3IULA

Appep_wt1 opened state
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
682
structure length
669
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 199
structure length 669
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iulA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iulA01
3IURA 3O4IA 3PUHA 4KE9A 4Q3KA 4BBZA 3E4DA 4UHBA 1ZI6A 4A5SA 1LPNA 3Q0TA 3WKEA 1FFEA 2PKYX 1QGED 5ESRA 3H2IA 5AKKA 1C7JA 5AKZA 1L7AA 1XZGA 4BVKA 1IMJA 1TCAA 4K6KA 4EY4A 1QIGA 4A23A 3QPAA 3G8YA 1MNQA 4KRXA 5HQ3A 1GT6A 4QDZA 5AK5A 1E8NA 4D9JA 5HQ3B 1GXSA 2OCIA 1M33A 5C81A 5IVKA 2AJ8A 3BIXA 4QA9A 4EB0A 5JAPA 1FFBA 4H35A 4BTVA 2XQKA 3HC7A 1GGVA 4MXDA 3P2MA 4OD0A 1JMKC 3T4UA 5FLKA 1AURA 2BUBA 2IIVA 1YAHA 1VZ3A 5E4TA 2XI4A 3WWDA 3BDVA 5AIAA 2OGSA 2BCEA 3H04A 5LKRA 1EB8A 3MGAA 1USWA 3PI6A 5HZGA 4QDTA 4CG1A 5EHQA 2HIHA 4Y2QA 1CFJA 2WIJA 4DSZA 4Q3OA 1XLUA 1J2EA 3HYSA 1JJFA 1CUHA 1CUSA 2DFPA 3I28A 2XUDA 4JYPA 2Z8XA 5ALHA 5FXMA 4HTAA 3QPCA 3BE8A 3WK7A 3H2JA 1Q84A 3G02A 3I2KA 2RHWA 3QH4A 1WPXA 2GBIA 2DSNA 3C5WP 1H22A 4PSDA 3AZOA 2OG1A 1KU6A 5JD5A 5JD6A 2PU7A 1ZD3A 1WHTA 3O4JA 4G9GA 4J0JA 4L9AA 4OSEA 2JEYA 2HU7A 5AM4A 4B83A 1CPYA 3AUKA 5LP1A 4F0JA 1EVEA 1CV2A 4MJ3A 3AFIA 3O9MA 5AH0A 1QTRA 2VF2A 1YS1X 2BAGA 3F8SA 2QS9A 4B0OA 4K6HA 3R3UA 4DMKA 3WKDA 4QWWA 3G0CA 2QXTA 2ACEA 2J3QA 2CBGA 1U8EA 2XQGA 2ZYIA 4P92A 1Y37A 3MVEA 1B41A 4DMHA 5LIPA 5LZ4A 5T4BA 4X85A 5AM2A 1H2XA 2XUQA 3PFCA 4L72A 5FKJA 3ED1A 4M0EA 5CURA 2PU5A 1THGA 4UHCA 1SCKA 1ZD2P 2DHEA 2G5PA 2RAUA 4DNOA 2HA0A 3I1YA 1JJBA 1K6EA 2E3JA 4LXGA 3AIKA 4BVLA 3U1TA 5CTAA 1F0NA 5CXXA 1IZ8A 2OCGA 5I8PA 3VDXA 1QTIA 2VATA 4BP8A 1GQRA 4K2AA 2VJDA 5FRDA 1IZ7A 1BN6A 4ETWA 2WJ4A 1CUEA 2QT9A 2CKMA 5CT8A 3ZI7A 3CN9A 3I6YA 2ONCA 3ILSA 3PE6A 2Y2VA 1R1DA 1EB9A 3W06A 1VZ2A 5ALSA 3GUUA 5HFNA 2J3DA 4IH4A 1CR6A 3DCNA 3LLCA 1ACLA 5DTIA 3DL7A 3N2ZB 2P8SA 2H7XA 3QMWA 1F8UA 3R3YA 2WFZA 4Q1VA 5DYYA 2HA5A 1ODTC 4DNQA 1XZEA 1YSCA 3H0CA 4BTLA 5HFAA 1L7QA 2RIPA 1UOPA 5CBKA 3KDAA 1JI3A 2J4FA 4DIUA 1YA8A 4HVTA 1ODSA 3GBSA 2QUAA 5BOVA 3V9AA 2XMSA 2PSJA 3JW8A 3GZJA 1XKLA 1XZAA 2H7CA 4FNGA 1UOQA 2WU4A 3STWA 5AKXA 1ZICA 3I2JA 3VKFA 5ALIA 4DGQA 4X71A 1BROA 4FBLA 4BZZA 4CFSA 3WYNA 1KEZA 1MAAA 1ZD5A 1WM1A 3BJMA 1N5MA 4FMPA 4QDOA 4WY5A 1R50A 1N5RA 3STXA 5LZ8A 4UBNA 1BU8A 4IO0A 2G63A 4J03A 3D0KA 3ESBA 5EIHA 3TJMA 5AI5A 3A2NA 5AK4A 3G0IA 5LZ2A 4RPCA 1U2EA 2WHPA 4OCZA 2ES4A 2V97A 2WHPB 3RLIA 4BCBA 3WZLA 3C70A 3DYVA 3R3XA 1EDDA 4J0CA 3NWOA 4ZV9A 2X8BA 4Y2JA 2C0PA 4QWMA 4EZIA 1LLFA 2WG1A 4X94A 3ZLUA 4H7JA 2XE4A 3BL8A 4OB6A 1SOMA 4QDUA 4BE9A 2LIPA 4B85A 3WIBA 4UHFA 3HSSA 5YASA 5IH7A 3DS8A 3WKCA 4B80A 4GI1A 4KAJA 1NU8A 5KWIA 4PNZA 3PF9A 2C0QA 4UUQA 1JKMA 2V96A 2PUHA 1EXWA 3BIWA 2XUAA 3G9ZA 3W9BA 3LIPA 2OAGA 3VXKA 3WK9A 1XRRA 3GELA 3L1HA 4AMYA 4OPMA 4WCVA 1CEXA 1WB6A 1VA4A 4TVKA 5LKAA 1Y7IA 5ALMA 1HL7A 5ALJA 1QIDA 1QO9A 3JWEA 4ZRDA 3WIOA 2GYUA 4C4YA 2JIDA 4OU5A 1HBJA 3ZWQA 3BWXA 2BFNA 1PJAA 4MWTA 1FFAA 1DTEA 2CUTA 4FOLA 5JANA 3W2TA 2AJCA 4GDMA 2VAXA 3AJAA 1W76A 2Q0XA 2OPHA 5AICA 2HM7A 4DLNA 2WM2A 5AHXA 3F98A 4FLEA 1RWQA 2ZSHA 3GFFA 3WK8A 1XLVA 5T4HA 4EBBA 2V9ZA 2XDWA 5FV4A 4Q34A 4U2DA 1MT3A 1RYYA 4H7IA 1LPAB 4UBIA 4KAFA 1HDEA 2VJCA 4Y7DA 3N0TA 5CH5A 4Y2TA 5KBYA 1CUCA 1ZI9A 1CQZA 1QE3A 4G9EA 4MEAA 1AC5A 1LBTA 1MAHA 2PM8A 1CQWA 3STTA 3OURA 1YASA 4G1FA 5KREA 3L1IA 4X3CA 1XRNA 3WWPA 2R11A 5DYWA 1X2EA 2I78A 1EVQA 1H23A 4DNFA 4FBMA 2WLSA 4UBJA 1UK8A 2CB9A 3EIOA 5AI9A 3HABA 1TRHA 2PSDA 2WG2A 1QO7A 3STYA 1P0PA 4DSAA 4J0KA 4GXNA 1VA5A 3WJ2A 4HRXA 2ZJ6A 1U65A 5EFZA 4B84A 1QLWA 4CCYA 1MX1A 3QZUA 2OGZA 4CCYB 4F21A 4IQ4A 2YXPX 4C4ZA 5CMLA 4EY7A 2OCLA 1N1MA 1XZKA 1H2YA 3O0DA 3FWHA 3HACA 1LPMA 1AGYA 2HFKA 1QIHA 5ALZA 4C89A 4MYDA 5ALUA 3PDCA 3EQ8A 5AK3A 1CUGA 1AKNA 3QMMA 4ARAA 1Q83A 3SC2A 5C8VA 3IDAA 2W22A 3FVRA 4DTCA 5EHZA 3D7RA 2HA7A 1ZJ5A 2D0DA 4N8EA 1W1IA 4DMCA 1Q0ZA 3I6ZA 4K5QA 1DWPA 4PF1A 3R41A 3NGMA 4YK7A 2HL6A 4MEBA 1YB6A 1YCDA 3KWJA 3ESDA 3WL5A 5LZ7A 4ROTA 2HRRA 2VJBA 1AMNA 2Z3WA 2CJPA 2XMCA 4LYEA 4WDRA 5ALXA 2WUDA 4Y2UA 1W4LA 5AM5A 2ZSIA 4KE7A 3C45A 4AMZA 4BYMA 5D6OA 4H18A 4MQLA 2HA4A 1W52X 3IULA 3H2GA 1MPXA 5IKXA 2HADA 3HJUA 5C8XA 3AIMA 3M3DA 3M81A 2AJDA 4H7KA 4AZ3A 1R9MA 4PO3X 5HKAA 2WHRA 1ISPA 1A8UA 3A6ZA 4DYHA 1JU4A 3K6KA 4AQDA 3CN7A 1UKAA 5DYTA 3H18A 4K6GA 1LZLA 3FCYA 5BWCA 3WKBA 4ARBA 1LPPA 2XUHA 3QVMA 3VVMA 2YYSA 4ZV7A 3TEJA 5ALQA 1QONA 2XLCA 4G8DA 1AUOA 4BC1A 2FJPA 3QMVA 4UHHA 1XQVA 5K3AA 2HA2A 3QITA 4KR0A 2FJ0A 3SX4A 1NX9A 4P9NA 5K5EA 4AO7A 3ZPXA 5EHNA 4U2FA 3C6ZA 1XZIA 2O2HA 3EQ9A 4I19A 4W1QA 2C7BA 4Y9SA 3O4GA 2WIDA 3FNBA 4FNMA 4U2GA 2XMDA 1XZCA 4UFPA 4LIPD 2VQ6A 2XB6A 4G5XA 3FYUA 5HF5A 4CIBA 3FYUB 1KU0A 1WHSA 4Y2RA 1CUBA 1UFOA 5K3BA 2O7RA 4LXHA 1XRMA 4W1RA 4LYDA 4W1PA 3KXPA 1WCYA 3D3NA 5HCUA 3O4HA 5HF8A 4H7FA 4BP9A 4WY8A 1CUYA 3U0VA 1CLEA 5AKYA 4KJXA 1ODCA 5D3KA 4CI9A 4GECA 1XFDA 3HEAA 5JATA 1MJ5A 5JZBA 5ALVA 4BDTA 3C6XA 1GPKA 4UBLA 3V1LA 1FSSA 5I9IA 2DHCA 2XMRA 1HLGA 1TCBA 4C87A 1CUAA 1UZAA 4X6UA 1K4YA 3WWOA 