3IUMA

Appep_wtx opened state
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
684
structure length
668
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
molecule keywords Prolyl Endopeptidase
total genus 187
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iumA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iumA01
5C81A 2XLCA 4DM7A 2JGMA 4Q3KA 1G5FA 5AM0A 1CLEA 3DKKA 1XZEA 4H7FA 5JADA 3EQ9A 4MEAA 3RLIA 5JAUA 3EBLA 4Y2PA 1F6WA 3ZPXA 5LIPA 1ZJ5A 3H18A 3IUNA 5BOVA 4NVRA 4BYMA 2WTMA 3D2BA 3RK4A 1UFOA 2BUAA 2ORYA 2HRQA 2H7XA 4LKOA 5DYYA 3I2KA 4EB0A 2VQ6A 2PUHA 5CH3A 5LYYA 3STWA 1DINA 3WI7A 1U4NA 5EGNA 3IB3A 2BCEA 5ESRA 4HXEB 4J3JA 3D7RA 5E4YA 4UHHA 5EFZA 3G0GA 3K6KA 4AMYA 2WFMA 3WZMA 2PX6A 2E3JA 1EHYA 4IO0A 4LYDA 4XIIA 1R88A 1EA5A 2HIHA 4RE5A 3V48A 3ESBA 3I2IA 4Y2SA 4L9AA 2QOEA 3M83A 1USWA 3DYIA 2PPLA 4J7AA 5JD5A 1DX6A 2QJWA 5D3ZA 2XMZA 1XZCA 1YAHA 3C6XA 1JMYA 4BAUA 5AOCA 5BV7A 5EHXA 1EK2A 1HPLA 1D07A 2QTBA 1CR6A 1WHSA 1BE0A 3O4HA 2RAUA 1QIGA 5DNWA 5DWDA 2J3DA 5IVIA 4AO8A 2Y2UA 1EI9A 5K3BA 2BGRA 4AN1A 1H2WA 1ZGBA 4BRSA 2IITA 1BS9A 3H17A 3IUMA 3ICVA 2OGSA 5LZ8A 4Q1VA 2V98A 4OUKX 3TGLA 5ALDA 5ALGA 1R50A 2BGNA 3F97A 3W04A 2WLSA 1W6RA 1DU4A 3H2IA 5AKEA 1EDDA 5C8XA 5LZ7A 1CUGA 3I2FA 1IVYA 4J0IA 2VAVA 4HAIA 4DTCA 2B4KA 2DHEA 2G63A 1EINA 2WIDA 4LHEA 1VKHA 4QZVA 4BVLA 3STTA 1VA5A 2V96A 3DS8A 3ILSA 2RGUA 5D6OA 3HSSA 4M0EA 3AZOA 3VJLA 1E8NA 4RNCA 1JJFA 4B83A 4UBKA 1Z68A 5A7HA 4QLOA 5FPPA 3BDIA 4WFJA 2OAGA 3LIPA 4RGYA 5LZ2A 3D2AA 3QPCA 2EDCA 3R3ZA 5JAOA 3KXPA 1A8QA 4QWMA 2OCGA 4UFOA 4S0XA 3QBJA 1KEZA 3UMJA 1VXOA 4FNMA 5IKXA 3F96A 1CUEA 4MWTA 3CCCA 5E4JA 3LS2A 1QE3A 5A6VA 2DSNA 5AKZA 2FJ0A 4B7ZA 1XZDA 3ICWA 1GKKA 2R11A 3QYJA 4HVTA 1IUPA 3W2TA 5A7GA 3VKFA 1XZIA 3PFCA 4X7BA 1WHTA 4AZ0A 4N5HX 5ALWA 3AIMA 3LLCA 3S2ZA 4U2EA 2CEKA 4V2IA 4BAGA 1U8EA 1JFRA 2WFZA 5ALIA 4DMFA 4F5ZA 2JGEA 2O2IA 4PSCA 2VJCA 4GI1A 3CCBA 4HS9A 3TJMA 2WQZA 2XB6A 1BEEA 5FLKA 4JH0A 3FYUC 1CUHA 1P0IA 2C0PA 4H7JA 1QGED 1ODTC 4FHZA 1T4MA 5JD6A 4ZREA 1WOMA 3PUHA 2HM7A 3VISA 1BROA 3DKRA 3KOOA 4BBZA 1ODSA 1YA8A 3WL8A 2VEOA 2VT7A 3G9TA 4FBMA 4H35A 3I6MA 4AMZA 4WJLA 4CIAA 2OPHA 5AH0A 1QIJA 4UBMA 3QMWA 1IZ8A 3A2NA 3G8YA 1DWQA 5AOAA 2PSEA 2UZ0A 4UUQA 4B9EA 4Q3LA 1SC9A 4G4IA 3SWWA 7YASA 4JYPA 1B6GA 2LIPA 3H0CA 5ALHA 5SYNA 1O6GA 2QR5A 2Z3ZA 4PSDA 4KE6A 4AO6A 3WWDA 3WKDA 4BC0A 2V97A 4C01A 5EIAA 4QEKA 2VJDA 4K2AA 2DCMA 2I78A 4X97A 2QS9A 5CRIA 4HXFB 2NW6A 2J3QA 4U2CA 5AK6A 2CMFA 3VVLA 3AINA 4W1QA 1ZD3A 3CXUA 2WHQA 4M0MA 3OTQA 1TQHA 5AI0A 3I28A 1GT6A 1XQXA 3L1HA 1UK8A 4ZGBA 2R8BA 4N5IX 3V1LA 2GBCA 4BDTA 3I2JA 5IVHA 3F67A 2JGJA 2C5FA 2HFKA 3IVMA 4MEBA 4UPDA 2GBGA 4J0HA 4DMHA 4ARAA 1A8SA 3GFFA 3D5EA 1PJAA 5AM3A 1QO7A 3OC0A 4MYSA 4QDZA 1MT3A 2CKMA 5ALJA 1CUDA 3Q0TA 4B81A 4W63A 5AIAA 4B85A 3E4DA 3WWCA 2AJLI 4GECA 4H0CA 3AJAA 4HZGA 3OOSA 3V1MA 3ED1A 2JIDA 2WU4A 4U2BA 4CCYB 1XFDA 1IZ7A 1DQZA 1LPAB 5AKHA 4OYYA 4W9RA 4Y2TA 4IHAA 3ESDA 3UUFA 5C7YA 2QZPA 4FWBA 2AJCA 2DFPA 3R0VA 1IUOA 4L0CA 4H7EA 4X3CA 5CTAA 4X91A 5T4EA 1E8MA 4M0FA 1MPXA 3YASA 2OG1A 3JW8A 4KE8A 1GPNA 1ISPA 4FBLA 4OB8A 5ALRA 4ROTA 2O2HA 1I6WA 4DGQA 1SCIA 1EXWA 2HA3A 3N0TA 5HF6A 4PQEA 2CB9A 3ZLVA 3OM8A 2WHPB 5CW2A 1C7IA 4OB7A 1LBTA 4FLEA 4E15A 4EY4A 1HKHA 4X6XA 5JATA 1OCEA 1FFBA 1P0MA 4UBIA 5CMLA 3EF3A 1F0PA 5K5EA 4DNOA 5FV4A 1L7QA 1CPYA 4U2DA 3C6ZA 3V1KA 3WA7A 1HLGA 4Z49A 2DR0A 3HJUA 3ESCA 3W9UA 4WFKA 5CURA 4X95A 4G1FA 2P8SA 1E8DA 2EEPA 3IDAA 1XROA 4QWWA 2ONCA 5AM1A 1XQYA 4ITVA 5JAHA 3FVRA 1AGYA 3R40A 5AM2A 2OGTA 2OQVA 4J0JA 2JGKA 4PSUA 3BIWA 4HTAA 3HXKA 2XUIA 3STYA 3WK9A 4F21A 3FCXA 3T4UA 4F60A 3K2IA 4AX4A 5CXXA 2XUFA 1E3QA 5AO9A 1WB4A 5ALNA 3FLAA 3QMMA 2EDAA 1CQZA 3QM1A 5FKJA 1FSSA 2VTVA 2HDWA 1AQLA 1TCBA 2OGZA 5ALUA 1XLVA 2G5PA 5KBYA 1GQRA 2VF2A 4ZRDA 3B5EA 4WDRA 4QDUA 5HCUA 2C58A 4BE4A 1QOZA 4I4CA 4KJXA 1RWQA 3AIKA 3TEJA 5CT5A 1CUZA 1XZMA 2WM2A 3FSGA 1H22A 2B20A 3FWHA 4Q05A 4BRZA 4ZI5A 1JT2A 1LPMA 1W4LA 4JUIA 1J06A 5SYMA 4UBOA 1JU4A 4XX1A 2PUJA 4UFPA 1FFDA 5A7FA 1MNAA 2WG2A 3JWEA 1QFMA 3DEAA 4Y9SA 1A8UA 2JBWA 4MXDA 4ZV7A 2QUAA 2QMQA 1UOQA 4H7HA 2RHTA 3I2GA 4NS4A 2Y6UA 2GZSA 5BWBA 4BCDA 4LXGA 3B3QA 4OB6A 1DTEA 4G8DA 2OQIA 2QT9A 3NWOA 2JGIA 4CCWA 3FVTA 4FMPA 1LPNA 2AJBA 2JF0A 1LZLA 2BFNA 3D3NA 5FUMA 2YXPX 1Q83A 1R4ZA 3QMVA 1AURA 3ZLTA 5HKAA 5JZSA 5HF5A 5AJHA 2AXEA 4G4JA 4OPMA 3DL7A 1DT5A 3A70A 4L72A 5ALLA 3B12A 4BCCA 4RPCA 4EHBA 4UHEA 3D4LA 1CUVA 4KRXA 5JZBA 4YX9A 4RE6A 2ECFA 5JYCA 1CUSA 4O08A 5KREA 1CFJA 2VAXA 3H19A 2XDWA 3FNBA 3AZPA 4Q34A 1C4XA 3V9AA 4CG2A 1BRTA 2ROQA 1AMNA 2HHAA 2DQZA 4CI9A 3E1GA 2FX5A 4AO7A 2QRUA 1U2EA 2HA5A 3SX4A 3WK8A 4FLMA 1U65A 5AKXA 4B84A 1K5PA 4BDSA 3SC2A 2O7VA 3G9XA 4TPKA 3FSGD 1R3DA 1VOTA 3G9ZA 5LZ5A 1Q84A 1XZGA 2PSJA 2XUOA 2DHDA 2HA4A 1RP1A 4DMCA 1VXRA 2XUDA 5KWJA 3DD5A 3C8DA 3KD2A 4DMKA 2HA0A 1MNQA 3MUNA 4B0PA 1TCAA 1YA4A 4W1RA 2ZYRA 5ALZA 1KU6A 4X93A 1N1MA 5EIHA 3WIBA 2G5TA 3QITA 2WIGA 5DNVA 1J07A 2CJPA 4HXGA 1QONA 2J4CA 1K6EA 1Q0RA 3WKAA 3WWOA 4Y7DA 5CXUA 5K3EA 3X3HA 