3JA 2VXBA 3K5HA 5TPZD 1O6FA 2DF8A 5EXEA 2RGWA 4MWEA 4YRMA 4ZKEA 5BNFA 1HNZB 3H2ZA 4W1SA 4P1ZA 1KXJA 1BZYA 2B25A 3H2YA 1W7AA 2QMYA 2JH9A 1GT6A 1SZDA 4TMZA 3K15A 4MUBA 3HU5A 3WX0A 1LW7A 1CTQA 3COVA 5HMMA 5CBPA 3E7WA 4UCWA 3RC8A 1GOFA 3EEIA 3CVXA 3P0FA 4LE1A 1LTKA 3G5AA 4QTUB 2C3MA 4A8JC 5C53B 3PR2B 2CV1A 1PAUA 4C0QC 3KXPA 1X38A 1K92A 2P6OA 5BP7A 2GEKA 4QDTA 1N0VC 1A5SB 3WQSB 1CUJA 3DTVB 3CF6R 4IDCA 4L02A 3WK9A 4KXVA 3OQBA 1V8ZA 2OO7A 4YJ3F 1V8PA 3QVSA 5BN3B 2MSWA 3ORVD 3D81A 2IHJA 4GGAA 1Q83A 2O4UX 1P45A 1TKBA 3LK7A 3G8DA 3WNVA 4AD8A 4LCJA 5CXQA 1VYVA 2Q2VA 2ZRDA 3JAWA 5AKZA 4D0KA 1QOPB 3HLYA 1VLLA 2GVZC 2BL4A 1HKHA 2VBCA 2XQFA 3AERB 5I8PA 1GGNA 1MOQA 2VAPA 3LW8A 4EJ2A 1MVLA 2Q45A 3J80A 1B3RA 2RHOA 4Q4JA 5DI9A 1I3KA 3FIJA 2F3PA 3L05A 2ZVDA 1E9EA 4TLLB 1E2UA 1RHQA 4KXQA 2X7XA 5L7YA 4E4YA 2R68A 4MVJM 2XMPA 2NVWA 3H2IA 4BQEA 4YJGB 1CY2A 1NPYA 3P8ZA 3CGWA 1SJ9A 5JMPA 5B7PA 2GILA 3E7XA 4QJBA 4RADA 2PNJA 1OGIA 3QUBA 4EJ6A 3AKDA 4FMCF 1JNXX 2YFYA 5JTUA 3Q3IA 3KOOA 4GBED 3HEBA 4TLBA 2BHSA 2EW1A 1D03A 1BWRA 2MYUA 2ZIEA 4G36A 3SBOA 3UXMA 1Y6GA 1EDZA 5ITZA 2IVZA 4MYTA 1EAMA 4WK4B 1CJUC 1F1BA 3BOSA 3I45A 3EAQA 4N65A 4QWMA 5ADUS 1Z29A 4R2JA 4DMKA 1P0MA 1SVKA 1LVHA 2V8BA 5DLDA 3FTEA 3VNVA 3N58A 3R5TA 5A0FA 4EF5A 4YMTA 1JB9A 1GPDG 4C01A 3ZE2A 4H6VA 2RD2A 4HP8A 1UIRA 4BGEA 4PPQA 3PSLA 5CB8A 3OQJA 2ZVQX 5CH5A 3TX6A 2O57A 3AJ9A 4CQLB 4UNRA 5KHLB 2IS6A 4ANFA 1K3IA 4P81A 4GSYA 1SOWA 1DNPA 2RI0A 1L0BA 3DOCA 3LWBA 5T57A 3IQGX 4MKZA 3T12A 3E2MA 2C2YA 4BNKA 2QSJA 4F06A 1JKXA 1S2MA 5IT5A 4YAFA 5BVHB 1L4EA 1U5AA 3BK7A 3IDOA 4FZRA 3H5TA 4FGZA 3TK1A 5EE5B 1TM2A 1MORA 1RFGE 2H06A 1NOJA 1UJ6A 2I34A 4RMIA 4NH4A 4D46A 5CXBA 1GSIA 1QGUA 3P2KA 4WJLA 3QY0A 1FVXA 2HSWA 2GSWA 4AY2A 4AJOA 1NW4A 1PEYA 3BWSA 4A0BA 2C77A 4IXNA 5DH9A 4GM1A 4CL3A 5K3SA 1JJFA 3GPCA 4MVJH 5KNDA 3H05A 5IJ7E 3TD2A 1QGOA 1HDGO 2VRBA 1VHDA 2O1WA 3LBHA 4NCKA 1I32A 3BE8A 1E3EA 5HS6A 2K6GA 2XMRA 5B1HA 1FJ2A 2JAQA 1EUCA 2XECA 4HFMA 1WIWA 3LPMA 3GAFA 4BMSA 1WVMA 3CONA 1HYHA 1NSYA 3KZKA 4MQFB 4R8VA 3OLVA 3VAAA 3I23A 5LQCA 3T4UA 4CM9A 5DKFA 2IUQA 4JFAA 1L7DA 4MVWA 3RUDA 1HLDA 1UBGA 3URMA 1QTIA 3DGFC 4PXAA 1DO0A 1P3JA 2GCIA 1ZMBA 3W4JA 1O3YA 4EJSA 1XALA 3H1PA 3VZCA 2AZTA 2QQ5A 3MGBA 2AT1A 4TV9A 3REOA 2ON6A 4B7XA 2WC1A 4BO8A 3GR6A 4OX9Y 3PR1A 4XYLA 1WKBA 4EGAA 1N7HA 1M1YA 1I7DA 2WIAA 4MGYR 1JSLA 2J7PD 3N6XA 4BKRA 2HO5A 2PDAA 3PSCB 2UAGA 3PL1A 4P92A 2VQDA 1Y7HA 1GADO 4AY3A 2H1VA 3AG5A 3I0ZA 3S81A 3UAYA 1EVIA 4HDAA 1Q19A 4QWWA 3AUXA 2YV5A 2UZAA 3KT0A 2FR1A 3T5BA 2HSZA 2ZRCA 1FXSA 2BM0A 2Z0MA 4Q7EA 5K2OA 4RZIA 3RVJA 5KSYA 5LKAA 2C8JA 4JVSB 4LJ8A 3UK0A 3IDFA 3K9FC 2JB9A 1IUOA 2E37A 2OYSA 4NBKA 1EVLA 4EY6A 2AH0A 3CTPA 2I1QA 3KJNA 3OZ7A 2XA1A 5CT8A 1KE2A 3FOEC 4J7UA 4MMYB 2OXTA 4R9SA 2KPOA 2B4KA 1MJ5A 3DMGA 3BB4A 2LW7A 3H7IA 3K72B 1T8RA 2YN2A 