3IUMA

Appep_wtx opened state
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
684
structure length
668
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 187
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iumA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iumA01
3G9UA 4OYLA 1ORWA 4MEBA 3NWOA 1CUFA 5FPPA 3FWHA 3C43A 4J3JA 4Y2YA 5ALGA 3IULA 4GECA 4FBMA 1E8NA 3G9XA 3ZLTA 4MJ3A 5CXXA 2DCMA 5FLKA 3F67A 4B80A 1DX4A 4X71A 3DCNA 3OPMA 4KEAA 3D3NA 3DQZA 1CUCA 1CUBA 2QM0A 3EIOA 4AB1A 3WK6A 1DU4A 4AZ3A 4QWWA 5JAOA 5K3FA 3H2IA 3VJMA 1JJFA 2WSLA 4TPKA 4U2EA 1U8EA 3NOXA 2I03A 1H23A 2PL5A 1DQYA 4RPCA 3OURA 4H7DA 5AOBA 1W52X 3G9TA 2B9VA 3FYUB 3W05A 3GBSA 1BCRA 1WOMA 5AO9A 3VKFA 3FLBA 5CRIA 4RGYA 1THTA 2BJHA 4IO0A 5K3CA 6YASA 1R50A 2RHWA 2WHRA 1QTIA 1LNSA 3FVTA 4P92A 4Q3LA 4KE7A 1DX6A 1QIKA 2I3DA 4BB0A 4CG2A 3IUMA 5T4BA 2ZSIA 3STYA 5AP9A 1JU4A 1VXOA 4KAAA 5CH3A 5AKEA 5I7UA 2XMCA 3IUNA 5LYYA 1XRNA 1QIJA 2GYWA 4YK7A 3WYNA 5A7HA 5CT8A 2I78A 5BV7A 2GYVA 2IIVA 3C70A 1EXWA 5CH8A 4BTLA 4Q34A 3EBLA 4I4CA 3VXKA 1QIIA 1XZHA 4AO6A 2WG0A 2HA6A 4AMZA 4CFSA 3I2IA 2XQFA 4Y2PA 5LZ5A 5LLSA 1HL7A 1DWOA 4GLBA 2Z3ZA 3IDAA 3EQ9A 1LLFA 4QE3A 2G4LA 4TGLA 1CUYA 2XUFA 2EDCA 2B20A 2HU8A 2XUKA 1FSSA 4ETWA 4AXBA 2B4KA 3HACA 5E2IA 3FYUC 1VLQA 3DKKA 2J3DA 4WFJA 2C7BA 2Z8XA 4BP8A 3U1TA 3QPDA 3K9BA 5AICA 3UUEA 4FTWA 3OTQA 2PSHA 5ISMA 3E1GA 4BRSA 4K6GA 5ALYA 4KRXA 1CUUA 2WFLB 1Y7IA 1Z68A 5CXUA 4G8BA 4AZ0A 1QIEA 4Y2SA 2PUJA 5A71A 2JGKA 5AM2A 3UUFA 5AIBA 1HBJA 2FUKA 2PX6A 1EA5A 2ZYSA 3A2LA 1F8UA 4XWGA 4RNCA 4Y2TA 1QZ3A 3WKDA 1CUIA 1WHSA 4FBLA 1WPRA 2HRRA 4RE6A 4UUQA 4KE8A 4UBOA 5FOQA 2W22A 1CLEA 3W2TA 2G5PA 2RHTA 4UHBA 1ZIXA 5JATA 3AFIA 1UK6A 2DHEA 2XMRA 2J4FA 3C87A 4NMWA 1XZAA 5HF5A 4Y7DA 3T4UA 2QUAA 3DYIA 1LPAB 1XQYA 5AJHA 1VE7A 1J06A 1ZJ4A 3I1IA 2WUGA 1NX9A 2BGRA 4FHZA 1ZI8A 2K2QB 3G0CA 3MVEA 5D6OA 5AOAA 1CUJA 1A8UA 2P8SA 3FYTA 3BIXA 3R3UA 5HK9A 3KDAA 2CB9A 2CKMA 4G4JA 2QMQA 2ES4A 4OB8A 3I2KA 1HQDA 2RGUA 4CI9A 3BIWA 2OAEA 4FNMA 3I2HA 3O4GA 5SYMA 4OU5A 4E46A 4QDOA 5HKBA 3H0CA 1GPNA 2WJ4A 4K6HA 5ALEA 4M0EA 3FLAA 4C4XA 4ZRDA 4DNFA 4UBIA 1CUZA 4AX4A 2QR5A 2PU5A 3F96A 4JNCA 3ZLUA 2WLSA 1G4HA 1FFAA 5HF8A 3FNBA 4PQEA 2O2GA 1JI3A 5JARA 1FJ2A 3QPCA 1W76A 5T4HA 5I8PA 1ZJ5A 4FLEA 3RKSA 4MWSA 4BE4A 4BE9A 5K3FB 3D2AA 3H2KA 2C5GA 2VAXA 1ZGBA 3JWEA 1B6GA 1F0NA 3BXPA 3AINA 3L1HA 4WJLA 2RONA 2OCIA 3QVMA 4BZWA 4AMYA 4UBMA 1CIJA 2GBFA 1ACLA 4GXNA 1GKKA 4K5QA 4BDSA 2XMQA 1O6FA 2V9ZA 4A5SA 1SC9A 3A6ZA 4NZZA 4ARAA 4DSAA 3I2GA 3WQHA 1YAHA 1R3DA 4E15A 2IX9A 2ZVDA 3FYUA 3DYVA 2JEZA 4OU4A 4FNGA 4Q3KA 1AKNA 4L72A 1YB7A 2XMBA 3D7RA 4WFIA 3FSGA 3HC7A 4MYDA 1CPYA 5JYCA 2BCEA 2GZRA 3QZUA 1MT3A 1YS2X 3L1JA 3C5VA 4KACA 2XDWA 1OCEA 3AJAA 3M83A 1TCCA 1TKRA 5ALXA 3QM1A 5DYTA 3ESAA 5T4FA 5AKYA 4EBBA 5CW2A 3FVRA 3Q0TA 1WCYA 4N8EA 2JGMA 3A2MA 4C4YA 1LPPA 2VQ6A 4H7JA 2VEOA 1CUAA 4BBZA 1XZBA 4IQ4A 5JANA 2DHDA 1F6WA 4DLNA 1XRLA 1TCBA 3R3WA 5K5EA 1CFJA 2HM7A 2WHQA 1LZLA 4B83A 1CVLA 1ZI6A 5CBKA 4XIIA 1BN6A 1EDBA 1VOTA 1VA4A 1TQHA 5HF9A 3I1YA 3TRDA 5E4JA 3ESDA 4WY8A 3C8HA 5FKJA 5KWJA 4C6HA 3QH4A 2CZQA 2OCKA 2YXPX 4W63A 2PPLA 1ISPA 4UBNA 4M0FA 3RK4A 3ESCA 4EY6A 5JD4A 3Q8WA 1JJIA 2X8BA 2QZPA 4J7AA 2VTVA 3O95A 4FDMA 3HEAA 1EB8A 2H7CA 3G0BA 5C8VA 3H2GA 4UBKA 3STTA 3AZQA 5HFNA 3WK7A 1MJ5A 2WUDA 1UFOA 4OB6A 1G5FA 4Y2RA 4BRZA 1N1MA 1GGVA 1UOOA 4N8SA 4DYHA 3ANSA 2AJBA 3DJYA 4B7ZA 1DT3A 1YAJA 4HXEB 2YASA 1K5PA 1R9NA 2XQJA 2VJCA 3FAKA 3PUIA 4DSZA 2PSEA 1E3QA 3G0IA 3KWFA 3E4DA 4EY7A 1XZCA 1CUVA 1NU6A 3G0DA 5CT5A 5ALTA 1N5MA 4ZXFA 1CUGA 3LIIA 5ALMA 1MNAA 5EIEA 2GYUA 1Y7HA 2C0PA 2WU3A 4LYEA 2XUHA 3GFFA 5AKLA 1THGA 4WDRA 4G1FA 2XE4A 1CV2A 5D7BA 5FP0A 5JAPA 1XRPA 4J0KA 4G5XA 1YSCA 2JBWA 3R3ZA 4U2CA 5IKXA 1AGYA 1VXRA 4X97A 5JALA 4PSDA 5EIHA 1I6WA 3HABA 4IH9A 1FFEA 4HXGA 3NUZA 2O2IA 3WJ2A 2EEPA 1RWQA 1SCQA 2BKLA 3HYSA 4CIAA 1XZGA 1EHYA 1RP1A 3WK8A 3STVA 1P0PA 1WB5A 1GZ7A 5ALLA 1H2XA 4I19A 1EDDA 4G9EA 5K3DA 1ZD3A 4PV7A 2D0DA 1IUPA 2QUBA 3O9VA 3D59A 3S8YA 5HCUA 2WJ6A 3KD2A 3T52A 4DMCA 5KWIA 3SK0A 4P08A 4Y2VA 1QTRA 2EDAA 2BUAA 2QT9A 3R3YA 3PE6A 1XZKA 5HQ3A 4F5ZA 3O4HA 3M3DA 3FLEA 1XZFA 2VJDA 1P0IA 5FDFA 5LZ2A 3HI4A 2RI6A 2VJAA 5BOVA 1R9MA 1WB4A 4J0HA 5YASA 1R4ZA 1DINA 3WL6A 2H9YA 1E89A 1ZOIA 3WZMA 1UOQA 3JW8A 4F0JA 1QIHA 1AX9A 1KU0A 1AMNA 2YH2A 2Z8ZA 1MX1A 4Q1VA 4GBGA 4JUIA 3DS8A 1VA5A 4DM7A 3H2HA 4EY4A 5AI0A 1K6EA 1IZ8A 1AC5A 1QFSA 5ALSA 4B85A 5CMLA 1DWPA 4L3WA 5AH0A 2JEYA 2ACKA 3HRHA 3SWWA 5JAHA 1HPLA 3VJKA 2XMSA 5DTJA 3WWOA 5EIAA 5H3HA 4X94A 4BAZA 1DQZA 4DMKA 4A16A 1A88A 2WTNA 1SFRA 3C5WP 3OG9A 1EK1A 3WL5A 2RAUA 5DJ5A 3GZJA 4J0GA 2OXEA 2ROQA 4H18A 3RM3A 4KE6A 5JADA 5LKRA 1WM1A 2JGJA 1GKLA 4UFOA 4YASA 4F21A 3M82A 4Y2QA 2HFJA 3R3VA 4PW0A 1JJBA 4IH1A 1HDEA 2OCLA 2PKYX 2Z3WA 2ZJFA 5DNWA 3IURA 2I3ZA 3ANTA 5CTAA 1C7JA 1AUOA 2WILA 4FMPA 5AK4A 4JYMA 2AXEA 4F60A 2Y6UA 3BF7A 3AIMA 3V48A 1XRQA 3O4IA 1MTZA 2ECFA 2DR0A 4RE5A 2HA7A 3H04A 1UZAA 1UKCA 1XZJA 4J0IA 3WKBA 5K3BA 5JD5A 3FBWA 1YCDA 3PFCA 1ETHA 