3IUMA

Appep_wtx opened state
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
684
structure length
668
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 187
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iumA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iumA01
3RKSA 2HA4A 3O4JA 3IA2A 2QMQA 1CUHA 4X3CA 4QLOA 4BBZA 1YB6A 1A8SA 5AKLA 4C87A 2Y1KA 5AI9A 5A7FA 4BDSA 3QITA 3DS8A 1L7RA 5ALJA 5FOQA 4H35A 3IVMA 2GBIA 3HLKA 1CFJA 3WKDA 1EK2A 5I8PA 4IH9A 1PV1A 4Y2RA 5LZ8A 3S2ZA 5FUMA 2OQVA 3K2IA 2WLSA 5LZ4A 1DT3A 4WJLA 1DQYA 5A7HA 2C0PA 2Z8XA 2DFPA 3WK8A 4QLAA 1G42A 4FLFA 2QXTA 3JWEA 1BE0A 1CUZA 1T4MA 1HLGA 5AM1A 5ALWA 3ANSA 5JZSA 4ZV7A 3LLCA 5JYCA 1XZEA 2H9YA 1CUVA 2QXUA 1B41A 3WL5A 2VQ6A 3G9TA 1THTA 4OU5A 4ZXFA 2DQYA 1CUEA 4D9JA 1JKMA 4G4GA 2OG1A 5K3AA 1IZ7A 3G0BA 1SCQA 1YASA 2ZJ7A 2JGFA 2XMBA 5HF5A 4F0JA 1MX1A 2PL5A 2O7RA 3CN7A 1AURA 4U2CA 4C6HA 1QJ4A 3QH4A 4H7JA 3SC2A 4CCYA 1U2EA 1U8EA 2QUAA 1X2BA 1R9NA 3AZOA 3FLEA 2D5LA 1VZ3A 2WG2A 3ZV7A 3M83A 5AKZA 3TGLA 4DNPA 1YA4A 3W06A 3UUFA 2XUFA 3ICWA 1LGYA 1LPNA 4Q1VA 1RP1A 2ZYHA 5HQ3B 3GFFA 5HF6A 1WCYA 5AK5A 3AIMA 3M81A 2Z3ZA 4FKBA 4ZV9A 3ILSA 2XQJA 2ECFA 4W1PA 5AK3A 2QKYA 1GPNA 2XMZA 1O6GA 5AOBA 5AHXA 5C81A 4G1FA 1F0PA 4CG3A 3G8YA 3U0VA 3DYIA 1N5MA 4B84A 1W76A 1ZGBA 1EDDA 3DKRA 2PSJA 2QS9A 1J06A 4QZVA 4INZA 3H2GA 3MVEA 3R3WA 1DX4A 4DIUA 5I7UA 4YK7A 2JIDA 3V9AA 2XMSA 4Y2SA 4TVKA 3G0CA 4X97A 1WB4A 4L9AA 5JD5A 3G02A 2IIVA 5JAUA 1XROA 3FSGD 3ANTA 2OPHA 1EA5A 3DQZA 5ALSA 1IMJA 3I6ZA 2PKYX 1QGED 4W9RA 2XQIA 5AH0A 2WU3A 5I9IA 5JAPA 4AZ3A 5KWJA 2HADA 4QE3A 3ZWQA 1EB8A 2VTVA 4CG1A 3I2IA 2J4CA 4V2IA 1YS2X 3P2MA 3JYHA 1UXOA 2CMFA 4BTLA 3R41A 4X6XA 3FVTA 1N1MA 1QO9A 1N8SA 1M33A 3VJMA 5EHQA 1B6GA 1CUWA 2XE4A 3NUZA 1LZLA 2WJ3A 2WG0A 4Q82A 2GYUA 2XMCA 3MUNA 5K3EA 4X95A 3ESDA 2WUGA 1LPAB 3CCBA 4OB7A 1XZLA 3WWCA 2WSLA 1AKNA 1F6WA 3B5EA 4ZGBA 2WG1A 3D5EA 3KD2A 2VF2A 3H18A 1EXWA 2Z5GA 2QOEA 4RNCA 1TK3A 2BGRA 3PUHA 4N5IX 1E89A 5AOCA 1QIJA 3ZLVA 4KE7A 2WHQA 4GEGA 1LPSA 3LCRA 3S8YA 1AQLA 3VJKA 4K6GA 3QZUA 3WKAA 3EQ9A 3DKKA 2OAEA 3WI7A 3QMWA 2WKWA 5KBYA 2QJWA 2AJLI 6YASA 4IH1A 1XZIA 3DCNA 1QIHA 1MAHA 1ZI8A 4TPKA 2ROQA 4BP8A 5BWCA 1XZMA 4EY5A 4C4YA 1XZCA 1ZOIA 1UK9A 4UHDA 2WFMA 5IVHA 1KEZA 1P0QA 2DHEA 4L3WA 2RONA 2XQGA 4EA6A 4B0PA 3A6ZA 4DYHA 4FWBA 5LP1A 2YXPX 4AXBA 1HPLA 3G0DA 1XKLA 5D6OA 2QM0A 3BJMA 1MO2A 5AK4A 5ALEA 1I6WA 1W52X 2XLBA 5SYMA 3RLIA 1K63A 1CUSA 1THGA 4B0OA 4FTWA 1EVEA 1QIKA 3ESAA 4MWTA 1YAJA 5CXXA 1G5FA 1QIIA 2VJAA 3WKBA 4EY6A 1Q83A 2YYSA 5AKHA 1DWPA 5JD4A 2DR0A 1LPMA 1BU8A 2IX9A 3G9XA 3W05A 3WWOA 1DQZA 2JGEA 3G0IA 1IVYA 4MYDA 3IUJA 1S8OA 4JEIA 1K4YA 4Q34A 1GQRA 3M3DA 3C6YA 1WOMA 2QVBA 4BRZA 5DNWA 3U1TA 1ACJA 4IH4A 2PVSA 2WQZA 4JH0A 1E8DA 1CR6A 4Q3LA 4ZWNA 2OGTA 2PUJA 4BATA 4GBGA 1QLWA 4IO0A 4KAFA 5IVIA 3WJ1A 4X00A 1XZJA 4QDTA 4UFNA 2PM8A 2O2IA 2WHRA 1K6EA 4BE4A 1KU0A 1XRQA 1W1IA 1LBTA 3C43A 3AIOA 2BUAA 4UBLA 4DMFA 2HA7A 2GBGA 1CEXA 5AO9A 4B85A 1PFQA 3GZJA 2JGMA 4G9GA 3O4GA 2HM7A 2WIJA 1R3DA 2CBGA 3BDVA 2GYVA 3SK0A 4JUIA 4H7FA 2ES4A 4FLEA 3EQ8A 3I1YA 2ZSIA 3HSSA 4H7KA 5JIBA 3H17A 4UBNA 5HF9A 3HI4A 4U2DA 3AUKA 4LHEA 4EHBA 3FYUA 1H2ZA 3D7RA 3AINA 1BS9A 3EBLA 3WA6A 3LP5A 1NX9A 4Y9SA 2HFKA 3JW8A 1CV2A 2P8SA 4E14A 4FNGA 2XT0A 1WB5A 4BCDA 5HKBA 1QIEA 1CUXA 4OB8A 4EZIA 2Z3WA 4CFSA 3FAKA 5EIEA 2G5PA 1MU0A 2HL6A 3WK6A 3EQ7A 4CIAA 5LKAA 1X70A 3FLAA 4Y2VA 3WMRA 4OCZA 3HEAA 2UZ0A 1LPOA 3AZPA 4PQEA 4X90A 2XLCA 2RGUA 2ACEA 4LKOA 1DWQA 5AKIA 3G9UA 1ZI6A 3KWJA 1UK6A 5H3HA 5JARA 3GUUA 3SX4A 2HU7A 1ZICA 3BJRA 1SFRA 3AZQA 4EY4A 3ICVA 4M0EA 1XRRA 3IUNA 1QTRA 5ISMA 