5ALHA 4D81A 5LDHA 4DNVA 1THZA 3PHBE 3R3JA 3TE6A 3FJYA 1LDYA 4RH3A 3VYTB 3KTAB 2ZAMA 3PD0A 3H9CA 3K0CC 3PQ2A 3Q8XB 1LDEA 4HEHA 3WY9A 4NFHA 5TT1A 1LLUA 4GKBA 3D3NA 4M55A 3EUEA 2O0KA 2CXOA 4KCGA 1CS0A 1VA4A 5EN4A 3BRWD 3N5KA 1DEXA 3RC9A 4COKA 2OBBA 3JRNA 1I9CA 2JKZA 1N8SA 3EE6A 1X3LA 3DDWA 2MYTA 2OQIA 2NV2B 1GNSA 4WNCA 1TMYA 3B7GA 4YH1A 2PUHA 2IPNA 3K2EA 3A2NA 4MCAA 2EX4A 3K2BA 5ILOA 2FEXA 1X70A 3AV3A 2XL3A 1LY1A 1Y1RA 4KODA 5HIJA 1E1CB 1X3SA 4EKEA 2C42A 1ADYA 2ZE6A 1CB0A 2FWMX 3L04A 2JIOA 4IL5A 3C6BA 4WXEA 2XTMA 4BNJA 3GJYA 1KFCB 3NBAA 5EIOA 2Q28A 2DWQA 4XUGB 1DX9A 1C30A 1M67A 2IOYA 4NHEA 1KDRA 1T36A 4PC1A 2PWYA 2JGEA 2AG8A 4DMMA 1R0BA 2AXQA 4UNIA 1VLHA 3BIFA 5M5TA 4RSRA 4B9AA 1J0XO 2FSPA 3TIGA 3F67A 5FBKA 3V4ZA 3G2PA 5CTAA 1XD2B 4XIGS 1SD2A 4FI3F 5GJCA 2PZGA 2VPPA 3KUXA 4KW7A 4R1LA 4F6LA 1KJIA 1QQ5A 1XA0A 4GP6A 5T4BA 1YFJA 3CA8A 4S2EA 4MVXA 3ACBA 4O0MA 4BFUA 1X7ZB 4ER7A 1N75A 3EGVA 4HPJB 4FONA 1XEXB 3ICWA 4BNMA 3ICVA 3NOXA 1QYXA 2P62A 4KUGA 5HRAA 4XVUA 1ODLA 1JHOA 1N0WA 1SHLA 1WUJS 2ZBEA 1PQWA 2DPXA 2BSQA 1G60A 1O4WA 4OI0A 1RKQA 3NMUF 3L1KA 3C4VA 4KXWA 2EV9A 4JI5B 1M72A 5GZ6A 4ZI7B 2GPJA 4ICIA 2XF8A 4XWWA 2J5QA 2ZJ3A 3O8OA 4FLMA 5CRIA 5HUHA 1M1YB 1AHHA 2RHMA 4Q9AA 2J45A 4IG9A 4EP1A 2Z58A 1E2GA 1XA4A 5KX5F 3KQYA 8ADHA 3KVNA 4HS4A 3ZGYA 1HKUA 4CT4B 3FKQA 1G55A 1Q95A 2Q2QA 4R1MA 3NP9A 4L07A 3S2SA 1L7OA 1B2LA 1NFRA 4A0QA 1XAJA 5L6MB 1CZUA 2SICE 2QBYA 4OLFA 1T91A 2ZRLA 3GP3A 3L01A 2D7DA 1M73E 4AW9A 5HZGA 3CVWA 4PNKB 3G5LA 4MUXA 2NO9A 1TCCA 3DVLA 2NN3C 5DOVA 4A2QA 4B3BA 5ES4B 4MHOA 3E7DA 3N75A 4AS2A 1JR3E 1PE0A 3MMSA 3MK31 3D2CA 2C8LA 2GWHA 4PSVA 3KKEA 3NGXA 2RGNA 2W8BB 5DHFA 1PW7A 1PQPA 4CMGA 2Q46A 1Y8QA 3TW4A 2O7NA 1JL3A 4CI8A 3EB9A 4NP6A 3TJMA 4DYHA 4PLVA 4PQFA 3GJ7A 3UB2A 1G98A 3KDPA 3LKZA 5E6SB 4DRXB 1JAYA 3U1BA 4CEIB 4GRIA 3V55A 1TYZA 3D31A 3QE3A 1QFZA 4G65A 5T67A 5THKA 3W5SA 2R7LA 2V4UA 3QH4A 4ND3A 5K8TA 3BYZA 2QTVA 4FYYA 5SZIA 2ASEA 2GK6A 3RS2A 4ACAA 5HM6A 5BNWA 1LW6E 1L5WA 5AR1A 2JZNA 2QHXA 5EZYB 3WGZA 2GC7A 2IQ5A 3K6RA 4MUGA 1RXEA 1ZU5A 4E11A 2QPLA 2ZIZA 1J33A 3EZYA 2BFEB 1ATZA 4ZALA 1G8PA 4B83A 3VA7A 2WHQA 1LI7A 3KT6A 1RSZA 3E82A 2XB2A 1YQTA 3DDZX 3IQZA 1BH2A 4H08A 4MTCA 1FX0B 3BBPA 4MWTA 4P4UA 3GQBA 3SF8A 2EX0A 4BO6A 1NBMD 2IUVA 1RQRA 4RA6A 3BAZA 4RIEA 4ZV4A 5H9VA 1TRHA 2P6PA 5IT0A 3QVVA 1V1RA 1PWXA 2AUMA 3HADA 2JC3A 1SCQA 3NP7A 1VB5A 3EWIA 4K5QA 1N1MA 2QAGC 3TLZA 3URKA 3ZE0B 2UXCB 3GVCA 1JQBA 3PNPA 4MWDA 4C2BA 3ABSB 4NFLA 4B3RB 4KDFA 3R8XA 3AUYA 1P1JA 1QS0B 1O0SA 3W6ZA 4C1NA 1E0KA 3D6UA 1SOAA 1XK7A 3LC0A 2Q27A 3DMPA 4CEJB 1RKVA 4NXMB 2QI9C 5LMUB 1LQTA 2FZGA 1NHWA 2IPLA 1KVUA 3E53A 1VDMA 4FCVA 1DX4A 1JJVA 1KXZA 1Q77A 2JJ2A 3N6RA 4ZREA 2O07A 4M6WA 1H9BA 3R7WB 2IY7A 3L8YA 1AA9A 2UU9B 1QIEA 1IM2A 1GIAA 1TQDA 4GLJA 1KDVA 5CX1A 5CW1A 3OE7D 4S2UA 1CIVA 5CVJA 5EQJB 