1A7UA 1B41A 1DTEA 2OAGA 2QTBA 1IZ7A 3VJLA 3QBJA 3G9ZA 3WKEA 5AM3A 4MYSA 1N5RA 2XT0A 1YA8A 1E66A 3F9CA 4OUKX 1A8QA 4ZREA 3IVMA 2WUEA 3WJ1A 2LIPA 4MWTA 3PICA 2J3QA 5LP1A 2OQIA 4LXGA 3ZPXA 2O7RA 3PDCA 4BVJA 3C6YA 4CG3A 4PSUA 4C01A 4XJVA 3KWJA 2J4CA 3BDIA 5JIBA 1H2ZA 4LKOA 3H1BA 1AQLA 5C7YA 4JYPA 4KJXA 3H2JA 2XUIA 1XLWA 3FCYA 1GQRA 5BWBA 4S0XA 4QA9A 1CR6A 2JGEA 1JMKC 2RIPA 3DOIA 5ALHA 1XLUA 4Y2XA 5FPQA 3AIOA 1QOZA 4KRYA 1XROA 4YX9A 4BVKA 2CBGA 5ALZA 5EHXA 2H7XA 3C8DA 2QXTA 3H17A 4UHFA 4QDTA 5JZ9A 4FLFA 4BP9A 3BL8A 3C6XA 3D2BA 2WU4A 4ZV7A 2WKWA 5HK8A 5AHXA 5A2GA 3CN7A 3PFBA 3BJMA 5ALWA 5C8XA 4QDZA 5ESRA 5ALRA 3A70A 3I2FA 1VJ5A 4LIPD 3FOBA 1DWQA 5AM5A 2ZJ7A 3LP5A 3ICWA 3MGAA 5AKHA 5HQ3B 5CT6A 5DTIA 4BCBA 3WYDA 1AZWA 2PUHA 2OG1A 4DIUA 2WTMA 1ODSA 2OQVA 1ZD2P 2R11A 5ALJA 3GUUA 3OM8A 2JGLA 3WKCA 3L1IA 2AJCA 4MXDA 5CH5A 1FFBA 3D5EA 4NS4A 4AO8A 2AJ8A 1H2WA 1XZLA 2JF0A 1HLGA 1MNQA 5A7GA 4A23A 5I9IA 1QIDA 5C81A 1YA4A 2WIDA 3LS2A 4AO7A 5HF6A 1UK9A 1W75A 2QRUA 3K2IA 4C88A 3F98A 5CT4A 2H7YA 4UFNA 4YPVA 4UBLA 2WHPB 5LZ9A 1DT5A 4W9RA 7YASA 5EFZA 2VA9A 1XLVA 1YASA 4X95A 3G02A 4X6XA 5EHZA 3K6KA 3SX4A 4U2DA 1ODTC 1BEZA 4H7KA 2XLCA 4X90A 2BAGA 1EVEA 1U65A 3MUNA 1EDEA 2QJRA 2WG1A 4X93A 4Q3OA 2X5XA 4KR0A 1UK8A 3QMMA 3F97A 4B0PA 3I6MA 2JIDA 4E14A 1NU8A 4OSEA 5E4TA 3LIPA 4H77A 5AM4A 4ZWNA 1BROA 2OLEA 1CUHA 4OYYA 5IVDA 2HIHA 5AK5A 1EK2A 3WA6A 4G9GA 1UOPA 1JKMA 5IVKA 5K3EA 2XUQA 1M33A 2XQGA 3PF9A 5FRDA 1Q83A 2ZSHA 3LCRA 3BDVA 3WK4A 2QJWA 2QS9A 3WZLA 1D07A 2HDWA 2QXUA 3G0GA 1VKHA 2HRQA 5DNVA 4BYMA 3YASA 3ZI7A 1ZGCA 1C7IA 1GPLA 3D2CA 1CUDA 5EI5A 1LPMA 1JFRA 1O6GA 1QGED 4C89A 4O08A 3DL4A 5F4ZA 5FV4A 2OGSA 4PNZA 5ALOA 5EHNA 2XUOA 5FUMA 4V2IA 5D3KA 4MQMA 3NGMA 1TRHA 1K63A 3IBTA 4GI1A 1X70A 4D9JA 2C58A 2HA2A 2WIGA 3WWPA 1QE3A 2GZSA 3OOSA 1C4XA 2GBGA 4CCWA 5ALQA 3G7NA 2HFKA 1LZKA 3I6ZA 4LYDA 3QMVA 1EI9A 1Q0RA 4EY5A 2VF2A 2XUAA 5FXMA 2XB6A 1UWCA 1X2EA 1XFDA 2PVSA 3KOOA 1N8SA 4HRXA 2Q0XA 2ACEA 4UHCA 1CQZA 1VZ3A 2E3JA 1L7QA 4IHAA 5IH7A 2BGNA 4B9AA 2BUCA 2ZYIA 4J03A 1VE6A 1QIGA 4H7IA 1ZI9A 2JGFA 1TCAA 4KAJA 1XRMA 5EGNA 4OCZA 4KAFA 1VZ2A 4XX1A 3IIIA 5AKIA 1CQWA 2VT7A 1PFQA 4H7FA 1PV1A 2VATA 1BS9A 4OB7A 2AJLI 1ZD5A 1LPNA 4K6KA 4LHEA 4EB0A 2OGZA 3WI7A 1P0QA 4ZGBA 4HZGA 2DSNA 2WFMA 5A6VA 5K3AA 2ZYHA 5AM0A 1XQWA 3DEAA 1EX9A 4AN0A 3WWCA 5JASA 1EINA 5LKAA 1JT2A 3W9UA 1LPSA 3WWDA 4HS9A 3O0DA 1W4LA 3WL8A 5AKZA 2DHCA 3P2MA 4Y2UA 2PM8A 5LIPA 3E0XA 4X6YA 3W06A 5AK6A 2C4HA 3WMRA 3C6BA 3TJMA 3ZLVA 2WM2A 4HXFB 1ZIYA 1E8MA 4K2AA 2WG2A 4CCYA 5SYNA 1QO7A 4MQLA 3VDXA 1R1DA 1T2NA 2XQIA 3OC0A 2G63A 4AN1A 1YS1X 4GDMA 3AZPA 4PF1A 4N5IX 3FCXA 5ALUA 1LGYA 5KBYA 2H1IA 4I3FA 1WB6A 3UMJA 2OCGA 2PU7A 1Q0ZA 2XI4A 4EZIA 4N8DA 3CCCA 1XZDA 3VVMA 1XZEA 3RLIA 4KYVA 4PO3X 1BN7A 2C5FA 1L7AA 4AQDA 3WWEA 3IA2A 1G42A 2W6CX 4Q05A 3QPAA 4HVTA 2XMDA 3SC2A 3N0TA 3R3XA 1E5TA 2WHPA 3IB3A 2OGTA 4WDQA 4J0DA 3DOHA 3PUHA 3JYHA 5AKKA 1MX5A 3AILA 2HA3A 4L9AA 1TK3A 5D3ZA 2HU7A 3HJUA 1A8SA 4UHHA 1LPOA 3WIBA 2GBIA 3IUJA 1IUNA 2BFNA 2Y6VA 2WIJA 4ITVA 4DMHA 4EA6A 4WCVA 1AURA 4BCCA 4X00A 2XMZA 5IVIA 1FFDA 4KE9A 2QOEA 4W1QA 5HFAA 1XZMA 2IITA 4OD0A 1QLWA 1J2EA 3HZOA 1BE0A 2HA0A 2G5TA 3EQ8A 5C8ZA 5AI6A 3V1NA 4JEIA 5A7FA 1MAHA 4X7BA 2OPHA 4QEKA 3IUQA 2C0QA 2Y2VA 1JMYA 5AI9A 1F0PA 3STUA 2CJPA 1QIMA 1H2YA 3V1LA 4U2GA 3V1KA 4G8CA 1XKLA 3AZOA 1CUSA 1GQSA 2XMGA 2XLBA 2B61A 1UKBA 1XZIA 4ZV9A 3R40A 2VAVA 4N5HX 2WIKA 3QITA 2FJ0A 4LXIA 5AOCA 3BF8A 4IH4A 3O4JA 4WY5A 2XUGA 5CURA 5HZGA 4FWBA 2PSJA 3BWXA 3H18A 1CUEA 2HA4A 3M81A 5LZ7A 1X2BA 4FFVA 4C87A 4HAIA 4C4ZA 2V97A 2DQYA 5J3JA 1K4YA 2WFZA 5AIAA 5ALDA 1XKTA 2V98A 5LZ8A 2XUPA 2JGIA 1CRLA 4W1SA 4GEGA 1T4MA 4LXHA 4FOLA 1WPXA 1JU3A 1EVQA 3QMWA 1MN6A 2YYSA 4G4GA 4B0OA 5ALPA 2PSDA 2HA5A 3ICVA 4Y9SA 5HKAA 4P9NA 4INZA 2O2HA 5AK3A 4BZZA 2D5LA 4H7EA 1OXMA 4BAUA 2VSQA 3B12A 4WFKA 1W1IA 4NVRA 1G66A 2AJDA 2HHAA 4BVLA 1Y37A 5JD6A 3G8YA 3GELA 4ROTA 3EF3A 4EHBA 1UK7A 3CXUA 4CIBA 2HL6A 1QONA 3DLTA 1SCKA 5A62A 1K8QA 3TEJA 1ACJA 4P93A 3DD5A 1UKAA 4UPDA 1EB9A 1BU8A 3STWA 2Z5GA 3DL7A 3TGLA 3WIOA 2XUDA 2WQZA 3STXA 1XQVA 2Y2UA 5JZSA 4Y2JA 5ALNA 2ZJ6A 4JH0A 4BCDA 4QWMA 1FFCA 5DLPA 4X6UA 4X92A 4CCYB 4FKBA 4HTAA 3HLKA 4BDTA 4BC0A 4J0CA 3PI6A 4X91A 1KU6A 2PSFA 5AKXA 4DGQA 3CN9A 1ZD4A 4QZVA 1U2EA 5AKJA 1TIBA 5IVHA 3ESBA 1UT6A 3BJRA 5KREA 1MPXA 3B3QA 1GXSA 4H7HA 1RYYA 1IVYA 1S8OA 5DYYA 4XVCA 2WJ3A 3WL7A 4B84A 2HU5A 4DTCA 4B81A 4GW3A 4EUSA 1ODCA 4QLOA 3BE8A 5AM1A 1BEEA 3ILSA 4CG1A 1WHTA 2PBLA 4BAGA 4UBJA 3R41A 4ARBA 2XQKA 1BCSA 4FFWA 3V9AA 1MX9A 1EH5A 5ALKA 4Q82A 1XQXA 1CEXA 4GWLA 2O7VA 4GHWA 5AI4A 2NW6A 3FSGD 2CEKA 3HSSA 1J07A 2Y1KA 3PF8A 4EY8A 2WIFA 4HRYA 2BUBA 3C6ZA 1U4NA 3H1AA 1GT6A 2VT6A 1YB6A 5BWCA 3VVLA 3HXKA 5JAUA 3WK9A 3LLCA 4FLMA 3ED1A 3WLAA 2UZ0A 4B6GA 3GA7A 1L7RA 3DKRA 5T4EA 5DWDA 3AUKA 3ZWQA 4X3CA 3CCBA 4L0CA 2FX5A 3I2JA 5JZBA 4MEAA 4QNNA 1HKHA 4DNQA 3B5EA 3N2ZB 5DYWA 1YR2A 4B9EA 1XRRA 3I28A 2CMFA 1H22A 3KSRA 4TVKA 2DQZA 4U2BA 1QIFA 2QVBA 2VJBA 1SCIA 3W9BA 3C45A 3RARA 2CUTA 4QDXA 4X85A 1IMJA 3DDUA 3S2ZA 4H0CA 4M0MA 1QO9A 1LBTA 1GPKA 3O9MA 3EQ7A 4UHDA 3E3AA 2DFPA 3I6YA 4OPMA 2ZYRA 4ZI5A 5CT9A 3A2NA 4J0JA 2HADA 4BC1A 3W04A 4G8DA 1UXOA 4DMFA 2WFLA 3WK5A 4H35A 4E11A 4QLAA 5AI5A 1LPBB 3ZV7A 3X3HA 4W1RA 2XUJA 2R8BA 1W6RA 3WKAA 2V96A 2GBCA 1MO2A 4B82A 5DNUA 3F8SA 3D4LA 5LZ4A 1CUXA 5AKGA 1MAAA 3DNMA 3V1MA 1QFMA 4PSCA 3U0VA 1PJAA 4G4IA 4UFPA 2ORYA 1P0MA 2QKYA 1TAHA 5ALVA 4W1PA 4DNPA 1CUWA 4BATA 1Q84A 1USWA 5E4YA 4UHEA 5AI8A 3VISA 3QYJA 3MUOA 1IUOA 3AIKA 4Z49A 1MU0A 3GROA 2WUFA 3R0VA 1QJ4A 3KXPA 4DNOA 3WA7A 4U2FA 2ONCA 4QDUA 1ORVA 1LBSA 3H19A 1OILA 5ALIA 1R88A 1BRTA 5EHQA 1J1IA 1E8DA 1KEZA 5ALFA 2FJPA 1SOMA 1ZICA 3D0KA 2X76A 4BTVA