3PFBA 2DQZA 4MQLA 1NU6A 2JEZA 2ZYSA 4UFOA 2XUGA 3PE6A 4WFKA 5EFZA 3PDCA 2WUFA 4P9NA 5AKKA 2AJ8A 4U2FA 2J3DA 4Z49A 2VT6A 4WY8A 5AKGA 4H7HA 3AILA 1Y7IA 1FJ2A 4KEAA 4AMYA 3OM8A 1CLEA 3WYDA 1J2EA 5CURA 2I3ZA 4EB0A 4X94A 2JF0A 1A8UA 1CIJA 4AZ0A 1XRLA 2WM2A 4G9EA 4G4IA 4BAUA 5HQ3A 1GT6A 5DNVA 1MT3A 2C4HA 1DTEA 1QTIA 4UHBA 5HZGA 1GPKA 1QONA 3R40A 4B9EA 5ALVA 1TIBA 4UPDA 3A2LA 5CT9A 3G7NA 3STUA 2FUKA 3B3QA 2YH2A 4FMPA 2QZPA 5CT5A 5C8ZA 1T2NA 4PSUA 4ZREA 1MX5A 3F8SA 1CUDA 5ALZA 2XMQA 1DINA 2WILA 4KAJA 2WJ6A 4DMCA 1CQWA 7YASA 4OUKX 1CUFA 3IULA 3AJAA 4ETWA 5CRIA 4O08A 4M0FA 2FJPA 4GLBA 1HBJA 3IUMA 2R11A 1R9MA 5AOAA 2OXEA 5DWDA 2QRUA 3PF8A 4GW3A 2ZJFA 4J0DA 2K2QB 2RAUA 3QPAA 2XB6A 2R8BA 3UMJA 3DJYA 3H2JA 2ZYRA 4MWSA 1TRHA 3VVMA 3QYJA 4X7BA 4Y2PA 2XUQA 2E3JA 3NWOA 4DSAA 5BWBA 4K6HA 1ODTC 5FRDA 3T52A 5K3CA 5HKAA 3HABA 5EIHA 4OU4A 1F8UA 4HZGA 1E5TA 3TEJA 1G4HA 2HRQA 4EUSA 5FXMA 1VOTA 4IQ4A 4EY7A 5AI0A 4K2AA 2PU7A 4BRSA 4FFWA 4K6KA 1HQDA 3O9MA 4XWGA 4BE9A 1YSCA 4UBOA 1TCBA 3CN9A 4GDMA 4U2GA 4WCVA 3ED1A 4BTVA 5C8VA 5IKXA 2WUDA 3MGAA 4QEKA 2B20A 3OURA 1VXRA 1OILA 4KYVA 2HIHA 1BCSA 2EEPA 4LYDA 5A2GA 4AO8A 3D2AA 2ZVDA 5IVDA 1BEEA 1ACLA 3HC7A 4AO6A 5DYWA 1R4ZA 1BROA 3X3HA 1A88A 2BFNA 3BIXA 2XUDA 1CUGA 5AM2A 4J0CA 3WWDA 2H1IA 4WFJA 3F97A 2WFZA 5AIAA 4FNMA 5CH3A 2VAVA 4JNCA 1MJ5A 4M0MA 2BKLA 2PSDA 1W6RA 1X2EA 1GGVA 5JASA 2O2HA 4LXHA 1UK8A 3C6BA 5CT8A 3WWEA 3D4LA 1EDBA 3YASA 3BWXA 3I6YA 2HA5A 4HS9A 2VA9A 1SOMA 2HFJA 3WL6A 1UOPA 5K3BA 4E46A 4G4JA 2Y2VA 1FFEA 2Y6UA 4U2EA 2DHDA 3R3YA 1GKKA 3QVMA 1XZBA 2H7CA 1EH5A 4H0CA 2X8BA 3M82A 3WWPA 5HCUA 1EB9A 5FPQA 3ZLUA 4TGLA 4C4XA 1DX6A 2V96A 1ZD3A 3WK5A 5C7YA 1XFDA 1USWA 3QBJA 2BGNA 5FKJA 5AI5A 3ESBA 3ZPXA 2GZSA 4FBMA 4RE5A 3W2TA 3WIOA 1XRNA 3D0KA 3C5VA 3C6XA 3LIPA 4H18A 1DU4A 2Y2UA 2ZSHA 5AKYA 5E2IA 4NZZA 5CTAA 1UFOA 3H1AA 3I2JA 4B82A 4LXGA 1FFBA 3K9BA 1YB7A 1XLVA 3C8DA 4N5HX 4DNQA 5ALOA 2C5FA 4UHFA 1XZKA 2AXEA 2PU5A 5FPPA 4BVJA 3HJUA 4NMWA 3WA7A 3DL4A 4Y7DA 3E4DA 5YASA 3DOIA 2XUPA 3STYA 4X71A 4J03A 2JGKA 2W6CX 3UUEA 4ZRDA 2XMGA 4UUQA 5T4BA 4X6UA 3NOXA 4RPCA 2B4KA 1KU6A 2OCGA 4PSDA 2PPLA 2V9ZA 4H7IA 3DOHA 1QFMA 2HU8A 3FCXA 1QIDA 4PF1A 4Y2TA 1W4LA 1UOQA 2GYWA 2GBCA 2PSEA 1QOZA 5ALGA 3STWA 1R50A 5E4JA 5JALA 2WUEA 5A7GA 4I4CA 3ZLTA 4IHAA 1BN7A 5CH8A 4ZI5A 3G0GA 4A5SA 5JD6A 4XVCA 4QWWA 3LIIA 2ONCA 4JYMA 3H04A 1AC5A 3O4HA 2AJCA 1VJ5A 2WJ4A 3C70A 2C5GA 4B83A 5AM5A 5ALIA 1VKHA 4UBIA 1XZAA 2PBLA 1EVQA 1QE3A 3BF8A 1J1IA 1UKBA 1C4XA 2VJDA 4E11A 3SWWA 2OAGA 1LBSA 1EINA 4C01A 2X76A 4J0JA 1Q84A 3FCYA 2XUJA 2CUTA 4J0HA 4FLMA 4MQMA 3O0DA 1GZ7A 3FNBA 3W04A 4L0CA 3H2KA 1VA4A 3C5WP 3KWFA 3D2BA 2AJDA 2C7BA 5ALMA 5DTIA 2VSQA 4UHCA 4BAZA 3VJLA 2PSFA 2DCMA 5AM4A 5EI5A 3N0TA 4C89A 5IVKA 4DSZA 3IUQA 2RIPA 2EDAA 1ISPA 1AUOA 5FP0A 1UK7A 2BAGA 3OC0A 3V1LA 1E66A 4BZZA 3R3XA 4Y2QA 1CUIA 2AJBA 1YCDA 5K5EA 2XMRA 4B81A 1DWOA 1Y37A 5DJ5A 4WDQA 5F4ZA 1MN6A 4A23A 3FVRA 1QIFA 4BB0A 5BV7A 3NGMA 3Q0TA 2WHPB 3C8HA 1GKLA 3BF7A 5DNUA 2OQIA 4KACA 4MEAA 2HU5A 4AQDA 2VT7A 3WJ2A 5ALFA 2H7YA 2XUKA 1CQZA 3QPCA 3BDIA 2I03A 4BZWA 1FFCA 1OCEA 3WYNA 2Z8ZA 2WTMA 1Q0ZA 3PF9A 4X92A 1XRPA 2LIPA 1ZIXA 1ODSA 2NW6A 3HYSA 4AO7A 5LZ9A 3EIOA 4JYPA 4J7AA 1LLFA 4X91A 3GA7A 5JATA 1E3QA 2XUHA 1XKTA 1P0IA 3AFIA 1JJIA 5SYNA 3VXKA 1GXSA 3WK9A 5JZBA 3KSRA 3STVA 4H7EA 3LS2A 5EHNA 2XDWA 2JEYA 4MJ3A 4KE8A 4FDMA 5JZ9A 1XQWA 4HXEB 4W1QA 5LYYA 5LZ7A 2DSNA 4CIBA 2C0QA 2O2GA 3W9UA 1SC9A 4QDXA 3VDXA 2B61A 2CZQA 3I2HA 4F60A 1UZAA 1EK1A 1QIGA 4B6GA 4AB1A 4A16A 5ALTA 1JI3A 4QA9A 4P93A 2XUOA 5A6VA 2OGZA 3RK4A 4GXNA 2FJ0A 3WLAA 2D0DA 5ALRA 5CT6A 3WKEA 1NU8A 4UBMA 