1IN1A 1XXHA 4QLAA 3WL4A 2XRFA 1N2EA 3QOWA 4UEOA 3B6EA 4EW2A 5KDOB 3G2NA 4BX3A 1UEXC 1ZMXA 4X1OA 2UUBB 3KQTA 2P9BA 4B0PA 3PFCA 4GE3A 1EK0A 4MGEA 2Q6KA 3I6BA 1J24A 1H6CA 2QMUA 1RRCA 2CXNA 3AX6A 1Q74A 2HK7A 5D85A 3DVSX 3WLIA 2EJUA 1JV2A 2O54A 3TI7A 2OVQB 2FZLA 2GPTA 2D06A 2X1LA 2J3JA 4OH7A 1J6UA 3JQBC 1RQGA 2RH8A 4PW0A 4YMIA 1F6WA 1OT5A 2BEUB 3VMMA 2WFAA 1I1NA 4D8UA 2KHZA 4Z86A 1UOQA 2IAAA 1LJLA 2RKOA 4U2GA 5D5QA 2H07A 4FIZA 5KJEA 4EQ6A 1Z73A 1W85B 4RGYA 4Q3KA 5BSVA 5CURA 3S3TA 1FXWF 2JCGA 1ULBA 3PFWO 3PHJA 4EUEA 4DNXA 2ZQYA 2QMQA 5LFAA 4GRAA 1K75A 1MAWA 3C99A 2BR4A 4L28A 2F4VB 2VWPA 1K68A 2K7ZA 3W2TA 5JD3A 5CDFA 3V1MA 2GGSA 3RG2A 4H15A 3M5WA 4ZP1A 5JNVA 2QTVB 2WLTA 5KKCA 4N0QA 4QUDA 1Z12A 2DLDA 3AR4A 1WSAA 3E4CA 3H86A 3QX8A 1YZQA 2FFJA 4JT8A 1HDYA 3UXEA 2F43B 4D8YA 4R5MA 1CUAA 2NPOA 5HTOA 3P9IA 4CG2A 3D4OA 4HCJA 4AWAA 1MKYA 1Z2CA 2GDJA 4BZWA 1E1RD 4ESVA 3FYCA 1YNSA 1ZLXA 2IA5A 1NYRA 2WD8A 4QTTB 1FFDA 2DE0X 4XD2A 3V8QA 1GO2A 1DJQA 5EQDA 3JPWA 4FNOA 4AKIA 4S12A 1DDGA 3QZUA 3T7CA 4V0NA 1CUZA 5A9SA 1RPTA 4CZVA 1T26A 1TB4A 3GJRA 1PVDA 4DTIA 1VSTA 3IVGA 4U1RA 4XIJA 1WBJB 3C6QA 2OVBA 2SNIE 2XUGA 2QAJA 3UFXB 3WXBA 1T2FA 3FUWA 3PUXA 1OVMA 5K03A 1L4FA 1U4SA 2G0NA 3N86A 3R7AA 1CUEA 4NTZA 2PBLA 3Q4GA 4GC5A 5TS3A 6ADHA 2EATA 4BNTA 4RA9A 1JHPA 1PJ2A 1QUEA 1PZNA 1EVJA 4GKAA 1HTTA 3T1YB 5FI0B 2XCLA 4TXJA 1BXKA 5IVPA 4F2HA 5JXWA 1C4OA 3E3MA 4ZAWA 5IAAA 1SPXA 2O8CA 5DTQA 1MC8A 3KG2A 3QKWA 4MPDA 3QMWA 3MMNA 4YRPA 4BV3A 3MXTA 5HDBA 1Y7IA 4BV9A 4QO8A 1J8YF 1USVA 2DUJA 5B6IA 1VKZA 3MOIA 4IZHA 5E4FA 5TARA 3MTQA 1L4HA 1H42A 2NTJA 4U8GA 1GUFA 2FETA 4C5BA 3NBFA 1U11A 2MSCB 3HJNA 3MBOA 2QPAA 2XYIA 2Z30A 1E1QA 3EULA 5AW0A 2R4QA 1ENZA 4ITRC 2SCUA 1OHHA 4CL0A 1Q7EA 1TFRA 3RJ9A 2XNJA 3I01A 3THOA 1S9HA 4HSGA 4AQDA 3KZOA 1ZVJA 2AC2A 4LCBA 4X1KB 3UF0A 4EHKA 1R0XA 5JG7A 3ECAA 5E3JA 4CFZA 1IXSB 1N9KA 3WGKA 2XITA 3ZLVA 2ZUSA 2YICA 4H7HA 1Z3IX 4V03A 1YBFA 1YXMA 5K0TA 4TL7A 5DLPA 3KQHA 1LPNA 1T3TA 3FPKA 4IJ6A 3UJ3X 4A6XA 3CLTD 4OXYA 3EC1A 1WW2A 3AEUB 2PGIA 3T7IA 3U16A 4LWOA 4KPUB 4DCJA 4EPWA 4GBGA 1YRQA 3WGIA 2WUEA 1NM5A 3TSAA 3SBQA 3UG7A 821PA 5HIMA 1XHFA 1E6EA 1YQEA 1OMOA 1SHKA 2NVUA 1Z13A 3AJAA 2OTCA 2P90A 3OFJA 4L76A 4YDHB 3QHYB 2R9VA 1OUMA 4X61A 3L8FA 4OI1A 3DKPA 2HHLA 3QWIA 4HNHA 2AKYA 3NNDA 2JD2A 2NXCA 2YYSA 3CMCO 4H1VA 5G4LA 1PYOA 2G09A 1X2BA 4AN1A 3PXWD 1WPGA 2IZ1A 3AF5A 2EWVA 4NEGA 4QG7A 1UR5A 1FPQA 1DWPA 2KYRA 1NMEA 2F1RA 2W93A 3D5EA 3TYXA 4R05A 2X2FA 1WCIA 1AZSC 2E4XA 4IV0A 3WZLA 5HE3B 4RZ2A 3TMAA 5M3BA 4A5OA 3JYQA 4MV1A 1C9MA 1Z5VA 3GPBA 3X1WA 1JPUA 1X42A 4JJZA 2R60A 1FQWA 3F74A 4XIYA 3QXJA 4POOA 4M7PA 5JBIA 1T9BA 1Y5LA 3M81A 4MW1A 3QWFA 3CUSA 4Q3CA 4YUWA 2FG7C 4NZPA 3U3RA 1CWUA 2YMPA 1IBRA 4FS3A 5H80A 1A9XA 1ESMA 1QVRA 3TUJC 2F3QA 3EPLA 3QE0A 1DAKA 3MWLA 4LQCA 1ZAYA 1E0AA 3ZW8A 2ZSAA 4RJIA 