chains in the Genus database with same CATH superfamily
4FFBA 4IUBS 1IWBB 1ZXLA 3AF2A 4IJKA 3LDHA 5K3OA 3SZ3A 3I7LA 1JDPA 4OGGA 4Z9FA 4HRAA 3CSUA 1RPNA 2I7CA 2WLTA 1SCAA 1T0JB 1NXWA 1SK9A 4KV9A 1U6JA 4OA8A 2J32A 4EENA 1HORA 4F3YA 4Q4JB 3X2SA 2YL2A 1PBYB 1GPYA 4ZVVA 1ETUA 4ZOBA 4L5BA 3RVQA 4NBTA 2B36A 4K87A 1BCRA 4NHOA 1X87A 2UZYB 1WOMA 3FLBA 2FOLA 3AF4A 5CGZA 5KINB 5K3CA 5KB3A 4CT5A 3COWA 2GXUA 4R8KA 2DWCA 3GHHA 1SXIA 3GO4A 1JHDA 4BB0A 3L5OA 1YK1A 3N87A 1WP4A 3QVJA 3PJEA 2OP0A 4PFSA 2GZDA 1E3SA 3R7BA 3ZK9A 2PKQP 5AVOA 2JASA 4FFMA 3SEFA 3EMDA 5L95A 5AUPB 3D6VA 1VPVA 4KSBA 4TT3D 2I91A 5DIZA 5FHRA 4AMZA 4PYOA 2JZOA 1ECFA 3EEOA 1LLFA 3KZ1E 5KVQA 5DHTA 4CTJA 1M2FA 2FU5C 4KX3A 4AXBA 2QRZA 4L5CA 4NJOA 2X1MA 4FYWA 2GQ0A 3W5VA 6CHYA 4P34A 1E0DA 2FEMA 5KYKA 5BSKA 3QTBA 4R54A 4JJ8A 3U1TA 1E0AA 3H5VA 1P9LA 4FTWA 2IJGX 2YMMA 1FQOA 1PZEA 1P5HA 1CUUA 1Y7IA 4MULA 1G20B 5TRTA 4HPWA 3QVTA 1B74A 3EZGA 4MWGA 4R31A 2CV2A 2FW7A 2MHCA 2GZ3A 5DU2A 3BCSA 2GKOA 1W0CA 4QTZA 3RVNA 4PSVA 3RV3A 2DEUA 1O5OA 3HO8A 1HZZA 1VG1A 2Q5OA 4KHPB 2HZBA 1WOYA 2VNAA 3PITA 2CK3D 4O3FA 1V3VA 4HMOA 4CJXA 2ONZA 4BJ3A 2YOFA 2WSMA 4AJOA 6ADHA 1BJTA 4U7GA 3K9GA 2IS4A 5HK9A 4G0WA 5K8UA 1R64A 2GGSA 4B2LA 1MBZA 1D8AA 3DAGA 4DSNA 5DNDA 1QGUB 2CJXA 1Z6YA 2VDRA 3LP6A 3Q9SA 1VHWA 3CTMA 3JYNA 4MZDA 2ZIXB 2H5JA 5BW8A 5EYPB 4CTOA 4CTKA 5CB6A 2PMCA 1I2ZA 3KUUA 1F2TB 2R5FA 1MJNA 1O9GA 2VCEA 2X7HA 1Z34A 4D9MA 5ITZB 3Q7EA 2ZR7A 5B7GA 1DGQA 1U3GA 1YQWA 2AN3A 1QB8A 3PUJA 4UNNA 2J4DA 1LCIA 3PWSA 3KXLA 3ZWAA 4HO1X 1XG5A 2GBFA 5BUQA 1ZGJA 1OTXA 1SC9A 4IIJB 3MF4A 3W5AA 2GPYA 1YAHA 2IX9A 1RKBA 3F46A 4OL9A 1XTBA 3F6PA 4RPGA 2CHUA 3W3AH 1YB7A 2AVDA 4MV1A 4WFIA 3O82A 4PYIA 4RHEA 4C04A 5GMOA 1ENPA 4BFXA 3X1YA 5I9SA 3K1AA 4DLKA 3QOXA 3AJAA 4O3TB 1RPJA 4IXMA 5BV2P 3IO3A 2DUJA 4QGSA 2VDQA 1T2CA 2FFAA 3PZRA 2JNWA 5IH3A 3PEEA 1C3VA 2YZNA 2H68A 3EU7A 3CH5A 4N8EA 5ES4B 1ULTA 4NZPA 4BBZA 4O4IA 3H9GA 3GG2A 1NW6A 3HYCA 4IRUB 4EFMA 5K6AC 1EDBA 2ZI3A 2Z6VA 4B09A 3ZOKA 1GGHA 4F7DA 4HBZA 3ESDA 2X6QA 2ZSJA 5FKJA 3Q8LA 2VQDA 2DWQA 4TQUS 4RTPA 3QVSA 4QYIA 1HDCA 4JXXA 2QW1A 1PQYA 2LXNA 3C3JA 1UBRS 4W63A 4MB6A 2QTAA 2AG0A 4QGGA 3TPCA 1JJIA 4EF5A 5KNDD 4PLGA 3D1VA 3AJEA 3U4QB 3BWMA 3OKPA 4N12A 1ADJA 4IQ0A 4G56A 1KI7A 3BMCA 5BWNA 4BRZA 1FCJA 1CZRA 2OZKA 5GONA 4OH7A 2JI9A 1BPOA 3A6DA 4B7ZA 5HGJA 4FAND 1KJQA 3ADDA 3JYOA 3VFDA 1K0FA 4X65B 2WT4A 4H6WA 3I6IA 2E5WA 1SUDA 3LIIA 4OZUA 1IXYA 3GFFA 4BRUA 2OHJA 2V74B 1ZXXA 3V3TA 3RSQA 2K2WA 1E1NA 4AF7A 3HMQA 2RMKA 4WINA 2FP4B 2VJOA 1I6WA 3IV7A 1E2NA 3FPLA 3IPLA 3Q8XB 4I5FA 4MX8A 4AROA 4ZT4A 1DAHA 4FGLA 2IY7A 2IXAA 4DVGA 1UCFA 3STVA 3E4CA 3ETNA 2VRNA 1GZ7A 3PR3A 1XZPA 3SEQA 3UMYA 1EDDA 3UYKA 4XJXA 2VPYA 1F1BA 4PV7A 1IUPA 2EJBA 3DNPA 3D59A 3SOZA 4EJFA 1PK8A 4UAJA 4B8WA 3IQDB 2B4QA 2Q8PA 1NUAA 2R2AA 3L7CA 1XZFA 2PD6A 3H42B 1Q1NA 3KCNA 1QG2A 4MKRA 3Q88A 4MS1B 1B26A 4FYJA 4KXUA 5AJXA 4BQSA 1OBCA 4A0AA 1DBPA 4US2R 5J2TA 3CRW1 2V6MA 2P68A 4MUFA 1EGAA 2O5CA 2QG9A 2ZBQA 3DE1X 3EBOA 2H07A 2JAPA 4JUIA 4DM7A 1NMYA 1K6EA 4PG4A 3H0KA 1STOA 2VL7A 4NNPA 3SWWA 2YICA 1U8YA 3IAHA 4OHFA 3C3CA 1R0CA 4IIYA 3E8XA 3GA5A 2I8LA 2RAUA 2NP6A 2Z58A 1H2EA 2Z43A 4BNYA 1I9CA 2ACVA 1WM1A 1JAZA 4RHCA 4JQOA 4Y1EA 4PW0A 3VVBA 4CHTA 1I7DA 4YRDA 2N0SA 1SQGA 3VAAA 1I94B 3B13B 3VI4A 4JYMA 3MOGA 1PQ4A 6Q21A 2R0QC 3RUPA 1U1EA 1ZCZA 1U2ZA 4LUCA 3UB3A 3ZTTA 1JZTA 2HA7A 1KWKA 4B5KA 4CI2A 3D0QA 2WWXA 4ZQGA 1UKZA 3BD6A 4R68A 1UTCA 4P35A 4IV0A 5F7XA 1RBZA 3HU2A 3WLTA 2YMUA 3VJLA 2D06A 1X1QA 2Y3IA 1CS0A 4I7EA 1DBIA 3R6DA 3WBBA 3WJ1A 3NH9A 1JQAA 4JI4B 1P5ZB 5BVGA 4QEDA 3V9PA 4MP6A 3W2HA 4CW7A 3R7WA 4N6NA 4FYPA 3BOSA 3SQOA 2HEGA 2P9LC 3O4FA 3KE8A 1GSOA 3NTOA 2QHXA 1GR1A 2XGGA 1DELA 4Y9DA 1CR6A 2ZBUA 1QVZA 1MHPA 3DVAB 3GCGA 1XLUA 1A7KA 4UCXA 5HIAA 1P75A 5FIUA 2ZIFA 3A3KA 4TVSA 1DKPA 2EF0A 4ZQBA 4PGAA 3E9CA 2X77A 4UHFA 4ZQFA 2QLMA 2Z8YA 4FI3F 3K16A 1EQUA 4C0QC 4KUGA 4P4UA 5KVAA 3LG2A 2OILA 4PFJA 4WK6A 1W7AA 2W71A 4DUPA 4YR7A 1DWQA 1ADCA 1DJQA 3L79A 5G4KB 1RQ7A 3MS4A 2PH1A 4BNXA 2R6FA 2WTMA 2YC4C 3CKMA 2O8VA 1AZSC 2QD1A 4P0QB 2H14A 1CW2B 5AJUA 4RTKA 1O94D 2G83A 1D2GA 1PG0A 2NZUG 4B3FX 4DT1A 4BFLA 4CMAA 4AJNA 1MNQA 5A7GA 5I9IA 1QIDA 1UL1X 1Y48E 3LS2A 3X2FA 4C5CA 2BMAA 5FBHA 2XX3A 1W75A 3R74A 3ZE1A 1P81A 1UEIA 3PLRA 4HNGA 2J0UA 5C18A 1WRBA 4FB5A 3TZBA 4IHKA 4M9UA 5EFZA 