2JBWA 4N8SA 4BC1A 5AKEA 3F96A 4UBJA 2WIKA 1LPBB 3IBTA 1ODCA 1SCIA 4DMKA 4I19A 3ZI7A 1YS1X 1VZ2A 4UHHA 1LNSA 4DNOA 1H22A 2EDCA 1H2XA 4Y2YA 4J3JA 1JJBA 1CUYA 1K8QA 1JT2A 4EBBA 3H0CA 5EGNA 2JGIA 3ESCA 4HRXA 3IDAA 3TJMA 3RARA 5LLSA 4CCWA 2VATA 4HAIA 5LZ5A 2DHCA 4C4ZA 3O95A 2JGJA 2W22A 2HA6A 2QR5A 5HK9A 4WFIA 5DYTA 1IUOA 1UWCA 4PW0A 4W1SA 3O9VA 3A2NA 1WHSA 4KRYA 1W75A 3WK7A 1MAAA 3D59A 5KWIA 4DGQA 2FX5A 4DMHA 4OSEA 3BIWA 3DYVA 3OOSA 3O4IA 1VA5A 2GBFA 4X6YA 4KRXA 3N2ZB 4QDZA 1XZFA 5JADA 3FYTA 3HRHA 1D07A 2ACKA 4HRYA 3F9CA 4G8CA 1XZGA 1G66A 4CI9A 1H23A 2XI4A 3I2GA 4GECA 1RYYA 3I1IA 4AMZA 4MEBA 4G5XA 1HKHA 3DLTA 2I3DA 2VAXA 3GELA 4HXGA 1UT6A 5K3FB 4HXFB 3PI6A 4MXDA 4B80A 3C6ZA 2BCEA 4OD0A 3WQHA 4BCBA 5HFNA 1MNQA 5LZ2A 5E4TA 4FFVA 5BOVA 5CW2A 4XX1A 2WFLB 3R3UA 3Q8WA 4Y2JA 2V98A 1ETHA 2WIFA 3I2FA 3L1HA 5ALNA 5HK8A 1EDEA 1ZI9A 5CBKA 1BCRA 4FHZA 3R3VA 4KAAA 2VJCA 1CVLA 5T4EA 5CXUA 4OB6A 1ORVA 2OCIA 2XQKA 3D2CA 5CMLA 1QFSA 4BYMA 1JJFA 4NS4A 1U4NA 4OYYA 1CPYA 5EHZA 3E1GA 4PO3X 2G5TA 5EHXA 4ARBA 2V97A 2WU4A 4QWMA 4WDRA 5IH7A 2VJBA 3TRDA 1P0PA 5HFAA 4J0IA 2X5XA 1R88A 3IIIA 5DLPA 4OYLA 3WKCA 5DYYA 4Q3OA 5AI6A 4KE6A 4DM7A 1ZIYA 4DLNA 1IZ8A 4UFPA 1JFRA 5ALYA 2OLEA 1CUBA 4BCCA 1CUUA 3HXKA 5K3DA 1TAHA 1UOOA 5AI4A 1JMKC 3FLBA 1WHTA 1EHYA 5AP9A 4YPVA 1XQVA 1UKAA 3H1BA 4J0GA 1QO7A 4BP9A 1WM1A 1CUAA 2I78A 2QT9A 3V48A 4B9AA 5CH5A 3KOOA 3DEAA 1E8NA 1VXOA 1MTZA 4J0KA 3OPMA 4KE9A 4WY5A 2XMDA 3IURA 4CCYB 1JMYA 3DNMA 1ZJ4A 4G8BA 1FFDA 4QNNA 1C7JA 2PUHA 2QTBA 5ESRA 4BDTA 4XJVA 3QMVA 1AGYA 5T4FA 2WTNA 1BN6A 1QZ3A 5FLKA 1L7AA 3B12A 3EF3A 3C45A 1CRLA 2OCKA 1O6FA 5JAHA 1BRTA 1Q0RA 2WHPA 4W1RA 2RHWA 5D3ZA 2C58A 1JU3A 3QPDA 1VLQA 3W9BA 2HHAA 3BXPA 2GZRA 2RI6A 4B7ZA 1PJAA 1WPXA 3I6MA 3OG9A 4H77A 1L7QA 3T4UA 2WIDA 2IITA 5LIPA 4FOLA 1DT5A 1WB6A 5JANA 4NVRA 5HF8A 1E8MA 4PNZA 4YX9A 3PICA 1LPPA 4YASA 3I28A 4I3FA 4AN0A 2VEOA 5ALHA 2WIGA 4AN1A 1AZWA 1RWQA 3PUIA 4UBKA 1ZGCA 2OCLA 4MYSA 4GHWA 5EIAA 2J3QA 3E3AA 4LYEA 5AKXA 1LZKA 1TKRA 2BUCA 3A2MA 2Q0XA 1XLWA 3DDUA 1P0MA 4ARAA 5FDFA 2JGLA 1TQHA 3R3ZA 2Y6VA 4K5QA 5ALUA 4ITVA 4N8DA 1FSSA 1CUJA 3FYUC 4KR0A 1XRMA 1N5RA 1XZHA 3PFCA 5AKJA 3I2KA 2HA3A 2J4FA 2PSHA 2QUBA 2ZJ6A 2OGSA 2XUAA 5ALQA 3RM3A 1ZJ5A 1UKCA 1YR2A 2HRRA 4LXIA 1K5PA 3STTA 5FV4A 1F0NA 2CEKA 1TCAA 3G9ZA 5ALLA 3QMMA 5D3KA 2H7XA 5DTJA 1ZD4A 1VE7A 3C87A 4QDOA 1IUNA 1MNAA 4DTCA 1U65A 5D7BA 2CKMA 4L72A 4X85A 5E4YA 1AMNA 1AX9A 3K6KA 1ORWA 4G8DA 3AIKA 1MX9A 3DL7A 4X93A 2ZYIA 2O7VA 3FWHA 1Y7HA 2BJHA 2G63A 5J3JA 1OXMA 3DD5A 5A62A 1A7UA 2CB9A 1H2WA 4E15A 5A71A 3WK4A 1ZD2P 1R1DA 3CXUA 4C88A 3FBWA 2YASA 5T4HA 1TCCA 1EX9A 3WIBA 2CJPA 2XUIA 3VVLA 4BVKA 3A70A 4BVLA 3GBSA 4BC0A 3CCCA 3F67A 3WL8A 1ZD5A 1JU4A 3V1KA 5AK6A 5ALDA 5AI8A 3L1IA 3VKFA 3OTQA 4H7DA 4OPMA 3E0XA 1XZDA 4DNFA 3FOBA 1XQXA 2HA0A 4P08A 5AM3A 5C8XA 4Q3KA 1SCKA 5AJHA 3HACA 4S0XA 2RHTA 1XQYA 5ALXA 3KXPA 3GROA 4LIPD 5LKRA 3WZMA 4ROTA 1HDEA 4KJXA 4Y2UA 3H2HA 4HVTA 4FBLA 3R0VA 1XLUA 4GI1A 2QJRA 1YA8A 4PSCA 1QIMA 2XQFA 1H2YA 4P92A 1FFAA 4RGYA 3V1NA 1EI9A 3L1JA 4Y2XA 1A8QA 3WZLA 3H19A 1VE6A 4GWLA 4W63A 3MUOA 1C7IA 5K3FA 4HTAA 3F98A 4BAGA 4U2BA 5CT4A 2PX6A 1CUCA 4RE6A 1YAHA 5ALKA 5AICA 3V1MA 2HA2A 3STXA 4UHEA 1MPXA 4XIIA 4Q05A 2B9VA 4CG2A 2ORYA 1GPLA 1WPRA 4F21A 3KDAA 4N8EA 3VISA 4PV7A 3BE8A 2HDWA 4EY8A 1HL7A 2WFLA 3IB3A 2G4LA 4F5ZA 3BL8A 3HZOA 1IUPA 3D3NA 5JAOA 4QDUA 3FSGA 1GQSA 3WL7A 1BEZA 5ALPA 3QM1A 1Z68A 3H2IA 5AM0A 5KREA 1J07A 2BUBA 3FYUB 5AIBA 4AX4A
chains in the Genus database with same CATH superfamily