4C6HA 4OYLA 1Y7IA 3N2ZB 2JEYA 3L1IA 1PFQA 4E14A 4Y2XA 3WQHA 3WWPA 1LLFA 4J0KA 2I3ZA 4X71A 3H2JA 4JEIA 5FXMA 1QLWA 4OU5A 4FNGA 1A88A 5HKBA 1XLUA 1XZBA 1H2XA 1GPLA 3WKEA 4KACA 2QVBA 3MUOA 2WUEA 4KAAA 5LZ9A 2WJ6A 1ZD4A 2WU3A 1YR2A 4WY5A 2GZRA 1MO2A 3T52A 4ZWNA 5AM4A 3W06A 5A71A 4G5XA 4XWGA 3PUIA 1W1IA 1E66A 4FOLA 4C87A 1UOPA 2RONA 5A2GA 2WUGA 4TGLA 4BZZA 5HK8A 1GKLA 2VT6A 1QIMA 3HACA 3TRDA 1BCRA 2XQIA 2VSQA 1AC5A 4G9EA 2RIPA 4Y2UA 3EIOA 3WYNA 4PV7A 4EUSA 5I7UA 1B41A 2ZSIA 3DYVA 3VVMA 2WJ3A 2PSHA 1UKCA 3PI6A 3KDAA 1K63A 1R9MA 3DL4A 3HLKA 1O6FA 2Z5GA 4DSAA 4EY7A 1G66A 5AHXA 1MX5A 1SOMA 2WFLA 2ZJ6A 2HRRA 1XZLA 2B9VA 3HYSA 4I19A 4KAFA 4DNPA 1NU6A 4B82A 1EB8A 3C70A 3A2MA 2D5LA 3R3VA 2WILA 1YSCA 1UOOA 2BUCA 5AKYA 1QFSA 5LKRA 2ZYSA 1WB6A 3WK7A 4P93A 5E4TA 1CUXA 1ZI6A 4Y2RA 4EY8A 3O95A 4GWLA 4CIBA 3PF9A 2ACKA 5ALVA 1MAHA 1IMJA 5JARA 3PFBA 3AFIA 5CBKA 2C5GA 1CUAA 1HL7A 4N8SA 2HU5A 1E5TA 4UHBA 3HABA 1ORWA 3QH4A 5AKGA 3PDCA 2XUQA 1VZ3A 2XUGA 3BF8A 1LZKA 1A7UA 5IVDA 4K5QA 4JNCA 2OCKA 3BL8A 1XZKA 2D0DA 4P9NA 1QIHA 4EY5A 2BKLA 4QDTA 3ESAA 3AILA 4BP9A 3E0XA 5JASA 2VJAA 3BDVA 5HFNA 3A2LA 2XUKA 2PL5A 1W52X 4WDQA 2PVSA 3FLBA 5HFAA 2WFLB 1ORVA 5ALYA 2XMGA 2PKYX 2XUJA 2QXTA 1TRHA 3I1IA 4F0JA 4YASA 3AIOA 2O2GA 3EQ8A 1ZGCA 3M82A 1UK7A 2XMSA 4EBBA 1DQYA 4Y2QA 3O4IA 1WPXA 5AKIA 3G0BA 1NX9A 4CG3A 4B9AA 1Y37A 1H23A 3NGMA 4X90A 1ZD2P 3WKCA 4A23A 3GBSA 1XRNA 1UKAA 5JIBA 3ANSA 4BVJA 1ZIYA 3BJMA 5AM5A 5HF8A 5LKAA 4D9JA 1QO9A 4G4GA 2V9ZA 4A5SA 4UHFA 3D59A 2WHPA 1ZD5A 4P92A 2FUKA 4MYDA 3U0VA 3C5VA 2Y1KA 4OCZA 2G4LA 3BF7A 4BVKA 4GHWA 1CUWA 2OAEA 2PSFA 1VA4A 2XI4A 2WHRA 1J1IA 3IUQA 4P08A 4KAJA 3G02A 4FFWA 2OCLA 3NOXA 4GW3A 5HQ3A 2OLEA 1WPRA 2W22A 3WKBA 5AIBA 3DLTA 1AZWA 4XVCA 2GYWA 2XQGA 5ALPA 1IUNA 1VJ5A 3U1TA 1ODCA 1SCKA 4Q3OA 4IH1A 4B6GA 3FCYA 2J4FA 1RYYA 4MJ3A 3G0CA 1R1DA 4A16A 1CQWA 4BCBA 2ES4A 4QA9A 1CUBA 2HU7A 3I6ZA 1FFCA 2XUHA 5C8VA 2VA9A 1K4YA 2PBLA 3C6BA 2DQYA 3DNMA 1MU0A 3IIIA 4LXHA 1ZI9A 3LIIA 3FAKA 5AI5A 1QZ3A 1CUUA 2XMQA 4X6UA 3ANTA 1EDBA 1TAHA 3I6YA 1BU8A 5ALMA 3ZV7A 1FFEA 1DWOA 5ALQA 3A6ZA 1YS1X 2HADA 5AKLA 4IH4A 5K3DA 4OD0A 5JD4A 1THGA 3I1YA 4N8DA 4H7IA 1ZI8A 1GQSA 1N5MA 3F8SA 1T2NA 4XJVA 1LPBB 4CFSA 2BAGA 5DYWA 1LPSA 2HL6A 4MQLA 1EVEA 1WB5A 5HZGA 2AJ8A 2WUFA 4YPVA 2XMRA 2XQFA 1Q0ZA 1MN6A 4UBNA 4BC1A 3HRHA 5FPQA 4X00A 5ALSA 3CN7A 4EY6A 3S8YA 5K3AA 3WK6A 1HBJA 3M3DA 3WZLA 1VZ2A 2ZYHA 3GROA 5CT4A 2B61A 5CT6A 1FFAA 5K3CA 1ZOIA 2OCIA 3MVEA 3OG9A 2ACEA 2VATA 2ZJ7A 1QIFA 4DSZA 5EHQA 5EHZA 1QIIA 3STXA 1XLWA 5EI5A 2PM8A 3BXPA 3PF8A 1DX4A 3ZWQA 4AQDA 2WTNA 4TVKA 3DOIA 5T4HA 5DJ5A 3C87A 5AK5A 2H7CA 4L3WA 1MAAA 2H7YA 1W75A 3BE8A 3O4JA 4PNZA 4ETWA 3C43A 3D2CA 2BUBA 4J03A 5D7BA 4KE7A 4GXNA 4OU4A 1G42A 2HA6A 1CUFA 1CRLA 4QNNA 1JJBA 5D3KA 4WY8A 1XKTA 3H2KA 3PE6A 3SK0A 3NUZA 4MQMA 1HDEA 4HRXA 4QDXA 4EZIA 4UHCA 3I2HA 1QIKA 3HEAA 3VJMA 3L1JA 4J0CA 3AZQA 4BE9A 4JYMA 5CH8A 4Q82A 3LCRA 5CT9A 3STUA 2RI6A 4BP8A 4FKBA 1XZAA 3O9MA 4ZXFA 1TCCA 3E3AA 1X70A 5ALTA 5AI4A 4BATA 2IX9A 2WG1A 4H18A 2Q0XA 2HU8A 5BWCA 1J2EA 2HA2A 2QM0A 3CN9A 3H1AA 4G8BA 1N8SA 4C88A 4PO3X 2O7RA 1UT6A 4KE9A 5H3HA 3STVA 5AK4A 3GZJA 5ALKA 4E46A 1WCYA 3C6YA 3KWFA 1CUIA 4AXBA 3VDXA 5T4FA 4BTVA 2K2QB 3O4GA 1G4HA 1H2ZA 3FOBA 3WK4A 1OILA 3RKSA 2X76A 1EB9A 3QVMA 3HC7A 4GLBA 1YS2X 2WKWA 5J3JA 3ZI7A 1DT3A 5LP1A 4PW0A 1ACJA 1LNSA 3C5WP 5FOQA 3BIXA 1EX9A 3VJKA 3GUUA 4Y2YA 5I9IA 4J0DA 2CZQA 5ALEA 1ZJ4A 3M81A 1JI3A 3G7NA 1TK3A 3QPDA 3UUEA 3D0KA 4KYVA 3WIOA 4N8EA 2I03A 2ZJFA 3K9BA 2WG0A 1FJ2A 3FBWA 1SFRA 1F0NA 2WSLA 5CH5A 1S8OA 5EHNA 3QPAA 3IA2A 4DNFA 5ALOA 1CVLA 2C7BA 4KEAA 5FP0A 4C89A 5T4BA 4K6GA 2IIVA 1W76A 2XE4A 1MTZA 1GXSA 3BWXA 2X5XA 2Y2VA 4FTWA 5HK9A 4IQ4A 4UHDA 3WL5A 4MWSA 3W9BA 2CBGA 5HQ3B 1UKBA 3FLEA 4B80A 4CCYA 5AKKA 1M33A 2JGFA 3FYUA 1EH5A 5E2IA 3G9UA 1YAJA 4HRYA 1XZHA 3JYHA 3LP5A 4U2FA 2GYUA 4B0OA 2RHWA 1NU8A 2GBFA 3WMRA 1CUYA 2VJBA 1UK9A 3F98A 2Y6VA 3R3WA 4INZA 1EDEA 3QZUA 3GA7A 4X6YA 1P0QA 1XZJA 3W05A 1AKNA 2ZSHA 5FRDA 4GDMA 2WIKA 2JGLA 4GEGA 5YASA 1JMKC 1XQVA 5DYTA 1HQDA 1BN6A 5DTJA 2BJHA 4G9GA 5JANA 1MJ5A 2QKYA 4YK7A 2HFJA 1BCSA 1UXOA 2XMDA 2Z8ZA 1X2BA 1YB7A 3Q8WA 3MGAA 3DQZA 5AICA 3RARA 5ISMA 5DTIA 4W1PA 2YYSA 4UBLA 5K3FB 4FFVA 4H7KA 4K6HA 4H77A 4X92A 5AI9A 5ALFA 3KSRA 1QTRA 1VLQA 5F4ZA 3V1NA 3FYUB 5LZ4A 4QLAA 2WUDA 4DNQA 5I8PA 1QJ4A 3WWEA 2JEZA 1YASA 3F9CA 2PU5A 1UWCA 3WL7A 2PSDA 2WIFA 1L7RA 5EIEA 3HZOA 1X2EA 3AUKA 1KU0A 1QTIA 3EQ7A 1XRQA 5AI8A 1CEXA 4H7DA 4NZZA 1AUOA 1JU3A 1MX9A 5FDFA 1GGVA 1XRPA 3H2HA 2XMCA 5DLPA 1CUJA 3G0DA 1XRLA 4BZWA 1UZAA 2I3DA 1N5RA 2XT0A 4I3FA 2PU7A 3WL6A 5ALXA 2CUTA 1ZIXA 3H1BA 3R3UA 1QIEA 3WJ2A 1GZ7A 4FLFA 3GELA 4C4XA 1XQWA 1SCQA 1ETHA 5JZ9A 4AN0A 2XQKA 4E11A 4Y2VA 2YASA 2WIJA 1VE7A 2GYVA 1F8UA 5DNUA 2QJRA 3OURA 5K3FA 1Y7HA 3FYTA 3WA6A 4KR0A 4WFIA 2XUPA 4KRYA 1WM1A 3WLAA 1CUCA 1GPKA 1QIDA 1JKMA 4LYEA 4CG1A 4DYHA 4X85A 1XRRA 1MX1A 1CIJA 4BTLA 2AJDA 4C4YA 1XRMA 4C4ZA 1JJIA 1CV2A 4K6KA 3RM3A 3IUJA 1OXMA 3C45A 4PF1A 1DWPA 2YH2A 5IH7A 1LPPA 1LPOA 3KWJA 4ARBA 5JAPA 1EK1A 2ZVDA 1E89A 3P2MA 4WCVA 2GBIA 3R41A 1UK6A 3ZLUA 4UBJA 1THTA 3IURA 3DJYA 3R3YA 3WJ1A 5KWIA 4AB1A 1C7JA 3O9VA 1EVQA 2HA7A 5AKJA 4W1SA 2XLBA 1XKLA 1BEZA 1YB6A 3PICA 3HI4A 3IBTA 2H1IA 2X8BA 5LLSA 5CT8A 4Y2JA 2C4HA 1BN7A 4QE3A 2ZYIA 3DDUA 1L7AA 1TIBA 4EA6A 2XMBA 2Z8XA 1PV1A 4LIPD 1AX9A 5AOBA 4U2GA 4UFNA 2QUBA 3DOHA 4DIUA 1TKRA 1YCDA 4AZ3A 3G0IA 3H2GA 1VE6A 1K8QA 3BJRA 2Z3WA 3H04A 3IULA 1H2YA 4FDMA 5C8ZA 4BB0A 4J0GA 3C8HA 5A62A 5AP9A 1R9NA 1LGYA 2W6CX 5IVKA 2WJ4A 4DLNA 4IH9A 6YASA 2OXEA 1ZICA 1LBSA 4BAZA 4ZV9A 4GBGA 5AK3A 5JALA 3VXKA 3R3XA 2XUAA 4G8CA 2XQJA 4X94A 5HF9A 5AI6A 2H9YA 4LXIA 1P0PA 2C0QA 1ACLA 1XZFA 4OSEA 4QDOA 3WK5A 3WYDA 4NMWA 2FJPA 2QXUA 3DCNA 3O0DA 3OPMA 2DHCA