3DWLC 2KW5A 3PFHA 1DUIA 4DIEA 2QY6A 5C34B 1YZVA 2OV4A 3TUJC 1B9XA 5G0VA 3OIYA 3EH1A 2I8AA 4M53A 2O6LA 5E4TA 2OKGA 1PR5A 2OLEA 1F06A 5IVDA 3LNCA 5E9JA 5THQA 5E3IA 4ZP1A 3DPSA 4XDGA 6ABPA 4QM7A 1B8OA 2JFUA 3LPAA 3J7AC 3AKCA 3QYFA 3KEMA 4EYQA 1TQDA 1VJDA 4EHHA 4BYMA 3E53A 5LXTF 3YASA 1VSQA 3OKFA 3AEQB 3HEMA 4MUAA 3U4MA 5A3QA 5B4TA 1CR0A 5ITSA 4ARCA 3JB9L 3VYTB 2A92A 3WL4A 4CNQA 1CWUA 3FRJA 4ZT5A 5FFFA 1QQTA 5ALOA 5L7YA 4UVHA 3TTYA 1EXDA 3HH8A 1OYVA 4V2IA 3QW4B 3VR5A 2Y4OA 4K46A 3W4JA 4D9EA 2Q07A 4GI1A 4ZAFA 2HNAA 1KIMA 1O0BA 1GD1O 2O8BA 1V1MA 1US8A 4OK3A 5JDIC 2QENA 3LUAA 4FQ8A 5CBPA 2VF2A 1QYIA 3TNDA 3W5CA 3INTA 4Q00A 1XFDA 1JQBA 2IDMA 3MCTA 1LBIA 2FVYA 3C39A 4H3VA 4IG9A 2R47A 4J03A 2J3HA 4OAPA 3BG0A 2Z2JA 4A0HA 2Q7OE 4EX7A 4LFAB 3ZZUA 3IBYA 4BJ1A 3EIXA 3R5FA 1NNEA 4KQ1A 4TKUB 1WZCA 4ZCLA 2Q49A 1N0VC 5HE3B 5I5MA 5I4KA 3B9PA 5JNSA 3I7NA 2VYNA 4OHOA 4BN4A 1U9IC 4HZGA 5IKMA 3KT0A 4J0WA 2G71A 1AH2A 4DV2B 1RHJA 4L3OA 2GMWA 2A33A 3P2MA 1PX2A 2XB9A 3PVUB 4X6YA 4QGAA 2ON6A 4DHEA 4YDHB 2GXAA 4FGJA 1SUSA 3ADPA 2O2ZA 3USZA 3HGTA 1CHDA 2PIDA 2JPDA 3J80g 2C1EA 2D5AA 4I8DA 5GIOE 4MQEB 4LHZA 3KHUA 4CI8A 4JNKA 3EXEA 4PBSA 3L6OO 1CF2O 4L8LA 2NUBA 1MRNA 3OEEA 1KJ8A 3RWMB 3D4OA 2R62A 1WMFA 3BXXA 2JRLA 4HTFB 1QWSA 1L7AA 1J97A 2AH1A 1KFEB 4PYMA 5FA5B 4A5OA 5D5HA 1HLDA 2FEKA 3N0TA 2B7BA 3EF0A 3OZGA 2P9JA 5LLTA 1E9DA 1LPOA 1DG1G 4ITVA 4L07A 3DZHA 2XMZA 1KK2A 2EP5A 4FN5A 3OESA 3TGPA 1BXGA 1PUIA 1BE0A 3ZQJA 2NT3A 1E7RA 3HEBA 3KQOA 2FDXA 3DE3X 3V1NA 5ICMA 1M2JA 4BNTA 3O1IC 3EBPA 1XAGA 4IIXA 3VU0A 4MA0A 2VSOA 3GJ3A 1SU6A 3W1VA 3GT4A 5BO5A 1EE1A 2I4OA 1T4CB 1C0PA 1WW2A 1PJTA 4JC5A 3I8CA 1L5HB 3T5AA 2VDMB 1ILWA 1OBVA 1IY1A 4MR7B 4KDEA 5H1MA 3UG6A 1NLUA 2G72A 5BXQC 4ZPJA 2ZKLA 1PLLA 2NP7A 2DTEA 1CJSA 4JYBA 5CFOA 4B2PA 1TMYA 1E6UA 2AF3C 4L78A 3DB1A 3O7WA 4GC5A 2WZQA 2WC1A 2HGSA 3N8IA 3HJAA 1U8CA 3AH8A 1G2PA 4QOIA 3B6KA 2CC2A 3NDPA 2JGIA 1TTTA 1JMXB 1Z73A 3W4IA 1FE8A 4EL0A 1C1DA 2WDPA 3RC3A 4TQAA 4G4GA 3OO0A 5J4VA 1C9JA 3GP5A 1C7QA 3OPYI 1VHTA 3T4EA 2ORVA 1JLKA 4E2ZA 3A32A 1YV9A 1J9ZA 3EK2A 4RFLA 5DSXA 4EVQA 4NVRA 2HHAA 3MS2A 3D4NA 3QWHA 1F14A 1ZW6A 3G8YA 3ZGZA 3SZMA 2ZT5A 2VO1A 2BGLA 3LUGA 4O3UB 5EJ8A 4KFRA 4WK0B 4Z4HA 4Z0PA 4NARA 3TKAA 4Z99A 2AIRA 3AW8A 4OKNA 4QD3A 5FFOA 1R3UA 4ZC1A 3BWEA 4XAQA 5BN4B 3DFMA 3LE8A 4OM8A 3I9MA 2J3EA 1UFRA 2Q4RA 4RTJA 1UC9A 2J9GA 2O0KA 1Y3CE 2GKGA 5ARBA 2HBQA 3O5AA 1WS6A 4OHYA 1TYEB 1GJRA 1RI3A 4G5OA 3KQNA 4LHXA 2WOJA 3VO9A 4UM8B 3DE7X 4ES6A 1BOFA 1SQ6A 1UP4A 4HQ6A 4NLLA 4BL5A 2PYZA 4M0KA 3SC2B 4F2WA 1PDWA 1S3SA 2FSGA 5TNXA 1RRPA 3F1KA 2E4ZA 5B1IA 3TLYA 3OJXA 3EPKA 1MOSA 1IBLB 3AWDA 4EY8A 4TXLA 1ZJJA 3EGXB 4HRYA 4LRWA 5F2NA 3THYB 3C6ZA 3HDJA 1XO1A 5EZSA 3TN7A 4R3NA 2V7QA 2X2EA 1P9RA 1TK2A 2W7TA 3OJWA 2VBCA 3ZWQA 1U7DA 2PH7A 3Q6NA 5E7JA 1RNLA 4DNQA 4JP8A 4UNRA 4V0SA 1GVNB 3U3KA 2NUAB 4XWYA 2ZXEA 4YUAA 5FOWA 4QDXA 1TZMA 4D8XA 2C8JA 3CVYA 3A7EA 2ATCA 5FFNA 2AG6A 1W36B 2CO0A 4XVRA 2V6JA 1HRKA 1KL7A 3IHWA 3AU9A 1FQKA 2BF4A 5TVKA 1DEKA 4E11A 3ZV7A 4W1RA 2PE5A 3OQNA 2I99A 4TWJA 2V96A 2JFQA 1KI6B 3OU6A 5ECGC 3U49A 2FWPA 1QFMA 4Q4HA 5JCJD 1IATA 2BGIA 1Z5PA 3UPUA 2ZYUX 2ATXA 5IRCD 4GRDA 1JEJA 1S2IA 1NF3A 1ITZA 3E1SA 4M55A 1MU0A 4L95C 4BIIA 2AKEA 4M4SA 4RY8A 2LCQA 4UVGA 3WA7A 4PHGA 2M1XA 4K26A 4K2HA 4NONA 4BO2A 5HJEA 1ORVA 3DBHA 1K8XB 3H13A 1ZICA 3GMDA 2JBHA 4DCNA 2O20A 3IH5A 1NKTA 2M32A 5FWNA 1O4VA 2G40A 1RIFA 4M3NA 3MJRA 3C6KA 3LXUX 4PBZA 1NC3A 4B87A 3QI0A 1YBAA 4XR9A 3OQVA 3K9LA 4HLDA 1SBIA 3CG0A 3KDPA 1E8NA 4UPVA 2BFFA 2FN7A 4AF8A 1P29A 2VQ3A 2VRWA 5DMHA 1FLAA 3HK2A 5EJ9A 3ZHVA 3ED5A 5CM9C 4ZEXA 2QM0A 2WFAA 2WM3A 4EOGA 1DU4A 4PR3A 2A7XA 3H2IA 1MV5A 3D8BA 5L8VA 1VL6A 5JJIA 1U7UA 3U4AA 1JVSA 4M98A 3NT4A 4BFZA 1NATA 3EIHA 2C4MA 2W2KB 4PZCA 3NPMA 2FSVC 3QYAA 1H2AS 2A94A 2WHRA 4KE7A 4EUEA 3L6RA 1GCIA 2ZI5A 5CB8A 5LA6A 3LHKA 2GD0A 3STYA 4CY2A 2QUJA 3K30A 4OSPA 1EPUA 4YXWA 5IS2A 2GYWA 5A5GA 1OLZA 3DGFC 4P7BA 5JH7F 3TVTA 5ENZA 3F4BA 1EXNA 2IIVA 3PVCA 4FJ0A 3V4PA 2BWJA 2O4UX 4GSYA 2BEKA 4MV6A 2HA6A 4RKYA 1YS9A 2XQFA 3IJEB 2AI1A 2IEAA 2G4LA 4TGLA 4PQFA 1DEXA 2Y0PA 4ZTZB 3HACA 3ZS8A 4CMJA 4S1NA 2FG7C 1K4KA 5HYVA 1JHPA 3KJXA 2GA9A 2Z8XA 3UEOA 1T9KA 4ZZIA 1IOWA 1EWQA 3HSKA 1U2GA 3OTQA 1XK7A 3OP1A 3PR2B 3BGDA 3OIGA 4LZPA 2OK6A 4UZEA 3MCZA 4Q9LA 1AKUA 4AZ0A 3F90A 4G65A 2C4WA 1C30A 5BMOA 4YXFA 5I9BA 3DEZA 1G2QA 1M6VA 3JZDA 3KYCA 5GXHA 3RHSA 2ZTMA 1CSEE 1NDUA 2HYDA 3C2QA 1CUIA 5LMCA 4ER6A 3RS2A 2AFHA 4Q9KA 3IEIA 3UJBA 5EWMB 3BSSA 2OORA 3T1NA 3AFIA 3QSYA 4B6SA 1J8FA 4C0AC 1T10A 4NDNE 1Q1QA 3GEEA 3LBIA 2BGRA 3MGCA 5GZ1A 3DOFA 4NYMQ 1XMVA 3HBLA 3FPAA 3KDAA 3TDNA 4YUVA 2QMQA 1UM9A 4WZAA 3SDSA 4HLUC 3C5CA 4HDSA 4F4HA 3U0BA 1EX7A 4I50F 3DHEA 3QX3A 1UJ5A 4S0ZA 4E46A 2JDIA 2Y1OA 2NU8B 4U00A 2WJ4A 2FCAA 2DSTA 4O2BF 3HKEB 2ZKIA 4U3JA 2OVRB 3GGCA 4QHSA 2RK4A 3ZTWA 2AI2A 5J58A 4JSXC 4GL4A 5HGXA 3ACCA 4XX0A 4PIPA 3TM5A 3WXMA 3H2KA 1J2RA 1V26A 3ZN2A 2Q7XA 4EHFA 2RONA 1QVAA 2YRFA 4REQA 3LBYA 5ELLA 1TLLA 4LJ4A 4PG7A 3TX2A 1BCRB 3AU8A 1KIFA 2GILA 