4EHLA 3L7AA 1JNYA 4W7IA 4Y6PA 1KBOA 3KZMA 4F4IA 2VT2A 4ACBA 3PQ8A 4WN9B 3RVOA 2ESRA 2VXCA 2HTEA 4A6EA 3FBWA 4A10A 3O4JA 4JYCA 4OKNA 5I8ZA 4LE2A 4Y67A 3JASA 1XMVA 3MG9A 3U1VA 1DAPA 4AO7A 4DM7A 5K8CA 3E22B 4PY2A 3T9CA 2M9MA 2GBCA 1AKYA 4NMMA 4MRNA 4Z51A 5EMKA 2O8CB 1OLSB 4FN5A 1OU0A 4M0CA 2H68A 1NW8A 3ZTWA 2C84A 3DTTA 2EIHA 1I9GA 4PLGA 1PNQA 1QB7A 1YZLA 2EX1A 3E8SA 4HXGA 4KPGA 2NZJA 3PC8C 3WV5A 3WQHA 5SYMA 2NUTA 3EIXA 2NV0A 4JBXA 4OQYA 2Q3FA 2XUDA 4EITA 2OCLA 3I1FA 3GVIA 4K8OA 1YZHA 4QOEA 1DTWA 2GHQA 1MVNA 2GZ2A 2CMDA 1RBQA 4MH0R 1GN8A 4H0FA 2IU0A 2IX3A 4MIEA 1SKAA 2OHOA 4H0NA 3AVQA 3KR1A 1KQOA 621PA 5K9ZA 3PD7A 1MJGM 1PQYA 1KAMA 1TJYA 1C3JA 2A67A 4URWR 2V6GA 2WVAA 3A3OA 5J2TB 4N9QA 5AVUA 3HABA 5ALPA 1O03A 3BH6A 2CDBA 1NF2A 4ID3A 2XUZA 4MQ5A 4MQLA 2BR5A 2H8GA 2HGSA 4OP1A 5BR4A 5KNCD 3G79A 1E2NA 1PJSA 3F2IA 3CW2A 4NPAA 3RSQA 3HV0A 4GPD1 4HAWA 5JJKA 1Y4DE 3CZCA 2VPYA 2WYOA 1SUWA 4PZZA 5I7RA 4HGOA 1X7WB 1X1RA 3ZCTA 3UH0A 4OHKA 4WK0B 4HN9A 5EVCA 5E9AA 4ENQA 4HL6A 1UFRA 5ALSA 1TNDA 2B2XA 2ZSUA 1JDBC 2YZ2A 3RDPA 4B1FA 3I1YA 4QGHA 3R0VA 2XWBF 4BLPA 2OBXA 4YA6A 3H3JA 1DXHA 3H75A 4QGFA 2DQ4A 1U2GA 2FMIA 3CT4A 3K1YA 4EDHA 2P1RA 3JQDA 3RPEA 5KAMA 2QX4A 2RHLA 4NJMB 4QDOA 4RSMA 3WKBA 5AK4A 1ZIPA 4ZOXA 1DV2A 2Y93A 4V3BA 3UGKA 3AL9A 4YUAA 1N3LA 2DQSA 2GOYA 1V95A 3V1UA 4BNHA 5JBQA 3COYA 3INRA 4IFEA 4C4ZA 1CFJA 1Q0LA 4F9EA 1DJMA 4AX4A 5EIBD 2RBEA 5LKRA 3COPA 3OM1A 4YI3A 1OBCA 2QTFA 4C0HA 3MCWA 5EHXA 3OZDA 2P9PC 2QM3A 2ZAIA 1WJGA 3DZKA 4GXNA 5IXJA 1E3JA 1ECJA 1RJWA 2A59A 2QEQA 3WHKA 1OKKD 3PPVA 1J23A 2BV3A 2A0UA 1BN7A 1ZVKA 4LZNA 3SJCA 4BX8A 2R6DA 3B89A 1IXYA 4LW8A 3RW9A 1J8VA 4M0FA 1FFHA 1I2AA 3AKYA 5K3AA 1JB1A 1W1WA 1E6CA 1NONA 1J09A 1UJBA 1G9XA 4KMOA 1DUVG 4J0EA 1KPIA 5FL3A 4AIRA 4C76A 1FPMA 2AX3A 2FR8C 3GJXC 5JWHA 3LUAA 4EY8A 2PIDA 5FJIA 5JAMA 1IN5A 1DG1G 1M2WA 1E7WA 3A31A 2ATXA 4EPRA 2G4VA 1Z17A 4LJ9A 3ZHVA 4J4TA 1RZUA 3FYHA 2G71A 4EGFA 3VH3A 4REQA 2CHVA 5EOVA 3RC3A 1CUIA 2I2CA 2FRDC 1I2BA 3RVNA 3GQVA 4DDHA 1C3VA 3SXJA 1RE1A 2XYPA 3H17A 3LCJA 4Q1AA 4B6PA 5B55A 4BO0A 2UZIR 5TF4A 2N75A 4EMSA 1NMXA 4G0UA 3KQQA 1M1YE 1A5BB 5CB6A 5BN3A 3VO1A 1EVKA 1VC2A 3HRKA 3LWDA 3FTQA 5M61A 4FC6A 5KDLA 2IH4A 3PHGA 4G4JA 3VDXA 2Y9MB 1Z4LA 3TNDA 4UDXX 1RI5A 4NBNA 4PAWA 3I7KA 3T7AA 1R50A 1RTTA 4RGBA 3LX6A 4XFKA 2VDWA 2A0FA 4J2TA 5IVIA 1A82A 1XG5A 4I2VA 1UKYA 2XEXA 1ENOA 3VHXA 3N1UA 3VR5D 3UPTA 3O92A 2GA8A 5K5EA 1VL8A 1VSVA 1YASA 4RYLA 1DCFA 3TCKA 4BMXA 2AH5A 1BQ4A 3FOFC 1F60A 3PNSA 5BUZA 3RYFB 3UJPA 3ONVA 3SQLA 3BD7A 4MDYA 5HSGA 2ZAGA 1UPAA 2FUNB 4AZTA 4EVRA 3GUCA 1WPRA 2F00A 2VYCA 1GAXA 4KQHA 4X8OA 1JS1X 1ZWLA 1IQRA 2VNAA 3JYOA 4HWKA 2QYSA 1XZFA 4IGAA 2W00A 3THWA 2Q1YA 2J9FB 3V2GA 1JILA 1ANKA 2NT4A 2ZYRA 3PUJA 4WK0A 3MTJA 3I7HA 4PM4A 3CRRA 5CA1A 3MD9A 2BSAA 1IUNA 1COZA 2J3KA 3J7AC 1MDAH 1H0KA 1MO2A 