chains in the Genus database with same CATH superfamily
2O3QA 5JDCA 4Q3KA 1ZAYA 4KPYA 3QE4A 3QUCA 4X8LA 4IV8A 1MKYA 2B4YA 2GPTA 1CLUA 4HD8A 2V9PA 3H1GA 4GZ6A 4PAOA 5AM0A 3IJ0A 3F3SA 4HHEA 5F21A 3R8XA 4EB8A 2DERA 1E0JA 3E9CA 4LGVA 3DBHA 3EGWA 4Z9FA 4MCHA 3QHYB 1QORA 1WZUA 4AW9A 5K20A 3R7WB 2X0RA 2O20A 3RNOA 2E49A 1MP0A 2EKLA 3M6AA 3OFNA 3VAZA 5A0VA 4PNEA 4LSGA 4ZAGA 4Y7RA 1MXHA 5GXHA 3G2PA 1H2HA 2OVQB 2OXTA 1NUHA 1WRBA 1F6WA 1VBNA 1UWKA 3IDQA 2OK7A 4FBGA 4JN6B 1XVAA 1USKA 1BTOA 5K7SA 2V3CC 4HF7A 2KSQA 2YXBA 1K3IA 2YZNA 1SBIA 1ORIA 4R7AB 4DLKA 1NP7A 4M9XA 3MJDA 4W6QA 1XXLA 1DRJA 3DMFA 1E1CA 1KPIA 2WF8A 2F1IA 3EVAA 4NVRA 4KWTA 4BYMA 5EM2B 5IUNC 3ZD8A 4RY2A 2EJBA 4INPA 4Q4LA 4REOA 4CMIB 4GQIA 5J4HA 1I13A 3OF2A 4LKOA 5TGDA 2DSTA 3HY6A 3I2KA 4AECA 1Y1TA 1JIQA 1G8YA 2GESA 5CH3A 5T3UA 4ZDJA 3USZA 4GC9A 3RIXA 3SBXA 5KSWB 3STWA 1DINA 3MYYA 2ECOA 2D74A 1JR6A 1PFGA 3DLIA 3MMZA 1A5SB 1HYHA 3BMCA 3S8MA 1U4NA 1KNXA 3DNFA 3IB3A 2BCEA 2PT5A 5ESRA 3NDIA 3PS9A 1HE5A 4J49A 3GLFA 5E4YA 4U00A 1F6DA 2BFPA 1G18A 2C4UA 3HCBA 1QMPA 4URXR 3ZD6A 1LVUA 3G0GA 1WZEA 1PN3A 3K6KA 4GR4A 1Z4QA 4DCCA 3H4TA 1Y48E 2VF8A 3CE9A 3CH7A 4TTRA 4KW7A 5FFNA 2PX6A 3W79A 3WZMA 1SQGA 2Z2XA 5CYPA 4LQCA 1R0SA 1C3VA 3ZE0B 4QU0A 3Q3GE 5LBIA 1DFGA 4ZK2A 1A0RB 1JKIA 3PPIA 3UAVA 1EA5A 2RCNA 2OYCA 4P2BA 5IKPA 4IIUA 4N7BA 5CNKA 3BRSA 2HIHA 4IUBS 3ESBA 3I2IA 4Y2SA 5JUWA 1T6BY 4DREA 2FSPA 4I5GA 3SSNA 4Q1CA 4FDAA 1USWA 2O7SA 4HWRA 3FTEA 4IFIA 3P26A 1TJ4A 4XM0A 3WC4A 5GM2A 3RFHA 1RPZA 2MSNA 2QJWA 3TZHA 1JFFB 4PG6A 1I32A 1ITZA 1C5KA 3QG1A 4O59O 2DEUA 4BAUA 4EECA 2DQ4A 1V7QA 4DA7A 3ETNA 1ZLXA 2J87A 2KLBA 5EHXA 5FWDA 3HUEA 4FHDA 3GLHA 4LVCA 4GX2A 1OX4B 4OAQA 1E7MA 1IMOA 1HPLA 13PKA 4KXQA 1D07A 3I9FA 7REQB 2BI7A 3AFHA 5DLEA 3E48A 2NV2B 4LI3X 1WHSA 1EFPA 4XCQA 3CVUA 4ND7A 1JEYB 1HA3A 2EC5A 2VLBA 1JIIA 1IL0A 4AZVA 4CF4A 2XL2A 2B1GA 2OK8A 5FUXA 5JXWA 4GOOD 5DNWA 5K09A 4EHLA 1SXGA 2FSFA 2XAUA 3AEYA 1SAYA 2WSIA 4MVJD 2ZDHA 3P9NA 4YMHA 3EWEA 2A35A 2CVQA 2PKCA 4Q1BA 4YVFA 4Y1GA 2CW5A 3AC0A 5IVIA 1QO0A 3SN6B 5GINE 1KMHB 1L5FA 1I7DA 3KYCB 5ENDA 2GUGA 1X7ZB 2JH9A 2J46A 3RS3A 1MD9A 3RC9A 2H16A 2QD3A 3P2IA 4BXOA 3OUZA 3SP1A 1ISFA 2IITA 2PZLA 4LBZA 4DBLC 4PN7A 1KAQA 1BS9A 1NY5A 3KSBC 1WNFA 1YF3A 3W5IA 1UBKS 4J2HA 4C78A 4UU8A 4ZMBA 3WX0A 1PGUA 1Z6ZA 2GC7A 3DW1X 4RMGA 3FF4A 2V98A 1WD7A 1U5CA 2A88A 3A7EA 3GR6A 1PDOA 3Q7PA 3JQAA 3WS7A 3O8BA 4UTNA 2JJ2A 1UBMS 3M6LA 1SKBA 1SUIA 1KI3A 2BGNA 4F6LA 4Y8VA 1DPGA 3X0DA 4B6EA 2VC2A 1OC2A 2QUIA 4B32A 2GPYA 1C1DA 2Z5FA 4RGVA 3H2IA 1SQJA 5LLTA 2CNOA 2GM4A 1FTGA 121PA 1EDDA 3B36A 4LE0A 5LZ7A 1CUGA 5BW8A 1JAYA 3QWHA 3E2PA 2NU8B 3CINA 3UQZA 1IVYA 4KXYA 1G3QA 2HGSA 2JHAA 3K7EA 2Q99A 3Q3HA 3KD3A 4D44A 3GRCA 3RV3A 4J0IA 4IILA 5CFMA 5AW4A 3KC2A 5F9HA 2G8NA 3L6UA 2B4KA 1KYXA 2OHIA 2P3LA 2FG7C 2WZCA 4B8ZA 2DHEA 2R1ZA 2GWHA 1EINA 3PJRA 3PCXA 1C9LA 3NHRA 3UJ8A 4EIWA 3ZN2A 4FZRA 4BO1A 4BVLA 4GBMA 3IKLA 5FFMA 3IA7A 5FYQA 3HCAA 1M83A 3U7RA 1UL1X 2BJVA 3STTA 1M2JA 1VA5A 5DM2A 2E2WA 4LRTB 3MW8A 4O02B 3GLKA 4BMZA 2FZVA 4IIHA 2NGRA 3DL2A 5LBUA 1DELA 4MVWA 2V0GA 2WWWA 4D9HA 2J9GA 4JB3A 1SQFA 3PGKA 4QSMA 3LBHA 2H14A 1GSIA 4RHTA 2IYTA 5F23A 3PGXA 3H6KA 3R7FA 1FZTA 3R5SA 1RLJA 2V6GA 2ST1A 3M1AA 3PXXA 2OCAA 2XYIA 4KQXA 4MYHA 1M54A 3Q3EA 3ZJ4A 4DLBA 2PZGA 2HCRA 4EEXA 2FKAA 3A3KA 3HM2A 4UBKA 2QBYA 3N6XA 4TTVA 2XKKA 1Z68A 3CEHA 1F38A 5I7VA 1YHYA 1LDYA 4AYWA 1RWXA 3DBOB 2FLKA 5GWXA 5H0IA 1SA0A 1I4WA 4GR9A 4M87A 3LIPA 4RFLA 4U7HA 2YW2A 3UW3A 3MCAA 5ICMA 1PVOA 2EDCA 3R3ZA 2WDPA 5G1OA 3KXPA 4KREA 1X9HA 3RU2A 1ONPA 1CSEE 1G8HA 1PEAA 3T3GA 4YJ3B 2SHKA 4HB0A 1IK4A 4PYNA 4UFOA 4ZYLA 1ORRA 2PS0A 5G0SA 3BHMA 4O3FA 3HDYA 1TYCA 3KCIA 1RKBA 3ZK7A 4NR0A 5J2UA 1KEZA 4QBGB 3UMJA 1IUKA 3D8TA 5BV0A 3LY8A 4UEQA 3F96A 2C03A 4P81A 1NR0A 5AJYA 1U0SY 3CX4A 1RYDA 5B1HA 5GTDA 4OK5A 1HX7A 4KR2A 4RHXA 4AJ2A 3RU9A 4RHUA 2NT4A 3CW8X 1UAAA 4HLQB 4EF6A 1QE3A 3MZLA 3I23A 3PUYA 4IQ8A 4UU1A 5FA5A 2RBEA 1RQNA 2FJ0A 4I36A 4BMXA 5HKOA 3CVVA 1DZIA 1XAHA 3PG5A 3QOXA 1IAVA 4L16A 2HYEA 2V7XA 2R11A 5UKDA 3EEIA 5THKA 2AQ8A 4B6QA 5JAZA 1T2UA 3HPRA 2AG1A 4WKCA 1ZP6A 3LCVB 2CHGA 4Q4AA 6REQB 3VKFA 3KUXA 2BV3A 4XLTA 2PQ0A 3GEBA 4BX2A 5D5HA 5G1NA 1EQUA 1VPDA 3A6GA 4X7BA 3WE7A 4RVGA 1LDMA 3D3JA 5ALWA 3LLCA 1W36D 1IYZA 1RW4A 2ZTHA 1X9IA 2EATA 3Q8KA 