4TMVA 3OLQA 3I2GA 4JT6C 4WHMA 4PWYA 4Z6KA 4BZXA 1YHZA 3OE5A 3ZNQA 4D96A 1SIOA 4XDYA 4PANA 3OBIA 2CXQA 2B34A 1JQLB 1VQ1A 4OQMA 4TYPA 4UQPA 3NKLA 5KQGA 3CNQS 5CLGA 1WF6A 4L3GD 3UK7A 4MP3A 2P9EA 2PBZA 1UFVA 2FE1A 4LMAA 3UN1A 4M1TA 3DXXA 2Q1SA 4E0BA 3OSZA 1BHO1 4IGFA 3ICOA 4YRFA 1C3EA 5DHQA 2J46A 2PJUA 3QWAA 3P9XA 1O7JA 5AKYA 4AP6A 5UKDA 1RMTA 1U5CA 2JFWA 4ZOZA 1GQ2A 3FKQA 1YI8A 3HVIA 2BDEA 3H5AA 1CZHA 3G0HA 1RQNA 1QBGA 5FTKA 4KOEC 1Q20A 4ODIA 3FTCA 4IQ4A 5KQLA 1RIIA 2REXB 3KHSA 3IQEA 5TGDA 2ZR0A 2CUNA 4O2WA 4X3EA 3I1JA 3HCDA 2OAP1 1SBTA 1W5SA 2FZEA 1YGPA 5KX5A 5EP3A 5K4HA 1E1RD 4RMNA 2ZQ5A 4KWIA 1FFWA 4LJLA 4YECA 1NPTO 5JZOA 3PENA 3HXMA 2VPZA 4U9HS 3RYTC 1HEUA 1XL0A 5IEBA 2PG3A 3AZQA 5FL7D 2B94A 3QHQA 4GZ5A 3S2UA 2GM9A 1U1FA 1O4WA 1HNXB 2HX1A 3D0RA 1U80A 3UK0A 3OF7A 4CQLA 2F62A 2EFJA 2DBVO 3EF1A 2R44A 2WUVA 3RS7A 3RREA 4WTOA 4EHNA 3ZTYA 2VDRB 4D8WA 5K9ZA 4JJ6A 3WLOA 2QM8A 4OO3A 3O0TA 3WE7A 1E3TA 1VCOA 3UB2A 5A9SA 5ERYA 3ZE0A 2ATEA 5KJ1A 1UDXA 1QR2A 3PUZA 3GLHE 2H17A 4G5XA 4FVTA 2E4YA 5JALA 4TRMA 4TLAA 2LV8A 1SXHA 1VL8A 1A4RA 3MLBA 4O4JA 4R69A 1AXGA 2Y1LA 3IPXA 3SC6A 4DDUA 3T5TA 1WZEA 3R9WA 3G6WA 1EWVA 2ZUSA 3CW2A 3JD2A 1FMCA 3WTCA 3TRIA 4ZQHA 4QXAA 5HCUA 3CB4A 3A3PA 2BCJQ 1VPWA 4M99A 5JS2A 1Y5LA 4O8CA 1F2VA 3PE6A 5H9VA 3AP1A 1N2GA 4J7CA 4JLUA 5TIIA 3JVUA 3PIIA 3ST7A 3IAEA 5BOVA 3MMYA 1TO6A 1YHYA 1ZIDA 3CVXA 4FFLA 1DQPA 2H9YA 3JQQA 2JCVA 2C2ZA 3K1AB 1OTHA 5HXAA 1C9NA 4LZJA 2W4IA 4DLZA 4Q1VA 2DHQA 4YCJA 1HFWA 5EWLA 3KUXA 2ZWPA 3H2HA 2Q9AA 3ERCA 2VDQB 1KFKB 2PT9A 3M6FA 4B85A 1GGFA 1GA1A 1ILEA 3OEWA 4ZOLA 4FI3C 4GMXA 5JAHA 3U1BA 1AY0A 2Q6TA 2AOVA 4KSCA 4R8SA 1BWPA 1A88A 2WTNA 4RIIA 1FSGA 4FILA 4D9GA 3WGYA 4QAQA 3PQ8A 4KVFA 3WFJA 4UMEA 2ZRHA 1BH2A 2YZGA 4RU1A 4IH1A 3FWNA 3VUEA 3CEAA 4R05A 1P91A 4QYIB 2Z3WA 5LWHA 1T6XA 2JLRA 1U94A 2BM1A 5K0CA 1EVYA 3C98A 4EJSC 4HUQA 3O4IA 2H5LA 3ABQB 4WLOA 2FN8A 2WA1A 2DCUA 4D6VA 1QV9A 1JG1A 3FHTA 4BHTA 5FBKA 1Q44A 3H11A 1MV8A 4G56B 1JI0A 1GKYA 1T2AA 3X1MA 1GUZA 4JL5A 1YCDA 3BMCB 1Z6AA 4M89A 3GFVA 5GONB 5LMZA 3G88A 2HWKA 1JHXA 4UE3S 1Q2UA 3UO8B 4MPPA 3GN2A 5IT4A 1I80A 1G291 4HADA 3SSNA 4LE0A 1MQSA 5I9MA 5JS6A 2ZSKA 3DDOA 2PNFA 4YAGA 2GESA 3I6QA 2MSKA 4FKZA 1BOOA 1XE3A 2PUFA 1FRNA 9MHTA 3TNLA 3DPUA 3LC0A 1Y98A 4BWFB 4TLMB 1FQWA 3IHTA 4Z0HO 3PD0A 4LXUA 3L7LA 3N28A 2YNNA 3DQQA 4BNFA 4M8LA 2HXYA 4YRAA 3Q7TA 2WU4A 2OCBA 4B45A 2Z1DA 3KUDA 1XTVA 4HFRA 1T1SA 3OZFA 4JFRA 5F7OA 1SQJA 3FWKA 1Q17A 3NM4A 5ALRA 1JPVA 3TSZA 4JLDA 1OXSC 5AM5A 4EO9A 3ICCA 1E60A 4RVUA 6GPBA 5CAEA 1AZWA 3B1WA 4UM7A 1SVMA 3T7TA 3KQMA 8LDHA 2OXFA 1XVUA 1Q0SA 4DIFA 3W6NA 2EFCB 5J2TB 4FHCA 1A82A 4HAWA 3NRCA 2IF2A 5EVJA 3LCMA 1JG4A 5MHTA 3N8DA 1RC0A 2ILTA 2QE6A 2W6JA 3NBKA 2PV7A 4OLJA 4YHHB 4QREA 4LSMA 2H7YA 3O2QB 4BMDA 3PQ6A 2B30A 3GEIA 4EKDA 4DDHA 4Z9XA 5IJ8E 5EKUA 5JWHA 4DQXA 1I3KA 3SX4A 4U2DA 1PZHA 2ZSEA 1ZLXA 3UK2A 2GBLC 3L0OA 1F9AA 2CLHB 1TU0A 3SY8A 2G70A 2JIDA 1X1EA 3LX4A 4OI0A 2Q6LA 4DBVO 5AUOB 4ILKA 4F45A 3N59A 4L3VA 5BY2A 3VI4B 1Z9BA 1YIAA 1QPZA 4QXMA 1R10A 4GI7A 4PRLA 1KFBB 3QHYB 1G5PA 1IU9A 4PO1A 3ORFA 4M8SA 3AERA 1W46A 4LNAA 3DL4A 1M0EA 4IHQA 4GPTA 1KOGA 2JVIA 3DEKA 3L8GA 2RC5A 3QPUA 3RE1A 2CZGA 1DBQA 4CTNA 3RFUA 1CETA 4TWBA 3Q7RA 3AL0C 1WXDA 1PT8A 2HFKA 4D57A 3F9RA 5ICFA 3IV6A 2DFLA 2LWIA 5FPSA 5BVGB 1X2EA 1R6AA 1NI4A 1D9ZA 4M9XA 3HTXA 4EI8A 1QANA 1LK0A 4GMBA 5IJ7E 4DR3B 3OKAA 4PHTA 1BVRA 1V6CA 4MKFA 4BO4A 2ZIWB 3SU8A 5CFZA 4U4AA 1K7YA 4G3XA 1T1JA 3UR4A 3LQQA 3F4KA 1QP4A 1CYDA 3OSUA 4DJEC 2ORIA 3H1EA 1QHHA 4FYVA 4R9NA 4KFMB 4I5IA 2P40A 1KRXA 4EB0A 1XKSA 3KOUA 4ZICA 3TQOA 3WI7A 4CR6A 4CQNA 4BNUA 3L07A 2AMYA 2ZYHA 5AW8A 1M5TA 3L6UA 2RHHA 2CV1A 3VSEA 3GLFE 1Z88A 4AY4A 4Y8VA 5LYJA 2ST1A 2EBHX 3NYWA 2R48A 2G67A 4U2KA 4PXYA 3QU7A 2CNNA 3CUVA 3NEYA 1S9HA 2C03A 2WM2A 3T5MA 1N3LA 5DK6A 2WPDA 4G97A 4GMHA 4D0KA 2XGSA 3K6RA 4ZZ2A 4BNWA 1GPBA 3A10A 1PQUA 2QZSA 4BNIA 4TTPA 4R7GA 5A5VA 1EVIA 1BO6A 3I9OA 2XQIA 3JS5A 3EWSA 4IY1A 2IOHA 4RD6A 4N5IX 2CL6X 3LX5A 1XIVA 1NR0A 3E9YA 2IXEA 4ZDIA 1R9GA 1OX5A 4MYCA 2OHGA 2EP7A 2XCLA 1DC5A 1Z4PX 4FDVA 5EAMA 1ZVQA 3O91A 2OBNA 1YFLA 2IIQA 3ECAA 3KZCA 3NWEA 3KQLA 3T5DA 1J8DA 5IHPA 1N8KA 2B5VA 2Q3JA 2ODBA 1AB6A 2H2GA 1QTNA 1GFWA 3REGA 2IYPA 4D9HA 4J0DA 3H1GA 1O3YA 3O75A 3WIBA 3Q8KA 3R2JA 3EI4A 3AEUA 3N7TA 1JJAA 2QOEA 1LI5A 4W1QA 5HFAA 1KXJA 4CMEC 4OD0A 2JI6A 1G8YA 4CEIA 2FR8A 3OFVA 2P9QA 3PUWA 3NP9A 4IICA 3CXRA 1Z5GA 4HQ0A 2Y2VA 4B4VA 5JEEA 1SVUA 4Z8YA 2RHRA 2CJPA 4HGQA 2V1UA 3O3CA 1H2YA 3QPWA 3FE2A 3LVQE 2EBSA 1RLUA 5FKSA 4X6LA 4A0QA 1Z8HA 4JAVC 4HOYA 4G0NA 1G3IA 3RVPA 2AYXA 5T6BA 4N5HX 2O8BB 4GBED 5J4HA 1US8B 3KALA 1OH5A 2VDWA 2H4FA 3GRVA 5CBPB 4X1IA 3LI2A 4FYHA 2EKDA 3NBQA 1PEKE 1AKYA 2P77A 3OC6A 4YQFA 5CA0F 2V9CA 1ZA2A 2O50A 2A0YA 4N5MA 5AVQA 1K4YA 2PVPA 5AIAA 3ZJ5A 5KNCH 2GHRA 4L7QA 2XU7A 1Y3BE 5A0TA 4TMWA 4HNQA 4HHEA 3KEOA 3QVLA 2XTNA 3CBQA 3KM0A 4UVIA 4C0LA 1GYQA 4U7AA 3DUWA 1KEUA 3WRXA 2P62A 1FDWA 1U2SA 3L5KA 2DUNA 2XNDD 4JLPA 4D6YA 4M1QA 1QAMA 1AXEA 2P67A 2BTQA 1WW3A 4JITA 