3Q5DA 1L2TA 2BMDA 3PQDA 4LSZA 4HLCA 1U2SA 1UDAA 3CNHA 2AYZA 2JHFA 5AKLA 2ZAIA 1HDIA 2X6QA 2H4JA 1T6ZA 3SG0A 1DXYA 1UWKA 1TJNA 3GGOA 4K3ID 4Z7QB 3NHBA 4EENA 1XXHE 5EARA 1YIDA 5FUMA 4H5JA 1WRBA 4GXQA 2XCLA 2Q0HA 2IUTA 2YCLA 3HB7A 2WZBA 3TMAA 1AD2A 3JWEA 1EUDA 4RMJA 2YWCA 2IRWA 5IT4A 4BB6A 4Q21A 1IE3A 5KNBA 3F6PA 1PNVA 1A9PA 1XMIA 1CUEA 2OHVA 1U8AA 1PJ3A 4D81A 5HF5A 2NYAA 3A1VA 1KPIA 4PONA 1AURA 4TV8F 4O4LB 5K20A 121PA 3TL3A 4ZRNA 1IPEA 3EXAA 3QG1A 6ADHA 1VZ3A 2ZJ4A 4D82A 4QRJA 3H16A 4AP6A 4N5NA 3AEQA 1J90A 4QUKA 1UFQA 4ZZIA 3RNOA 3V97A 3U5TA 4RDHA 4G5SA 1M0WA 4UUMA 1CDDA 3F1KA 4WT7A 4P4SB 1V9CA 3AC0A 4EHFA 1TEZA 2VPIA 4DDWA 3VYUB 4D3XA 2J0EA 4EVRA 1NLFA 1SVSA 2GUWA 1R4MA 1RBZA 1Y6RA 1P22A 4J1QA 2VUIB 3AL0C 1TQ4A 4GI3A 2C3PA 1XROA 1DLJA 1YFZA 4PG6A 5ALSA 5DBFA 1K3FA 1R5JA 3C0KA 4JP1A 3VV3A 3VSBA 2XNDA 1RVV1 5JAPA 2R68A 3WMGA 3ZWQA 2VTVA 3AW8A 3GAFA 1ZCAA 2ICAA 4CQLA 1YS2X 3JYHA 3JRPA 3OF2A 4X6XA 5L7WA 1C7QA 1N8SA 1M33A 2XWPA 3HP4A 3MCTA 4F72A 2QAGA 2C61A 1HFJA 1P3JA 4OB7A 5BSMA 2EIXA 2BSXA 2QXYA 1PVDA 3H3XA 3D8BA 3RRFA 3EZNA 1Z4JA 1TK3A 3I04M 4E5ZB 3EA0A 4N47A 2DTDA 2TECE 2PMBA 4L8YA 5JY6A 5C8DA 4BO2A 1M83A 2HR1A 2Z9CA 3DW3X 2QJWA 2B8TA 4OLAA 2GERA 3G6KA 2QNRA 4K9MA 2ROQA 1RWKA 3ANMA 3PIIA 4EFLA 3WGVA 2J0VA 4N7JA 3FUTA 1XZ8A 4EP1A 2VZEA 2PH7A 3W7VA 3I62A 3EOBI 5TVGA 2V5UA 1PZNA 2XE6A 4AXBA 1XKLA 2JFBA 1S4QA 4CZ2A 3SAJA 1XD2B 1HNWB 3MJRA 4DUPA 3DB1A 4I2NA 3QVLA 3CLSC 3O0TA 1DWPA 4OH7A 1UBKS 4Y9TA 1JDBB 2WUVA 1FUEA 5AVTA 5A3RA 1KDPA 3L8MA 3O4FA 4M9QA 1CJUC 4IGKA 3EI4B 2J56H 1IVYA 4YT8A 2QTHA 4E54A 3UA4A 4GLFA 2W83A 1L7BA 3E9EA 2PVSA 4GM0A 2NGRA 5FT9A 4ISBA 3TW4A 4B3CA 3AKYA 4OAQA 2IH2A 2WHRA 4YJHB 2IY9A 3KL2A 4ACAA 5REQB 2HMAA 1LBTA 2QD2A 1NONA 2JLAA 3S44A 4MA0A 4RF3A 1BXGB 2PAFA 4RFSA 4RDXA 5JH7F 3AL8B 4TL8A 2A5DA 3MMPA 3JYOA 2IVFA 5JY1A 5SXMA 3KYCB 2RH5A 4MRVA 4IRUB 3C15C 1GG2B 4C7OB 2ZJ5A 3TQSA 3F3MA 1GPUA 3P9KA 3DMNA 4MGZR 4PC2A 3SBPA 2J9FA 3NFYA 2QT0A 2UVQA 1LLDA 2QPTA 1ZH8A 3C7AA 2QVXX 3TQTA 4YRDA 2ZBVA 2B4AA 1E20A 5CXCB 2V59A 2Q5QA 2EBFX 3RFTA 3SIWA 2UZ0A 4URFA 3VPDA 1PW7A 3W8RA 3R7LA 1AZLA 1I36A 3Q85A 5H3HA 4UOEA 1B93A 3JWIA 1T8SA 3PVUB 2HO5A 3SY8A 4YQEA 3NBZC 2ACVA 2Y0DA 2Z57A 1RPNA 3HKEB 4UFOA 5BRNA 3PDCA 1JHPA 4I6GA 3MXOA 1VTKA 1Y42X 3K35A 2Q3HA 4LVOA 1F4LA 2B78A 3GEHA 5EKXA 2VDPB 4KHZA 3GPBA 5CURA 5E7QA 1UH5A 4OFXA 2O2YA 2ZU6A 1P72A 4GWGA 5DNVA 1E92A 2BFPA 2C83A 3UWDA 3VYWA 3QA3E 2W6NA 2REXB 3TDMA 2Q3EA 3L8YA 4NAAA 4YAOA 3TTVA 5LNK1 2QMZA 3NEAA 2I4IA 4L1QD 4HG2A 4FGSA 5C8ZA 3FTFA 3E70C 3F8SA 3FPKA 1TT5B 2WILA 2EW1A 4DC9A 4OUKX 3IBFA 4M0FA 3IP3A 1DJOA 3BH7A 4F3YA 3F6SA 4WNAA 1W5TA 2K2QB 4MTLA 1BNCA 4FJ1A 3URMA 2AG8A 4FZ5A 3PRYA 2I6SA 1JAZA 1U0HC 3IJPA 1CJTC 1SZJG 4F2DA 1Z2AA 4R5MA 1TQ2A 2J5QA 3M6WA 4PLYA 5DCLA 4O2BB 1HWYA 1Q95A 3AXSA 4BFCA 5DH9A 3OUTA 5FXMA 5CLHA 3U4QB 4DAOA 4JBXA 5IKPA 2QB5A 3N39C 1Q14A 2ZFUA 1RWPA 1P60A 4BZQA 2C9MA 1Y8QB 2WUDA 2JIQA 5CK4A 3C3WA 2D1FA 3AHCA 3EDYA 5CDTA 3U31A 3IQIX 4A27A 3AQ4A 2ZJBA 3CUVA 1FDOA 2KBFA 1I01A 2RG1A 4U2KA 2RCYA 4MZXA 3WO0A 1A88A 2NVWA 1WIWA 3SHWA 4F4IA 4WFJA 1DS6A 4OHPA 2AX3A 4HAVA 2E49A 4PIVA 1ID1A 2DH6A 3EARA 3WWEA 3BMNB 4AZWA 4TKVA 3IQFA 1JPNA 2I91A 4C7MA 1MQ8B 3P4FA 3VR6D 5EJFA 3LUAA 4TN1A 1RAAA 3JAWA 3FRXA 2H68A 3L7JA 5G3ZA 3AM1A 3ZG6A 2HREA 3OQJA 3UT6A 2Y6UA 4A8JA 4E70A 1R8XA 5G40A 2G9VA 3TRJA 1MO5A 1XALA 1VPTA 2OBXA 1XYYA 4TGLA 3UBMA 4S1PA 3V3KA 3ZD6A 4YHHB 3ZVKA 4FNAA 4O4JF 5JLAA 1N77A 4JENA 2WAXA 3H9QA 1M67A 1QG0A 2HJBA 3DAHA 1G9SA 3W2TA 4W9NC 1RXYA 3V7NA 1C4KA 3D0KA 4DB2A 5ITVA 3A1WA 2W00A 2KHZA 3IIYA 4DNQA 4ND6A 2GBLA 4NMWA 2XQVA 4CT5A 1JH8A 1BX1A 2A1UA 4S1TA 4EF4A 1FDRA 1QAMA 4R9VA 1CF2O 3AHDA 4ICIA 5K4AA 1J2JA 