4L22A 2I7CA 4TWBA 3UGJA 3RYHB 5GJBA 3GGJA 2QA5A 3UMYA 5FHRA 4JMLA 3AF3A 3LXUX 5AO9A 2I2XB 4AJKA 4MPRA 4EBFA 1B1CA 4YMUA 4H7PA 4OA8A 5AM1A 3WO1A 16PKA 4MXDA 3T0GA 1J2RA 4RVOA 1E5TA 3FZNA 5B1IA 3VNBA 1E2MA 5JT1A 1TU0A 4ILEA 1II8A 5I5MA 3FZEA 2R6JA 4CM3A 1D7AA 1L4LA 3ZD6A 2FFAA 3UKOA 3Q2OA 2XAUA 4H1WA 2WSMA 2QMEA 3PC8A 4YJ2A 3QE9Y 4YJKA 1VGRA 3NBXX 2V6BA 1EX6A 2XDWA 2IHBA 2C2KA 4U00A 3RWMB 3ZEIA 4B6JA 1FP7A 2ZPAA 5HJ2A 3SKYA 4JL5A 1M34A 1H05A 5JALA 4D0GA 3W6UA 1C3OB 2EDAA 1H3EA 4M88A 5ALYA 1ZQ1A 5CDTA 2P75A 1WZUA 3QM1A 4HN2A 3R8CA 4BQIA 5LNK6 2ZM5A 3JZGA 2VZ3A 2EWWA 2A1UB 3HG7A 3OFSA 4FOTA 4WXHA 3SU8A 1T9DA 4ENVA 1OA1A 3IUJA 1T9CA 4DUGA 3T61A 3DDCA 4QU5A 4PZYA 3HFGA 1QIGA 1O97D 1GRNA 4OQDA 4KAAA 1HNNA 3FFWA 4I6GA 1IN8A 3FFXA 3G9UA 5C3UA 1NATA 3AF2A 3QG5A 4XDZA 5I8WA 4MW6A 4ZPJA 5HW0A 3HFJA 1G8GA 4QL3A 1ZCJA 3HWRA 4EGSA 3GT7A 3CYFA 1U0OC 2B35A 1BDBA 2Q7XA 3FDJA 5FFGA 4FN4A 4TKMA 3LY9A 3OG9A 3TEMA 3ZLUA 4ZZ0A 3O8CA 1PX2A 2IEGA 3JY6A 5JC1A 1WE2A 4DNWA 4LFAB 3RKUA 2AEFA 3TKYA 3EARA 2JCSA 3PE7A 1OCEA 4DNQA 2MSEB 5KVQA 3AHEA 2OHFA 2YS7A 1SVUA 1DWQA 4LC0A 4RY0A 4J9UE 2DWUA 3AEKA 3C98A 4D9EA 1TEZA 4K2AA 3OHPA 5F73A 2BUCA 3S2IA 4ZHQF 5A4MS 3OL2A 4O4IF 4PZUA 5IVKA 2HREA 1A77A 5F5XA 3ULEC 4IWXA 1RAGA 3N7AA 4TVSA 5I7HA 1W1IA 2WNHA 4MLZA 3ANMA 1FJGB 3WLJA 2EU8A 5EMNA 3FVQA 2NVBA 3I28A 3DLCA 3DXKC 1LGYA 4AMZA 2JBHA 3BULA 3L0SA 4IHQA 4DM3A 4CKWA 3HTXA 5A5VA 4DA6A 3T95A 2GN1A 3ILYA 5SZHB 4O0LA 4EFLA 2V58A 3B7PA 3N2NA 5EESA 1XCBA 4BZXA 2VNSA 4MWOA 3NRJA 3ZDXB 3V8RA 4BGVA 4DVJA 1G4AE 1PFUA 4D0NA 5ICGA 1XF9A 3ZX5A 4PRLA 5KAPA 1P5FA 3DUFB 4AJ1A 1UWCA 3D7RA 2H31A 4QX6A 3HGMA 4Z1MD 2QR3A 1UMDB 5B4UA 5BN4B 4WD3A 2RHTA 3HCNA 4IDGA 4PC3A 5AXBA 4D9MA 1KMHA 4L6CA 4RJKA 4PWYA 5C0OE 1V4BA 2B36A 2H4ZA 2ZSFA 4GRDA 4RW0A 2OO5A 3UM9A 5ITSA 4JBLA 1JYEA 3R5HA 1C0IA 4FZVA 2XNCA 4E21A 3RFTA 3OY7A 3B1ZA 1I5OA 3K9BA 2GBLC 4A7PA 3U56A 3N0RA 3OQOA 4X3OA 4U7PB 6CHYA 2XMZA 2ZYTX 2OG1A 3A05A 1B9YA 4PIPA 3ZIDA 5JDCC 2GJSA 4KIJA 4Y1FA 5FT9A 2P8SA 2VDJA 2ZANA 4RTRA 1L3IA 2P9YA 2AK2A 3ICQB 4C21A 2VJBA 4K6KA 1M7BA 1WSDA 4IHJF 4LYDA 4QBTA 2VWQA 2EDCA 5DM60 1SXJA 3DAPA 2YZ7A 4JT6C 2H9MA 1SEVA 3PCTA 4LKRA 5JZSA 1N2CA 2JGNA 1U5BB 3AEQB 1E4EB 4GYJA 3I92A 2QUZA 1NBME 4WESA 4MS1A 3SX0A 1RJ9A 1VKJA 3DULA 1JFFA 3Q5DA 3MVDK 3BXGA 1NW7A 4RFLA 4ZV7A 1KORA 2JH8A 2LGJA 2AL7A 3PR3A 4K28A 3RK1A 2WKRA 3M5PA 1CRWG 5B7QA 4LXGA 1RAAA 3EWNA 4ZI2A 4ZI7A 4FA9D 3N28A 2VR1A 5DN6A 1UC9A 1ZM3A 3NVXA 5I4CA 2NG1A 3BTVA 3IH5A 4O8ZA 2QTWB 1E2IA 2OVRB 1JDBB 2VI5A 1THGA 3CZ9A 4PSAA 1GRCA 1YS6A 1Q21A 3LP6A 4R8RA 3AIKA 3G5UA 4NATA 3T9FA 4U7GA 1AUPA 1JF8A 3SS7X 1ZJYA 3NHZA 4GH5A 4A09B 2P41A 3WIEA 5I5EA 3K70B 3IGFA 2I8AA 3X1YA 1E1LA 1MUUA 4K3UA 1Y33E 1XLVA 4C0BA 3LFUA 5F64A 2PCJA 1ZGAA 3UMGA 1R6BX 4BUCA 1V5IA 4UM8A 3W3AH 5MGNA 1Z08A 5CB4B 1N25A 1SAYA 