1ODKA 2JIMA 3GPDG 4RQUA 4DCVA 1PD1A 3WGMA 3ORRA 3RRNA 4NP6A 5IYZA 3CXUA 4N0MA 1VBFA 1K8QA 3TEJA 1FNDA 4EG5A 2FKNA 3WQSB 3TGLA 4IQFA 3LTNC 1BGXT 4LFCB 2XPCA 3CPJB 4X6UA 2Y1FA 5IAEA 2PLRA 1XEWY 4WXEA 2H54A 1U0OC 2DQ4A 2J3IA 5ANRB 3IHKA 2IV3A 4QZVA 4FOTA 2PAAA 1TLTA 1GGEA 3EHEA 3EXEB 3CINA 2ZCVA 3AY6A 3P71T 4BGDA 5K6TA 4LE2A 4CL8A 1IXRC 1G9TA 3M33A 1FUYB 4H2DA 2ZSBA 2GYYA 3BDAA 1ES9A 2X3UA 1DZIA 1XMPA 4UEWA 1OGIA 1OBOA 3DDNA 3U61B 1Y3FE 3MXXA 2NW6A 3AHDA 1M34B 3HSSA 2Y1KA 2H18A 1DB3A 3LYLA 2WNSA 3HL4A 1KSFX 5H5JA 2WIFA 2VDOA 4BNZA 4BXOA 5AJWA 5BWCA 2C2GA 1BXGB 2ZDHA 2Q50A 1ML3A 1ZK1A 3LLCA 1PNOA 2UZ0A 2BEVA 3PX7A 5T4EA 2YUTA 3GLTA 2QSZA 4A09A 2ZE8A 3OIUA 3AUKA 2EBFX 5GM2A 3U4CA 3JYLA 4BKPA 1GNVA 2EJUA 4FCVA 1TW3A 2J09A 4JK3A 2ZBPA 3KB8A 1TUIA 5GXIA 2PNJA 5FOTA 1N0UA 4GS5A 4LKRA 4E5PA 3JZHA 2Q9UA 4IDDA 2O3QA 3RIEA 3ETGA 2J3MA 4AS3A 3OUUA 4UDNA 6AT1A 3EI3B 4ZI5A 5SY6A 5CT9A 3FOWA 4JJGA 1R37A 1B6RA 1DCFA 5F1PA 4EDHA 1U8CB 3AH8B 1WV0A 3TLKA 4HPXB 2I6FA 2ZUDA 5K05A 1E32A 1YA6A 4PS1A 2NGRA 3UHAA 1C1DB 1KH1A 2MDTA 3MTEA 3MUOA 4J6EA 4MGYR 1KDRA 4DV5B 2QRGA 4AURA 3KXPA 3C97A 4DNOA 4LZLA 5IKOA 2Q41A 2BYTA 4A1FA 5ALFA 1X7ZA 1OAOA 3OLVA 1AKMA 4KMRA 1ZD8A 2G6TA 2YWRA 4QASA 2V5UA 4IIBA 3V42A 1SUCA 3B3AA 3FWHA 1K1EA 3IVCA 1W1WA 2A1TR 1QDLB 4TWZA 2OO5C 3MINA 4ER5A 4F6LA 3GWZA 2JGNA 4GP7A 5BR1A 4PG8A 2NTVA 2NVOA 2V5AA 2OVQB 5KC8A 1EZ4A 2ZB3A 1W88A 4KUEA 4ZCSA 1QK4A 4X71A 3DCNA 1EG7A 1SBNE 3SBXA 5CTJA 3DQZA 4JQSA 1EK5A 3RVOA 2GARA 1CUCA 2GZAA 1XELA 4NTZA 3I5XA 1VKRA 3KOZA 1N0HA 1YOBA 2IBTA 4G63A 3VJMA 1JZQA 3G5UA 2A5FA 2VPTA 4UAVA 3TTVA 1T9GS 1UZUA 4I5GA 2OV1A 4U5QA 3P2YA 3A8TA 2XVAA 2B9VA 2HMAA 4MRVA 2PX3A 3RQIA 4JBGA 4NSXA 3ZCUA 4AUMA 2IYXA 1XPOA 5DGCA 3HB4X 4F9FA 2RI1A 4AUKA 5DPMA 3PXDA 1C9MA 1S1MA 3EUEA 1Z35A 3BRCA 3Q7IA 5JE8A 4G25A 2R68A 4AW9A 4LSGA 2CLEB 2BI4A 1GL6A 3AX6A 5K1CC 1KBOA 3S2YA 2JK0A 5CT8A 1HFKA 1Q7RA 1KPIA 5BV7A 4YXWD 3GLQA 4I4CA 4Q34A 4E5NA 3R5JA 4YRZA 1E0SA 1J23A 4I14A 4J7XA 3OI7A 2IW3A 3BULA 4DVJA 4DXAA 3SBPA 4CIWA 3Q87B 2HMYB 3QKSA 3SZLA 4A2LA 2ZREA 2B4KA 4OM7A 3L82B 4GNRA 3C48A 1K7EB 1H9CA 3OPNA 4BV8A 3HJFA 1CY8A 3F5SA 3KOXA 1BXKA 4D0GA 3AFMA 1ZMXA 3P26A 1QIEA 4Y2SA 1MB0A 2YV5A 4Y6GB 2HJWA 5H8WA 4JT8A 4Q12A 3UUFA 1B73A 1I7SB 4GI3A 2QK4A 2WF7A 4KDRA 4ROSA 5F5NA 3HN2A 3QW2A 3GXBA 4M7PA 5F4BA 1WPRA 3IIEA 1A9XA 4LISA 4Q4HB 4RE6A 2GAFA 1YB5A 3N74A 4KE8A 2E4WA 4RVHA 3QFHA 1GZDA 4M8NE 2G5PA 2NZJA 3IQIX 4UAGA 1L1RA 4QU9A 3JARA 2MIIA 2X5JO 2I76A 3TQTA 1HOTA 1E79D 1RM0A 1OAKA 4U39A 1NF2A 1GY8A 4WERA 4TRRA 2JLSA 3IJ5A 3ZWBA 3EUFA 3MVEA 3DBHB 8MHTA 1ESZA 3SDBA 3GRYA 4BLSA 3EQ2A 2O2EA 4WESA 2YW9A 1EP2B 2X6RA 3HFRA 3O4GA 2I7DA 1R4NA 2V3CC 5DP1A 1GOGA 2GFQA 3H0CA 4DA4A 1U3FA 3FGOA 1RM5A 5F33A 3A04A 2H2WA 2GEVA 4KH1A 4YUWA 2BFFB 5IT9A 1RT9A 4Q1FA 3PVSA 2WM9B 1CY2A 1ONPA 1JI3A 1WIWA 2N1MA 1DO0A 1I2BA 4S1WA 2VTBA 1E64A 3WNQA 1LVUA 2WF9A 2GEKA 4JP1A 1QYXA 3BHNA 1H5UA 2WWTA 3MD0A 3ILVA 4BV2A 3QKIA 4E21A 1E2FA 1Y81A 2NO0A 2PJZA 5T5QA 3MTJA 5HDQA 4BDSA 4J82A 4DS3A 1G3QA 3PDIA 2AG8A 5DX0A 2CXTA 1R3DA 4WQMA 3DXKC 2AEJA 2LBPA 3KEGA 3WJAA 2W6ID 2X1LA 4RCVA 1MP0A 5TF4A 5LA6B 1G41A 1NMQA 3UOAB 5FI1B 2J33A 3AF1A 5JS1A 5BORA 1K5DA 3CURA 3EGCA 4DJAA 3EWEA 1SZDA 4WGGA 3ASZA 2ZJBA 1XKQA 4RMIA 3V4PB 3F3MA 4LSWA 4LX8A 3CZ9A 3D6TB 1TKRA 3EYWA 2KSQA 4MW9A 1RAEA 3R6LA 3ESAA 2O05A 2VAWA 4AK9A 3UXYA 1COWA 3CZQA 4P31A 2WJPA 2IRWA 4F71A 3PFWO 2JKZA 4YACA 4CDMA 1GNLA 2VEOA 3RC7A 1QHNA 1UJNA 1P9WA 4DLNA 2AOTA 2EW2A 3R3WA 2C4TA 3VTKA 3KEFA 4JYAB 1BN6A 2YWCA 4YRPA 4FR5A 4AZ0B 3INYA 1OT3A 1C30B 1PK7A 4BFWA 3UKUC 2CNDA 1JDNA 4BH6A 1PO7A 4AAYA 1M6VB 1T6BY 2CZQA 3R9KA 2OCKA 2G88A 2FWRA 3KYCB 2DLCX 2BP7A 1ZIPA 2AR9A 2QNRA 3K9CA 3UHFA 3EVZA 4OIFA 5TT1A 2ZBGA 3BZUA 2AFHB 2X8BA 2PDAA 2O1WA 4J7AA 5CDTA 3Q40A 3V4RA 1M2GA 2EBWA 3ZD7A 3EVTA 5BN1A 4E70A 3M70A 1EWRA 4JLWA 2GNAA 2P2GA 2XXAA 3A1TA 2OFOA 3WK7A 3LXXA 1G5FA 3FM9A 1SHZA 3FOCA 1VDMA 2D62A 1WU8A 2WYWA 4N8SA 1Y8RA 1TAQA 2ABWA 3I8XA 4HN4B 3DJYA 1A0OA 3PQDA 1ZM2A 1UM9B 3IAS6 4WZAB 3BJIC 3OOWA 2FFHA 4HDSB 1RABA 1NPDA 2VUHB 5G53C 1S6YA 2IDZA 4W8OA 4AKHA 1JYSA 1EJBA 4JCOA 3B20A 1EX6A 2C8VA 4P2BA 5EC8A 3K05A 5ALTA 5CCDA 2X0DA 1J09A 2YFQA 2IU6A 1SU7A 5HYNB 4KBFA 4U3JB 4EHIA 1FLVA 4B75A 5FBLB 4KH0A 2C3UA 3EB9A 1SD1A 3DDZX 1R0WA 4YA6A 2W8ZA 2R8YA 3PDHA 4RENA 5DMXA 5I5IA 4XX0B 3FTDA 1SCQA 1YK0A 2VK4A 1SG0A 2ZWIA 4QXPA 4X41A 4AM8A 2OMEA 5AK0A 1P1JA 2KYRA 3FRIA 4WXHA 3ISJA 3DDCA 1NVUQ 3H1FA 1CY6A 2QZ4A 4YT5A 2WJ6A 5FCDA 1NOKA 5FR1A 3ZD9A 4H31A 1R6TA 3EGEA 2OJYA 1AGNA 4RF4A 1YF3A 3VNVA 4C7JA 4OWRA 3R3YA 3G8DA 1JWAB 2CLFB 5HQ3A 4F5ZA 1TC2A 4MI9A 2GETA 1NW7A 5REQB 3M6VA 2NO1A 2WOOA 1GPWB 2RB4A 1R9MA 1K88A 1A1VA 5AW0A 4CF7A 4UJ3A 1FZQA 2CFCA 5C5DA 3O4VA 4LJ8A 3TOZA 1XCJA 3GH1A 3H99A 4A8JC 5FI3A 3QKRA 1L0BA 4IVRA 3RRMC 1I0ZA 5AESA 1ISJA 4EG7A 5CMLA 1TVMA 2PM7B 4PLZA 4ZMSA 1FRVA 4O4HA 2AQHA 2VXYA 4MCJA 1BJRE 2FPPB 1LSJA 1FC0A 2YOGA 5DKFA 1IOVA 4RXUA 4Q1CA 4H18A 3DB2A 3MJSA 2GUGA 1HTBA 4G37A 2A3RA 2P65A 1PLKA 1QQBA 5A2QA 