4C4XA 3T52A 3BJRA 2VT7A 2GZSA 5DLPA 3STUA 4CG3A 1XZDA 2XUGA 3D5EA 4UPDA 3GROA 4WJLA 5AKEA 3IUQA 1JFRA 3BDIA 3GA7A 3V48A 3WL6A 4XWGA 4J3JA 4PQEA 3S2ZA 1O6FA 1Y7HA 4H7EA 2RGUA 4UFOA 4Y2XA 4BVJA 5BWBA 3QM1A 3BF8A 5AI4A 1XRLA 1AX9A 1MTZA 3FBWA 3R0VA 1TKRA 3EQ7A 3DKRA 3DQZA 3HLKA 5FPPA 5AKLA 1B6GA 2R8BA 2O2IA 1UKBA 2AJBA 3HI4A 3FLBA 1MNAA 1GZ7A 1C4XA 3BXPA 2AJLI 2ZYHA 1ZJ4A 4W1SA 4IHAA 4RGYA 4LXIA 4J0GA 1P0IA 2JGJA 5JD4A 3O95A 1TQHA 4CG2A 3FLAA 3D2BA 2Y6VA 5AI8A 2QJWA 1T2NA 5A7GA 2ECFA 2XUKA 5JARA 3ZV7A 4UHEA 3IUJA 2CEKA 2WIFA 3FOBA 4NZZA 1X70A 2PPLA 1CVLA 2JEZA 3W05A 3ZLVA 1DU4A 1MO2A 3KOOA 5AK6A 1LGYA 4ZI5A 1DINA 1HKHA 3R3ZA 3G0DA 3ICVA 4BE4A 2YH2A 2FUKA 1IUNA 2PVSA 2ORYA 1E8DA 3ICWA 1J1IA 4F5ZA 4GW3A 1BS9A 4M0FA 3WWCA 1HPLA 4MQMA 3VISA 1K8QA 3WL8A 4DMFA 3I2IA 4AN1A 1OXMA 2YASA 2WG0A 1SCIA 2GZRA 2Y2UA 4FWBA 3WMRA 4C01A 1XZFA 1LZKA 3X3HA 2WQZA 1RP1A 3FYTA 4V2IA 3DYIA 1D07A 4RE6A 2VT6A 2CMFA 1WB5A 4W9RA 3TGLA 2BUCA 2C5FA 3C87A 1EHYA 5T4EA 4WDQA 2JGMA 1VXRA 5EI5A 5JASA 1XZBA 1G5FA 3K2IA 3D4LA 3SWWA 1UT6A 4MYSA 5D3ZA 2BJHA 5D7BA 1TK3A 1H2ZA 5SYNA 3RARA 2B61A 3KWFA 1ORWA 3OC0A 1UWCA 5ALKA 4X91A 1R4ZA 5AJHA 2ZVDA 1J07A 3B3QA 5JZ9A 4ZXFA 4EY8A 1ZGBA 4H77A 1OCEA 3YASA 3V1KA 4X7BA 1GPNA 4LKOA 3RM3A 2OQIA 4EA6A 5DJ5A 1EX9A 4JNCA 2JGEA 2RONA 3TRDA 5CH8A 5FP0A 2HA6A 3K9BA 3VJKA 1LPBB 1CIJA 4AO6A 1DWOA 4FHZA 4B82A 2JBWA 5AKGA 5DWDA 4YASA 4ITVA 3R40A 3WKAA 1R88A 5IVIA 4QZVA 3D2AA 1SC9A 3G0GA 4Y2VA 1H2WA 1XZLA 4BCCA 5K3DA 2EEPA 3UUEA 4PV7A 4AX4A 1F0PA 2OCKA 3ESAA 4BAUA 2JGIA 1SFRA 5ALTA 1G66A 3I2HA 2PSHA 1VKHA 3DLTA 5AI0A 4OYYA 5F4ZA 5C7YA 5A7HA 2Y6UA 2WHQA 5KWJA 2NW6A 1EK1A 4EY6A 4S0XA 5AO9A 3IA2A 5J3JA 1YAJA 1LBSA 3OTQA 1UXOA 3WJ1A 4A16A 1VXOA 1IVYA 1JT2A 2HRQA 3VJMA 4ZGBA 1E5TA 1QIIA 4ZREA 3SK0A 2AXEA 1IUOA 5JIBA 1F6WA 5BV7A 4O08A 4FDMA 5AI6A 2V98A 4GHWA 1AQLA 1YA4A 3RKSA 3IVMA 3H1AA 5DNUA 4OB8A 1ZIXA 4X6YA 4MWSA 1VOTA 3WYDA 1ACJA 1E66A 4Y2YA 2HFJA 1EK2A 1E3QA 1HQDA 2HU5A 5A71A 1EI9A 4OU4A 3UMJA 3I1IA 4G8BA 2DHDA 1R9NA 5HF9A 2WKWA 4NMWA 2XUFA 2WFLA 3H2HA 2WFLB 2XLBA 1BE0A 1WB4A 2QTBA 3VJLA 5ALGA 4Q3LA 4TPKA 4FLFA 3CCCA 1A7UA 2QJRA 1QFMA 4BC0A 2BGRA 1QIEA 4N8DA 4J7AA 1PFQA 2O2GA 2JGLA 5A62A 2X5XA 1Q0RA 1A8SA 2WSLA 3QPDA 5ALFA 1TIBA 3E1GA 3WZMA 4BAZA 5E4JA 5JALA 2ROQA 3AILA 1CUXA 4Q82A 2XMZA 2H1IA 5AOCA 1GQSA 4KAAA 3LCRA 1CRLA 3DJYA 3LP5A 3RK4A 4AZ0A 1CUFA 4C6HA 2WTMA 5ALYA 1P0QA 1TAHA 1XZMA 3DNMA 4Y2SA 3MUOA 2GYVA 4QLAA 4PW0A 3D2CA 5A6VA 5K3EA 3G7NA 4HXFB 4AN0A 2PSEA 3FSGD 2XT0A 2VJAA 2XUPA 4WFJA 1S8OA 3F67A 4FFWA 2W6CX 1N8SA 3PUIA 1QOZA 2K2QB 3EF3A 2VSQA 1THTA 2B4KA 1UOOA 4X95A 2PUJA 2I3DA 5ALOA 4OB7A 2Z8ZA 1BN7A 4I3FA 3ANSA 3A2LA 3F96A 3L1JA 4B9AA 3PF8A 5DNWA 1WOMA 4P93A 2EDCA 1NU6A 4HZGA 1MX9A 3WA6A 1WPRA 2BGNA 4U2BA 4QNNA 5T4FA 4F60A 4C88A 4BDSA 3G9UA 3DOIA 1L7RA 2WIKA 4X6XA 2JGKA 1XZJA 4L0CA 2GYWA 5A2GA 4JYMA 1W6RA 2ACKA 3KD2A 3FCXA 3BF7A 2EDAA 5IVDA 3B12A 1EINA 4TGLA 4J0DA 1VE7A 1UK7A 5JZSA 2B20A 4CCWA 4GLBA 3FVTA 4Q05A 4X92A 3A2MA 4FFVA 5CRIA 1MU0A 2Y1KA 2H9YA 2C5GA 1DT5A 3B5EA 3D59A 4H7HA 3WK4A 1DX4A 3WK5A 1AZWA 3H17A 5JYCA 4AXBA 1I6WA 5SYMA 3HXKA 5JADA 1GKKA 3IIIA 5ALPA 4I4CA 4XJVA 4KYVA 3I2GA 4E15A 4YPVA 1ORVA 5FDFA 4N5HX 5EIEA 1SCQA 4NVRA 4YX9A 2VEOA 4QDXA 4KE8A 1YR2A 1O6GA 5ALRA 2BKLA 5H3HA 1LNSA 1DX6A 4UFNA 1CUWA 4PSUA 1ZD4A 3FAKA 1CUDA 1FJ2A 5AOAA 3HRHA 4BAGA 3Q8WA 2XUJA 3OOSA 1XRPA 1BEEA 1QJ4A 1UK6A 2OAEA 2BUAA 3F97A 1CUJA 1K5PA 2X76A 4UBOA 3DD5A 3DDUA 1G42A 1ZOIA 2QRUA 1DQZA 3LIIA 4UBMA 3WL7A 1QIFA 4XX1A 3W04A 2OQVA 3WA7A 1U4NA 5AP9A 7YASA 1E89A 3IUNA 4BRZA 2GBGA 3WI7A 1QIKA 4RE5A 2D5LA 5C8ZA 2WUEA 1BCRA 2I3ZA 3CXUA 2RHTA 3KSRA 3LS2A 4B6GA 1IUPA 5FOQA 2QXUA 2DCMA 3WQHA 5JAUA 5I7UA 2QZPA 1OILA 5IVHA 4XVCA 2PBLA 3OPMA 4OUKX 4EHBA 2XUIA 5AM3A 1EDBA 4PSCA 1MN6A 1J06A 4J0HA 2ZJ7A 3DEAA 5ALWA 3M83A 4M0MA 3E3AA 1W75A 3H19A 1PV1A 1EDEA 5EGNA 1DQYA 2WFMA 4UHDA 2O7VA 3G9TA 3E0XA 3O9VA 5AKJA 2I03A 5ISMA 1XQXA 5CT4A 4KRYA 2ZYSA 4L3WA 1R3DA 1FFCA 2QR5A 3C8DA 4H7DA 4BRSA 1QIJA 4B9EA 4B0PA 4G4IA 2WIGA 1VLQA 5FPQA 2VTVA 5AKHA 4N8SA 4J0IA 3V1MA 1DT3A 1ZI8A 4DNPA 2XMQA 2HHAA 5AIBA 3C5VA 5AM0A 2QMQA 3AZPA 4E14A 2PSFA 2C58A 1Z68A 5ALEA 2ZJFA 5CT6A 1FFDA 3IUMA 3AZQA 5K3FA 3I2FA 1E8MA 5CT5A 5K3FB 4KEAA 4U2CA 4JH0A 4LHEA 5EIAA 3R3WA 4G8CA 2XMBA 3ANTA 4AB1A 1GPLA 5AKIA 2JF0A 4INZA 1VJ5A 4GWLA 3ZLTA 4EY5A 5E2IA 2OGTA 3ESCA 3W9UA 5AOBA 3G0BA 3AINA 5LLSA 3FYUC 4B81A 4X97A 1TCCA 1UK9A 3CCBA 4JUIA 5HK9A 3STVA 3OM8A 2G5TA 1GKLA 3I6MA 4P08A 4BATA 1BEZA 3F9CA 2WJ3A 3C8HA 5JAHA 3EBLA 3MUNA 3G9XA 4Z49A 1BCSA 4HS9A 3PICA 4X90A 4FLMA 4G4GA 4RNCA 3NOXA 2HDWA 4X93A 5E4YA 1MX5A 5HKBA 2Z3ZA 5EHXA 4BB0A 4N5IX 2UZ0A 3JYHA 2QM0A 4HAIA 3IB3A 4UBKA 1LPSA 4HXEB 4BZWA 3C43A 4IH9A 4GBGA 4WFIA 5ALLA 1JMYA 2OXEA 4QEKA 4NS4A 5HK8A 4GEGA 1XLWA 3H2KA 4BCDA 2C4HA 2RI6A 2VA9A 1C7IA 3NUZA 5A7FA 2QOEA 1X2BA 3DL4A 1CUUA 3A70A 3WK6A 4FKBA 1VE6A 1YS2X 1QZ3A 3V1NA 1BRTA 5DTJA 1XRQA 2WILA 2PL5A 4AO8A 2FX5A 1JU3A 1P0MA 2CZQA 5K3CA 2HU8A 5CXUA 4B7ZA 5ALNA 5AM1A 2QKYA 1XZHA 5FUMA 4ZWNA 2H7YA 2ZYRA 2IITA 5DNVA 3HZOA 4Y2PA 3M82A 2IX9A 1CUIA 5LZ9A 5LYYA 2PX6A 4FTWA 4WFKA 1YB7A 1ZGCA 2J4CA 4KACA 2VAVA 3QYJA 2GBFA 4HXGA 1XQWA 1K63A 3FLEA 4X00A 2WUFA 1EH5A 5CT9A 3DOHA 1G4HA 4E46A 2DQYA 2WTNA 2XQJA 3VVLA 1CUZA 2HA3A 4IH1A 2DQZA 2XMGA 5JAOA 4H0CA 5ALDA 1A88A 4G4JA 3S8YA 3WLAA 1A8QA 3AIOA 5CW2A 1XKTA 5CH3A 4XIIA 3IBTA 1XQYA 2DR0A 1T4MA 1DWQA 2XUOA 4QE3A 1LPOA 4EUSA 2G4LA 3C6YA 4W63A 4CIAA 2QVBA 2XQFA 3H1BA 4HRYA 2QUBA 2GBCA 1CUVA 6YASA 4JEIA 1EA5A 1QIMA 1UKCA 1QFSA 2Z5GA 4KE6A 4QLOA 3FSGA 3WWEA 2WU3A 3OG9A 2OLEA 2WJ6A 3DKKA 3C6BA 3R3VA 1JJIA 5HF6A 3PFBA 4E11A 5LZ5A 2XQIA 4OYLA 4DM7A 2WUGA 2B9VA 3QBJA 2JGFA 1ZIYA 4U2EA 1XROA 1ETHA 3UUFA