1P3JA 3LHKA 5JNTA 1G0NA 4B3JA 3OC6A 1IN7A 2D2IA 2WFZA 3RYFA 4D9SA 3EI2B 4G4SO 3E15A 4DCNA 2O5EA 1ULHA 2ZIXA 3GXOA 2HMSA 4DMFA 2Q6VA 1HWYA 4CC9A 2VJCA 1D4ZA 1YDMA 3FOEC 1YVRA 2RCYA 2J45A 1JDUA 1TTQB 4LCEA 3CCBA 2Q62A 1P2VA 2PRSA 3DEFA 3G2QA 1MAUA 3GJ6A 3I32A 4QXRA 3RUFA 3ZCUA 4IEEA 4JH0A 4R51A 1DAGA 2NACA 2V3WA 4M9ZA 5TSDA 1S3GA 3TSYA 4PNPA 5EC8A 1QGED 1X1QA 1QOPB 2I2FA 2MCFA 4UCXA 2RD2A 1F6BA 1T8TA 1XZPA 3PKIA 1DZ3A 5DGCA 3PXTD 2HW8A 1T4MA 5JD6A 5KVSA 3MIZA 4PQYA 2F1JA 2HHJA 4MI6A 3EI1A 1NZJA 3RNLA 3FG9A 1NUUA 3PUHA 2Q1WA 4ZJYA 1JHDA 4HDQB 1GRRA 1A4XA 3DKRA 3RROA 1RWOA 2DFNA 2HF2A 2QE6A 3FNIA 1E9RA 1ODSA 2DFTA 2XZDA 1GNRA 2VEOA 4ND4A 1VLJA 1QF6A 2VT7A 3G9TA 1BYIA 2FR0A 2QTRA 1RLIA 4AMZA 1I14A 2C0CA 4XTCS 1ILWA 4JJ7A 2VDNA 2VYFA 5FI3A 4CIAA 5JH7A 1FDIA 4MRVA 3D3KA 3KRXB 1M1YA 1Q7BA 2AG6A 3T7JA 3DHWC 4DMRA 2XA1A 5B3AA 2KWIA 3KOXA 4OSPA 2DVMA 5H02A 1KO7A 5A4JA 2YHAA 1IZ8A 3U44B 3PXEA 5C7IO 1X14A 4CKZA 3TMKA 1KVSA 1P7VA 2CL6X 4JUAA 4LJ5A 4ZQBA 4XYGA 2ZJ3A 4C6TA 2MTAH 4P2GA 2EJVA 3I7NA 2P3SA 3ECCA 3CA8A 5JS8A 3SWWA 3R6DA 3NORA 1NLUA 4EQ6B 1G64A 2UZYB 5FLEX 4ZJZA 1XD2A 3BHJA 4BNKA 4EK9A 1B6GA 2XRYA 1GNTA 4PCUA 4JS0A 2LIPA 5TT0A 3U4MA 1TZKA 2DUWA 3EIFA 3NI2A 3QYAA 3KZCA 1NBMA 1PS0A 1K3UB 5DHFA 5ALHA 4TKVA 1K27A 3R5XA 4W7HA 1YIOA 2GBPA 4Z0HO 3LRXA 5SYNA 3V8QA 1Z2EA 4GMKA 3KSZO 2QR5A 2JB9A 3K9WA 3MUFA 2ZJ0A 1NQTA 2ZU6A 2CSUA 4XLLA 3ZX5A 4AO6A 4QYMA 3ZWLB 2O2SA 3IOMA 1HDYA 2XE7A 4F2HA 1XFAA 2D3TA 5BT8A 2NYRA 4LWOA 5ER6A 3HYCA 4J1TC 1KETA 4L9OA 4MVJH 3T12A 1VKZA 3C8UA 1R0BA 3JD2A 2ZBQA 2V97A 521PA 1SBQA 5CB6A 1NBIA 3L7OA 3OE1A 1CS4C 4MQFA 2BI4A 3CF2A 3FETA 4X1YB 4YTEA 2VJDA 3AF1A 1OAOC 4JHNA 1Y5RA 3EGIA 4YREA 3TIVA 4BJHB 1ENOA 5AVRA 1CRQA 2QS9A 4HXFB 1E3WA 1GTG1 3Q40A 5E1OA 3SDZA 5DM70 2HHLA 3UB4A 3O8DA 2FPIB 2QC5A 3WMXA 5EJ6A 3Q12A 3B7FA 2HSWA 3AX6A 2ESRA 3PKZA 4P4SB 3HJNA 3KQLA 1NPTO 2DPGA 4M0MA 1VI6A 5J2TF 1QZUA 3KE9A 3LCMA 1XB2A 1A9PA 1VHDA 2P67A 3KEQA 5DCLA 1G98A 5BSRA 1JWLA 4OGLA 3C7AA 3UF0A 3UJBA 2IW3A 4GM1A 4DBLE 4DXAA 4DIMA 4PLWA 2R751 2ZBVA 1XPRA 1AQJA 2IS6A 2ONZA 5KYUB 4WGGA 1JXAA 3ZW7A 2YBEA 3O4RA 4C7OB 2JJ1D 1TK9A 3TKYA 2BGMA 4EYSA 1QCYA 2ZJ1A 2XTAA 1W44A 1CY6A 1CHNA 3OWHA 4C4SA 1OA0A 2QU8A 3H4MA 3QX7A 4JMPA 1GUZA 2VT3A 2J33A 3H2YA 3HYLA 3I2JA 1VG0B 4OG2A 4BDTA 2JGJA 1I33A 1U7OA 2JPDA 1P5RA 3WICA 4RUKA 2QAGB 4NI5A 3PWTA 1GPAA 4FYHA 3LHIA 2AKEA 1KAGA 1PYDA 4G85A 4R9VA 4EDFA 2V0CA 4JJGA 1AS2A 1R8JA 2GBGA 3Q98A 4QKQA 4JBLA 4XJXA 5EM2A 5IM4F 1QE0A 3BD6A 2FU5C 1FP2A 3DZBA 3IVRA 3RJ9A 2QQEA 3QKRB 3GFFA 3ZBTA 4CMIA 2DXIA 2ZJAA 3JAWB 5D1NA 1GY8A 3OETA 1PJAA 1KQNA 1GZ4A 3A4TA 1U8CB 4NBLA 5H5JA 5KX5A 1W36B 5I9SA 4IG9A 1BVHA 4QTYA 3SDSA 1F0KA 3D81A 3U1VA 5CDTA 3OC0A 3QWAA 3ZW9A 4QEDA 2F67A 2ZWMA 3E3MA 3INNA 3Q0TA 2ODAA 2P2NA 2PQ6A 3NKVA 1Q1BA 3L0DA 2FN9A 3D1VA 3CLRD 4W63A 3OUUA 4HB3A 2NXEA 3E3LA 3L4SO 3HR7A 4MWEA 4XPZA 3E4DA 5KNBH 4YCAA 4AFNA 1LW7A 1NTOA 2GTHA 3JPYA 1RIFA 4CDGA 1QVRA 2X2EA 3ZHOA 2X19A 1MB3A 4N01A 4I79A 3G1UA 4G1UC 4EI2A 3UFXA 5LQDA 4IXWA 4B76A 4JV5B 2P4SA 4OHYA 1T5SA 3G79A 3OOSA 4ENPA 3UUWA 1SXJB 4C0WA 4PCVA 1IM5A 4IL5A 5DM1A 2O8BB 4W82A 1USIA 2C84A 1FXWA 3KV1A 3JYNA 1TNDA 2CJWB 5IKEA 4FR5A 3LKZA 3AVVA 3PIDA 2D2EA 1I6KA 2C3MA 2ZIFA 3BIJA 3PFNA 2N42A 4IV0A 3PQ3A 4R2LA 3S2FA 4Z1MD 1JFFA 1YE3A 4NAHA 2WU4A 4A0SA 4FS3A 3VUEA 2LCIA 3C1TA 4CCYB 3ULKA 4D4MA 1IZ7A 3HKDB 4PXWA 1EX1A 2H2IA 2RGWA 1LPAB 1WUTA 2EFYA 2YWJA 3BZBA 4LS3A 3CEAA 1QYIA 3TJRA 3ZV4A 4BRWA 4OYYA 4W9RA 2QNBA 2IIPA 4DIFA 4TTTS 4GP6A 4NZOA 2AYYA 1X1AA 2AYZA 2IZZA 4BFVA 3DEYX 3W0LB 3UIEA 4RTKA 2J6CA 1D6JA 4KFMB 5C7YA 3ANMA 3BWDD 4WI1A 1S1MA 5C1OA 1ZJWA 3R0VA 2YXEA 4PYIA 3CVWA 2OQRA 2LNDA 4U1EI 4I7EA 4L0CA 2AF4C 2Y1XA 4H7EA 2C98A 4X3CA 5IS2A 1E1RD 1EQAA 4LX8A 1WMSA 1ECCA 2X8JB 4H1TA 4HEHA 5IU6A 3H5NA 1JG3A 1N8TA 1QCCA 1IZ9A 1W94A 4X91A 4G5GA 4J75A 4J94A 3T7CA 2HH9A 4BNMA 4WE3A 3IE1A 4MPJA 3EZYA 1FS5A 2Q8QA 3RU3A 2HK8A 2CO0C 1FSZA 3NAGA 4IPTA 2R6GA 3DM9B 5HSGA 2CUKA 3F6RA 3GNTA 5JNSA 4W5RA 5AJXA 4C5CA 1LVHA 3UMGA 5KQGA 2YOHA 1KZ7B 1J25A 1LLQA 3LW8A 1L1RA 2I3BA 2X5OA 4PTLA 4DEXA 2E37A 2GM5A 3U3ZA 1XTTA 3TNDA 3E61A 5JDIC 3STHA 4X5OA 4ROTA 2AYXA 1I6WA 2O2HA 3L84A 3C7KA 4IF4A 1VSVA 1AY0A 1TC2A 2CNLA 3KTDA 4Q6BA 3W2FA 9ATCA 1QHEA 3WNVA 4KWIA 3ODGA 3ZLVA 3RSFA 2VC2B 3GHYA 3MD0A 1E64A 3EZ7A 4H3HB 4RPGA 3IXQA 1UPXA 1U2VC 4KXNA 4QGGA 1ISRA 1E79A 2PKXA 4F5EA 3SYTA 1C7IA 3NGLA 4I8IA 4AY6A 4G65A 4RTLA 3E81A 3FTQA 3WGYA 3AF6A 3ONVA 2PX3A 4EY4A 3AHDA 2EHJA 1ZITA 2WKPA 3DOCA 1LBQA 2Z0MA 3OQPA 3R7BA 3LPCA 1WP9A 1XEFA 4DQUA 2GPJA 2FX2A 3H5VA 4OQZA 1H4SA 3A6KA 4UBIA 3RE1A 3RRBA 3ZE7A 3EF3A 3JS5A 1X13A 1PHPA 1KVTA 3E5MA 3UJAA 5BWNA 4DNOA 5FV4A 3CZ4A 4XH9B 3U56A 1LNZA 5A2Qg 5K6RA 1A4RA 1MOPA 2B1QA 2FDRA 2JGDA 3DBIA 4U2DA 4CG0A 4ZJUA 3UAGA 5I6DA 1W4BA 1MTOA 3FZNA 4W4TA 2A0FA 3GDOA 2O48X 2P2YA 3NR2A 4EJ6A 3DZCA 3ORFA 1HV8A 3VR6A 3CTPA 4HKTA 1QHFA 3KJXA 1LBIA 3AUSA 4ZOXA 2WJHA 1U2QA 3O90A 1TDJA 4FDTA 1AKRA 5DP1A 10MHA 1PI6A 4RYDA 3G59A 2Z2KA 3JARB 3UJ7A 2FHSA 2FUNB 