4FE3A 2ILVA 3FIUA 1XTUA 1SC9A 3E8XA 4Y30A 5GIOE 1KYZA 5ADWA 5EUBA 1T5LA 3G49A 4D98A 1TW2A 1XDSA 1TIBA 1A9ZA 4M7WA 5IKXA 4DA9A 2HK8A 3A10A 3NWEA 1AT1A 4UPDA 1MG0A 3EY4A 3IVCA 4AJNA 5JYCA 1A8SA 2X8AA 2P9HA 3ORYA 4G56A 2WLSA 3I5MA 1B6RA 3VNSA 5ELXA 2WU1A 4GW3A 4O2BB 1ZCBA 2VZEA 3IKLA 4RV9A 1SZCA 3OIUA 5HF9A 3RHZA 4Z0TA 2QTNA 3HCOA 3K27A 5CFQA 2H17A 4Z4FA 4JT5C 1ISSA 1RWMA 2A58A 3B20A 3O84A 4KL8S 2YQ5A 1CD5A 1IPEA 1DEKA 2YVAA 4U2EA 3OAAA 2JHGA 2EG9A 1M2OA 3I5AA 5EZYA 3ZBUA 5B37A 2H8KA 5KJ6A 2PRJA 4NC9A 4TVKA 4G63A 2CCKA 3LX8A 1O54A 1P2GA 1U8EA 4F9TA 4Q37A 4ZDJA 1W2HA 2B99A 4KXYA 4ZFNA 1E9VA 4C89A 5D86A 1OFIA 5BQ5A 5CFZA 5FLYA 9LDTA 4PZ9A 2D5CA 3TQTA 3W7BA 3AP1A 4OXNA 4UBNA 5UKDA 1P7CA 4WJKA 1ZIXA 4PYJA 4YCNA 1JRLA 4KRFA 4GL4A 1FX0A 1LPOA 2G5CA 4P7GA 3CUVA 4RKRA 3EGEA 3TCXB 1XMJA 2HF8A 5AK0A 4ZVRA 1RWXA 4ZOAA 1C3XA 2GPAA 5AM5A 2QJOA 2H4JA 3ED1A 3FGNA 1L6IA 2QUKA 3OLYA 1AHNA 4M53A 4RK4A 4XB6B 4XOIA 5IK2A 3UQZA 1UOPA 1JFRA 2A7QA 4EB3A 1R3DA 2V5AA 3D59A 5CEFA 1QP7A 2Q5HA 2X58A 3KZXA 4BUJC 3MAJA 3A9TA 1L4MA 1J9EA 3KFLA 4R1TA 1N2CB 3S2ZA 1K3UB 1MQ8B 4O2BF 5SYNA 1JDZA 4QZVA 1A2OA 4UFNA 1Q1NA 3SDBA 3R3ZA 1TJNA 1TFUA 2MMGA 2WG2A 4ON9A 4HXEB 1MX5A 4KYTA 3S1AA 4F4UA 3IRVA 2YCLA 5B53A 4W9RA 4G0PA 2AMLA 5CCXA 2GYUA 4FB4A 2NV6A 2XYRA 4MGKR 3R7SA 1MG2A 1CE8A 1XDDA 1CNMA 2DP4E 1FK8A 3AU9A 5IJ0A 1E1NA 1A88A 2H1HA 1INLA 3K0CA 4MIYA 3CLRC 4FHLA 3HYSA 3OPQA 4KK3A 3WIVA 3U7JA 5K01A 4L8VA 1Z82A 3L06A 4R2KA 2LDBA 4Q9KA 4I55A 1NE7A 1VMIA 5AK3A 4D97A 4DC9A 3HBNA 1PVVA 1R66A 2D5AA 1FFXB 3NW9A 3P9YA 4J4HA 2D6FA 5KI6A 3MRVA 4B6FA 5L45A 1OJ7A 1CY1A 4OP2A 5ILQA 3HGQA 2B83A 3GDWA 2FOLA 2ANCA 2AGYA 1QZZA 5JO0A 2FMXA 2QX7A 5ENDA 4HDMA 3I01M 3UHAA 4DR3B 2Y6UA 3IAEA 3JYPA 4Y1RA 1LF5A 4WBXC 2C4VA 3FWZA 2BGWA 1J2UA 3BHIA 3D54D 1IOLA 2VSOA 5CT9A 3WWZA 1KI4A 1KARA 1YIOA 2C7VA 4JC0A 3V6LA 3ZWWA 2G4LA 5CYKA 2IS2A 4U2FA 1CYEA 2P2LA 4B4DA 2PGNA 3KXKA 4FR0A 1RE0A 1TF5A 1X0XA 3EIHA 1M1UA 4O2BA 2ZE5A 4U9UA 3M5DA 3O4RA 3WGNA 2DXIA 4ZOZA 4Q4HB 3I9KA 5DHPA 3ADKA 3A04A 2V4ZA 5TQ0A 4ZVQA 3FETA 2FR8A 3F4KA 1I3OA 5DB4A 3FF4A 4EG5A 3SXUB 4P4SB 3IKMB 1H8HD 1XNGA 1H5UA 3FYSA 4B17A 5JAHA 4LJAA 1Q22A 2A9QA 4E12A 1T4BA 3L43A 4OQNA 2CLOB 2JJ1D 4QUIA 2BFBB 3OQIA 1A69A 3R8FA 1WULS 3B2EA 1C4WA 1PG2A 1IPHA 2BCGY 2I3BA 4B79A 2XGJA 2CD7A 3C3MA 3N8KA 1PTJA 2NPIA 2C2OA 3T1VA 4G0XA 4HGNA 4QU9A 4U7WA 2E4AA 3RFXA 3BA6A 3HBMA 4X3CA 3LT0A 2Y8EA 3HSYA 2Q50A 3ONDA 4BB5A 1HGXA 4KN9S 4FCWA 3WTCA 4F85A 1IJBA 1FYVA 3PTAA 1UM9B 2G8NA 4Y2GA 3W5VA 2AGWA 1AMUA 3I32A 3M6IA 1BFDA 1E5VA 1G2QA 2Y1EA 3KVVA 5DTEA 3BKXA 5I9BA 3UUEA 2XIJA 4J9VA 5EMJB 3SEZA 5IHPA 1SHTX 2YWFA 4ZQHA 4GZ6A 1UDRA 2IHYA 2WDZA 3JQ6A 4CHGA 5IJ0B 2I6FA 5LMZA 5DU2A 2IYYA 3H8JA 4NHOA 3V2IA 3FPFA 1VLJA 5FKQA 2AC7A 3LQ2A 4AMVA 3HVKA 3NBYC 1OWMA 3I0MA 2AOTB 3E9CA 2QYHA 5AJWA 1DTEA 2Z2OA 