chains in the Genus database with same CATH superfamily
3IURA 2I1QA 3EEBA 2AK3A 2VZEA 1VMAA 3DAFA 3E4DA 2B7CA 2RGWA 4WZAA 5BV0A 3JATA 3UJDA 2GN4A 3ROEA 2PPVA 4WKBA 4G5YA 3RSHA 2YWFA 4NHEA 2ZIXA 4KLNA 3LVRE 4CLRA 5B57C 3MEQA 1G2QA 1FMJA 4TS4A 3FTPA 3TAHA 1H9BA 2WIAA 4EHHA 3JTMA 4KDCA 5HQ3B 2DXIA 2ERYA 2DFVA 4EB0A 2PVCA 3Q85A 2OHOA 1CVIA 1DXHA 5KJ1A 1U5BA 2IIVA 3T5MA 3H65A 4R0MA 2UZIR 3LCJA 3QLUC 3A4MA 3H04A 3EN0A 4M22A 4WBNF 3NTRA 1TKAA 3PFWO 3ZBPA 5BN4B 3ZWNA 1SELA 3GVXA 3KD3A 1A12A 2PKWA 4FHFA 4DSZA 4IIJB 5AXDA 1ZQ9A 3VOTA 2FX2A 1CUHA 4LYHA 5EJMA 3AYZB 1WUYA 1JQJC 4ER0A 2E21A 1JU9A 5IEBA 5G1OA 4POAA 2MOKA 3WLLA 3HNRA 1BIFA 1V16A 4CZ2A 1PDVA 3VNVA 4FI3C 3AZOA 2YC4C 4CTKA 2OZEA 5NLLA 4QGAA 3FPEA 4G9GA 4YCMA 1YB2A 1PVOA 1WULS 2W48A 2GJAA 5C92A 1QB7A 3AM5A 3UJ3X 5T6MA 2B25A 3FZGA 2AG0A 2EW8A 1G5PA 5ETJA 1XC7A 4CTJA 3IUEA 1V39A 3ONEA 2WE8A 1LLDA 1ETUA 3T1OA 4FYMA 4R2JA 1IQRA 1SVWA 4BN5A 2EIEA 1VHTA 3OOYA 4QT0A 3R9IA 3C3YA 3OIDA 2AH1A 4OBEA 4P22A 3PQ4A 5FA8A 4DNOA 2HA0A 3I1YA 1I3OA 2E3JA 2C2OA 1AGRA 3PX2A 4ZJUA 5DCLA 2XNHA 2P3LA 4ECEA 1YBHA 5H3CA 3GRUA 1R0ZA 5L3RA 4H08A 4NYJQ 4XPIB 3QLEA 1YQ9A 1U28A 5ER9A 2J3DA 4I14A 4IFIA 1XTTA 3N2ZB 3QMWA 3CT4A 2PT5A 2HA5A 1ZK3A 1C9LA 1CFZA 3AUXA 1C3VA 1Y7PA 1KI3A 4NOMA 4QICA 3KK0A 5ITVA 5THXA 2WOOA 3QUSA 3DWGA 3VBCA 1JIUA 2FFQA 4JHLA 1XXHB 5LXTB 5HMLA 1UM9A 3F0TA 4GUAA 4XM0A 1GZ5A 3WP0A 2OHJA 3LFUA 2FEPA 1QU3A 1G20A 4LY9A 2WB4A 3IQDB 4CMEC 3AF6A 4KPYA 3RS3A 4KNWA 3D0KA 4ZEVA 5AI5A 4ZAVA 3VH0A 2VK4A 2IU4A 1MAUA 1U9JA 4BLTA 2D7JA 3WZLA 3DYVA 3R3XA 3TZEA 3VSDA 4Q4JA 1U8CB 5JCZA 2EERA 2HLDD 1TA0A 3LBIA 5CNKA 1V11B 2OR3A 5KU1A 2BMEA 5A4DA 2ZYVX 3WNBA 3P9PA 4A0AA 3FPBA 4HWSA 2CNXA 3JYOA 4UXHA 3Q7TA 2PX3A 4YV2A 2CXQA 4FQ8A 3OWHA 4AMYA 3EG9A 4B3MB 5I6DA 2AG1A 3DONA 1MQSA 4OGKA 4EHLA 1X1BA 2FPMA 5ALJA 2PX2A 1T0IA 1E4YA 3R77A 1L5MA 5J1TB 1ZUNA 4RD2A 3BWXA 1RLJA 5DP2A 3HCEA 3C6KA 4LNAA 1ULSA 3FYSA 3W3AA 4QYWA 1EFCA 4ZI7F 3TLBA 1KHHA 5K19A 4NU8X 5ERXA 4OV6B 2WM2A 2ZI6A 4L6IA 2LDBA 3F98A 3EPRA 4GR4A 3GFFA 4WXRA 1VHQA 3NFYA 3WK8A 5C3MA 1GTJ1 2XRMA 1T9CA 4B79A 3KQMA 2FHSA 1L8QA 2FUG6 2NZVG 4X45A 1FMTA 1Z4JA 2A0WA 4F1KA 1Y34E 2TRSB 4WZAE 3GHYA 3IEKA 3EH1A 4QQFA 5F33A 5CH5A 4YRLA 4QPCA 3K3PA 3TLYA 3TQOA 4G9EA 1M34A 4GYWA 4UM8B 3DEJA 5LYJF 1OBFO 3FHJA 1RP7A 2ZT7A 1YASA 4OKNA 1C8LA 3LGXA 4A1OA 5DYWA 5KOJA 4LDJA 4XGIA 5EIFA 1ADCA 1SVSA 1U3GA 5AESA 2BM9A 5K3SA 1TRHA 4UUNA 5EZ5A 2BGWA 3JXEA 3JYLA 3HWSA 1MX1A 2EJTA 5AK0A 3KBOA 3ROXA 4EWRA 4HD8A 3HN7A 2RHHA 3HVRA 4G56A 1FXWF 1LPMA 3VR0A 1Y1SA 4HAZA 4B4KA 3ESQA 3KFVA 4K9MA 2QD5A 2G9RA 3SCYA 1VFPA 1NBOA 4FSDA 1ISFA 3BCHA 4A0QA 2EJBA 2OBFA 3WADA 2ZREA 3NBAA 3GLHA 3NCHA 3D3KA 4CDGA 2YY6A 3CW2A 3D6UA 3K1ZA 4AMZA 1ONOA 4CM6A 1ZEJA 3GUHA 3RQIA 2VN8A 3AUJB 1JPVA 1MPXA 4HAOA 2HHCA 1WSAA 4YMIA 3MELA 1T4GA 5EXXA 2YFHA 4JB8A 1T6BY 3A6ZA 3ZY2A 3PQ5A 4G5GA 2ZUDA 1AQYA 3IKOA 2DLNA 5ANRB 4K6GA 3IMFA 2IW1A 5TC4A 2H9MA 3MT0A 2PL9A 4LNUB 3QBVA 5GINE 4EBFA 2H4HA 4LUCA 2PQ0A 3P9XA 2IGBA 4B3FX 1PW7A 3TDMA 1Z38A 4KQ9A 4TSKA 3LNCA 2FQQA 1ZRNA 1QHYA 1KAGA 3V34A 5DIZA 1P2DA 3H5OA 4B4DA 1RE1A 2FPXA 2OCDA 2XMDA 1J7KA 1D7OA 1H0KA 3IAS1 1T2UA 4CL2A 1IM5A 4FJ0A 4I55B 3LUGA 1PV2A 4PAMA 2W4IA 3I0MA 1WCIB 4BFSA 3UBMA 1ZESA 16PKA 4LYDA 1ZIDA 2QN3A 3KXPA 4RF4A 2JZCA 1Q0HA 3TXAA 4QOJA 2O19A 5IAOA 4WY8A 3ANMA 1P8AA 2OV8A 4PFSA 5IJ0B 3O82A 4BE7B 2HCRA 3UPUA 4JYAB 1E0JA 3E22A 1G20E 4R68A 4AJNA 2YOFA 1IVSA 2O06A 3V97A 1OFHA 4IXNA 2HK7A 2CHQA 2OBBA 3U7JA 3TOVA 3D5EA 3LX8A 4RO0A 3EE6A 4FFLA 3SVTA 3OCWA 3ZD8A 5FUBA 1EM8B 1KE2A 3S2ZA 4KSYA 1JBKA 1B6RA 4ARZA 1Y7HA 2Y1XA 4BVJA 5DFAA 5KNCA 3TOXA 1R2QA 4MV1A 1Y3AA 4AY6A 5D87A 2JBHA 2I1LA 4G09A 1R00A 3KOWA 1QQ5A 4Q48A 2W71A 1W36C 5DI3A 2PFSA 1GZ7A 1ZSVA 1GSAA 2OXIA 1KARA 3H9GA 5CVUA 1TQHA 3AKCA 4A0GA 3DZCA 1ULHA 3VUEA 3LOUA 4UHEA 4NZZA 3IUSA 4BP1A 4XFJA 2YJGA 5LWHA 2BHTA 1PKEA 4JT6C 4IDFA 2XYRA 4DLTA 4Q21A 5DGHA 1GDTA 1NOIA 4LDRA 2LKCA 1SUBA 3NUGA 3FI9A 2OZLA 1QRRA 4WERA 3S2IA 2HNBA 2EKLA 3A3NA 1T15A 4MRVA 2EBUA 3K32A 4X8OA 4QYTA 3TW8A 2FPGB 4MB2A 5ICCA 4S04A 3MMZA 4XCVA 3X3HA 1IRXA 1G55A 3HR7A 4U00A 3VR2A 3FYTA 2HSWA 1BD3A 1R6XA 2PH1A 2W6JD 4MA0A 3I3OA 4WKPA 4BO2A 4PCVA 5H5JA 3S1AA 2AWNA 1XZBA 2G1KA 3AG6A 1QG4A 4NIMA 2IIQA 3SWWA 4GYKA 1M34E 3TINA 5JD3A 3NKVA 1KTVA 1YZNA 1IZZA 1FTYA 1T3HA 