4FPXA 3NOXA 1YZTA 1JLSA 4MS3B 5FNZA 3HUUA 4MYTA 1N5LA 5IWCA 3K6RA 4P58A 4JLVA 5IH3A 5CFOA 4P83A 2UAGA 5M2QA 2HB6A 2XYVA 4Q1CA 4BN0A 3OFVA 2O8NA 4HQ6A 5I7AA 3K7EA 3VSAA 3ZQ6A 2GZDA 2B1QA 2G6BA 1KMIY 2J3IA 2VOJA 3GUCA 4HYTA 1ZGAA 5EL0A 1YVPA 1PWEA 1TO2E 1Y7TA 3C70A 2C5GA 3GFQA 3FCSA 3PG5A 3ICCA 1EYZA 5JXIA 4DT1B 2I1LA 1TF5A 1QRTA 1I33A 2QI9C 4RD4A 2OR3A 3ZHVA 4YV1A 2CUTA 4MQMA 2P77A 3I7PA 1EE2A 4OYHA 3RODA 1EWTA 3KSAC 1E2MA 3FHLA 5JXJA 2BGMA 3BORA 4KSYA 3NP9A 2ECPA 1E1RD 2X5NA 2Q2QA 1DC8A 3NRJA 5FP0A 4QXAA 5AW3A 1R5MA 3TIVA 2YJ3A 3PHLA 2RAVA 4M0KA 1QIFA 4R1NA 3KD3A 3A6JA 5B7PA 2CN2A 3M3HA 2HU5A 2IUUA 4BH6A 1WV1A 3DDCA 4OXRA 4WKCA 1MFPA 5KNBH 3KT8A 5KDDA 2IE0A 1XRPA 3Q0EA 4Z5XA 3HYSA 1ZGZA 3AWIA 3GA7A 3TO5A 1WNTA 1Z7BA 5FTKA 2GJ4A 3HDVA 4Y0VA 3E9RA 3GFTA 2NQ8A 4N0EA 2QV7A 5H59A 4UPVA 4QGHA 4WN9B 3INRA 3G23A 2B8NA 2V6FA 3PXXA 4KFCA 4J1SA 1CD5A 3V6LA 4HXEB 4DR4B 4BO5A 2O2SA 3L06A 4YYEA 2HHHB 3VDXA 3MQFA 1NKVA 1GNLA 2E6UX 2XJ9A 4OHXA 1GSHA 4EY3A 1JHAA 3UN1A 1CEQA 1EK1A 2PT6A 2D2IA 4DLXA 4DUGA 2D0DA 2R96A 4TKUB 5ALRA 5CT6A 2UZ1A 3IKTA 1G6KA 1XXHB 2GFIA 3BAFA 4WLFA 2FX2A 2ONJA 2YZ2A 1LPBB 4TQAA 4XEUA 1MG2A 1QG2A 3VVCA 1YV9A 2K5UA 4PGMA 2QBYB 4L5IA 2EDCA 2PTGA 1XVTA 1H0RA 2WWXA 3LX8A 1E2BA 2A7QA 3NGXA 1OFIA 1DFGA 2VDOA 3NBYC 3VM6A 5AUPB 3PKZA 1YBHA 2JGJA 3D64A 4EG4A 1KYTA 2QR5A 4RHTA 2H52A 1GUDA 2CVPA 4WFIA 1Y6QA 1F2UA 1WHSA 1GFZA 2D1SA 3PEVA 1MAAA 3OX1A 5HP4A 3KDPA 5KWIA 3CH4B 3GRRA 4ZVVA 5DT2A 1D8TA 1LW6E 1SD1A 2PZLA 2NIPA 4RD0A 2FEXA 3EOAI 3BRQA 5AJYA 3UGJA 3FJYA 1W8DA 1QTQA 3ZDZB 2H00A 1IY1A 2RGBA 1WMEA 3JPXA 1M73E 5KQPA 5U9CA 5E3HA 3THWB 2OLKA 5TPWB 2PM7B 3KKEA 3FB1A 3BRCA 3CPEA 4U02A 4GBJA 4DCGA 1R27A 5AMXA 1WBBA 4ES6A 1KO1A 4D97A 1YR3A 2D00A 1OJLA 4ONEA 2G0NA 5CW2A 2WNHA 1ZM9A 4Q9DA 1TVKA 3VR2D 1RRKA 4R7ZA 1RLJA 4OHOA 4OM8A 2W90A 2F9LA 1WZUA 3EPLA 1H6AA 1O0BA 5T4EA 4XQEA 1NRIA 1NIJA 4WRRA 1QFSA 3ZJUA 2NXWA 1U4NA 4JODA 2D2XA 5EHZA 5EHXA 4DCMA 5GXHA 1S4MA 2C2BA 5BSHA 4B3JA 2FMUA 2VJBA 4IEFB 4Q4DA 2Q4TA 3GJ8A 5LYJF 3NBAA 4FKZA 2GFQA 2BFCA 3ISVA 5CCDA 1FDTA 3GAZA 4TL7A 2YDYA 1E2PA 3S81A 1JPVA 2HPHA 2J3LA 2BTOA 4NH4A 1BVUA 2A88A 5D8DA 4YUYA 1N0HA 1S3FA 3IT0A 1E6UA 1PRYA 4J2OA 2Z6AA 4ZK2A 4BNGA 3T5PA 3VI3B 5AP9A 2VHCA 4OXYA 4EVIA 1LBEA 4TWJA 1ZJZA 4J90A 2DUNA 3V48A 3IPCA 2C2KA 2NUTB 4KNYA 4QIHA 4LCBA 4M83A 5ICGA 5DOVA 2V7QD 3H11B 1GYQA 1F38A 2C7RA 3PUXA 2O5EA 2WF6A 2PUHA 5ESRA 1GFWA 4JB0A 2YC2C 1SUEA 3FMPB 4F12A 3K31A 1RXCA 3OKYA 2I6FA 5TR9A 1W0JA 3ILHA 4NH0A 3LKZA 1L5KA 5JEDA 1UDBA 2PX0A 2O59A 2WJGA 3B7FA 1VCHA 1NJ5A 3TTWA 3KT6A 3AXTA 4OQFA 3RF6A 3K0KA 4AX8A 1RC0A 2FOLA 3N6XA 2ZWVA 3OKCA 1OF1A 3LCCA 5FYQA 5K3OA 3QOXA 2O2ZA 1YS6A 5K0FA 3KEMA 4YX9A 1I32A 1JILA 4AN0A 1JEAA 2IYFA 2WIGA 3ZWAA 2FEMA 2YNNA 2FCAA 5HCNA 1V9SA 2OCLA 1RRMA 4YALA 2NUPA 2RH9B 2JFWA 1XD8A 1WPGA 4GMFA 2I4NA 2UUCB 3GFPA 1WQ3A 3SKXA 2JBAA 1BXKA 4EA9A 2RK4A 4GI7A 1ZUIA 4ZT2A 1XZHA 5FV7A 3NVKI 2HBQA 3IV9A 3GLGE 3CH7A 3BMOA 5HBRA 3MRTA 2P9LC 4KV7A 4UASA 5F33A 3D6HA 1QSGA 3E7FA 4OKSA 2CEKA 4GL2A 3U2QA 3VPHA 1NVAA 5J59A 3QMMA 4KWIA 3JQFA 3A26A 5DISB 4RK7A 3VBEA 4CMGA 1K6XA 3I9MA 5KSYA 2HMVA 1V1MB 1X14A 1I14A 3HB0A 2B2XA 2FZEA 4PS0A 1E2QA 1E4OA 4UZFA 3N3AC 4MKXA 2OCYC 5EXEA 1XQ1A 1OXMA 2QSYA 1NVXQ 4OHBA 1ZD2P 3NM4A 4AS3A 4F6RB 5JC8A 3T9BA 5LQJA 2YXNA 4CM4A 1DKPA 2WU0A 3O6VA 1IHDA 3G5UA 3GFVA 2RC5A 4EUHA 2ORWA 2CNWD 2R1TA 4Y0NA 1AGXA 4GU5A 4UC0A 1EP1B 4MULA 1EGHA 3GLKA 4Q3KA 3OEYA 1V8BA 4G8JA 1WSBA 4XDZA 3SSOA 5FKTA 3KXPA 4LIPD 1QJCA 2XL3A 1QV9A 10MHA 2WE8A 3U81A 3MZKA 3TQQA 2H9AA 5IGOA 4DVJA 3RC8A 3R7SA 1QIMA 3JYQA 5DCWA 4F8YA 3SX2A 3QUTA 1LUAA 