5K4AA 4BNNA 1P1RA 1YAHA 3OHMA 3TIIA 2VF4X 5C80A 3F8TA 1MQSA 5ALMA 4OPMA 4E5ZA 4KIGA 4XLZA 3EI3B 5THQA 3W90A 6YASA 2OD2A 1LI4A 4TV8F 2DJIA 2E4UA 3K0EA 2PE5A 1MFPA 2IPOA 1YTUA 3HN6A 3REFA 4INJA 1JEQB 3RQIA 2BHRA 2FDRA 4EL5A 3NVQA 2Q9UA 4OQQA 2O06A 1W59A 3IR7A 1CR2A 1D6SA 3DWEX 4CFSA 2FQQA 4I08A 2BISA 4R2MA 4PSXB 1TT7A 1XTIA 2VJMA 3A6ZA 3BFKA 3ILXA 4YRSA 5E2BA 1XJCA 4IS3A 4Z8YA 1E6LA 1Y82A 1YJBA 1BH6A 3AEUA 3SEAA 3VUEA 4UOQA 4WDRA 2YZMA 3AXSA 3BL5A 1OZFA 3WL8A 1E2PA 1XRQA 2ZIWB 1J9GA 1X74A 4US0R 5J9FA 4EGCB 1CETA 3QI0A 2DERA 1NC1A 1LBQA 4ZC1A 4DCUA 2Q9AA 2YX1A 3PJDA 1KOGA 1S7CA 2ZGVA 3GWGA 3JARB 4RTSA 2XE6A 1G7TA 3Q6IA 1CJVC 1MPXA 2QL7A 3OICA 3L5KA 3CO5A 4WDQA 4YUVA 3ME5A 4II3A 1N6FA 1QWOA 2PL9A 2I7DA 3PX7A 5JCJA 1ZJ4A 5SV2A 2VG8A 2J0UA 4OCZA 2PIAA 3HUUA 3WWEA 3UKDA 3EY9A 4LHVA 1AK2A 2QAGA 4EIWA 4DNPA 2G08A 2Q6IA 4MJXA 5F3RA 4HNGA 1OAAA 2EHJA 2GEDA 1N6KA 2RC6A 5SY6A 1U8CB 4PGMA 5JFTA 1M0SA 1MPTA 1UOEA 3DD5A 4JI6B 5JS8A 1EHCA 2UVPA 2CKDA 5DM4A 5EUCA 3DM0A 1EEXB 2A5JA 2QP3A 3WNZA 3WGVA 4YPFA 2GZSA 3GLGA 2ISQA 1A9XB 3ES9A 4CIDA 5HE8A 4RVCA 4D0RA 1PRYA 3C7KA 3P9SA 4YLEA 3K30A 1RMTA 4LSMA 4NMLA 4AICA 4EVSA 5A5FA 4CETA 2H48A 3ETJA 4NDZA 3ZZMA 1D2GA 2ZYDA 4FJ2A 2IKQA 5IN4A 4Y2SA 3GEGA 4K9PA 2RHRA 2F9MA 1FFEA 1CERA 2YIMA 5LYJA 5JJIA 2PTHA 2YXLA 1SKQA 3OP4A 2JA2A 4U2BA 3RUAA 2GUWA 3W8DA 4PFKA 1IY8A 5KYXB 2O5EA 3HR7A 1CLUA 2BPOA 4O33A 2E4ZA 2YRWA 2WQ8A 1UT8A 4B6EA 1OREA 5HVNA 2DFDA 3KQKA 2H11A 3EIQA 1OZAA 2PEZA 1H6DA 4FKBA 4W99A 5B12A 3WAKA 2ECFA 2H0RA 2HDWA 2V03A 2WJIA 3MQFA 4JS0A 4AKTA 3UJ7A 3I9V6 2B8EA 2PSJA 3K1AB 5ECWA 1CY0A 5F51A 5AM0A 5AUNB 2AHRA 2YRXA 2XCSB 2FG5A 2CLHB 1EA7A 4RIHA 2QD5A 3QOXA 4GQIA 4DQ0A 1TUGA 1EJ6A 2R79A 2C7RA 3JAWB 2WF9A 1Y0BA 3K1ZA 4LOLA 2XHEA 2PBFA 4ND2A 1EESA 1CQJB 1ES9A 4ESOA 1XKLA 2CN3A 1J39A 1TAHA 5DHAA 2QRUA 4HTAA 1UL1X 3PJGA 3U7IA 5AW2A 2P0EA 1EK1A 5K3OA 2C3UA 1KEPA 3FFAA 5JFGA 2VYFA 3C5VA 5E8RA 3A6PC 1QHIA 2VDKB 5EP4A 4C4AA 5J2TA 3VYUB 1O6CA 2A92A 2WSLA 4XQEA 4N47A 2VPTA 3OKAA 2Y2VA 3V6MA 2VJMB 5JY6A 3QPVA 4QOJA 1HZJA 3F8WA 4D25A 3VPSA 4R9VA 4IIUA 3AL0C 2CYBA 3GRAA 4X90A 1SZJG 4KXNA 4RDIA 2QG6A 4HRVA 4OXIA 2HA6A 2AEMA 5KMGA 1ZHFA 5JWZA 1NDHA 3RSGA 4TMWA 3WKDA 1X15A 3K70C 4LG1A 4TQAA 1CSEE 2WIFA 2B2CA 3IJPA 3JARA 5EE0A 2ZT5A 2R1VA 1ZIDA 2VRNA 3PT5A 5TJHA 3WGYA 7YASA 4EYOA 5MFPA 2G63A 1YOVA 3MRTA 2YIJA 1COWD 3CZMA 5G1NA 2IHKA 3PXEA 1G66A 4LGCA 2Y1CA 4D74A 3M70A 1SQ0A 3A14A 4EJFA 4P4NA 4CI3A 1LD3A 1P7VA 2HQSA 3O1JC 4TYMA 1UKZA 4ZCTA 5AW3A 2J5KA 4UUNA 5LLTA 1UOOA 4OGFA 1OTHA 3BVPA 5GM1A 4UUAA 5F21A 4Z0HO 5BNZA 5DYIA 8ABPA 4KUHA 5AVWA 3OIVA 4MGZR 1D07A 1VG1A 4N12A 2C2XA 2PEYA 1SG0A 4L5IA 3V3TA 4C2TA 2MHCA 1CR0A 1D1SA 4B80A 3FHTA 4AXXA 4C1BA 1ZOOA 2EG5A 5HK8A 2V59A 2ID7A 1BEEA 3OT5A 4Y9DA 1XPUA 2QZZA 2PT6A 2XYHA 2LKCA 3EN0A 1JFLA 1OPXA 1W9MA 2XTNA 