4IOKA 3TEMA 1I4WA 3A9RA 1LTKA 1JMZB 3T1NA 2COUA 4MV5A 3L4KA 1S2NA 4NYIR 2GHQA 3GH3A 2J87A 4V0KA 3KKOA 4RUKA 3UK6A 4JNCA 1IAQA 5EJ4A 1VCNA 3GUZA 1D2GA 4FFNA 3D3WB 2D1SA 4TV8B 3T99A 4BUJC 4LNHA 2X6RA 1R12A 4NBRA 1V9CA 1SXIA 3WRXA 4B3JA 5JTTA 1BXKA 2P6RA 3I6IA 2Z1NA 4RMGA 2WYWA 5AVOA 4EGCB 5HYVA 1B93A 1Z6TA 1TZ2A 2QPTA 3X1KA 2KBEA 1VLZA 3RYHA 3UFXB 1PS8A 2WTXA 4X60B 1D0SA 5FT9A 3DLTA 4M9ZA 1GLGA 2IY8A 2Y6UA 1VBKA 1VLMA 5HIJA 3MJDA 3PL1A 3R7FA 3HP7A 3VYSB 3RIGA 1YAJA 4ZAGA 2YNPA 4B2IA 1UXOA 2LPMA 2DUWA 4LXUA 3K9QO 1Y4AE 1Q14A 3W2FA 4CKCA 1RXUA 3UMCA 5EJEA 3DFUA 5EWLA 3PEUA 1FS5A 2ON6A 3V8NA 2C9MA 1MG5A 3IQGX 3TOSA 3NPAA 3SXPA 1X7YB 3A1WA 5FWDA 5EMJB 3FMGA 2PXAA 4S2UA 4LVCA 4JI3B 4JBYA 4IIDA 3WNCA 1E3QA 4HLCA 4BJ6A 1ZBQA 2HU5A 1EI9A 3OJ0A 3BOSA 3GCXA 4LE0A 2RH4A 1N3BA 1KERA 1C50A 4JJAA 3IT2A 3EIXA 5C8YB 4LGYA 5FQDA 4V02A 3NEJA 3AVUA 1KJWA 2J3MA 5JXGA 3G23A 1QKIA 2QTBA 1GYPA 1USVA 4GC5A 3ZE8A 5H3LA 2BGRA 1GPJA 3S7ZA 4BECA 4HLQB 4CKWB 4HH4A 4MMXA 3UJ7A 4GGMX 3FFAA 4BHTA 3WZMA 1CHDA 1KMHA 4MVJP 4XYLA 5JALA 4YMVA 3GUVA 4PBSA 4JL8A 4A8JB 1LU9A 4EK9A 3T35A 5EXSA 3PR1A 5KQLA 2PZLA 1WMDA 1CUFA 1N6EA 1BXGA 1AHNA 2H59A 3E9CA 1PP4A 5B1YA 3ICCA 2G76A 1Y8QA 4YJFA 1DPGA 2IU3A 5AVQA 3V8QA 4KH1A 1C41A 2C7VA 1XF9A 2W5UA 3N2GB 3O74A 3FSRA 2X6TA 2G8LA 1UOOA 4BVHA 5JC8A 5BQ3A 2VTDA 3L8GA 1YZUA 2H2IA 1VPWA 1SWWA 4KPEC 2QTVA 3SLKA 3C5CA 2BFEA 5EMMB 1WPRA 2YHSA 4D7AA 3F49S 2P68A 3PJFA 3NIFA 1B0AA 1J8DA 4AT1A 3N74A 1KE1A 3DMNA 3JVEA 1ADYA 3KJHA 3IAAA 4OQQA 5CX1B 2GAJA 1VE7A 5AVWA 3PQFA 4UEOA 3SBOA 3D59A 5JNSA 3OJXA 1N36B 3WK5A 2Z2KA 4ES0A 4RQTA 3H17A 3M6IA 1OBVA 3JRPA 1GKKA 2UZ4A 4BH6A 4YPVA 1R0BA 5L4NA 2NSYA 4LDNA 5E6RA 5I47A 4PHGA 4EFKA 1WKBA 4O4IF 4QDXA 2H52A 3QFSA 2WBLC 4MVJM 3GJ4A 1GPBA 1GCIA 2F1HA 2V74B 3FAKA 2HQ1A 2P5SA 3C0KA 1PK7A 1DQNA 2QTRA 2XUJA 1PTJA 3OFKA 3OOSA 1XKXA 2J41A 3MJTA 2FW0A 3Q87B 4X44A 4RIGA 1ODJA 3QVXA 1OWNA 1AKYA 3RRMA 3ZHSA 2KYRA 3EVNA 1RTKA 3OU6A 4NJEB 3PD1A 4J0XA 5JQGB 4ERXA 4RZIA 1LK7A 3F8WA 1E89A 5DOZA 4BRZA 3TLXA 4FPXA 4UOQA 4JA2A 3JQAD 4BASA 4Q66C 1XDBA 3OE7A 2WUEA 5FNVA 3QG1A 2I2XB 4JEHA 3LS2A 1SEVA 3I4CA 3DUWA 3WQHA 4G67A 4C3OB 3TG2A 3IT3A 1JKJA 4P35A 5SZHB 3EW9A 3HNPA 3R9XB 1OXXK 2OD2A 1EHIA 5IZ4A 1PV1A 3B1XA 1YKGA 3OU7A 5GOTA 3QLTA 2GKGA 4L8VA 5G3ZA 1NF2A 3O9VA 5AKJA 1KO1A 3HUEA 2GAFA 4J9UE 1XYGA 4RF3A 1DBSA 3ZNOA 3KXIA 1PZMA 1UXIA 3WXBA 1FX1A 2YXNA 4HNAA 3QXJA 3OZVA 1VCHA 2WJGA 4OQFA 5AKHA 4N8SA 1WUIS 1Y4DE 3TSOA 3DDZX 3KELA 3OA0A 5B1HA 5CIYA 3A2KA 3DT8A 3GX1A 3MT7A 3OQHA 3JAMg 1EAYA 4W6QA 2GCOA 3KZMA 1CQPA 4YRNA 5D7NA 1S01A 2RHCA 1N6DA 1YRWA 4RZQA 3N0EA 2XL2A 3GJYA 4IMPA 4D57A 3WOVA 2G5TA 1HDOA 3FZEA 4M8LA 1E9AA 5JUWA 2FTKE 4BEWA 2ASVA 3OUTA 2HLPA 1BCSB 2QVZX 3CG4A 1EGHA 2CCGA 5EJGA 2OBLA 3T4EA 3AVTA 1C7QA 1Z22A 1A0OA 3PPWA 4C14A 2QM0A 1UMCA 3CIKB 1PWHA 4F2PA 5B7NA 4AOWA 4TL6A 1BOOA 2W8ZA 4RJLA 4AG6A 3P9SA 5LVAA 1GL6A 4BKOA 3R6GA 4CZYA 1V25A 4KQ2A 4CKYA 1UKZA 1K8ZB 1PL0A 4RZ3A 1XWIA 1P1KA 2B9EA 3TVYA 2ENWA 1WUJS 2RI6A 1C7IA 4B6RA 2CD9A 2EG5A 3N8HA 1D4FA 4TLCA 3BGIA 4FX5A 1JPNA 4EQZA 3DZJA 2BFFB 4KGXA 2WNSA 1LNQA 4KPUB 2HKIA 1Z2CA 3V1NA 1SUFA 3B53X 4PX2A 4Q9IA 1QPZA 3GAZA 5FBVB 5IBCA 1UH5A 2OZKA 3VDRA 4C78A 2QY6A 3G0OA 1ZD9A 4Z0TA 2DFTA 4YMHA 4Y2PA 3EY4A 2AXNA 1FX0A 1OHHA 4TUYB 1L7MA 3FROA 4OXIA 2H1RA 4XD7D 2AC7A 4HCJA 1T8TA 5CM8B 2VCEA 1Q19A 5DGIA 3EAFA 2DVMA 1DTWA 1L0BA 4RK6A 4XDGA 3RGWS 4IZ6A 5GJBA 2J5RA 4MVJD 4XLTA 1DXYA 1B4DA 5JQWA 3DGFC 1UMDB 4RD1A 3KU4A 1WDKA 5KNDA 2QRKA 3NTLA 1JHOA 4Q7MB 4XI9A 2AFHB 1TYBE 3EEQA 3U7GA 1H4VB 3IQXA 2ECKA 2XNJA 4ERZA 5B7PA 1CP2A 1ZIYA 5IMBA 3NBMA 1KMIY 1NBIA 3UUFA 5JROA 3EPPA 2SECE 3C8UA 2AI3A 2VDMB 2O1WA 4GGCA 4BBZA 1N5OX 5J23A 2CN2A 3Q0TA 3OX4A 4DEVA 4ZT7A 4E08A 3O1HB 1NKSA 2VDRB 3IIMA 3NBKA 1K06A 1TEXA 4YRIA 2FN3A 3E7DA 3GA0A 4BFVA 4K6KA 2VP9A 2HXYA 4M21A 5HIMA 3GFCA 1NW5A 2ZJ3A 3L7DA 1KZ6A 4TWIA 1HA3A 1T36A 3CUYA 3D3EA 1Y9EA 3CHYA 2Q4BA 4H35A 4J49A 3PHHA 2PX8A 5AVYA 4FB5A 1GGVA 5HFJA 2W2OA 2H29A 1EBBA 3K0KA 1IATA 1AE1A 5B1EA 3LBFA 4B1FA 1P3JA 2OO5A 4DJAA 2FZKA 2VF7A 2QZ9A 3KOYA 5DBOA 3RS7A 2Q2NA 2J3IA 3CVVA 2DU8A 3KXLA 4MK0B 4A2CA 3CA8A 1PQYA 3HFQA 1Q21A 3GDOA 5ITZB 1N1GA 2IUFA 2WR8A 4P3PA 4NNOA 2IL1A 5ALHA 3GBPA 7MHTA 2QK4A 2XYHA 4KO3S 1ORDA 2ADOA 3VO9A 4QAQA 5DLYA 3NGLA 1DC3A 2IZZA 3KKQA 2GA8A 2FGKA 3EHDA 2BP7B 2IHKA 5KYWA 4LJ6A 1WZEA 3T1VA 3UJHA 3UQYS 4G5SA 1U90A 1TVCA 3RFUA 4DV5B 2B3DA 1CV2A 3EH2A 4CCSA 2J5BA 3CRW1 4L51A 4WX2B 2G07A 1YJBA 4K6HA 2GAIA 1JJVA 1JHXA 2IE8A 2QQ5A 1D9ZA 4MYRA 2XQGA 3TPFA 3UXEA 4TXHA 2PGNA 4Z1MA 1K7XB 2QP3A 4CI3A 1QJCA 4HH0A 1H2XA 4ODIA 1UJMA 3ZCXA 3ZZ1A 2V58A 2C9BA 3ED1A 4NZNA 2PU5A 1SBQA 3TYXA 3RFXA 3FPGA 2JFVA 4CYMA 1NJ1A 3JU3A 4H17A 1F0NA 2XHEA 3CZ5A 3HO1A 4A2WA 2WFAA 1Q17A 1N2BA 1L7VC 2O8EA 5KYXA 4OI4A 2CV1A 4BFTA 1MD9A 1PFKA 1XNQB 4YJ3F 5A0FA 1T3ZA 3U2QA 4CHGA 5LU9A 3N5CA 2PQ6A 4PVCA 3PHGA 3PJRA 1R1DA 3LYUA 1WJGA 4PPFA 4N0PA 5DO9A 1CQIB 1WS6A 2WJIA 2GH1A 2ZG6A 2DWOA 1PE0A 3TLZA 3Q0IA 2DT8A 4A91A 1KVUA 2V6JA 2YYZA 3ENVA 