2JGJA 3BM5A 2VK1A 3VC7A 1WY5A 3O2SB 3R3VA 2EQBA 3P45A 3MCUA 5FPYA 2DBZA 4AG3A 4F9EA 2ZJFA 5KX5B 4W7SA 3RK0A 1H85A 3ZJVA 5C80A 4AJIA 2I3ZA 3JYPA 3CX6A 3VR1A 2BGUA 3ITNA 2H6NA 1AN0A 3H04A 4TSRA 3SHWA 4OA5A 4QTXA 4NMLA 5BSFA 2WKQA 3I7HA 1TTPB 4RF2A 3DXYA 1CHNA 1IBCA 1NYTA 5JD5A 3L05A 4EPYA 2OAGA 3GEPA 2Q45A 1W36D 3K72A 5DH9A 2OBLA 1CR1A 2P2NA 4CQLB 1LS6A 3MZ0A 1NN0A 4PPFA 4XD2A 1SHJA 4PYQA 5FLXg 2LIPA 4Q19A 2ZCJA 1NN1A 3HCCA 3LT4A 4XJVA 1MW8X 3JVVA 3AEKA 1GCUA 1GZ3A 3V2IA 1OOEA 1OX4B 4BFUA 5A9SB 5L40A 3VZBA 2NO9A 3ZE0B 3HI6A 5CLIA 1YUBA 5DXAA 4OFBA 3C14C 4LWPA 4L1QD 4CRWB 4REMA 4YRJA 5KWVA 1ICEA 4OQNA 3QXGA 2PR2A 3E3OA 2YS6A 4M36A 1KQ3A 2V7EA 4HB2A 3DCJA 5A2GA 4ZDKA 1KZ9A 3ICQB 4R1NA 3QPBA 5HP4A 3M1AA 3C4VA 3DV0A 2IVFA 3H2SA 2ATIA 3TTSA 4QDZA 4O3MA 3RS8A 3RAEC 1S96A 1O95D 1GOTA 1MG0A 1N8TA 2J9ZB 1H8EA 2GA8A 4EPRA 2JJ1A 3ZZ0A 2PGOA 3UT0A 2AYZA 5M7EA 2FE4A 3AQIA 3V33A 5T6MA 3OPVA 2DPGA 2AJCA 5ESXA 3QP9A 4NS4A 1AHHA 4DE5A 1QDEA 3GJ6A 3G13A 3TQQA 4CM8B 1XAJA 1UK9A 5EWLB 3V80A 2P6PA 1G8SA 1Q7EA 4C6TA 4F1WA 3DWGA 5CT4A 1OI2A 4NK4A 5JAMA 1RCFA 4YPVA 4ZOLB 1XLVA 4ZQIA 4YN3A 5EHZA 3K6KA 5DCLA 3JRXA 3ZDZA 1Z56C 1U65A 2REQA 1CJTC 1EDEA 2YIDA 1Z7EA 3Q7QA 4GZ8A 3C3EA 4KC0A 4YC7A 3TQFA 3QMMA 1WSWA 4GKAA 1KGSA 3CEMA 1PFYA 4LXQA 1CUHA 5HRAA 2R8EA 1EK2A 2PUGA 5K3EA 2AMFA 2CVPA 1Q83A 4BVHA 3BC1A 4G24A 5CG2A 1Z4OA 5AW5A 4HUQB 1L2TA 1D0SA 2ZK7A 3ZNOA 2ZRMA 5DCWA 4RL6A 4FA9D 5GJBA 3NVXA 3UCFA 4Q3EA 3W8RA 2B99A 3H11B 1RE1A 3HP7A 5I7EA 5EESA 3MB8A 4URFA 5A06A 4B6EA 1NVXQ 3N0XA 4ESGA 2HA2A 1GN9A 3WHPA 3C5EA 4YYEA 4UUBA 5GJCA 3G7NA 2H4YA 1Q0HA 1YVUA 3QMVA 4C20A 3E81A 4GSLA 3VI3B 1N8SA 5ULLA 3EEYA 1CK4A 1GDDA 4IMIB 1TZJA 2TRSB 5IH7A 4B9AA 4RBNA 4Z0TA 2IUEA 4UM9A 4BX8A 3ESRA 1PV4A 1N5OX 3C6QA 3ONFA 2W2LA 1Z6PA 3AR8A 4H6XA 5G1PA 4Q3AA 1E2BA 3KLOA 4XLZA 3P2KA 2IH4A 2EKQA 5BOSA 5TEWA 4LHEA 1C41A 5EUQB 1PWHA 1VCHA 1MFZA 1U8FO 3PPXA 1FS5A 1OA0A 2QR3A 2OGZA 3PIDA 5HTOA 1J20A 5CYFA 3JWPA 2QSJA 2FI1A 1AS2A 3DOEA 3UTDA 1EX9A 4TS4A 3B1VA 3IP8A 4WACA 3IOBA 1THZA 1LPSA 3ZGVA 1PR3A 3O0DA 1GQOA 1H69A 4LX0A 1NW4A 1UBLS 4NYIQ 5CAEB 5SY4A 1D0VA 5TXGA 1XYYA 2YVUA 2QXYA 5FQOA 1D4OA 5G02A 4EQ6A 2WJWA 2QIPA 4R1MA 3IP1A 1VCIA 3RK1A 5H59A 4FEAA 4IRMA 4Z7QA 3NYRA 4GDMA 3AZPA 4NOJA 1E62A 3TCXB 4R2JA 1PLJA 2BZ0A 1NOJA 2BZSA 4NQZA 4Q66C 2WTBA 2PU7A 2AN1A 1Q0ZA 4EZIA 4IJUA 5G2OA 4DNUA 4QSHA 4KYVA 4BGEA 2HC9A 4CU2A 1I3OA 3WDKA 1N0IA 1CJVC 2NYAA 5I51A 1YOVA 3DVRX 4ZO9A 3DOHA 3HCFA 2EIXA 2IEIA 1N2CA 2BFNA 2DOKA 2PWAA 3HXQA 4ZJPA 5AVVA 4BCCA 3KQKA 1RVV1 4GX5A 4PZYA 3M6MD 2B5NA 4C03A 2HMWA 5IT5A 3VU3A 4JODA 5IPFA 1HV8A 1NVMB 3M9LA 3FZNA 5BR4A 4L2IA 1QYVA 1YMVA 4A7JA 1FS4A 3AERB 1P1FA 1R0KA 4F2GA 2Q1WA 3B60A 1FFYA 2R8RA 5L4LA 2DECA 4ZO6A 2G06A 1K98A 3WBFA 3WRYA 8OHMA 4PX2A 5TT0A 1N32B 2PLAA 3DZKA 2W9XA 1Y4UA 3FKSA 1XEAA 2GERA 4JBHA 3M6XA 4DL9A 2JH3A 3UJDA 1IHUA 1NI4B 1XD2B 1IXZA 3GW8A 3IAS1 5K8TA 3ZWNA 1DV2A 1EFKA 2IE8A 3T3EA 4B4UA 4OIMA 2WFZA 3TEMA 5ALDA 1CRLA 3FOFC 2QORA 4W5HA 4KWEA 4XIFA 2ZUCA 1YRWA 3PEFA 4KRGA 4QPJC 1QHHB 3L40A 1JVBA 3CNOA 2EWWA 1FPMA 4TZ0A 2D5LA 2VSQA 4ZOXA 1ZEMA 4FFBB 3QK7A 4W99A 2FQ1A 2BFBA 4ZVOA 4F3NA 4KKVA 1ZH0A 2PMDA 4EHBA 2ZIVB 4JQCA 4CIBA 3V4LA 1G4UR 3BK1A 2YDYA 5EQTA 1G2IA 4NICA 4M46A 3E7WA 2XZOA 4LRSB 4XRGA 4JJ7A 1H4TA 1N1EA 2AN5A 2B8JA 4FGSA 4YRSA 1KMMA 2J6BA 2Y67A 2UZIR 3KYBA 3RC9A 1KU6A 5AKXA 1T3SA 4LDJA 3BQ9A 2VP4A 4UTNA 1IK4A 4O2AF 5BPHA 1KE1A 3B7WA 4R4JA 2B83A 1IN1A 3WL7A 5C4GB 1R0ZA 1UXHA 4ECEA 3RHFA 3I1FA 1QKIA 1ZVJA 4JQYA 1QHYA 4COKA 3COSA 2HPZA 1B8PA 4WJZA 4Q7LA 3VR6A 3ODPA 3AFGA 4XSGA 4FFWA 4CHGA 2ZRJA 2F9FA 2PL3A 1CEXA 4E88A 4F12A 4GHWA 3QKUA 3EI4B 3AEUB 3GL9A 4A15A 2JAOA 1SQSA 3FSRA 2QQGA 4KK3A 3FPSA 4HAZA 2CNOA 4I79A 3W8FA 4D92A 4PZPA 2Z9CA 3LGXA 4QAJA 4MEAA 1D4AA 3RFTA 1KKMA 3ZI4A 1RYNA 4C14A 4LBWA 2YXNA 2CMFA 3KSRA 4TVKA 3FGBA 3C45A 4GH5A 2JHPA 1ZH8A 1GITA 3ZXSA 5H02A 1M75A 4UHDA 5AXDA 4JROA 3WO0A 3V34A 2IURA 4X1IB 4YY3B 3HVHA 3QU4A 4ZVLA 4H35A 3WLPA 1CJCA 1EFCA 1D5CA 1REQA 2X8JA 2PGAA 4JSRA 2F8MA 1CUXA 3TXYA 5AKGA 1MG5A 4BUJC 4NU8X 4R2HA 2X0KA 2ORYA 4YAIA 2OLJA 3AHGA 1OASA 2W8BA 5ALVA 2P9CA 3EAQA 3ZU6A 4ZVRA 1CS4C 3FUWA 1IUOA 5KIAA 3OLZA 3ZHBA 5CVEA 3GROA 3CUWA 2CE8A 4O33A 4AY2A 2RKBA 5AJZA 4LGMA 1B8VA 5KTSA 1GUAA 2WE8A 1UJ2A 4EB6A 1HT3A 1KYYA 1Q0TA 1GCAA 4G1MA 4O4LA 4XSHA 1J1IA 5FKQA 1AZTA 4UDXX 1JA9A 2O1EA 3QOFA 3SIPA 4W5RA 5AMSA 5IYZB 4E30A 1XLTA 4KWTA 2ZYTX 4DSUA 3UHPA 1AKRA 3MMZA 2IBSA 2JW5A 2LE0A 1Z2PX 3ZXYA 1E2IA 3SNHA 1SCBA 2OV2A 2I22A 4GECA 2YXEA 2ZJ8A 2C3MA 4MLDA 3ZLTA 2DBYA 1SH7A 4R5MA 2DCMA 3E5MA 4EI7A 4P81A 2ECOA 4EVIA 1G8KA 1GHTA 3NTXA 1N4AA 3L04A 4PWZA 2QBYA 3DLHA 2IUUA 4PIVA 2XVMA 1SKYB 3ER9A 5CW1A 1B16A 4DTIA 4XYEA 2P5TB 4TKMA 1OWPA 1KYXA 1SXJE 2ZWOA 2ZYGA 4M0UA 4GYWA 2FPWA 2QYTA 1K3IA 1DQYA 1XV5A 4RPCA 2CUKA 4ME6A 5K2MA 1P1BA 4MVJH 5JRJA 4K81B 2VG8A 3FDJA 3MKQA 1I32A 4ZVPA 1E2JA 3A31A 3VV2A 4FIZA 1THTA 2GTHA 3AUYA 4D25A 1LNSA 3TINA 3FF4A 4DV1B 4AG6A 4WK4A 2Y9PB 3IUMA 1JU4A 2I67A 3U80A 2N1BA 4OXXA 