3LYLA 4NOJA 4GLLA 3U49A 4LDNA 4RK7A 1MHPA 4FFWA 4BN4A 3RKRA 1JDTA 4DQKA 2D4HA 3ZHTA 5A6SA 3FA2A 4GPZA 2HN9A 3KUDA 1GCGA 2CXRA 4RHUA 3T3OA 2GBFA 3DZBA 1T8UA 1QQAA 1RQLA 3PQEA 3AHHA 1J06A 4N3GA 3OJ0A 1NFQA 3PBKA 1JE1A 3CKMA 2FEOA 4L9SA 4URXR 1E3LA 1I3CA 5D1NA 2JJMA 4DIEA 1PS9A 4ND5A 5IT9A 2R0QC 1JVSA 3MJRA 3CX3A 1FJXA 1P19A 2XPCA 3W2FA 4ZMSA 2GH1A 5EAPA 1GLNA 5CYFA 1KDOA 5C9ZB 4TYWA 4O29A 4RFSB 1GQRA 3VHQA 2A5GA 3IQFA 1RD4A 1L4KA 4UBLA 3DT8A 3STWA 4L4SA 4RF3A 3Q6NA 3WFIA 1CVRA 3GLRA 5JCOC 1JYFA 3C3CA 1YCHA 2F48A 3EAFA 4O2AF 1JHQA 3EVFA 721PA 1MBZA 4WK2B 1OV4A 2PA0A 4RV5A 4PHGA 1F9EA 4M9CA 1EG7A 1FUKA 1E5DA 1GOGA 2ODWA 1YQWA 2A0KA 4Y9SA 5JPIA 1A1SA 5JVDA 4UM5A 1C3LA 5JAUA 5GONF 3EF1A 2IP4A 3N05A 3GA7A 4CIAA 1QH1A 2E55A 1YVDA 3HJUA 4OWRA 1ISFA 1R9JA 3GG2A 3QHQA 2RCNA 3KV3O 1XYGA 4JHXA 4PG5A 1AQUA 3A1EA 4WW0A 3FWNA 2OPHA 1E79D 3ZVRA 3TR6A 1CBUA 1QF7A 1KI7A 4DR1B 2VT7A 3PC7A 4V0RA 1EK2A 1OD6A 4YT5A 3K6SA 2YZNA 3LI2A 4JXKA 4KRYA 1H4TA 5FBWB 1UQUA 5ULLA 4J90A 3MT9A 1KU6A 2FPUA 2PD3A 3CGGA 3KSUA 3TW6A 5KMGB 1FSZA 2B34A 2VYVA 3HPRA 4JQSA 5LA6F 4JP5A 3ZIUA 2QXYA 5EWMB 3ASUA 3B85A 4TS9A 2R44A 1NI4B 1ZBQA 4JMPA 2M6SA 3MC1A 4OK6A 2VZLA 1U7ZA 3MB8A 4IVPA 2GZRA 4JLNA 1X87A 4RPIA 5FL7A 1GGVA 6GPBA 1WETA 3KYBA 4PQGA 1YOVB 1ZNXA 1DBQA 3CKLA 3IPCA 2QSUA 4KR3A 4MVJP 2R6HA 1O95D 1NVTA 4RC9A 1KAHA 1Y89A 4DBZA 5GM2A 3LU1A 1OLXB 2KJQA 2RAUA 4M1SA 4TQ9A 4BUJA 1O77A 2FPGA 3QXHA 4DSNA 5E7IA 3CNOA 1G21A 3BD8A 1KRHA 4W1QA 4S1TA 5E1MA 3U3MA 5LPNA 1UBEA 2C5FA 4ARZA 1IVSA 4PYNA 3AI1A 3H5WA 5H68A 1Q2XA 2A9VA 3QY9A 4K46A 3I9V1 3PLNA 5JLAA 2P9SC 4N3CA 2DHQA 2GHTA 1YI0A 2H63A 3ACCA 4GR9A 1QFJA 4CUZA 1TJ4A 4TWAA 3PCRB 4XSGA 2OLEA 2A1UA 3LVFO 3BJEA 1A7AA 4L4XA 1FUUA 3ADCA 1ZGJA 4H3VA 2RK6A 4RL4A 4ZIRB 1E2FA 3UHPA 1NAIA 1F4LA 2ZJ0A 4D43A 2D4AA 1LS1A 4P3XA 4YGXB 4UE3S 1PV1A 4DJEC 1EJ2A 2VNHA 3VTFA 1G20A 4ZQCB 1KAGA 1LI5A 5JMWA 1RS0A 1NULA 3ONEA 3VO9A 3O8OB 4H7IA 5EKXA 2TRSB 3K05A 1LPBB 1STOA 4EECA 5LQRA 5K19A 4EEXA 2XT6A 1FEZA 1ZITA 3O0TA 4FMBB 3QX7A 2DVMA 5F9HA 1E3WA 3DZCA 1V7QA 2QOEA 2V97A 1JMZB 5HE0B 2XBLA 3HKBA 1VHJA 2JD0A 5CVTA 1N92A 1EGVB 1YIAA 3KB1A 2QBYB 1CJBA 4KBFA 4MROA 3WDMA 3OF5A 2PMBA 3AEKB 4C0AC 2H14A 1LX7A 5IM4A 1ECCA 2WJZB 5KB3A 2LE0A 2WE7A 1UUFA 1NSTA 3FTNA 1G5QA 1N6DA 3G2LA 3UHOA 1WQ4A 1MENA 1T9GS 3BD9A 4QYTA 1FX1A 5AM4A 5EKDA 5HE2B 3SSAA 2JG3A 1BXRA 1RCTE 1SQ6A 1U8UA 3I12A 1XNJA 4R4JA 2AFHB 1DQNA 1PYDA 2PUDA 1RI3A 1MW8X 4DJAA 3LPCA 1ZN8A 4XWTA 2FMFA 2A9JA 1JXQA 1RWOA 3MWEB 4H7KA 4P08A 1ULZA 2BFPA 4X94A 3VKWA 1UAGA 4ZT5A 3AMVA 5H1MA 3N74A 3J7TA 4HRYA 4OUDB 4EZEA 4A82A 4PVDA 2FSVC 1JDUA 2AJ8A 5EWMA 3I2KA 5JBNA 2BI8A 4Z7NA 1T4CA 3IT1A 2XMBA 3EZ7A 1GCAA 4LJ5A 1QO9A 3RM3A 5IKMA 5E0OA 3PZBA 1PX0A 3KB2A 1NVAA 2ZJ5A 3GYGA 1KYVA 1YL7A 3P4UA 4W9NC 3AR3A 2D2IA 1Q11A 1KO8A 2P7IA 4ISCA 1KZ1A 4A0HA