1XT6A 4LJSA 3AUXA 1CR2A 1OASA 1JIVA 2ZRAA 1QZXA 3N0EA 3OL2B 2D5IA 4G1FA 4J3NA 4ZZIA 2WYUA 3FCEA 4OZUA 1ISMA 4M21A 1UT8A 4ZVNA 3TB6A 4Z54A 3HXOA 4IIXA 2ONCA 1I8TA 5AM1A 1LSUA 1U2GC 2ADOA 2JATA 4OGFA 1AGYA 4D9MA 3R40A 4BV8A 5JAHA 5JXJA 4LNUB 1SC1A 2GA9A 1OTYA 4XR9A 5JYDA 5H1MA 4CEIB 4LZZA 3NVQA 1D2EA 2PK3A 4PSUA 4DWOA 1SVKA 2RHBA 3ENNA 4GRAA 4QFCA 4UJ3A 4DB2A 1E9FA 1J6UA 4YMIA 2Q3CA 2O0KA 1NF3A 2NX2A 1HK7A 4H27A 4CKXA 2R44A 1FNMA 3LQRA 5KQRA 1AXEA 1EK0A 2V5VA 1A9YA 2COUA 4YP5A 3TQOA 4E33A 1YOVA 4GFDA 1UBSB 1H6DA 5DBOA 3T4UA 4OJNA 3LK7A 4F60A 1RR6A 3WIVA 1ZR4A 5FFOA 3L07A 4AX4A 4JGIA 2XB2A 1EWQA 3R7LA 1DDOA 1E2QA 3ELDA 2PS1A 1X7XB 4JASB 4OKSA 4WCFB 1P22A 1XMXA 4MS3A 4CIDA 4YCDA 4RA9A 2Z8YM 5ILQA 3ZY3A 4CUZA 1GUBA 1NI4A 5IJ9B 5AO9A 2RIRA 4PY2A 4X60A 3T0IA 2AMJA 1FMLA 3IKMB 3M7IA 4OTZA 1F5SA 4XGIA 5I8ZA 4AZSA 4DDMA 3HQ4O 3DPIA 1L8LA 1R27A 5AVOA 1OXVA 1N0UA 3FTDA 3AP1A 4MRPA 1Z35A 2FPXA 2I4TA 2WJAA 2ZS8A 4TWZA 1Z28A 2VP4A 2ZKLA 1U6KA 2HCFA 4NV1A 2NV6A 1XLVA 2G5PA 3PC8A 3QJ5A 4QDKA 4TV8F 5KBYA 1XPUA 2VF2A 2VRWA 2BFBA 1DMRA 5KU7A 5I7HA 2ZBFA 3A0RB 2CLLB 2C29D 2HB6A 2X9GA 1UBCA 3GNQA 4L4XA 3E9RA 4XYBA 4R40A 4QDUA 5LD2B 2R2AA 3BEDA 2IEZA 2YIDA 4YRQA 4BE4A 1QOZA 2TMDA 1MAVA 1XMQB 3ZDQA 5EQJB 1FQJA 1ERJA 1RWQA 4Q01A 1KJ8A 5KPDA 5IFKA 3MA0A 3W5UA 1E7WA 3JVVA 1ZL0A 2IYVA 5JBNA 2GTPA 1GXSB 1T25A 5IKOA 2CT8A 2WM2A 5D2CA 1H22A 2B20A 3FWHA 1QG6A 3CO0S 4MKRA 2I3TA 1RXSA 2CNWA 1Z5NA 4QFMA 3OZEA 2X42A 4TS4A 1A7AA 2FAXA 2RAFA 2QRMA 3AB7A 4JUIA 4GM9A 1OFVA 3U7QA 2YFKA 4EG4A 2OO5C 4Q9NA 5C53B 4WT7A 4UUOA 3FFBA 1Y9AA 1J06A 4G5SA 4MJXA 2FRDA 3TD6A 3CW2A 4JU8A 2NU7A 1JU4A 2BKUA 2XTZA 5SV2A 3UBMA 3LQ4A 4MK4A 3RKRA 1FFDA 5TEVA 5A7FA 3PUXA 2ZTLA 1U1EA 2FEXA 2WG2A 2PMKA 3M49A 2G9UA 1B8UA 5DT9A 4YAIA 5JYEA 4J0WA 2DWUA 1FXSA 1A8UA 2HBRA 4HGPA 1ADGA 2FPWA 2D00A 2P5TB 3OX1A 4L8VA 4NPCA 1UOQA 4HN2A 4URVR 2XZLA 5NLLA 2WABA 4H7HA 3NONA 5JEEA 3LFUA 4GQ1A 3Q9SA 5TEWA 4K3VA 3M1YA 5AVWA 4E5SA 1JQAA 3MTQA 4B1FA 4MLDA 2Y6UA 4KODA 2J5BA 3JQQA 4YEDA 2A4KA 5BWBA 4DUGD 2VDNB 1UC5B 4IX1A 4X64B 4TSRA 621PA 2W90A 1Q57A 1XHLA 4ZMRA 2Q4BA 2KHZA 4PBTA 2ZYDA 5F98A 3NHAA 2O8FA 4JJEA 1A77A 3A27A 4GVLA 4P4GA 1VI2A 2CLMB 3K1TA 2OQIA 2QT9A 3NWOA 4ERZA 4RTRA 2FGJA 3QFFA 2FWIA 1XZNA 2FSUA 3CPJB 3U81A 4LHSA 2PSSA 2EXXA 2YMQA 2J41A 4KPEC 2H2AA 3CZPA 2ZB3A 1QVAA 4MARA 4RVSA 5ER9A 2AJBA 4JQZA 2JFGA 3RAEC 4N18A 1JJUB 2JF0A 1LZLA 2BFNA 4WXHA 4H1WA 2H9MA 1Q83A 3PQDA 1R4ZA 3H99A 4TMKA 2PO5A 2K2WA 5JVDF 2Q3JA 1H2EA 1Z6GA 2QI9C 3EH1A 3FPFA 4M49A 4OAPA 5HF5A 5IAJA 4ALJA 1R5MA 4G4JA 2BM8A 2V74B 4X7PA 4B7AA 2C4KA 4OPMA 1VI5A 3LUDA 4NYMR 2ATVA 2P35A 1KTIA 3A70A 3S6JA 3DWFA 3M3HA 2IS4A 2X6QA 5C35A 1M9NA 2XGSA 4DYVA 3A9SA 4I3HA 3BXEA 2P4HX 3UT6A 2ID8A 4HBZA 2IUTA 1NFQA 3PNYA 1H8EA 4GDFA 3HSYA 1Y3DE 5HTOA 1HLPA 2JZOA 2WVHA 2R96A 4NE2A 4P7BA 1K68A 5TDHA 5KTRA 3TSCA 3D4LA 5FLYA 3SYRA 4WOKA 3SHWA 3JATB 3VYSB 1DC6A 4M1SA 5JZBA 3F49S 5DHRA 1WLYA 5TMEA 5LA6B 3EDOA 1GZ3A 5PGMA 1CUSA 2PTGA 3VQTA 1UKZA 2VTDA 4IEFB 5B7NA 4OHXA 3CFYA 2VAXA 3BK1A 3IVAA 1L5YA 1JFSA 3LPMA 3CLUD 1NBWB 3F46A 2PUVA 3FNBA 4Q34A 4TROA 2C97A 4BFLA 4TXNA 2O52A 1BRTA 1V16A 2C7RA 1YQUA 3IUYA 4C4YA 4DN6A 2CLKB 2FP4B 4JLAA 5EZYB 2WWVD 1GP2A 4K3JB 4RSMA 3FKJA 4DCPA 1AMNA 1AF7A 2JGAA 5FWYB 2O0HA 1QM5A 2DBRA 2FX5A 4K86A 4JI3B 3AF4A 1YUMA 1W73A 2W8BA 3RFVA 2ZP1A 2GPNA 1KXZA 1TOAA 2GNOA 2QMOA 2YS7A 1SD2A 4FQ7A 4REMA 3SX4A 3ITKA 1RHKA 4C7OA 1Z63A 1SXPA 1OAOA 3URMA 2BF7A 2NTJA 2FQYA 4EAAA 2X0NA 1RSZA 5CLQA 1KQPA 2YWBA 1TAQA 5HPYB 4WBNB 4OJKA 1Y8AA 5TVGA 4UI9R 1X7HA 2CVFA 1PNVA 3RAGA 3SZRA 3O8QB 5DN6D 1ULZA 4DNXA 4QXMA 4DW8A 2WP8J 3OEYA 2FN7A 4O5OA 3OU2A 2SCUA 2X58A 3G9XA 3OCWA 1DV2A 4HZUA 1WMAA 1P1JA 2PXXA 2G6TA 3A1VA 5LP6A 2W2MA 1VOTA 1ODIA 3V7NA 3OKYA 1X87A 2PSJA 4ZYYA 1SUFA 3DCYA 3OTIA 5EUQB 5I7SA 4MWCA 5J58A 1VHJA 4P0QB 4KGVA 3ZDYA 3THSA 2C78A 3V5NA 3P0EA 1YC5A 2O9JA 3PC2A 3JZIA 2BFMA 1JQ5A 4YI3A 2RHLA 1OXBB 2X77A 2VPTA 5KTKA 2G71A 3DD5A 3OKCA 3ROFA 2B5LA 5EERA 3WLHA 1V1RA 1TCAA 2M6LA 3CISA 4CGYA 1YBAA 3VKGA 1QF7A 3DB2A 2JGRA 2R6AA 1KU6A 4MQ6A 1T9CA 1NXPA 1KZ6A 3DFUA 4ZOYA 4O6VA 5AFU3 2BFOA 2RHOA 3PU6A 3R3SA 4ZKDA 2O07A 2Z2OA 3KALA 2FE4A 1M2GA 1XD9A 1JI0A 1XHEA 1KBOA 2R60A 2A14A 1M66A 2BFCB 2WIGA 1MGOA 3U7IA 2PLNA 1TX4B 3IYLW 3HB4X 1QTQA 1Z7BA 4JWKA 2IU0A 3MOSA 2H5JA 1JR3E 2DTEA 2HF8A 2AKAB 1G3MA 1NRWA 1YQ9A 4Y1RA 1PF7E 1DS6A 4MGEA 3ZZMA 1E3SA 1YDFA 1PGQA 3C6KA 1NOIA 2MSEB 3DDCA 2GN2A 4JOBA 4M55A 4J2OA 2VFAA 4Y2XA 1DKMA 5CIWA 3WQHA 2WINI 3AETA 3IT1A 2X9QA 1Z4IA 1A97A 3WRXA 4B6JA 4BWFB 2I6SA 4DJEC 4Q7QA 5COQA 2JCXA 4Y30A 5G3ZA 1Q22A 4NOKA 1PQWA 2I3ZA 4XA8A 5IUKC 4DQ0A 1XMIA 3G8CA 5IT4A 1Y6JA 1ZH8A 3H2JA 4JEIA 4OXNA 4OU5A 4UPVA 5CVUA 3M4YA 4FNGA 5FXMA 1KDRA 1KH2A 3A9RA 2RHCA 1X1SA 4GRIA 4GPAA 5F9MA 3UNXA 4RTNA 2WT8A 3ON5A 5BYKA 1AKWA 2W37A 3HPQA 4M53A 4P0TA 1XRSB 3U37A 3WLFA 2PTHA 4BNGA 1ZD4A 2AT1A 2WU3A 2NVUA 1R00A 3I9V1 3PUZA 4WY5A 1IWBB 4F3RA 4F2WA 2W8ZA 5DHAA 2ILVA 3QVKA 4BFUA 1A71A 2WD7A 2XBMA 1OAKA 2DPYA 1AGNA 3OZAA 4H4EA 2JI6A 