3FTNA 5IABA 3GUYA 5JSFA 4C0LA 3OCZA 2Z5FA 2A0UA 3ZQ4A 2BCGY 1GY8A 4A0BA 5LA6F 2HDWA 821PA 3HR7A 5A6SB 1T5DX 4HX2A 5AJTA 2LKDA 1DQNA 3BFJA 3UJ8A 1IUPA 3KPUA 3D3NA 1MOZA 2V0GA 1WCV1 5AM0A 4RGBA 4D0GA 5EUBA 3TW8A 3IOCA 1H69A 4HT3B 3EPRA 3DO5A 4RHCA 2JI9A 3I2YX 3DAYA 1VYVA 3AEUA 4QLOA 4JI8B 2LDBA 4K05A 3F5FA 3IL2A 1J0CA 1HDRA 1J2RA 1OBFO 1YXMA 3LV8A 4RKYA 4ACBA 3MG9A 3EG6A 1ZNXA 4H3VA 2FOXA 4TSKA 1ZVMA 3S40A 3KAPA 3IVMA 1E9FA 4Y9RA 2GBIA 3RRXA 3JR3A 4YS6A 3LUBA 3MWDB 2MOKA 1RQXA 4MR8A 5LZ8A 2B98A 4O9DA 3MA0A 4OBEA 4J1TC 3ROZA 1ZLXA 4B7AA 5FPSA 4QLAA 1UBNA 1HT1E 3QYFA 5IJ7E 4AYWA 3DTVB 1MO6A 4KXVA 5DNAA 1TZCA 5LMZA 1CK4A 1VM6A 1UMKA 3L8DA 4QULA 5DO9A 1N0IA 2DQYA 1A9QA 3ZJ5A 2CMHA 5K99A 2Q7XA 1MX1A 2PL5A 3VAAA 2DBZA 5L8VA 4EHDA 1EMDA 3C3CA 2IHVA 2WTXA 3PNOA 4U2CA 4DIBA 3HU5A 3PITA 3AVQA 1S8FA 1R0RE 2XYHA 3BE6A 1JDBC 3W06A 2NAFA 3VJRA 1S2LA 2XQJA 2ECKA 3GYGA 1KAEA 1EP9A 4P3YA 1ELOA 1J06A 1M0SA 5TQVA 4MJLA 2G9AA 1KH3A 1XU7A 2ZUBA 3DOOA 1VHJA 4QOSA 4TVKA 1NPTO 4FEAA 1UJ5A 2B8EA 2GEUA 1BFKA 4D44A 4HJXA 3PQ7A 3FSGD 3ANTA 2OPHA 4RTSA 3VHXB 1DIOB 3RBAA 4BASA 3BB3A 1QGED 1L4YA 2NZ8A 1PT8A 1V8OA 3S7ZA 5I9IA 3WMWA 4EDHA 4JT5C 4R1QA 2ZWMA 5JMWA 4QD3A 3UH1A 1XRSB 2CLEB 1TYEB 4B33A 1MJFA 5EHQA 1WB9A 4ZHQA 4JCOA 1OGYA 3LTNC 2ZJ3A 2QLNA 4XPIA 1OIXA 3L5OA 4UM7A 2WUGA 4R1MA 4JLSA 4HWRA 2QRVB 3ZWXA 1XZLA 4PXYA 1ADYA 3LBIA 4HN4B 5EJ6A 5FQNA 2Z5GA 5TS3A 4KITB 2D8MA 5E95A 4CZVA 5BT8A 1KEKA 4L0QA 5AOCA 1W5BA 3QZUA 2H63A 3PXAA 4LK2A 3UXYA 2HWYA 4CMJA 3QI0A 2JFQA 2IFTA 5J2TB 4EY5A 1C8VB 1I4WA 4BPBA 2FMFA 2O2XA 1XELA 5HM8A 5H9WA 4B35A 3GBPA 3NTOA 3HCOA 1CY1A 2W6JA 2Y1GA 3GAMA 3R7FA 1JSXA 5E0KB 1TUEA 4AZVA 3COJA 4GOKA 4LPSA 3ZV5A 1Q22A 4DZRA 1MO2A 2DRIA 5SYMA 3RLIA 2R47A 4IS2A 1PQWA 4B0OA 3E7XA 3CO0S 1CBUA 1IU9A 1IHUA 3ACCA 1G5FA 5EMNA 3WKBA 2C8LA 2C94A 2XZPA 5DW0A 2IX9A 8GPBA 3FIJA 1Y5MA 3R23A 3KUDA 1L4HA 1OFTA 2E4UA 4BNDA 4AN4A 5JHGB 1ILWA 4Q34A 1DAIA 4RA6B 1GQRA 2EXXA 4XB2A 1H6BA 4COKA 1AHHA 3K15A 3SBXA 2WQZA 4HZIA 2FV8A 2V7GA 4TTIA 2X0KA 1RTTA 2I29A 5A4AA 1T8TA 4QUIA 3WJ1A 4QBTA 4KIGA 4ZDWA 2H1VA 3R6TA 4HF7A 1N34B 5LP6A 3OU7A 5TMDA 1BO6A 1Z16A 2IW1A 3O38A 3EXFA 1LXCA 2YMQA 3GMSA 4DNXA 3CKLA 1TB4A 4ZO9A 4JP8A 3WLIA 1VKRA 2YFKA 2FRXA 2B92A 3IMEA 1PBNA 2AKEA 4EGAA 4KBFA 4IIEA 3D3EA 1T9AA 2WK1A 1GU7A 5IAGA 3FFXA 1Y3IA 1WKVA 1KK2A 3SMRA 1AKYA 1SRQA 3KV1A 3PXEA 4LHEA 5CFQA 2JK0A 1CQJB 3FYUA 1DP4A 4M6WA 5JYEA 2WJJA 4X7MA 4BL5A 5JCPA 1QH0A 2DOKA 3WISA 2RGYA 5EERA 4ID3A 4G5FA 2P8SA 1RM0A 5EP1A 4PLGA 3U17A 1XA4A 4CRWB 3AFGA 3ZBUA 1QIEA 5HE2B 2Z3WA 3FYDA 4FT4A 1KJNA 4AOWA 2HL6A 3HPRA 4UXHA 2XMPA 4RY0A 3VX4A 3WMRA 3HDTA 1V3TA 2B3DA 4X90A 4OMCA 4NHOA 4ZCRA 3DUFA 2CLMB 1GNRA 3ADCA 5EEHA 4FEEA 4K3UA 2XKKA 1KR2A 3ICVA 2OG2A 3IUNA 3B9BA 3QXXA 3H1EA 1OFVA 3GVCA 4PGAA 1G9XA 2XUGA 3GJ4A 1Z73A 4BFVA 5GADl 2PVPA 2AC7A 1LF5A 4F91B 4JSVC 4GOMD 5AFU3 4H7HA 4KVZA 3S8EA 5JWRA 5EMKB 2PZBA 4KEAA 3GOQA 3KKLA 4JVSB 3LY7A 4XA8A 1BFUA 4MR7A 1EFUA 3OTOB 3QGMA 4M87A 4Q0MA 4E1BA 4ZMSA 5K0EA 3IJCA 2L42A 3ZGXA 3T3NA 5C2JB 4J0WA 3EAGA 3EAFA 2JLUA 2NU7A 2VHUA 1OTXA 2OSBA 4TMTA 3FTCA 3B1JA 3IEPA 2Z2JA 3UJHA 4F86A 1GT91 2XDYA 4IYJA 1E2FA 5ALZA 3EC1A 2XMQA 2O1WA 3C6KA 1IAQA 2OB2A 2WJ6A 1C0PA 3PHIA 4UM5A 4YMUA 1CG6A 4ETWA 4DWWA 3DF7A 1EXNA 2O8VA 1HBJA 3P2KA 1LI7A 4MW1A 1N6KA 2YR0A 1R74A 3RCBA 3B3GA 1JLLA 1G6OA 3KYIB 3PF8A 1KBQA 4YAJA 1E9CA 2R1VA 4MWSA 1PZGA 2VCYA 1TRHA 1H2FA 4X7BA 1ZKDA 1PSZA 1XLTC 3DA8A 4MMZB 4HGRA 3F73A 4IZIA 1CX9B 2XXAB 2VSFA 4D99A 3CNQS 3ZCRA 3TG2A 4FMDF 4TX1A 3ZOZA 1SQ6A 2PU7A 4BKUA 1RKXA 3C7CB 3O9MA 1AQJA 1JV2A 2A5YB 5FWXA 3ANXA 2H1HA 2VJMA 