1P81A 4GGAA 3GHHA 5LJLA 1NLYA 3GZJA 4FNGA 1OXKB 2YN2A 3EPJA 1QGZA 2EFCB 1G8YA 3JARA 4BJ1A 3ZJ5A 5DX0A 4RESA 2WF9A 1GZ3A 1BWSA 1S0UA 3IEVA 1ZRSA 2X7JA 3BJMA 5JTUA 4OIMA 1EGVB 3O8QA 2V54A 5ESDA 2QN6A 3OJOA 1T5IA 4LEIA 4HLDA 3KT3A 4RPKA 1DIGA 1PNOA 5FWAA 4F2GA 4EZIA 1U2ZA 2G82A 2Y1EA 4RHXA 5KYTA 3UM9A 4L4SA 4U9HS 4PGAA 3NTUA 2PR7A 1OXTA 3E23A 2VDLA 3H3XA 3W79A 3FTCA 2VUUA 3KQHA 1EXWA 2ZXEA 3PYMA 5CLIA 1KMCA 5BSTA 2GHTA 4OXQA 1COZA 3K2BA 4QKQA 4BPBA 4PZEA 2AFVA 1I0LA 1KIMA 1CEXA 4DVJA 5DMXA 1R6TA 5GADl 2O3JA 4WHMA 4GSYA 1LC0A 2KS6A 4IOLA 2ATVA 4NG5A 4KIJA 2Y1OA 3WIOA 5TQ2B 4D44A 2ID4A 1WWKA 4H1WA 1EP3B 2DQKA 1FFXB 1MOSA 2ZGVA 2HXGA 4WEQA 4HYTA 2G5GX 4GYJA 5AICA 3RC3A 3K1AB 1KQ3A 1E61A 2KE5A 4YO8A 3QKIA 1INLA 4RORA 4AJ9A 3QE4A 1RM4A 1TM5E 3CLVA 2YFQA 3IEMA 2VBCA 3R5XA 2NTEA 2OQ2A 1NW7A 2FPPA 1X80A 4B73A 3DAYA 2BEUA 3KJIA 2YFYA 4HUQB 5IJ8E 1A9YA 1LS1A 2XADA 2YIVX 3HKCA 3OE5A 4MQ5A 4ZVLA 1P9WA 2GN1A 5I48A 1LBTA 2J7KA 1SC4A 5J59A 3OURA 5IJ9B 1OFIA 3VR5D 2R11A 1H23A 5HKOA 2XU7A 4NBWA 1XTVA 1GAJA 5AI9A 1LDYA 3DEIA 3JTEA 1Z2AA 1LSJA 5FR2A 2HDHA 5KVAA 4NH4A 3BWCA 4XIFA 4G6ZA 5CFOA 5T57A 2IUYA 3HBJA 3WB1A 1ZMTA 5JXIA 3DHVA 4WCFA 2B8TA 2FU5C 3VZPA 1KRWA 4QARA 2NZWA 4J3FA 3VYUB 5G41A 1I6LA 2PNJA 3AI1A 1PSZA 1R6BX 4KNVA 2FN8A 4ARAA 2O07A 2GMWA 4YRQA 3SC2A 4DC0A 1E94E 4IDEA 3A6LA 5TSDA 3A58B 5K6TA 2NNWB 3Q40A 4OVKA 2QW8A 3E3MA 3RODA 3RPEA 3BRWD 2BW0A 4N3GA 4FFDA 1FU7A 4J7CA 1PS0A 3GH1A 2DKOA 3WYFA 4QUIA 3SIRA 1GRCA 2CXXA 2R00C 4EVQA 1U4CA 3P9KA 4AS1A 1IY0A 2WHRA 1Y8ZA 2Y8EA 3DHYA 3IJPA 4K9RA 1NBMA 4MIOA 4RAOA 4H15A 5DBIA 4DWOA 3K8QA 4RKQA 2PWPA 1MVOA 4BFLA 1KI7A 2ZBEA 2RHBA 3ZHTA 3I5YA 2AG5A 1WABA 2ZXUA 3QITA 1W73A 3GARA 5DI9A 5CVDA 4E3WA 4G0VA 3MGCA 3GN2A 5EGSA 2BGTA 1NMZA 2Q1WA 3OD1A 3EGXB 1MDAH 4G5XA 3FYUA 2CL6X 1T9HA 3CMCO 1UFOA 4QDKA 1PJLA 2PL1A 2WUWE 3AEKA 5CYKB 2X0KA 2MHCA 5BSUA 1RYFA 1Z7BA 5HF8A 1B43A 4OK6A 1STOA 3B9PA 5FHRA 4D5GA 2FUCA 2QNRA 2X5NA 3KUCA 3PX7A 3TE6A 1XFDA 1TM7E 4PLHA 1XCOA 2G80A 3OZEA 3WGUA 2B1QA 2V4ZA 4M0PA 1IQ0A 1TTHA 2W2NA 4JP3A 4I3HA 3PFFA 2VXOA 1ZUD1 4ILEA 4D9NA 2QUHA 3K53A 1RJDA 3AW8A 3BE5A 3RSCA 4IL5A 4WZBB 3ILYA 3H9BA 5JDIA 4DT1B 2D1QA 1FFYA 1EFRD 2Y05A 3CM0A 2P27A 1C1XA 1R0KA 3K09C 4OY3A 4JWKA 4S1WA 1XPUA 3EMBA 4U7DA 5MN6A 1U4OA 3BFJA 2R8BA 1M6NA 4DXDA 1ECJA 3SEZA 2JVKA 1JAZA 3U39A 4EJMA 3BXPA 3BXGA 2PBIB 4D79A 3HY6A 1Q47A 1QYXA 4UCQA 5JNTA 4MDYA 3OQ1A 5AJWA 2ODQA 3VPGA 5TQVA 4GXRA 1HLFA 4QUKA 1DU4A 2JI8A 3HB0A 5AK6A 3W2EA 4OHCA 4IXMA 3UK7A 1RJ9A 1JFTA 1GAWA 3ITEA 4PC3A 1PGJA 1TU0A 3OHSX 1QP8A 8ABPA 2CWDA 2XEXA 2OHIA 4FAVD 3RTCA 5DN9A 3TFWA 4YT5A 2JD2A 4WKOA 2FK8A 2Z1MA 3GOHA 3B52X 1OXMA 3WSWA 2HYIC 1P4SA 3P4YA 2GZRA 3AKZA 4QTTB 4EKIA 5CBPB 1X14A 3GLKA 3KSBC 4KSCA 1GLNA 5C35A 2B4EA 1BS2A 3UMVA 2IYSA 4NMXB 4TQ9A 1FEZA 4RA6A 1VXRA 2QLBA 5BURA 3ON5A 1Z2EA 1QFZA 4R9RA 3NDIA 3OKCA 3LXUX 2ZQYA 1J0XO 2IIPA 4BQEA 4EH1A 4Q01A 3NBXX 3IX7A 3QLVA 4CQNA 4X91A 5IDWA 4II7A 3T41A 4ZXFA 3SPXA 3KXKA 3ZDYB 4E7OA 1HSOA 3PT5A 4OQPA 1GCAA 3ULKA 4DIMA 1G21B 3TTTA 4NKRA 3EPHA 5KOYA 3VJKA 1V8DA 1G8GA 3OLXA 4LFCB 4X1YA 3PP8A 3FWKA 5HVNA 1KH3A 1PJ2A 2FV8A 2QE7A 1UBCA 3N39C 3NHZA 3S2UA 1W4BA 2MINA 3WAKA 2B6HA 2O8VA 1X19A 3PU6A 3DE0X 4Z8XA 1IE3A 2ZVPX 3ND8A 3UHJA 3VI3B 4Y2VA 3QUCA 4OKIA 1H2WA 2QGNA 3GN1A 3OL2B 5IM4A 3TOZA 1T9DA 1TW2A 2FLKA 4M9XA 1JEJA 4H0NA 4S35A 3OEHD 2PSHA 1EP9A 2ZSUA 3AVVA 1TYAE 1IJBA 3H5LA 1P1BA 4L5YA 2NADA 2D2EA 1JXAA 3EJ6A 3E61A 4MEJA 1EK1A 5JT1A 1KRXA 3LX4A 5HGJA 1BQEA 4FYYA 4ZGBA 4QO7A 3VSEA 3TKAA 3U7EB 4DCJA 1CRQA 1P2VA 1P6QA 2HH9A 2V98A 3QNMA 2VDNB 5FOWA 3O84A 3D4BA 3FW1A 5HUQA 5F7OA 1SULA 4OQLA 4LOIA 2O05A 1GV0A 2H1VA 2PTGA 4BLSA 1ECFA 3D6VA 1IXSB 3LX6A 1TPYA 1CRZA 1V1RA 2DH5A 5A71A 4CM9A 3R7LA 1C4KA 3C8ZA 2W90A 1HRDA 4X7MA 3LXRA 2BN4A 1Z5PA 3QOXA 4NP6A 2P5YA 1P7ZA 2ZB4A 1N92A 1JW9B 1MRSA 3CCCA 2VHTA 4BC0A 3E2IA 3WJAA 4DQUA 1NRIA 3TFQA 1D1PA 1ENOA 1SQ0A 4U5QA 4H16A 4DZRA 3NXKA 1FP6A 4QELA 3QWIA 4NZ9A 1ENYA 2Q0SA 4QX6A 1C9MA 3TTUA 3KZ1E 1CRLA 5DVZA 2R8XA 3E15A 4QJBA 3BXHA 2J59A 3GW8A 4R8KA 4AZ0B 2V4MA 5DN6A 2LCQA 1M6VB 1N7IA 4AMUA 3MUOA 2GYVA 4ZQIA 4LY0A 3WIDA 1CE8A 2GPNA 4YRRA 2PSEA 2XT0A 2J56H 4MV4A 1Z4NA 4ZU1X 1I4EB 1QO0D 4WADA 4PHTA 3WXMA 2O1SA 1THTA 2JAOA 6GPBA 3L01A 5EKUA 5DNWA 4GF5A 5EJ5A 1EXVA 2OA0A 4F60A 3QVVA 1HSZA 1L7RA 2EZ9A 4Z4QA 4X6XA 1JZTA 1JHDA 2FHPA 2QJFA 4HNGA 4JSPC 3OOJA 3HPRA 1ILEA 3PE4A 4BNXA 2E1PA 1JQDA 4LYYA 4Q05A 3VVCA 3DZFA 3H2SA 2Y1KA 1Q12A 1CCWA 821PA 1R0YA 1M0WA 3LCVB 4DDTA 4YUAA 5WRFA 3W7VA 5GQSA 2VJMB 3V8RA 2GGSA 4PC1A 1RBMA 1WTAA 1FFSA 5HA5A 3A37A 4V0RA 4F71A 1U2GC 3Q4GA 5KTTA 1UBJS 3GCDA 4JMPA 4LC0A 2WY2D 5BUSA 1OMOA 3ZU5A 3U62A 2YY7A 5ALRA 2J30A 4C6SA 5H3HA 5B3AA 1CUWA 3FOWA 3R7WB 3GFVA 3FGNA 2XDAA 4IJVA 4WLEA 5EZYA 4LHWA 3VTZA 5I9TA 1QBKC 1X7XB 2CZCA 2O0JA 4BVFA 1FDVA 4O0LA 3AH8A 4QVGA 4UNIA 4MRMB 1TZCA 3DAGA 1GNQA 2PQ2A 4MW4A 2OQVA 3U9SA 3O2QB 2I71A 4QODA 3PQDA 2FW9A 5C5CA 5C8ZA 4Y9TA 4MCAA 4X84A 1YNSA 3IV7A 1KS9A 3KSRA 1IPHA 1YF3A 3KRWB 3I73A 3RHZA 2QAJA 