2FWJA 4O2BF 4KL8S 1BE6A 4XWGA 4N0QA 1GAEO 3DXZA 3ZZ1A 5EJ7A 4FOLA 4E88A 1XEAA 1YA6A 2H48A 3LPAA 1UOPA 1MJGA 1XYGA 5DT2A 4R8KA 3PGA1 1BW9B 5A2GA 5ICSA 5A9SB 2WUGA 4JLSA 2CLDX 1UBRS 2VTEA 2ZYGA 2HGZA 4YRCA 3NFYA 4PGMA 3OJXA 4KQKA 1VIYA 1GL3A 5KSOA 4JXKA 4X1IA 1T5BA 2REOA 2W2PA 1ULAA 4MGHA 3A4VA 4K6MA 1J7KA 4XX0A 4WKOA 5HE9A 1L7OA 4E0BA 4EW3A 2C96A 4C6SA 2IOYA 1R8XA 5AVXA 2ZRNA 5C31A 1TPZA 3GFQA 1V4NA 2YHIA 1Z5GA 4ZDIA 4Y2UA 1KYQA 3EAGA 3OAAA 3ZW8A 2AFRA 3OLWA 2AOXA 4PV7A 4B48A 4EUSA 4KSYA 3NM6B 4YWHA 1ZU5A 4D26A 1WULS 1Q2XA 2ZSIA 3IIJA 2FMHA 1EFVA 4KQWA 4O8CA 2BFAA 3DYVA 1GVHA 221PA 3N2KA 3E9YA 2EFCB 2WJ3A 4QOHA 4LOLA 5B4WA 5EE3A 3C41J 1WCWA 1S2IA 4EFDA 3SWSD 3PI6A 4YJ2A 3KDAA 3IJEA 4DHWA 4CMAA 1G20A 3HP7A 3V6MA 4GI5A 4BV9A 2DR2A 3DL4A 5T57A 1PQPA 2Z95A 4E5ZA 3I6BA 1G66A 1TYEA 5IJ7E 2R8RA 4R7TA 3WO0A 4LY3A 4AF7A 1YRHA 3E22B 1KEVA 1MX5A 1NVUQ 1YMVA 4UDXX 4B2LA 2ONKA 1P0CA 4PR3A 5F1PA 2H4YA 1ZK1A 1VGQA 3PVZA 1R0CA 2Q6TA 4AG6A 3PENA 4P34A 4D96A 2G76A 3L8CA 4RFSB 1FQWA 1NVTA 4JSPC 2QRZA 3GZNA 5A4IS 4E4YA 1NL3A 2DQSA 3AFCA 1FDOA 3K0CC 4FP9A 2B9VA 3F6PA 2I7DA 3F7OA 4IO1A 4KAFA 3OL2A 1EIWA 2AXNA 2ODPA 3PNBA 1PZGA 1L9XA 2H9AA 4IUDS 3V9PA 3VH1A 1TE2A 1NG1A 1MORA 2IHYA 4HDRA 3DJFA 3AKEA 4TRMA 1LFAA 3A28A 4R8MA 2OWDA 3CX3A 3JRWA 5I5GA 2FUG1 4B82A 1V3QE 3C70A 1RPNA 3A2MA 2IE8A 5I7OA 2D5LA 4HLDA 1UR5A 3R3VA 3OKTA 1G7SA 2V54A 2XXJA 1GLGA 1UOOA 2MR6A 3B3JA 1HNZB 1YGPA 2AOTA 1D5CA 5AKYA 1KO8A 4XYHA 1LWNA 5FI5A 4EHDA 5LKRA 3GAAA 2PLFA 3U13A 2EZUA 2VUSA 3OIDA 4D4IA 2P30A 1DC8A 3DAGA 1XSEA 3GMSA 3L7IA 2I3GA 3V7YA 1SUDA 1J0EA 1DIAA 1YOVB 5GJCA 5JS7A 4YMVA 1CUXA 4EW2A 4Y2RA 4EY8A 4EZBA 3COSA 1SVOA 2JFNA 3BVPA 4I55A 4X63A 5SY9A 2ACKA 1XEXB 4CY1A 3U17A 3EMBA 1WO8A 2Y3IA 4TWJA 1FJGB 2QAJA 3R9KA 2Y66A 3KJNA 3OF3A 3MWYW 1WABA 4AJJA 1W6UA 3H0EA 1OZAA 1BA3A 5CVCA 3AHEA 3SEQA 5KHAA 3BWEA 3L6DA 3PJDA 5LWQA 4A36A 3LF2A 1C3XA 1FUIA 4MR9A 2IP4A 3IUPA 4PHGA 5AKGA 5B1DA 3K96A 1K6IA 3KLOA 3PDCA 3IAS1 4J16C 4ZYWA 2WDZA 1DKLA 2XUGA 5IKMA 2BGUA 4WESB 3IBGA 3N53A 2GK4A 4ZIRA 4XQEA 2R6HA 3F4BA 3E1SA 1NQOA 2IY9A 2D0DA 4HS4A 4P9NA 1QIHA 3SEFA 5FX2A 3WIDA 5DGTA 4ND1A 3JAMg 1XF9A 1JMXB 3GL9A 4UHJA 3K71B 2O3TA 2IH2A 1WE2A 1GCOA 2EGHA 5HRUA 3KKLA 1TF5A 3LUAA 2CV1A 5I7RA 1A98A 3FWPA 4ZALA 1NVDA 4PIPA 2Q2QA 4ID9A 1IBKB 1Y8ZA 3O21A 4LQ4A 2VJAA 3RYHB 3JSAA 2QMUA 3JQCA 3QHQA 1ADYA 3FCSA 4U5XA 3Q5GA 4X1OA 4XDGA 1HYQA 4XUCA 4DSUA 2VA8A 2GASA 3ICEA 2WR8A 3GUHA 4CMKA 2W6IA 1RKVA 1W52X 1AIPA 4Q39A 5A4AA 3HNRA 1JBKA 4G1EA 2PFSA 5KJCA 1VJDA 2ZWPA 3DC2A 2WFLB 4OHKA 1ORVA 2BL4A 5A3VA 4N47A 1U7XA 2GLTA 3E05A 1RWPA 1KEEB 5HGJA 2F00A 3KT0A 1YRWA 1E7SA 3AVOA 4E51A 2O8VA 3I1IA 4F0JA 1DUVG 3NLLA 4R1UA 1J2JA 3B6MA 3V4RA 4WZBE 4YAJA 1QAQA 3PX7A 1ZS9A 2ZB4A 3D1LA 3D0OA 3E5HA 4XYLA 4KFCA 1ZGCA 3LXUX 4Y9DA 1W0JA 4I08A 3QWFA 4U2KA 2ZSKA 3ADCA 4AY4A 4L3GD 4IINA 4HNAA 3O4IA 4G5FA 1T3ZA 3WXBA 1MRZA 1NQAO 3KZ1E 3UAOA 2JGNA 2PUEA 3OQOA 1VCHA 2JIPA 2NU6A 2VJMB 2W6QA 1Z74A 3GXBA 2ONYA 3FA2A 1M72A 3OIGA 5CLGA 4FX2A 3IP8A 3TKLA 4CM1A 3LRPA 4WEOA 4X90A 2XXBA 1IY1A 1ZD2P 2ZIAA 3RODA 1P7YA 4DARA 5F2KA 5AXAA 1H2AS 4GZLA 4NS1A 4PRZA 1E4VA 1CE8A 3WJ7A 4BVJA 4ERQA 3AEKA 3TQHA 2H7VA 3BJMA 1TGVA 4EX7A 3P2KA 4NF2A 2GBLC 4KRGA 1G2IA 4WADA 3EVNA 1QP4A 4MLCA 1JEDA 5K0NA 3EEYA 1PDVA 7MDHA 2B6HA 4ETMA 3JALB 2B4QA 4PX9A 1X1EA 4EHFA 1PS8A 2LIVA 3PXBA 4QPDA 4NU8X 4NZNA 4KR3A 4MYDA 4FGKA 3LKVA 3TPFA 4F9TA 3QFCA 5DNYB 1MDBA 2Y1KA 2VKQA 3I61A 1Z83A 2GK7A 4JVLA 2DPHA 2ZUFA 1K7XB 1J09A 1RI1A 1SKAA 3B7PA 3G8DA 3GK3A 1DJQA 1CUWA 2Q07A 4RVDA 3IR6A 2PSFA 8ADHA 1EJ6A 4MUHA 4RLSA 4YP9A 3RUAA 1UBNA 3C5CA 3IUQA 4CDRA 1H9AA 2BSQA 2G8LA 3U7EB 1JN0A 1SG9A 3B6ZA 3K1AB 4PC3A 3RAPR 4G2NA 4FFWA 4B3MB 1E32A 3MHTA 1S4QA 3VPFA 3V7UA 4EBFA 3TXAA 1G8AA 2OCLA 4GW3A 4FKZA 1J9GA 1ZJJA 2W22A 5SZIA 1YMUA 2C4VA 4JJKA 4J7XA 4CKWA 3VU3A 3TBKA 3VC7A 4EELA 1P7CA 2AD5A 1JHOA 3TSOA 2IYZA 2PJUA 2QXVA 2FTKE 1JJVA 1LK7A 3C6QA 3U4IA 4QPZA 2QTMA 4XR4A 5K6AA 3K6SB 3KPUA 3VSBA 3B8EA 1XNJA 1B8OA 4MV6A 3QFHA 4OP1A 2XJ4A 5CXBB 1ZCZA 3VR2A 1WMBA 4YBZA 5KOIA 1EK5A 3F7TA 1CQJB 1KQOA 2AR7A 2IYEA 3I9LA 1AKUA 1L5HA 1XKQA 4LRUA 5FL3A 4GXRA 2QMHA 4B6GA 3R2JA 1GZHB 4XRRA 3FCYA 5EESA 1W581 2J4FA 1ML3A 3UWKA 1Z0DA 3ZTTA 4AKEA 4PEVA 2O19A 1K92A 4JC4A 4C7XA 1O94C 5JCOA 4B34A 2WVAA 2XGGA 3PWKA 1XNGA 1R1DA 4A7JA 1Q19A 2V5AA 2QQ0A 1CC1S 1LKZA 3EVGA 4B35A 4OF4A 2P9IC 1YVPA 1NNSA 1KMHA 3IHKA 4O33A 2ES4A 4DKJA 4NABA 4QA9A 4PX5A 3KHUA 4TS3A 1DAKA 3RFXA 5C8VA 2I1LA 4AJ9A 1ZM7A 3IUBA 1XALA 1K4YA 3O8QA 3R8CA 1VE9A 4PGGA 3URKA 3C6BA 2TSYB 1SH7A 3EWAA 3TDKA 3ABZA 3EUEA 2H5LA 1NHGA 4FYPA 5IULC 3AL8A 3FIUA 3GD1I 3RASA 5K1ZA 2R8EA 1PJTA 2W6JD 3IIIA 4ZVSA 1PJ3A 1ZI9A 5LP6B 1G19A 4P5EA 5AW2A 1VYUA 5A4MS 2OMKA 4WFQA 4GMXA 5FFGA 1ZESA 2G5CA 2W70A 4C03A 4CLXA 1PG0A 2QQFA 4QYXA 2CK3A 3FAKA 2R8OA 1F3LA 5AI5A 1QZ3A 1N6FA 3AKCA 2ONJA 4X6UA 2HLNA 3I09A 4PG5A 4UJ5A 4JEUA 1U3CA 3I6YA 3AONB 1J8YF 1N6NA 2JFYA 4C3VA 3NC4A 2H9PA 1QQ5A 3T99A 3SQLA 4W99A 4JUDX 3ZV7A 3G6KA 5ARDA 3DXMC 3CF6R 4WZAE 2HO5A 