2AGVA 5JMOA 4PLCA 2A57A 2XRMA 3RSFA 3DNPA 3VOBA 3DTVD 4ZZ3A 2BFBA 1W7AA 1BCSA 4ZAGA 1JHXA 2QC5A 3ITKA 4K3JB 5CB4B 2QW1A 5CXBA 1J2TA 1TOAA 2B35A 2PMKA 3D6FA 2YUIA 4DBLC 3R20A 2DQ4A 2FWBA 1ORTA 2F3RA 4S1WA 3CZ9A 5CP8A 3F3FA 2R60A 2QJFA 4LMPA 1W48A 2OKGA 1YZKA 1G38A 3D4LA 2ZRMA 5I5IA 4DMGA 3R74A 4FYHA 1USKA 1DC6A 1II0A 3A4NA 3U9TA 2VUSA 2VDWA 1YMVA 3G2MA 3U44A 2F8TA 2NT3A 5IKOA 5JNRA 2C95A 2GHIA 5F1OA 3FNHA 2NUAB 1WXDA 2QUZA 1JVBA 3LCJA 3LT2A 1PJLA 1YMUA 4WIAA 4MMXA 1EXDA 1C7RA 4JL6A 2G88A 1SZCA 2YY7A 4YR9A 4YMSA 1SHUX 4JS0A 1NKTA 5L3SB 3UKRC 5LP6F 4C76A 1JSLA 4I1PA 3ELUA 4Q5IA 2ZSHA 3GRFA 5JCZA 2GPAA 4IWYA 3TD2A 2HDHA 1PR6A 5DHUA 1EFDN 3GCWA 5TS2A 1K8RA 4IEEA 4TMZA 2VWHA 4KK3A 2EBHX 4TV8A 3BKWA 3UW1A 1T3GA 4KWHA 4ENWA 3GGJA 2J67A 3NZEA 1DOAA 3UF0A 3GLGB 2OCGA 2WF9A 1VI6A 2XWSA 4KYIB 1MB2A 1WTCA 3DOHA 3GVXA 2BGKA 4LZPA 4DSNA 3GT0A 4ZKEA 3NTLA 5EQTA 4BO0A 3K0EA 1DKQA 4CM8B 3NVAA 3STWA 2HTFA 2P5TB 2PNFA 1TJYA 5EQFA 1ZR4A 1PWZA 1FQJA 1U0EA 3EG5A 4G0OA 4GX0A 4BV8A 5F5NA 2IU0A 3NHSA 3E9YA 2PKRA 2HF9A 4KWEA 2A0WA 1EUYA 4QWWA 1C9MA 4ARUA 3LIIA 3WNBA 2VTEA 2PKQO 3TI9A 2PIDA 4WESB 4HAOA 4C0XA 4Q66C 4DJEC 2C1ZA 3FCYA 1JFFB 1VPDA 3QEMB 4KR6A 3IPXA 4CEJA 2VKTA 4OHMA 1YR1A 3C4JA 2PEZA 3UAXA 4CIYA 4WOCA 1HORA 2DUMA 3KS9A 3MINB 3QU5A 2RKBA 2Z95A 1UWVA 3PR2B 4DIKA 1YBMA 1EFRD 1L7OA 3WTCA 2GCGA 2J8ZA 4IGAA 1PLJA 4J81A 4KXLA 4JI1B 3Q0TA 4AMVA 4MJ7A 3T34A 2RJNA 3O94A 2QK4A 4LDPA 4IUDS 5C4GB 2AKAB 5FBZA 2OK4A 5G3YA 2C84A 1RHKA 3BDIA 1FFCA 1OCEA 2JPDA 1N2JA 4QNMA 4AUKA 1PS0A 2EW2A 4D8UA 3QHPA 4F2PA 1EVKA 4CLOA 5JTUA 2WHEA 2XUHA 2IWHA 3TVTA 5CA0B 5I9NA 2O48X 4LGNA 2D13A 4ER5A 1PJBA 3KKKA 2VJNA 1CR4A 5AQEA 3QUAA 4WQMA 3RS2A 1BMQA 3EZ6A 1V41E 3OTIA 3CWCA 3OSZA 4BX9A 2I2AA 4B4DA 4B1FA 2OFPA 5EE1A 4MITA 1U8FO 3RSQA 1O0CA 2G5CA 2B34A 1KP9A 1UXGA 5JNLA 1PJSA 1V43A 2AF4C 4CF5A 1C9DB 3L1KA 3NTXA 2FJ0A 4JLMA 2UZAA 4FUTA 4JLPA 2HZ7A 1LW7A 1L5GB 5CVDA 3L9WA 4YCCA 3BN3A 1NF8A 2NTNA 3NS7A 1SCIA 1RHUA 5A5FA 1YS1X 4PEVA 2BKXA 1NW3A 1GV1A 3VNAA 4J3JA 4R2HA 2SKDA 4HDSB 4Y18A 5HMMA 4BOYA 1KBZA 1GCOA 1PJ2A 4XDGA 4HRXA 4G24A 2CDRA 3ND6A 2XRFA 4E09A 4PNHA 2QX8A 4YLYA 4Q02A 5HK9A 2R6HA 3SEAA 5JH7A 1U1IA 2YIDA 2OBMA 3PE4A 1LQTA 4DGQA 4KQGA 2G17A 4OHYA 2R48A 4FYXA 5BUSA 4ENTA 4YT5A 3TIGA 1RJWA 5ES3A 4EPXA 4EELA 1ZM2A 4PSXB 3K4QA 4WVLA 2I7DA 3C8MA 3CISA 3NKVA 2XITA 2CBZA 2Q3JA 5JNVA 2RBKA 4FFNA 1DBIA 3SQOA 1XPUA 1W96A 4ETNA 1HKHA 4LX0A 5A0TA 3IEUA 4OHZA 4AVYA 4CR8A 2WE7A 2F1RA 3ONVA 2CVQA 1GZSA 1PQ4A 4BCBA 1OFHA 4EG3A 1WA5A 4DNVA 2JFPA 3ZK9A 4FA4D 1U0RA 1ETHA 1KR5A 3W5CA 4DIOA 5KVSA 5FCDA 3OW8A 4A91A 1ZI9A 4KAAA 3WYEA 4CDGA 2XA1A 1HZZA 4LVUA 2FEPA 2OCIA 1WSWA 1NXVA 3VYSB 4V38A 2J30A 5G4KA 1I2MA 2G83A 1R88A 2M6SA 1XNJA 1E6WA 3CRNA 4X3OA 3GDFA 1F2TA 2NVUB 1GOGA 5CGZA 4WE3A 1YKFA 5IC4A 5JRDS 4YMWA 4L4YA 3PWZA 1Z18A 4KSCA 1CUBA 1W88A 1O95D 5K6RA 3FLBA 2OZEA 2A8YA 4J0GA 2CLOB 2PGXA 1E79A 3AHEA 1DRVA 1EQUA 4R2KA 1TI7A 4ALJA 2PD4A 3X2SA 4ANFA 2AQHA 1QGAA 1Q16A 4E0BA 3TZCA 3LUFA 5LQSA 4I66A 3RN0D 3OEWA 1FFDA 4PBYA 3FW1A 2CLHB 2X8LA 5CA1B 5KU1A 5KEIA 1RBMA 2FMXA 3AHGA 5BYAA 1WU7A 3O2SB 3DM9B 3IAM6 2WMOB 4BMYA 4HI0E 2HC9A 2F64A 4RHUA 1RAFA 3KG2A 1VL0A 5KCMA 3TCKA 4LRSB 1FLVA 4TMYA 5EZ6B 1XNRB 2HBYA 1UP6A 2R8YA 4WBNF 4OMDA 4BQPA 1E5VA 3TB4A 1Y98A 4B71A 1G98A 2XTNA 1V16A 4J76A 4F3KA 4F3NA 2B9EA 1AU9A 4LQ4A 2WDZA 3ICPA 4R3UC 1E64A 1Z7GA 1E8MA 5I5MA 1VC2A 4PNZA 3HJCA 4MB6A 5FBWB 3GJTA 2XYQA 4C5CA 5ALHA 5F7ZA 4MSUA 2IURA 4HQ0A 5EZQA 4IQFA 4ZI7B 2XB4A 3I37X 3JRWA 1Z36A 3AVUA 3DDUA 1KIMA 5DOZA 4TYMA 4N8DA 4NFLA 2JIBA 2PJUA 5FOXA 1N1DA 3H9UA 4XWKA 1P1KA 1UM8A 