4D6PA 4LZAA 1KY5A 2XUIA 3ZHYA 4B3CA 2G4VA 3DCYA 4EX7A 1NR0A 4NE7A 2ZJ0A 3MPUA 1YJCA 2WICA 5JG7A 1XNHA 1XEAA 1WETA 3TIVA 2YWRA 3F7TA 4PINA 4CM8B 4UE3S 1TK2A 1Q7GA 3X2SA 2DJ5A 1EZ1A 3MHPA 3PZRA 5FTJA 2CXUA 1XJCA 1VI5A 1OYYA 4Z4HA 2X23A 4CV2A 4NXNB 4G4IA 3A1EA 4GNRA 2I2FA 5FPQA 1DE0A 1B6TA 2C04A 3AQIA 4WUVA 1XP5A 3SHFA 2Z2JA 3EUFA 4DNPA 3C5VA 2YXEA 4NESA 3RBVA 1Z0DA 1Z68A 4UMDA 1WF3A 3EAQA 4US2R 1TVMA 1E8MA 2FZ5A 1P9NA 1WXQA 2XMBA 1LNZA 3ZDQA 1JEEA 1CZKA 2JANA 2XXBA 3KLPX 3NNNA 3TZHA 3KG2A 1PLKA 5CXSA 2WSSD 3IOCA 3STVA 1M2OB 4BATA 1F60A 3DCJA 4ZO9A 2WOJA 1Z2OX 4ZJPA 1CS0B 2PUVA 3RVKA 7AT1A 4P5EA 4N5IX 4DA0A 3HMQA 1XDUA 4R9UC 4UBKA 5D3MB 2Q8QA 3L7BA 4RY2A 3HHEA 3CLUD 1NA5A 5HK8A 1SIWA 1QG0A 5AJVB 3I1FA 3L7AA 5G3YA 1ZISA 3IHTA 1TI7A 1ZGZA 1D8TA 4L0QA 3WLJA 2FFBA 4J84A 3MGBA 5E8JA 4Q4AA 4YJKA 4PX5A 1CW2B 1OXUA 4LZJA 1R5BA 3JAKA 1ZVVA 1ADGA 4JI7B 2GJSA 2CZQA 4L5IA 1J21A 3IVCA 3SI7A 4JC0A 3R6WA 3EXIB 4F46A 5CXCA 1EDOA 1U2GA 4MUYA 4I4TB 1S1CA 3PDWA 3DMYA 1EMDA 3IPCA 4D1YA 1WXHA 5BYAA 3EI2B 3A3YA 3D0RA 1S4QA 2HJSA 1E9RA 1OC2A 3DWIA 4LJ5A 1LBEA 3PXAA 1A9PA 4B2PA 3Q8MA 1KP2A 2PUGA 1YBMA 2HSEA 1KNQA 2FN7A 4W63A 4MS3A 2HZ7A 1DJOA 4JBGA 3RHSA 1UP7A 4G84A 1TA4A 3AX6A 2WU3A 1PSDA 2VK1A 4FWIB 3R3VA 1K68A 5HSGA 2GLTA 2X3UA 2VF5X 3GUYA 1HDRA 3HDQA 4N5LA 3ML1A 4KE9A 1SJ9A 5U1PA 4HEQA 2QRJA 5TIIA 4DMUB 4Z53A 1M0TA 2VKTA 1C7JA 2VDKA 1CRWG 1W96A 1WD7A 5BSGA 3ZGLA 1TMGE 4FX2A 3RU9A 4FFMA 4C3ZA 4Q47A 4PQGA 2BZ1A 3VOAA 4AAYA 4DLAA 4ID3A 1ESEA 5TLSA 2NYUA 4GEKA 5A3VA 3OBIA 4GDFA 1FUEA 3FUWA 2JJMA 2O0MA 2CK3A 3H7AA 2FOIA 5DASA 3OM9A 5DHTA 4Y2QA 1PZNA 3I28A 2FSHA 3WLPA 3CLSC 2BONA 3VZDA 4RYLA 2Y1WA 3HYNA 3RC2A 3G02A 3JZAA 1II0A 3WRXC 1HEYA 3OQVA 3O94A 4CN9A 4KR3A 4HTFB 3IILA 3C5WP 5B3LA 2ZQZA 1PWXA 3K5IA 4PSDA 2IUPA 2XIQA 3DPUA 1I01A 1X8KA 1J8MF 1M5UA 5DXFA 3COWA 1JQLB 1Z25A 2XWJI 1T6NA 1YS1X 4L07A 3GLTA 2EC5A 6ABPA 4G9BA 4KNYA 5B36A 1YZFA 1RHQA 4TL9A 4LVOA 3VHLB 2F6RA 2J3QA 1U8EA 1DBRA 4BNTA 2IBMA 3OF5A 3ZE6A 3ZKWA 3S2YA 1BQ4A 1BNCA 1MFPA 3M4ZA 5ADHA 4RWEA 4O2WA 3KQOA 4J0QA 3Q1LA 3GRCA 1P7PA 3QEMA 4AJHA 3OA2A 5GP1A 3Q2KA 2OV2A 2VUSA 1K5HA 5KINB 4NCAA 4UZSA 4QTXA 2CKMA 4TKUB 4DC9A 1HURA 2YN0A 4PG7A 3NORA 1ZRMA 1EB9A 3A1CA 3QEJA 4HH1A 5KVQA 4F7DA 4Y1RB 1EJBA 1HOXA 3Q9LA 4IWNA 3IYLW 3OBBA 3EXG2 5IP5A 3OPYA 3A7EA 4LHYA 3RANA 1T25A 1ZNYA 2WTEA 3THYB 1G59A 4BTLA 2NG1A 1YU6A 1O8CA 1S2LA 4NBLA 2N3ZA 3PDUA 4L28A 4OXKA 3STWA 3A6FA 5JEEA 2B2NA 4QHTA 4B4OA 3IVGA 3NRBA 4NWIA 3G7UA 2VP4A 3LQ2A 4G1EB 2UVQA 3Q9SA 3FJOA 2CNLA 4DCVA 2YN4A 3I72A 1DPFA 1Q0SA 5JPIA 4IO0A 4MV8A 4NMMA 3T0GA 1I2CA 2RFLA 1X39A 1N3LA 3CF0A 3PC7A 1YS6A 1XU7A 4QEDA 4M99A 4ZHQF 4J0CA 1B8PA 1YCHA 2NXEA 4RS4A 1SKYE 4DNXA 4DB2A 1D6MA 4KWTA 4Q7JB 5H80A 4L8YA 4J78A 1AY0A 4H60A 3TQHA 1C0PA 2C0QA 1KYWA 1QCDA 1UL1X 1C9JA 4EPXA 3AF2A 4MX8A 4JVNA 1UWLA 2G9VA 4L0DA 4R2XA 3L1HA 2Q3BA 2JJ1A 4C30A 2DMRA 3R5FA 2WT8A 1WSWA 3MWYW 1Z5WA 1SBHA 4N4AA 2JIOA 3D5TA 4E2WA 1E0KA 4NCKA 3CNEA 2ZP1A 5JANA 1GPYA 5LOVF 3MF4A 2XKKA 3PGLA 5K8JB 3AP3A 3I01A 3NT4A 3H6GA 3IQHX 4HEA1 2PUCA 4P81A 5EAIA 4YR7A 1PTJC 2Z8YM 3V6LA 3W5AA 4FLEA 2XECA 1AZTA 3ZC3A 4Q0MA 2O2EA 3OJFA 4QBTA 3RRMC 4XQ0A 2XNSA 1ZFNA 5IW8A 5ED0A 2HB6A 3MMXA 5DW3A 1F2UB 4JROA 3H13A 2A5YB 2J3JA 1IWOA 4FINA 4FCTA 5ARCA 1MAHA 2PM8A 1BMFA 1T26A 3BMQA 1K98A 4KTTE 2DX7A 3BA6A 5BSKA 5AUOB 1YRAA 1NTOA 5FORA 1EVQA 4DNFA 3H9CA 4HMQA 4XRGA 3NHWA 4EPWA 1I7SB 1NRJB 2A9RA 4PHCA 1OH7A 2QI9C 4FBGA 4EKEA 3GMTA 1U6JA 1VA5A 3UAGA 4AMVA 4BMDA 1NSFA 3DNFA 4F21A 4ISCA 2AF3C 3A1SA 2Q5JA 3L43A 1XAJA 5LNK6 2GUGA 1VFNA 3U9TA 1U81A 2QAGB 3E5HA 3H87A 4GRAA 1T29A 4J0EA 2H6EA 3QYPA 1F2DA 4DTCA 1Z0AA 2WYIA 1DJLA 3R4CA 2ZUEA 1XA3A 3I6ZA 4JK3A 1E5QA 2ZS9A 3WL5A 3SBDA 4K3VA 1SHTX 3E9RA 4MKFA 4IEIA 1Z0JA 1B3BA 2ZBQA 4FOPA 3H6KA 2D5CA 3ZE2A 4EY3A 5I7EA 2ZT5A 2APJA 2PO7A 3M81A 2PGDA 1CEYA 5A3RA 1K89A 5CB4A 4DLXA 3CN7A 1O95D 2C8JA 2IYZA 5BWCA 4HK4A 2P9UC 1SPXA 2Q0HA 2ATIA 2JJ2A 1NYTA 1V41E 3CEJA 2A1UA 1GN8A 2QUKA 1VG0B 1K3IA 3HKDB 3T3PB 4KR0A 3AJ8A 2M98A 5JH7B 2HUNA 4DBLE 1PT9A 3MZLA 4EOGA 5GIOE 2IOFK 3WTCA 1RT9A 3DAHA 1P1IA 4MLDA 3D0OA 3MINA 1DKNA 1XZ8A 3ABIA 2ODTX 4JEUA 4CIBA 1CR2A 4RADA 4QAMA 4BXOA 4Q6WA 4BMOB 4QUEA 4F4HA 5HCUA 4WIAA 3ROQA 3LUHA 1TUEA 2FPKA 2QQFA 3D7MA 5LUAA 1XYYA 3K0EA 1JDNA 2GILA 4CLHA 1FSSA 3LF1A 3Q72A 2YZGA 2A9VA 3M7IA 3BJRA 3SBEA 1H6AA 1Y8CA 2EFDB 3DE2X 2WHYA 3COVA 4Z7JA 4MB0A 2CUKA 2PM9B 4JQYA 4O5AA 2F3SA 1S02A 4UFOA 4Y2XA 3N2YA 5CG2A 2AOWA 1DKUA 2UZXB 2JASA 4AZSA 5JMPA 4IICA 1YDEA 2BJWA 3FCSB 4JXMA 5DCUA 1RKVA 2X7HA 1XJQA 1K2WA 4U02A 4QQRA 1N9GB 3P0IA 4Z4CA 1MOQA 4RGYA 1M6YA 4LXIA 1OYVA 4YUVA 3RSSA 1Z73A 3M89A 4TV9A 5A7GA 4YV0A 4MIKA 1YR1A 1VKOA 2PS9A 1YR3A 2WD7A 1OUMA 1DLIA 3GF4A 2LCIA 1QHSA 4YI5A 1Q2XA 4JXJA 4Y8VA 3G0HA 4RPJA 2HO4A 2C4TA 3NHBA 1JIVA 1RM3A 4MQFB 4K9PA 4LPSA 1VMEA 4WK2B 2OO5C 2VC2A 2XDQA 4BEVA 4D9KA 3VPAA 2WG0A 2X40A 3C3AA 5FX2A 3G2JA 1RP1A 5DYGA 1OR8A 1U8YA 2VT6A 3A6GA 4Z8LA 3SQDA 3FCAA 3HBNA 2BKVA 5GMKn 5KTNA 4N9WA 2XB9A 4F6LA 1ISRA 4PZAA 