3LXXA 4H5JA 3OQBA 1CVIA 5ALQA 3QJYA 2VRBA 4B46A 4CL2A 1YS1X 1YR8A 5JE8A 1PCXA 5E95A 1JV2A 1E3LA 1YB5A 1IAQA 1MEOA 4Q9DA 3ZDXB 3ECSA 5K3DA 3S2UA 4MUAA 2VBCA 1KSHA 1THGA 1VMKA 3GEEA 5FWAA 1HE4A 3SSAA 5REQB 1I1QB 3ASVA 2BFCA 3GUVA 5BOSB 3NHBA 3NOVA 4ICIA 3EVCA 3KJEA 1GQSA 2CVHA 1EZZA 3F8SA 4UTVA 4IDQA 1T2NA 3GBPA 1GQ2A 5DX8A 1JQKA 4UVHA 2G9NA 4E5KA 1AKEA 3MLBA 4JCOA 5FLXg 1ZWKA 3KNZA 3RF6A 4PGAA 2P40A 4CFSA 5JBIA 2R5FA 2BAGA 1JIKA 4DILA 2YWCA 1LPSA 1HMPA 2G09A 5FB3A 1H05A 2G70A 4MQLA 3X1YA 1CP2A 3U48A 4PLZA 1ETUA 1PL0A 2OCBA 4PS1A 1PBTA 3ZE2A 5HZMA 5LZ9A 4EH1A 4IIFA 1YL6A 4JKYA 2RFLA 3L0CA 2QRGA 1U8YA 4UQPA 5JMPA 5C1PA 3B1KA 4W5QA 5EL0A 3J80g 2PUDA 1Z2CA 4L0QA 2PD6A 4E3ZA 1PNRA 1ZXLA 4UBNA 2C2YA 3NXKA 1PZXA 4OMFG 5KC9A 1NJ6A 3C1OA 2QGNA 4M9QA 4XSHA 2IFTA 1BQ3A 1WKVA 4X00A 4JFAA 5B7QA 4MHTA 3S8YA 2H47A 5K3AA 5HS4A 4S1VA 5ERYA 2A1TS 3TW6A 1L4YA 3L4KA 3G1TA 1E6MA 1HBJA 3F5QA 4A5OA 5MF6A 4B73A 1KY4A 3RTDA 2ZYHA 4F45A 2HYIC 2D06A 3RV4A 3W4IA 4FGWA 1IY8A 1K97A 1L4HA 1RRVA 3I9OA 4FMCB 4UE2A 4XWYA 2Q1YA 2ZE6A 4E07A 4CETA 3OG9A 1P7PA 1UFRA 4LF7B 2Q3DA 2VATA 5ITZA 3ZGNA 1YJQA 3KOMA 1PL8A 5FA5B 1QG2A 5HBRA 4B3XA 5BMOA 4IJWA 3L18A 4DZRA 4I55F 4OREX 4EQZA 3CHYA 3HFQA 5KUTA 2Q4RA 1R4MB 2VHYA 1UQRA 3A1CA 5FD8A 4ODIA 3OKWA 2QQGA 2I33A 2QL9A 3IP3A 4DDKA 1PJCA 4ARVA 1FFWA 3NAZA 5GJWC 4K1XA 1B1CA 4CDMA 2WQ6A 5HYNB 1WV0A 2XXAB 2AA3A 2PM8A 3FHJA 2OV8A 2R68A 3O8LA 4N1AA 5BRNA 5LXTF 4IFBA 5E8RA 1V43A 4EKNB 4BNYA 2GZ2A 1M2OA 3H05A 5IG2A 1IBRA 3C3XA 1RM5A 2YHIB 3E8XA 4FNAA 4TVKA 1RMTA 2PV7A 3NHLA 4GX0A 4ZRMA 4ZT3A 1UEJA 3I01M 5K8VA 2ZPTX 1DOHA 4YLGA 4WL0A 5HS6A 1MC8A 2QD4A 1KDVA 1P75A 3WV4A 4CQMB 1D1QA 3GX1A 4EB0A 5GY7A 1YFJA 4B74A 1H1LB 1U28A 3QHPA 5DK4A 3H5LA 3SOZA 1JDTA 2H7CA 1XTZA 2WA2A 5JROA 1AS0A 2IZ1A 4FU0A 1UFKA 3SZ3A 3T7EA 2WSYB 2XVZA 3IJEB 3MAAC 4GKVA 3HJCA 4ZT7A 5BMVB 4Q18A 2ZDQA 3LQKA 4YALA 3F4LA 1QDEA 5F3RA 1EEHA 2H7YA 1Y1RA 2A9QA 3A31A 4Z0NA 3SJ7A 3AKZA 3QPBA 2Q50A 3BE8A 4OHRA 3N74A 2PZAA 4YCJA 3H5TA 1WSBA 3AGQA 3K2EA 3W2IA 3K70D 1TT5A 1WCIA 1HDIA 4PNZA 3W5JA 4TYQA 1BE8A 2TRSB 4TMYA 4DLWA 3EPRA 5HEKA 1F3OA 2UVQA 2OHXA 2XTMA 3CPEA 2J57G 2P41A 4K46A 4ETWA 2BZ1A 4ZOBA 1JIUA 4JIMA 3SSOA 1FFYA 4XWOA 3MVDK 3EI1B 3LBYA 5D7BA 3NC1C 4K87A 4K9DA 4KLAA 2EJUA 4OU4A 5I9NA 2VPQA 3UWMA 3WOHA 3O93A 4FPXA 3K30A 3TYXA 1FU7A 4I50A 1CUFA 1CRLA 1Q5PA 2CDCA 2J4DA 3K16A 2NUTB 3B8HA 4MZDA 2G9AA 3WV5A 3ZNPA 3O4VA 4NK4A 1V8FA 4TTAA 3W6OA 4MQMA 1HNNA 3H87A 5EZQA 1HDEA 1JAXA 2Y1OA 1HDZA 1NXSA 2YUIA 3OD1A 3Q7IA 4IIEA 4MWDA 4A1OA 3WLQA 2OVBA 1PNTA 4B44A 4TMFA 5IYZF 3F3GA 3JVUA 4M1OA 5BWOA 4CUJA 4EZIA 3WBBA 4D4LA 4UHCA 4YPFA 4ASUA 3I2HA 4MW9A 4CGZA 1DUSA 5KINB 2AHOA 2OLJA 4PAGA 4DV5B 5HJEA 1B3BA 3O31A 4LRYA 1N78A 5CB4B 1T2VA 4JL5A 1CY2A 4X63B 3LNCA 3K0HA 2AW5A 2L82A 5EJEA 5H3LA 2OT3B 4P0PB 4D6XA 2CWWA 1IATA 2HAEA 3QBVA 2OBYA 4KV9A 4PYLA 3LCRA 4IOJA 1AZTA 2YWDA 4Q82A 4RLQA 2Z98A 3B1VA 4ZANA 4F38A 3ADOA 2H8KA 4GGPA 4IIVA 5EAIA 4V3CA 1JQBA 2XNSA 2GEBA 4H16A 4R05A 1Z2OX 3O3OB 4Y98A 2PZBA 4NZYA 2ZCUA 2Q1XA 4BMOB 3SY8A 2OKGA 2AMYA 4FA4D 2COKA 3E3AA 3P9RA 1N7GA 5ALTA 1G6Q1 4F9FA 3AFMA 5AI4A 2XSZA 4G25A 3OJ0A 1KP3A 3V4VB 1G21B 1C1XA 3IO3A 2WG1A 4GVXA 3QU4A 4BOYA 2H1LA 2QRNA 5ARCA 1GPWB 2OCYC 5EINA 2HT1A 2HDNB 2HU8A 1UBFA 2WWFA 2X14A 3ANYB 1J2EA 2HA2A 2Q1UA 2J6BA 5I4BA 5K03A 3K71A 2GEKA 2W6ZA 4CBVA 3N28A 4PO3X 2FSVA 1HEIA 3PA6A 4ON9A 4MQFB 4X1YA 2HKMA 4KE9A 3AF0A 3QE0A 3WOVA 3EX7C 2VK8A 4OQLA 3NT4A 3SXTD 3IDOA 1XMSA 5AK4A 5JSQA 3PB3A 5ALKA 1L7VC 1T0BA 3CXRA 2I71A 4CMGA 3N9IA 5FULA 4DMUB 4E46A 5K6TA 2VCYA 2JASA 2IPAB 2IKSA 2FWMX 2O23A 1H0HA 3PEVA 3QU7A 2PWYA 4TMWA 1E7QA 4DWVA 2G3YA 2QU7A 3GP5A 3KWFA 3P1JA 1S8NA 2A1TR 2ZLBA 1Z2AA 4HGRA 1CUIA 1ZVKA 5ESXA 4AXBA 3NKFA 4RH0A 3IBYA 1SR8A 1QQTA 2JC3A 1PR6A 3PIRA 1P9OA 3DCIA 3MJEA 3QLJA 3TGWA 2LKCA 4G5OA 1DRUA 1KEEA 4L02A 2H3HA 3OT5A 4XW2A 2NYVA 4FHEA 1YS9A 2FG5A 5A4FS 2OE2A 3GVIA 3HWWA 3VM6A 2JKVA 2VSFA 3UWDA 2AI2A 3V2HA 4M8SA 4DLAA 1JLLA 3ZWVA 1O3YA 4EB6A 5IX8A 1XTQA 2FJUA 4AUNA 2UYOA 4LOKA 3TW0A 1UTCA 3AR5A 4QIHA 1D2CA 5FUBA 3ZWPA 1MC1A 1SZDA 1PUIA 1KXJA 2A9FA 5LUBA 1GZ6A 4TZTA 3ZI7A 2J9FA 2VDMA 3MB8A 1A5TA 2DTXA 1YONA 2IYFA 2NU6B 2VJMA 1MF7A 3H13A 4LDAA 4N3BA 3SXJA 5GGXA 4QJ4A 3CIOA 1WXXA 1LNSA 1REQA 4R0VA 3TCXB 1OKKD 1P2TA 4KUEA 2H1OA 2D4AA 3VDNB 5FOQA 4RULA 2GAIA 1KKMA 3CLVA 5CTJA 3RWBA 1G38A 3VR6D 1B74A 2VP2A 3C0KA 4MSUA 5KYNA 2FQWA 2P8JA 3JXEA 3NEJA 4LZOA 1HEUA 1ZA1A 4JGGA 6PFKA 1GIAA 2BTQB 5ALEA 1ZJ4A 2XOXA 3FVVA 1IDN1 4EZEA 1JI3A 1NVKA 4JROA 1G21E 4BYGA 1CXZA 2XCUA 3AVTA 2C9ZA 3BM5A 1NBAA 3R6GA 4G1MA 3AK4A 4KYVA 3WIOA 4N8EA 2WQ8A 1HY3A 1JQLB 2I03A 2ZJFA 4GMHA 1Q0TA 3FBWA 2OENG 1BC5A 4RH1A 3EXHA 1TW3A 2AUMA 5LDGA 1F0YA 1ZK4A 2VPYA 2ZOSA 5F7JA 3EIQA 3UVNA 1S8OA 4AJ4A 5I8WA 4ZJPA 5EHNA 4PCAA 3EQ2A 4QOFA 4KPUB 3G82C 5ALOA 2MYUA 1QHGA 1CVLA 4Z1MA 3DE5X 3QUBA 5FP0A 5BYAA 3ZHZA 2XTJA 3F6EX 3TZKA 4AX8A 1RQGA 4FOSA 2AOUB 1O57A 1YUNA 3L1VA 4JENA 4PPQA 1W47A 4EVIA 1W76A 4J0QA 2A33A 2NZVG 3IMGA 3LFHA 1KRHA 2X6RA 1VMIA 