3QEBZ 3EH2A 2CLSA 1JG2A 1M8PA 2WJZB 5B12A 2AGZA 3C70A 4A09B 4G86A 4REOA 4RVCA 1AZLA 2PUDA 5IZ4A 4HG2A 4O4IB 3I2IA 2YC2C 2YCBA 4XR4A 1DWOA 4K88A 3UA4A 2H9PA 4EAAA 2XUFA 3FRHA 3RD5A 2P90A 3FYUC 1THMA 4WFJA 5CR9A 4UJ5A 2VFAA 1YACA 2XYGA 2D7CA 1CP3A 4FSHA 1JBKA 4MVJG 2PTGA 5ISMA 2QPTA 1DXYA 3DXZA 2MYUA 3RU3A 4MW4A 2H11A 3VHQA 1GR0A 1Z22A 3DM9B 1MQ8B 1JIXA 3CF6R 4MQFA 5JAIA 1OROA 4E3WA 2ZYSA 3F71A 3VSAA 3A2LA 5G3YA 2GEDA 1DQRA 4FAVD 1KVQA 2HRRA 4ALMA 4B6JA 3FAZA 5E8RA 3W2TA 3ECCA 4XYGA 4ZO8A 3D8RA 3S2EA 4AI6A 3I3OA 1J5EB 1T6YA 3PTZA 3QRWA 3P19A 3ZY2A 1T5DX 4KO3S 4GR5A 3VRHA 4X8MA 4JYZA 3R5HA 2BISA 4FGUA 1RBQA 4M8IA 3FHLA 4QTTB 3G89A 1X7ZB 2XDAA 3B78A 1QQ6A 4DZTA 1UBSB 1G5IA 4IQ8A 1LDNA 4OX9B 3KTAA 4EG6A 4HMQA 4F5DA 1G19A 3QFSA 3KKOA 4IUYA 2D5IA 1AHIA 2JFGA 2FRVA 3MINB 1RTKA 4M0EA 1C0EA 3M3PA 5CVVA 3UCXA 4HSEA 2RGBA 3F96A 2B7LA 1I1HA 1W88B 1DCKA 4I4TA 2O2GA 2X7XA 1V9LA 4MPRA 3HCAA 3H05A 2IUSA 5M29A 2AVNA 4XJTA 2YV4A 3DNFA 5FWYA 1ZGBA 1B6GA 3DEJA 1KSHA 1L7NA 1F0NA 3K9FC 1AS0A 5LOVF 5LUBA 3L1HA 4KYUA 1J39A 4A2MA 4WJLA 4CU5A 4QPCA 4MWCA 1V39A 3UCEA 2UYQA 3EPHA 1TDJA 3SZOA 3C9CA 4HEQA 4BZPA 1G8JA 1UJCA 1W4CA 4A0AB 3ORQA 3W6PA 3E3MA 5SYAA 5TJHA 1QZUA 3FPKA 1J2UA 3F0TA 2QAGC 4Q3KA 4WL0A 3SD7A 4Y6LA 3LT1A 4HJXA 3V9FA 3AR6A 3FSGA 1K3TA 2I1QA 2JCXA 1IQUA 2R6HA 1BE8A 1KIAA 4PXAA 1ZQ1A 1TFRA 3DSMA 5I8WA 1K8RA 4NH0A 2A5DA 4G84A 5DYTA 2F2TA 2CNKA 3QKSB 3RIXA 3LC1O 2EOAA 4MVJE 2J3LA 1LPPA 3EZNA 3EPLA 3B5IA 1VSBA 2X0NA 3G2IA 5KDDA 4P1ZA 4PLTA 4PGFA 1N6EA 4XGRA 2GNQA 2G8LA 2IP1A 5ILQA 2O07A 2C5SA 2R5NA 4XIIA 3FCUA 3DAFA 2PMFA 1I4OA 1TQHA 3I9JA 3M49A 3IBSA 1ISGA 3CIKB 1ZR2A 2HUPA 3P9ZA 2XGJA 1J9GA 3K0CC 5JJKA 2YXPX 3MMSA 1JX6A 1GRCA 1A9XB 1E9FA 3Q8WA 4NFYA 3CNBA 3RUFA 1Z0UA 1GUYA 3JARB 4FFRA 3T41A 1EB8A 2H7CA 1RJDA 5B3JA 2ZU0C 1Q21A 3N2EA 3H9QA 1L3CA 1H05A 3GA0A 3OLYA 4RZ3A 5AR1A 1CS0B 4R0MA 3VR5D 1A9ZA 2JAWA 4NYMR 2JC3A 2P2CA 1FLDA 5EPUA 1GGVA 2QRQA 2PKRA 4NENA 1WVMA 1VG0B 1T5TA 3R7WB 2F3PA 1K5PA 2XUZA 1P4SA 4GMKA 3QJYA 4WESB 2JH8A 1QCZA 3PX2A 1PJLA 1NGSA 4DSZA 3WLLA 3FMPB 1NU6A 2GS9A 3D3EA 3T9CA 5AHRA 1E5DA 3H9JA 2HHLA 3A36A 1MF7A 4WOJA 4FSDA 3RPEA 1RQGA 2W93A 4LYEA 2FSFA 5AKLA 2A84A 4IAOA 1NUTA 4HS4A 2VJPA 3IR5A 5FP0A 2JBAA 4KHZA 3F74A 1II8A 2VDKA 2VTBB 4PSDA 3CMMA 4WH0A 4IH9A 1WEKA 3I61A 2JZCA 4OQQA 2FPSA 4DLUA 1XMQB 2VYND 4HQNA 5I7SA 3WY9A 2IXBA 5AW2A 1LBQA 2EARA 3UMRA 4ZKDA 5IKEA 1EIWA 5FNVF 4DMCA 3TQIA 1LH0A 3PDIB 3TLZA 3VKHA 2A5GA 3TRFA 4WNIA 4DT1B 1P0IA 5TPZA 3HDQA 3DOUA 1YE5A 4RK6A 2NTYC 2ZE6A 3ZE1B 1NE2A 3T95A 1HQYE 2J0UB 3N0EA 5DXFA 4RY0A 4DA9A 3FXAA 3ZWPA 3UH1A 1U2VC 3K5IA 1J9EA 1JTEA 1VPDA 4IRZA 1NMXA 3GLHA 4ZHQF 2B25A 3OEED 1EZZA 4CM9A 5FQNA 1VYVA 3A1EA 5EIAA 1DQZA 5HE2B 4U5XA 1M5UA 4A26A 2AOTB 4M7WA 1LVHA 1EK1A 5K51A 1IJEA 3EIEA 3BQMB 4F92B 4J0GA 3A9WA 2D3WA 3SQNA 5K09A 1T8SA 2Q5QA 1LWNA 4P33A 1RPAA 3JQAA 5A4MS 1NBME 4W4TA 5I7WA 4PTLA 2P1DA 3SE0A 5B36A 1DX9A 3AHIA 1K06A 4XFKA 2W4QA 4MMYA 1LQUA 2IXFA 4F85A 4AZVA 4BEBA 2QX4A 2BP7B 4G5RA 4WOCA 4KIUA 4H3HB 3PUVA 2F6RA 5BR8B 1PGJA 2I0TA 2QY9A 4EPWA 1EAMA 1I2MA 5CEJA 1XNGA 4XIYA 2ZJOA 1QPGA 3V8RA 1V1MB 4ZOAA 3WKBA 2D6FA 4AEZA 1UR5A 2AUNA 4GGOA 2OK7A 2QL7A 2P79A 1CU1A 4MYSA 1MAVA 4TKVA 2NSJA 1PR6A 3AY3A 1UIRA 4KITB 4QUGA 3WTBA 3KKEA 3BGIA 3C5MA 3PEVA 5F9FA 3IXLA 3EEQA 4Z4GA 4GLFA 3ONDA 4IZOA 1LJUA 1JSLA 3WLFA 5CUQA 4CTMA 1GTSA 3WDLA 1PWEA 1UBJS 2OCYC 2HPVA 5ERGB 1QHEA 4JYPA 2QX7A 2PPVA 1XLWA 4BGVA 2JGEA 2ISCA 4RLSA 5NULA 3WXBA 2RBEA 1SQ0A 1XDUA 5ALZA 5GGXA 2VHQA 4I46A 4KN9S 2QXTA 4QDTA 3L8CA 3V5WB 1PR1A 2OP1A 4HDOB 3K0SA 3UC5A 1B43A 1M6EX 1FRFS 3D2BA 1HQKA 3N3BC 2VT2A 3L41A 1UXJA 3B7FA 2IHNA 2Z2NA 4NNOA 3OJEA 3VH2A 2Z5FA 2XYPA 5ESRA 2W00A 3NBMA 5DYIA 2A9JA 1JG7A 1VJ5A 4LIPD 2X58A 1ONOA 5HQ3B 4QUHA 2PRJA 1K7FB 5TSDA 1L7EA 1H8ED 1LBHA 4NZNA 3PP8A 5ARDA 1FFBA 2E4XA 5AHOA 4YMWA 1CZNA 2RBKA 2PT6A 1ZH2A 3EVFA 1Z5OA 4FX2A 3DVSX 1NFRA 3PKZA 3QKRB 2NZWA 4EYKA 3ETDA 1JILA 4D97A 3JQDA 3ISVA 2O48X 4M37A 1E4VA 3C3XA 3OTIA 4PZZA 4X6XA 1V1JA 1SRQA 1BFUA 4HY3A 1FTWA 3QFTA 1EVEA 2QTCA 4HQKA 5CK4A 4BWVA 4Q3OA 2X5XA 1C7RA 1E5QA 4Q1AA 1TB4A 3KQQA 4HDRA 1CY7A 3UGKA 5AK5A 1DRVA 2F48A 1E3MA 4RZXA 3PF9A 3INRA 3UAXA 1YRYE 4YAUA 2ASEA 2V7QD 2QJWA 4WA8A 4YQZA 1D07A 1V6SA 3G2LA 4FB1D 4E31A 3ZI7A 5FFMA 5GWXA 3AETA 2YV3A 3MYYA 2ZRKA 5AUNB 1ZKDA 3KKKA 3BORA 2A4KA 5LP6A 4Q9AA 4PQRA 3KAQA 2YQ5A 5HCNA 2BCGY 3IBTA 3K72B 2GN4A 5M5SA 5FUQA 4OX9Y 4PYJA 1LZKA 8GPBA 4DMMA 2FEOA 2H1OA 1SBZA 1UWCA 1OKKA 2ZG6A 4N76A 4LG8A 3HZHA 5IULC 3AEKB 3NC0C 1CQZA 3L77A 4PO9A 5KAMA 2XOKA 4RPJA 3GLSA 4TV8F 1VE6A 4HLQB 4Y6SA 3C41J 3BE6A 1TCAA 2OIZA 4J1TA 4ZQEA 4E5UA 4XGNA 1DJOA 4YP7A 4AJJA 2Y8EA 4INPA 2H9MA 3IDOA 5HUHA 2VATA 3A6PC 5C8YA 2O8FA 3UBTA 1KPGA 3EMHA 3NX4A 4Q18A 3NG1A 3G2JA 2G5GX 2ZM5A 4ALNA 4IIEA 2NSDA 3JCZA 1T5SA 1XQWA 5CB0A 1KYTA 3SEAA 2A57A 2UZAA 4CMCA 2XA2A 2JI7A 1CR2A 1PVVA 3UJ3X 4BJ5A 5GAJA 1RXUA 1UWKA 4WUVA 3PG5A 2OGUA 2P8JA 2R6CA 4I2VA 5G1NA 1RMQA 2P2ZA 3AOEC 4J2TA 2EGHA 1T2NA 4AKEA 1O89A 1WX1A 2YMPA 3D7SA