2W2PA 2WKQA 1TMKA 1V6AA 5TQ0A 2JBAB 2CVQA 1UT6A 1JKXA 3VR4D 1JQKA 4HLUC 2JCVA 2H1HA 1ORWA 4EAQA 2G0TA 4JR1A 1R4ZA 4RK1A 5H81A 4DARA 2JAPA 4BKUA 4H77A 3G13A 2NYAA 3YASA 3ZTYA 4IDCA 1FJXA 2WK1A 5FP0A 2X58A 1T1RA 1QB8A 2BHRA 2QXVA 1KYTA 4QYIA 4IMMA 3B6JA 1TVKB 1Z6PA 1G6Q1 1PGOA 3DBOB 4NV0A 2GM3A 1V5EA 4KIGA 4RTPA 2QMHA 2C8KA 4OF4A 4UJ5A 1IOVA 1OYOA 1SIUA 1I2MB 2YHAA 2FFHA 1DADA 1HXHA 2P6NA 1X6VA 2ZBUA 1RAFA 1M6WA 4A08A 4MRRA 1E62A 3CH4B 3RTAA 3RYFB 4CDNA 2H4JA 3L46A 3HNOA 1A4IA 1QHEA 4RZXA 4XYGA 3OTHA 4L8WB 4IHJF 4C6TA 4OK3A 2RB4A 2H1CA 1OGIA 2ZSAA 1ITZA 3GBVA 1YZYA 1RAEA 3LKVA 4HQ6A 4DIKA 2YJZA 3GI1A 4JHXA 3S44A 4C3UA 4G5QA 1JUDA 1PFUA 3MCWA 4YPFA 4F7WA 1I4TD 3HRKA 5KMGA 5J5VA 1U9YA 4K9LA 4XKJA 5LB2A 1R9JA 3DB1A 4G24A 1WOYA 4N3CA 1S8NA 1QH0A 4DEYA 2XUFA 3RBXA 4CMBA 1CDOA 3CZ9A 1WQ1R 1WB4A 3MCUA 2AXQA 2Y0CA 1RFGE 3RRNA 4H3VA 2BI7A 5DK6A 3TL2A 2IZ5A 2HYDA 3C48A 4C6RA 1LW6E 4CT0A 3CLHA 1MC5A 4AP5A 1FYFA 1PR0A 2OBMA 2FXIA 3L7OA 2YNMA 1NIJA 1XD8A 1QF9A 3PVSA 1OX5A 2XOKA 2GYYA 2R87A 3L4SO 3K27A 1J70A 5HDBA 3P94A 4BNFA 5B4TA 3BGOS 2JIZD 4ZEXA 4CY3A 2RG1A 3EGOA 1M5TA 1Z36A 3L6RA 3DNMA 2B78A 2B8EA 3JZIA 1B23P 4EKDA 4KVAA 4Q12A 1I94B 3Q3HA 1WD5A 4PW0A 4AULA 3EDOA 1D4ZA 6REQA 3ENQA 1E7WA 3KLNA 3ZWPA 5LQCA 3X2EA 2GCIA 3S68A 3EZ9A 4UAJA 4IQ8A 2AN9A 3X44A 2K2QB 4OAQA 4IIGA 2X13A 3N7AA 1II8A 2AC2A 3A05A 4DN6A 1OLXA 4HP8A 4HT3B 4XWWA 1XV5A 1OH5A 4P4GA 3WNZA 2JLZA 1YGPA 3AFMA 4RY8A 2GYWA 4QQEA 3OKAA 3R3JA 1XEFA 4NC9A 2I6SA 3TQFA 5JZSA 2GC4A 2HAEA 4CI8A 1PJTA 1DT5A 2HSDA 3B5EA 4HLUA 1Y5NA 2O8FB 2VYVA 3WK4A 3C7DB 3BK7A 3ZDZA 3ZKAA 1CXZA 3DTNA 1ZM2A 5JYCA 4Q02A 1MV8A 2OFFA 1XXHE 4JJKA 3FF1A 1ZN7A 3JQAB 4B6JA 4C43A 2GRJA 2DJIA 3LC7O 3UHPA 1GTVA 2CXNA 3M6MD 2HU2A 2VEOA 5J2UF 2CUZA 2YWGA 4FCVA 2SKCA 5CX4A 1B0ZA 4Z7NA 3PENA 3MHTA 3Q8WA 1K0FA 2VPXA 5F2OA 1UK6A 4A7JA 1Y1QA 3BJEA 2ZI5A 1RYHA 4D99A 4WCFC 4CMJA 3RWBA 2ZRLA 4G0XA 1EFUA 1RQPA 1DKRA 4XQEA 3BDAA 4ZAZA 2GCEA 3UW3A 1YD7A 1BCRA 3B38A 1MO3A 1FXUA 4BNZA 4GZ6A 3G1WA 3LPMA 3CB2A 3F3FA 3DBLB 4XVCA 1L5HA 3F5FA 2IEZA 4WOKA 3FRXA 2I2BA 4RXMA 3HPQA 1FC0A 1RFLA 3M83A 4QUJA 3IJ1A 1US8B 5AR1A 1CDDA 1N2IA 1SRRA 1C7ZA 3QUTA 2CLDX 4L27A 5CA1A 1T2VA 3EUEA 4LSGA 2IUQA 3Q3EA 2QG4A 4INAA 1RNLA 3T7TA 3SSOA 3SEQA 5DSXA 4EUEA 2WIGA 3ZJYA 3MPOA 4KUGA 5KTKA 1VGQA 2BH2A 1VGRA 2AEMA 1YDHA 2JFHA 1W29A 4I0WB 4EGFA 5E0KB 1P5HA 4E14A 3G2LA 4J6EA 4MAAA 2CFTA 3HDHA 2WQ8A 3UKOA 3U4DA 1SOWA 3LVQE 1YL5A 1HYBA 3GEIA 3MB8A 4R3WA 2P9LC 3FYUC 3B7PA 1O54A 3EF1A 3AFNA 2JFGA 4FW9A 5TX7A 3RYCB 5B12A 3OM8A 2Q5LA 1GKLA 5BW5A 3TSYA 1B8UA 4X90A 3V8BA 4X93A 2MU1A 2HIGA 4MP6A 4F96A 3HU1A 3T54A 2OTCA 2RARA 2C9DA 3IB3A 2I9PA 3K92A 4RVHA 1N2JA 4C07A 5ARBA 4RWZA 1MW9X 4I36A 2XWSA 3K26A 4MB6A 3ADBA 3K05A 1H85A 4Z3DA 3OH8A 4AG3A 1GCGA 3D3QA 2XGJA 2AFIB 1NRXA 3K0HA 4FKBA 3UJPA 3FGBA 3EWSA 3ETDA 5JDIC 3Q3JB 4PQYA 4W5NA 4O3MA 2J45A 3QYAA 3ROFA 3AP2A 2A1TR 3FPFA 1QFXA 4MKHA 3ET5A 1E1RD 2ZRCA 4KOEC 1KQOA 3KRXB 1XG5A 1UC4B 4ZWNA 3W5VA 3GVCA 3KRTA 2P4UA 5K0BA 5KKCA 4CG0A 3EOBI 3C1AA 1P31A 1QU2A 1C3EA 3G68A 3JD2A 4ZCIA 1W2WB 3SLRA 4YJ2B 4JASB 1Z6AA 4QPNA 5LMCA 2AYYA 2DPYA 4OI2A 1O2DA 3C3PA 1DKOA 3HS3A 4DLSA 2BF4A 4PO9A 4P7JA 1XCGB 3AIOA 3U7QB 2DR0A 3HA3A 1OLZA 4BFWA 3RTDA 4R2WA 1KO4A 4PHFA 5EHGA 2GPBA 3SLGA 5A2QA 1X1EA 1HMPA 5E1MA 3MTDA 3AJ9A 2PKXA 4C7VA 2M6LA 3N6RA 3N59A 4XVUA 3UUWA 3I45A 1QNLA 5JVDF 2IPXA 4HGRA 4IJUA 2W4QA 3COYA 3KT8A 2Y1GA 4HS4A 4Q00A 5K0CA 2O0KA 3I7HA 1IDOA 4TYNA 1HFWA 4K6CA 3AUFA 3W2HA 2G99A 3J81g 3LDUA 1UZLA 5IWCA 3PXEA 4KAXA 5JSFA 3Q3VA 5DISB 2YZNA 3H2IA 4DMMA 4ZCRA 3ABOB 5AKKA 2GM9A 1EP2B 1TEVA 3SC3A 3SZLA 2V9PA 1M6HA 4GH5A 2B2CA 2I4MA 3B2EA 1P29A 1XEWY 1ZONA 2D74A 4D9JA 1ZH8A 4EPRA 5DM0A 3L05A 3BIXA 3AV3A 4IJ6A 2OWEA 3QLVC 4ZOEA 1JQBA 3UB3A 3EF0A 1RYDA 2BF7A 2CNKA 2HMAA 4NCXA 5BMVB 3GIDA 3FKSA 4ZPXA 1RRVA 4RY9A 1KVRA 1VCMA 2WTBA 2AJTA 1ENZA 4Y6RA 2QC5A 3THWA 3V55A 2A2ZA 4D41A 2L82A 4F85A 3QPCA 5I5JA 4L2IB 5IJAA 1IZ0A 3BA1A 4DIBA 4X54A 5IAEA 2IV3A 2H16A 2GETA 1KU6A 4XXHA 5B4UA 5KSYA 3NQ41 3TIFA 4L57A 2DUMA 5L7TA 4B83A 5LD2C 3TB6A 3UAXA 1E9FA 1ZVQA 4EEZA 4QGHA 2A84A 3PXXA 1U0EA 3CZAA 3BTSA 5IAJA 2O48X 3ZXUB 4XYIA 2A3NA 4O4LA 4LG1A 2R66A 2FMTA 2R6JA 4QO8A 4GPEA 4C76A 4PX9A 5FBWB 4IGFA 4NE2A 5BUCA 3FOAA 5LIPA 3R24A 5T4BA 4QG3A 2V7PA 2IDZA 2NVUA 4PZCA 4L72A 5EJ8A 1I33A 3OCJA 4UHCA 2KMLA 4FA4D 4YI3A 2EEZA 7MDHA 2O3SA 2XF2A 4LXGA 5LQAA 1KR5A 4RPHA 1O94D 4ZK2A 2WP8J 2OJYA 4YXWD 1GQRA 3MTJA 3AL3A 3QF4A 5JNUA 3HR4A 4M3NA 2W2XA 4AKIA 1T8YA 1U6KA 4IDQA 5EJAA 4M1SA 4EF4A 3R3YA 2YV4A 1DC7A 5L53A 3PHBE 2BMDA 3QENA 4CLOB 1XVAA 4G0OA 3KSMA 2JLBA 4K6MA 1FYDA 1MRNA 4YQEA 4PAQA 2R8YA 2W6ID 1Z83A 4J7UA 2LTAA 1VYUA 1ZXLA 4X71A 4BZZA 2AQIA 3EXEB 4BOYA 4JJFA 3AHHA 3CTMA 1MW8X 2P3SA 2ZS8A 1KAOA 1WU8A 2VT2A 5EIHA 2FR0A 5G0WA 2H9NA 1R4AA 4RFVA 4W8OA 1F6DA 3U4YA 2WA1A 5FL7D 5KDOB 5F5NA 3WDKA 1GLVA 2C98A 2VUHB 2VZ0A 1HK7A 1BMDA 4X94A 1FP1D 2QRLA 3FDZA 3UUGA 3VU3A 1VE3A 1KNXA 5KX5F 2NPIA 2LIPA 5T7BA 2C3MA 5KNBH 5TMPA 3HP4A 5FJJA 4JD2C 1AQ6A 