3AO0B 3QOYA 4OM7A 4RD2A 4EUEA 4OM8A 5HE0B 1DJOA 4XGKA 3B7WA 3DE6X 2LCFA 2X5XA 2NTEA 4I2VA 4Z6KA 1PGJA 4AJKA 1GYQA 1OJ7A 3R3JA 1H5NA 4MAMA 2BFEA 4O4HB 4PO9A 4MWSA 2D4HA 4DJ5X 2CBGA 4ND6A 4A0BB 4D9FA 1V5EA 1OWMA 2OLKA 3NAQA 5JS1A 4KP7A 2WB4A 2IXGA 4P5PA 1WDMA 3NRCA 4FI3F 3RSLA 4B80A 1IN8A 4BFTA 1PZEA 2P75A 2XDQB 4CI8A 2EOAA 3K4HA 4RM2A 5EVJA 3I62A 4AY2A 2PH3A 2C04A 4YONB 4JK3A 3VX3A 3AVYA 3F6YA 4NZPA 5CXBA 3T4PA 1E2UA 4OFWA 4EENA 1CQJA 1EH5A 4QU9A 5TY0A 3DHNA 3OE7D 1L5HB 3OIFA 3T9CA 3GHHA 2W2LA 3G0OA 4GNKA 4DVJA 3BA1A 3CNBA 5A03A 3M5DA 1WMFA 4LJYA 3WBFA 5B55A 1D0VA 1QS0B 3TWOA 3OKAA 3TNJA 2JLYA 1CUYA 3IGFA 3AWIA 1UZNA 2YN2A 3LX6A 2Y6VA 4DHEA 1OXTA 1OFHA 3ONEA 3L4OD 4LMBA 2ZM5A 1J24A 2IU4A 2QUKA 4C0LA 3UICA 2CZCA 5G0VA 1Z37A 4X6YA 5CDUA 1RM0A 4CWAA 3G9QA 3HYNA 2W43A 4ETIA 4HQOA 4JELA 4Q3AA 3VDMA 1RAHA 4R71A 1DVRA 1MJFA 1JJ7A 4CLHA 1AKNA 5FRDA 4CI0B 1HDOA 2G17A 2WYVA 1G4AE 1R10A 4IKOA 4R1MA 2EP8A 2A5YB 2E4UA 5DBFA 4WBXC 1KF0A 2HEIA 2LW7A 2NSHA 3BH6A 4GEGA 2PH5A 3IVXA 5DYTA 4NH0A 3R9WA 1K7SN 3FNQA 1JSZA 5HKLA 2V6IA 4EW6A 4DDVA 4N5MA 2X4LA 2QTGA 4OFXA 3SBRA 1BHJA 1DXHA 3T9AA 3TQSA 1NVBA 1I36A 1OU4A 2EJTA 2GCGA 4AKSA 2ZQYA 4ZQGA 5KTMA 3SEAA 4BUJC 4WAUA 3L8EA 4OQEA 1UXOA 3K0AB 5IH3A 2XMDA 4G4SP 4P84A 2WMDA 2Z8ZA 4JP2A 4RDXA 3ER9A 3Q8WA 4UNRA 5K4AA 1USGA 2IYXA 3V3TA 3DQZA 4MMXA 3CRW1 3QK7A 3S7ZA 3N8NA 4KN5A 4HWPA 4RIEA 1T9DA 5ISMA 2JGDB 4JBGA 4UD6A 5B7GA 2DR3A 3F2VA 2OZEA 1KI6A 1U1FA 5CNMA 2O57A 5EARA 5IM5A 3QXSA 4PYMA 3BXZA 5EJGA 3VO8A 1GNLA 4FCWA 4YWJA 1V3UA 5JSFA 4B3CA 3U4QA 5F51A 1D7AA 1U7TA 4UEOA 5CDGA 3L0ZA 1SOUA 5AJTA 4OJMX 5KTOA 4LDJA 3KSRA 1T1JA 1ZCBA 3OPYI 3CSUA 3I0ZA 3T1OA 4QG3A 3H2ZA 3FZYA 4E12A 1VLQA 3JWJA 4B40A 3PXSD 1WSWA 3P71T 1X80A 2LXNA 5LZ4A 2J48A 4NSNA 4RPKA 3PHHA 3NCTA 4F7WA 1A5AB 4N0DA 4ZVMA 5KEIA 3VBCA 1HYGA 3WWEA 4AQ7A 3TZ6A 4Q0MA 2G36A 5JRZA 2QLJA 4GOMD 2DUNA 2XQVA 3I3OA 3P9CA 5TQVA 2QD1A 3T54A 3WL7A 1CIPA 3TOSA 2FCRA 5LMUB 2UVPB 2VF7A 5I4KA 1XWWA 1YR9A 2JIMA 2C1ZA 4LVUA 1ZN7A 2C8JA 1L6IA 2J3MA 1L7RA 3LWZA 3THXA 2HRDA 2F48A 4Q3DA 1X2EA 3K8ZA 4Q4JB 3K15A 1T4GA 3RJMA 4MGZR 1Q7TA 2ODNA 3HI6A 4R9UC 3SJZA 3V4ZA 2D5BA 1SKMA 2B5MA 2IK8A 3ADDA 2ZJZA 3GLIA 1CEXA 1TPYA 4RLFA 5CW1A 4Q9KA 2NP6A 3S2YA 1J9EA 1JU3A 2PUGA 3G3EA 5FDFA 1XRPA 3H2HA 2CHUA 1A9RA 2XMCA 4PC2A 2YMPA 2GNQA 1ZXXA 3WZ2A 1R8YA 1OU0A 4WN3A 2XRMA 5LM3A 3KRWB 4WK4B 3QNUA 4CHGA 3P9PA 4XWAA 1EP2B 3I04A 1EM8A 1N5RA 1PBNA 1EWVA 1SK8A 2Y9PB 3V32A 2PM6B 2QN6A 5JXHA 2AEEA 4CV0A 4M22A 4RV4A 4WXPA 4A6DA 5JSZB 2XPCA 4ZCQA 3CSDA 3IDSA 2QAIA 1DB3A 4YV2A 3R3UA 3TNLA 2FOIA 2GK6A 4GPIB 4FLFA 3CLTD 3SC3A 3FPCA 3GELA 3SPXA 1NRJB 4C4XA 1M2OB 5IASA 3VO2A 3I6QA 4C0KA 2IYPA 4P7FA 3ST7A 1RYZA 4F97A 2I3AA 4Y2VA 4CRWB 4LKRA 1IK6A 2JJYA 2VO1A 3KFLA 4RPIA 4F93B 2EBFX 1VE7A 3AM3A 4IDEA 3RFGA 3N0DA 2ODTX 3I4CA 2IYQA 3WMWA 2EIXA 5DNUA 1DFHA 1XDSA 3BS4A 3CG0A 3FWNA 3MTIA 1GXRA 3NWPA 4CODB 4DLYA 3EU7A 3IL2A 3FYTA 5C32A 3HA3A 4KR0A 3MMNA 1HG1A 4UCFA 3ZWNA 3OPNA 2YWGA 5JSUA 1SKYB 3B52X 3W5VA 1X19A 4MX8A 4YT2A 2I80A 5BMVA 1A95A 4MWBA 2J07A 3ZLJA 4YJ2F 1CEEA 4RL6A 4LYEA 3H42B 1J5EB 3AMVA 2DWQA 4WLUA 3ISTA 1NJGA 2O3SA 2GAFA 5I5JA 5DYNA 3H5WA 2BEVA 3MTEA 4ZVTA 1CIJA 3ONWA 4ZU1X 4HO1X 1IRIA 1Y1KE 4BTLA 1IM2A 4FW8A 4EHAA 4G37A 4AMUA 2YJZA 3ZBPA 1XRMA 1OGJA 1U0EA 2OK4A 1SQSA 3A26A 3B2NA 4WACA 4C4ZA 5LOVB 2AX4A 2X9NA 2YDYA 3PJFA 1TQ6A 4M86A 3IQZA 4J6FA 4ZQCB 3O2NA 3SNHA 2JVJA 3JRNA 2CO0A 3EVBA 2A9JA 2MYPA 2ZJ5A 2CNDA 4PZAA 2CD9A 5AWFC 2QYHA 3B3AA 4JBNA 2NU9A 1NWCA 1PWXA 3GJ5A 4M1WA 3ROXA 2HK6A 4YHHB 2IJGX 4OHMA 5EMNA 1EK1A 2OFPA 1KWKA 2V58A 1WAMA 4HFNA 4A10A 1E89A 1I1OA 1L4MA 3AQ4A 5IEJA 4TWAA 4L85A 3P2MA 4FFBB 2E6KA 4WCVA 3B20A 3EVTA 4JL6A 5TS3A 1T1IA 2VNJA 4RDCA 4C07A 2HLDA 5CYKB 1YKGA 2FFQA 5AJWA 5KNDA 2ATIA 4J6EA 1SUSA 3C5MA 3PXDA 1UK6A 2P6RA 3EK2A 1RFLA 3D2LA 3R0ZA 3I42A 4ZHQB 1AO0A 3MGCA 4YDHB 4D8YA 1JFTA 2P3OA 4MHSA 4C7JA 3RKUA 3LKBA 1RYFA 2Y05A 4L5JA 1CYEA 4O2BB 2AC7A 4BGEA 4MQ4A 1ECJA 4J1NA 4CLRB 2OV4A 2M2IA 3FMVA 4MO9A 2TECE 3AJRA 2JA1A 4ZRNA 4D8UA 2B1RA 1K5DA 3R3YA 3HO8A 1YCHA 3WJ1A 4LJRA 3O9VA 4YFVA 4B4DA 1GTZA 1ODJA 2XAAA 3SG0A 4B7UA 4DJJA 1XL0A 4NENA 2BZGA 3HNPA 2CLSA 1WHTB 3MPOA 1FCJA 1JR3D 4C4PA 2QSUA 4H1HA 2KQUA 3NG1A 1XKLA 2FSSA 4KTTE 1YB6A 1ODKA 2GVDC 1ZY2A 2JIZD 5TDHB 3PICA 4K9MA 5KNCD 3G2KA 2ORWA 3L7DA 5C92A 4YUXA 5LDHA 1BAPA 4RV5A 2V6FA 3R4CA 5AJUA 4O5AA 4XB1A 4DKXA 1V3VA 1RQRA 2C4WA 3N2GB 4BX9A 3SQXA 5CT8A 1Z82A 4Y2JA 1N2CE 2C4HA 5LA6A 1OF1A 1AGXA 4NMHA 3UAZA 5JTTA 1D4FA 4WERA 1UMBA 2H3XA 3L8MA 2YVLA 2I6XA 1S8FA 1KAEA 2R6ZA 1WDLA 2B92A 4D3YA 1T4DA 4DIBA 4II2A 4NBUA 2XF8A 3IR5A 4HLUC 4U0JA 2GQ0A 1J23A 2M6SA 3SVZA 2XMBA 3T1VA 4E13A 3M6MD 2IIBA 1NUQA 2PL1A 3Q3JB 4RMJA 2IH4A 3NYQA 1PSDA 4D81A 2ORED 1T26A 2HSZA 2Q5LA 2WF5A 4MV3A 4OI1A 3L6BA 4FN5A 4Q7EA 2FMXA 2H18A 3GRAA 4PSKA 4E70A 1OX6A 3OJFA 3QBEA 2BEWA 4ZVUA 3I64A 4Q7JB 1C81A 4RK1A 3A2KA 2GJ9A 4Q9AA 4LHXA 3BCHA 5DV9A 5DF1A 3RDPA 4DIUA 4ERYA 1MC4A 3C8ZA 4AG3A 1TU3A 2YWEA 5CJ2A 2GPSA 3SCZA 1OGYA 1K9VF 4ZAWA 4CF3A