4YUZA 2XNCA 5FLYA 3AERA 3FR7A 2CV2A 5KSPA 3VXKA 2K6GA 1V4BA 5HR5A 3DFMA 1XWFA 1GJRA 4GVPA 4WOJA 4YPOA 1WB6A 2GN0A 1IHDA 4TVKA 2WWHA 1DAHA 5IHPA 4DA7A 2NUAA 2W8BA 1QIDA 4HWKA 2YIDA 3JWEA 1TMOA 2BBWA 4URFA 3OPQA 1DTEA 1E0DA 1V37A 3GLVA 1G7SA 4FOOA 4CQMD 3SJBA 1QPBA 2ZCUA 4CV1A 5LA6B 4BB5A 3AJAA 5CM9C 2GJ8A 3DUFB 4YDSA 1BE1A 2ZFUA 4QXQA 1YGYA 4DLNA 2WDPA 2C2GA 5AHXA 3I7LA 2XZLA 4NCNA 4YIKA 2DBQA 1OU0A 2OT3B 2F9FA 3NJRA 2OVQB 1PG2A 4AIIA 1HDGO 3N7UA 5EMNA 2REQA 3CEAA 3JQPA 4H7IA 3BJIC 1GG2B 3S5UA 3Q3IA 1YQTA 1EFPB 3M2PA 1UMBA 4ZA2A 1G0NA 1F2TB 3HJBA 3VHXB 4N5NA 1DG3A 4IMIB 4LZZA 3ZHXA 2JFUA 4XVQA 3U3OA 3P9IA 3STTA 3RK1A 3FTEA 5BYBA 3H5AA 5DTQA 3NCTA 1Y7TA 2GAOA 1AK1A 4KQ6A 3WQRA 4EKNB 1Q91A 2JFYA 3BRCA 4I5EA 4BNWA 3EIOA 3QOWA 1FLVA 3ONVA 3NT5A 3T95A 1DV2A 3INYA 3M9WA 4R7ZA 1Y3CE 4KDEA 1CT9A 2EWMA 4CCYA 2P11A 2YVKA 1FSGA 4I50A 5CMLA 1RSZA 1XZKA 2H54A 2EGHA 3M9LA 4REMA 3F6PA 2EWVA 4BVAA 1QIHA 4O4HB 1IJEA 4U1RA 2C20A 4LHSA 4D9FA 2ODAA 3KAJA 3N8NA 4I5DA 5FR1A 2HSGA 4D0NA 4TWJA 4HDRB 3VO1A 2HWYA 3QKWA 1T8PA 3QFFA 3RVSA 5T67A 1DWPA 1Y1LA 2BSAA 3K94A 2BIFA 3H86A 1LEHA 5EP3A 3W7BA 1IHPA 4U6SA 5ED4A 2R48A 3OHMA 3GT4A 2YKGA 3FPCA 2AFRA 2CYBA 1J0BA 3NWPA 4WGGA 1D7AA 1QGDA 4E5PA 3DVAB 2O50A 1E63A 3EY9A 1ONBA 5JMWA 1O5TA 4ZU6X 3P9ZA 3SE0A 4H7KA 2R6AA 4ZZ0A 3N86A 2GJKA 3D4NA 4DYHA 2P1DA 4AQDA 3LUPA 3MCAA 2D7DA 4DR6B 4D8WA 3LPNA 3C1TA 2HXSA 4CY2A 2XOEA 3SR4A 4P0QB 2HRZA 2OCYC 1NE7A 1QONA 4X7PA 3WOHA 2P2NA 3RW9A 1VMDA 2ESRA 1Q5PA 4FHGA 5REQA 3C6ZA 1H8EA 3AOEC 1XDGA 1K7FB 1BX3A 2OSVA 1RACA 3HB9A 4KMRA 4OFBA 4QUHA 4AJPA 4KWEA 4O4JF 4C3VA 3F1KA 1M74A 2XB6A 5HF5A 2FSIA 3DKVA 1ZVMA 5ICGA 1ZJWA 5K03A 4C7OB 1A98A 3DE6X 1NQ5A 2VOEA 2EFJA 4YONB 2W43A 3GREA 5EVJA 3RVLA 3FDJA 3B6EA 4PAGA 5FUVA 1NJSA 4LG8A 1J8YF 3GDGA 1TW3A 5B2EA 3RU7A 5D3KA 1GTMA 1XSEA 3K71B 1DEKA 2V6BA 2O3RA 3C3XA 2EIXA 4HUTA 2DHCA 5IS2A 2BI8A 2AN1A 4MYCA 2R96A 4TSFA 2HQSA 3UMYA 1WBJB 1J09A 3LLVA 1KSHA 3GLIA 3DLHA 1MHTA 3K9NA 3K96A 2PTHA 1JFRA 1DJNA 1UJ6A 2Z2PA 4ARVA 1PR5A 5DHSA 2N9UA 3MKQA 1E79D 1EAMA 2ZKIA 1T4CA 1N8NA 4NG4A 3SQLA 4FIZA 4IKEA 2X0DA 1Z62A 1DQSA 3P4UA 2R8PA 5EKSA 4KOAA 2QTTA 4IFEA 4DYVA 2FMHA 1MNAA 3U7FB 2J32A 1NASA 2QRNA 4IXWA 1VB3A 3BREA 2OVRB 4IHAA 3AJRA 4CG2A 4O2LA 3NAMA 3Q98A 3SSMA 3KOOA 1DC6A 2NV6A 3O2SB 2NT3A 4A0BB 2LXNA 3DDOA 3CUTA 4HGOA 2YH2A 5FBZA 1V45E 2JLCA 3N2KA 1Z18A 1I8TA 3IPRA 2RHJA 1RZRA 1ID8A 1WR8A 2C57A 1SNYA 3HVKA 2A5DA 1MG3A 1TUIA 3B82A 4RELA 1FYEA 3HXQA 2IYWA 4B43A 1PJ3A 3GMDA 4P4SA 3HLTA 4DR7B 4CQMB 3EDCA 2ZKLA 4QBFA 2KQUA 1TTPB 4PCUA 4IDAA 4HFMA 4RGQA 2F64A 1GQ2A 3UHOA 2P2YA 1ESNA 2Z09A 1GPH1 4R2IA 5JASA 4GMHA 1NM5A 1EFLA 4E54B 3R7SA 5BVHB 1K2VN 4MYSA 3MSCA 2CBXA 3DTTA 4LQDA 4XOUA 3ZCQA 4NAHA 4EJSC 4UPVA 2Z30A 4P1ZA 2HCFA 3M34A 3SHVA 1U8AA 2RONA 3DEZA 1QM5A 4BGVA 4M1QA 1G2OA 4L6CA 4PSAA 5TPZD 2AFHE 2JBWA 5CCEA 1E3IA 4L4UA 1HOTA 3EUWA 4BVBA 5AKGA 2NLOA 3IJ0A 5HS4A 3I4FA 3QI7A 4UI9R 1V8FA 2X1MA 1R88A 3HXTA 4REQB 5I7HA 4KPFC 4ZICA 3LCMA 4KR2A 4IUCS 3AOEA 4Q03A 1Z8FA 4MV6A 1U2DC 3KV1A 4CZVA 4G01B 1CJKC 2ABWA 2XGMA 3PV0A 3B8EA 2IWRA 4MUBA 4P7BA 3G1TA 1VTKA 3FM0A 3JALB 2C1XA 4DBLC 1SKQA 3DEHA 1FDOA 3RCBA 4D9SA 4KFCA 5DWVA 4W5RA 4ER7A 1EUDB 5FLEX 5H8WA 4O1QD 2D8AA 2FPIB 3ZU4A 5CA0B 4A16A 1VXOA 4TLDA 4HMOA 3L8HA 1E60A 1TQ6A 2DP4E 3F46A 4Y67A 5DM2A 4EG5A 2PFKA 2X1HA 2BEWA 2HI0A 5CNJA 4ZAYA 1LD3A 1L3CA 3CX7A 1ZIXA 1QDLB 1Z0FA 5FPHA 1LC3A 1M8GA 1XL1A 2VYQA 4J2OA 2X8JB 4QT4A 1G64A 3NDJA 3T9BA 3GCZA 4A10A 3QHAA 3UMJA 3I1IA 2PRZA 3KV3O 4FFOA 4NMWA 3MCTA 3WC4A 4H4EA 1W59A 3UQZA 3RIXA 4EO9A 1X15A 2PH3A 5ALGA 4LWQA 1P80A 2BMVA 1RABA 5FTMA 3H11A 2JKXA 1T9BA 2YL2A 4RVDA 1VPEA 2P6MA 3WIEA 3VYWA 4MUAA 2I4LA 4ESVA 2IHJA 2X4DA 4B17A 4YEDA 1XTBA 1F8GA 5AOCA 3O3NB 4YRTA 1X7ZB 3G6KA 3DJYA 3KYBA 2G88A 4L4ZA 3K8YA 1G3IA 5ALYA 2IBTA 1QH1A 2OLKA 4JOSA 3E9YA 3QXGA 2AHOA 4FSHA 3SZUA 2O8DB 4YCDA 4EITA 4ZO4A 3EYAA 3KSUA 1KYQA 2VSFA 1JQEA 3DHNA 1L5GA 2RGBA 1UBMS 3GLIE 3TL6A 3DBVO 3LLSA 1N0VC 2PUJA 4OB7A 1RQ2A 4CDMA 3ZV5A 5EMHA 2B99A 4EGQA 1WOMA 4LCEA 4P93A 1S9DA 4O2BB 3KHTA 4P4NA 1MUUA 4WLUA 4J4BA 1B0UA 1UBUS 3L07A 4YP9A 3GRFA 1C0LA 3ZZMA 1W8DA 3CLTC 1YRQA 1Z7YA 3BL5A 1JLRA 3B9BA 2QAIA 3HBMA 2B4RO 2CE9A 5BVGA 3OCYA 3D7NA 2X0EA 1L7PA 1S89A 4OEHA 4FMCB 4JCOA 3CKYA 2FZ4A 2J5KA 5SYMA 5BSMA 4NPAA 1FOEB 4EJSA 5J43A 1MABB 2B5OA 4L1KA 3ZDBA 1KO5A 4M9CA 2B1RA 5CGQB 5EMKA 2PUBA 1VRVA 4ZT5A 3ETGA 4C7KA 2CL7X 3IAS6 3NBYC 2BKLA 1O96A 4QSHA 5LBUA 1A1SA 3OF2A 5EMLB 3U80A 3AY3A 2IBSA 4OJNA 2ZW9A 1Y6GA 1AKEA 1U2DA 2X76A 1C14A 4C2AA 3K9LA 1NURA 2W6QA 1ZOIA 1E7RA 4ROSA 3IAUA 3MB5A 4GM3A 3LIIA 4G37A 1J90A 3AI7A 1K0UA 4ZOLF 4GQBA 3IRVA 1R5MA 2PUDA 1ZSNA 3Q7SA 2FPRA 2IV7A 4FAND 3RUFA 3RVPA 4CQLA 4MW2A 1L1EA 3QVJA 2OZPA 4PG6A 2CNDA 2ET6A 2I34A 5DXJA 4ZVPA 3U26A 1JI0A 2JFZA 3JASA 1RRGA 4RTSA 2XTNA 1QDUA 2WC1A 3ZNQA 4HGNA 3DVSX 4QPJC 1X7WA 4LBYA 2EFEB 2I4RA 5IT9g 1WSDA 2ZYSA 1FFCA 2FVYA 4JVLA 2CVPA 4NNJA 4BRSA 1LI4A 4B7XA 4K03A 3PQ2A 1I4DD 1XZPA 5EIWA 2IOHA 1J2JA 2CFCA 1RKUA 1GGEA 1SXJA