1OAKA 2Y27A 1ZJ5A 1F6DA 5HZMA 1W0KA 5A3JA 3O2NA 4ZOZA 4BO9A 1VSQA 1B0UA 5BO5A 1L7XA 1QVRA 4O4JA 3R8XA 1UZMA 4HNVA 4EHNA 1T6NA 1SCJA 2A4MA 3IAS6 2FP4B 1P8JA 4REMA 1RYDA 3SC3A 2AN9A 1MX9A 1ZG3A 4GKVA 5IDXA 3AONB 5IJ9A 3ZKWA 1K86A 3PRKE 2ZXUA 4EWRA 3DE6X 3T54A 3V3TA 3L6BA 1YRYE 4GX2A 1EVZA 2PMDA 4JYZA 4ZYVA 1GXRA 5EFOA 3R4VA 5KSPA 4A36A 2RHLA 4HNAA 4CM6A 1HQKA 1EX9A 2L17A 5J2UA 3K2BA 3V4FA 2A9KA 1N5DA 1NXOA 1MXFA 4F45A 4ZVTA 4HWSA 3G5MA 1I1NA 5GQSA 2HA0A 2RG7A 3QFHA 4PQFA 4Y6GB 5EMLA 5AJHA 1NXQA 1I9GA 8AT1A 5IUJC 2C8VA 4GD3Q 4HPXB 4D3FA 4FAVD 1CC1S 1X3SA 5E6UA 3H2HA 2CY0A 3OKTA 2ZYAA 4HO1X 3Q98A 1EG7A 4YO7A 2NTVA 1PVOA 1U5BB 4A2QA 2W2OA 2LRHA 1VRCA 4GM8A 3E9ZA 4TLCA 3TLKA 5J5VA 1YVEI 3DBLB 1WDKA 4ILEA 3RTCA 1OXUA 4LV8B 2VLBA 1D2NA 4K1XA 3JTEA 3A4IA 4A2MA 3QHYB 2UUBB 4IIHA 4X8OA 4K46A 4ZAFA 3VA7A 2WSMA 4F97A 4GMGA 4WH0A 1J23A 3FZYA 2JAXA 4NBUA 3ZCVA 4WV3A 4QTZA 1D7AA 3OBIA 3K5WA 1R18A 3NAGA 1H4SA 2QSUA 4CYMA 3I8CA 1ULAA 5LCXA 4R8MA 5EXPA 3H4TA 1NR1A 4RNDB 1JHVA 3W34A 4I4TF 1YR6A 5G02A 4D4GA 1N2SA 3UC9A 4UTRA 3B6IA 2Z8XA 4HN9A 4ZT7A 4HDAA 5AM1A 5CYGA 1XZEA 4JASB 3AKEA 2QTCA 4LSGA 1K98A 4Q1DA 3BDAA 2ALJA 3JQEA 2XMBA 3DUWA 4I6JA 4BLTA 3B2EA 2VK2A 4XWOA 4B3XA 3A32A 1NMEA 3PQ3A 2Q9AA 1T9DA 2I54A 4BU1A 4KDRA 4UUOA 1YA4A 2QA5A 1GTSA 2P5YA 1UEIA 5BN1A 3HYCA 4X44A 4A2CA 2I33A 4TV9B 2BZGA 1SY7A 3B6MA 4HBGA 5FI3A 1KJYA 2WYVA 2Z2XA 1ZY2A 5GJBA 2XZTA 3MTJA 1EDDA 3DKRA 4QZVA 1J1UA 2ZZNA 4BVGA 3BIOA 1ZIOA 4CC9A 2W2NA 3NT5A 3U40A 1M6YA 3AUXA 3KOYA 1H4TA 2CW5A 4MQ4A 5GVRA 1UJ2A 4GKJB 5C51B 1S2OA 2NT4A 1JBEA 1CY4A 5CLIA 3DQZA 3QENA 3IPYA 3PXBA 3IEIA 1UBHS 4XUDA 2ATIA 1VIMA 3I2IA 4V2IA 2OC4A 2AEEA 2IHKA 5BSEA 1PEAA 3JYNA 4U7AA 2QPLA 1G6HA 1P4SA 4S35A 2W93A 1XI2A 1RJEA 1E59A 2RMKA 3Q3CA 5K3EA 4RH0A 1PR3A 3MLAA 5AVVA 3HM2A 3ELBA 3UB4A 1VSTA 1MP0A 3RVMA 5AXBA 3DZDA 2WG1A 5F7XA 3DFFA 4RKFA 2P67A 2RHDA 2HJWA 4F4UA 3E9DA 2DECA 1SKAA 1S0UA 1E9BA 4UMVA 4D57A 1F3OA 3CZQA 4R69A 2W6QA 3DCNA 3FZQA 1NJGA 3NIGB 4GSYA 5J2UF 1T2XA 2X5JO 3ZV6A 1DRUA 1YFJA 1ZVKA 1ST2A 3U6KA 2OYRA 1UK9A 4KX5A 4IIVA 3BD8A 4PHTA 3CA8A 2O8DB 5K0ZA 4IJKA 2IHUA 4PG7A 2QW0X 4HQLA 1HPLA 4ENRA 1EVIA 1VL1A 2QM0A 3PYXA 4FTWA 4EG7A 3DMTC 3ZS8A 3ZGVA 5J47A 2ZIXB 4OJMX 4R1UA 3OEHD 3K09A 4REQB 5LYJA 5A03A 4YYZA 3L7NA 3WWOA 4FB4A 3D3WB 1T5IA 2WQ7A 5AW1A 1FNCA 4PO1A 4HNSA 3PX2A 1IHOA 6LDHA 5TDHA 1YO6A 2HK8A 4Q7MB 4N65A 4AJEA 4BVBA 1C1XB 2WVJA 3EGOA 1TJ4A 4I55B 2W4MA 2VR1A 3OJXA 3Q88A 4ZWNA 5JS6A 2P65A 4GBGA 1N5IA 3HPQA 4KAFA 4ZAVA 3DT6A 1KAHA 4TTRA 2BT4A 4B7XA 4KQ2A 1A5SB 2F4NA 5K2OA 2MR6A 2VPXA 1W581 4DMFA 1GTVA 2QROA 4B85A 1ZSYA 2WIJA 1R3DA 2PD6A 5F35A 1W35A 3G13A 4GP9A 3KT0A 5LQNA 4B7UA 4E5UA 5HF9A 1XG5A 1MABA 4WX2B 3UWOA 1UPUA 1WW3A 3CZ5A 4V0NA 4AUEA 3IYLW 3IDOA 3QW2A 3VQTA 1QC5A 4GI5A 3RS3A 3E1KA 5EG5A 4C08A 1G7CA 3LDGA 4CUZA 2FVYA 3N6RA 1UZNA 3UEOA 4LWQA 5I3ZA 4GM4A 4R7TA 4BHTA 4Z53A 2UZIR 2VDKA 1R3UA 1C30B 4JITA 1KERA 1XDBA 1RAIA 1UAAA 1Z17A 2YXEA 2JLRA 2PLAA 2YQ4A 4R6XA 3PT5A 4GRIA 1P44A 1LQUA 2JLXA 2F55A 2HWUA 1IZ0A 2VHQA 2JA1A 1O95C 4QFMA 1YBAA 1XRRA 1CR0A 1XEWY 4KN6A 1QTRA 2BFDA 5E6SB 4WFKA 3SYTA 4JSTA 3NHAA 2VT6A 3LPDA 3HA2A 4QU8A 2ZJ2A 2ZTSA 3SEFA 2WV9A 4QHTA 1GR0A 3ZX4A 1W4ZA 5DLQC 4UU0A 3ZVLA 3BAZA 4JKYA 5HQ3A 3H1PA 1G7RA 5FLYA 1ZK3A 3ADDA 2VP3A 2VPTA 4DCOA 2XGJA 1DJLA 1GPKA 2GEDA 3NI2A 2NQTA 3R40A 1LC0A 2ADFA 3FDZA 1UKVY 4JXZA 3AF4A 2FPMA 3PNKA 3EDCA 1JXOA 3W8EA 3WGLA 4JX9A 4FZRA 4MPTA 5CYKB 3DYBA 2HJSA 1ESCA 2PL1A 4IBOA 4HRVA 4KAJA 3LSYA 4ZAWA 1E3MA 1GKUB 1LTKA 1V8ZA 3IULA 3AJAA 1LF0A 2GPYA 1QPZA 1NGSA 3MTBA 3ORFA 5B3KA 1U6KA 4RX1A 1WBDA 4Q93A 1LDNA 1EBFA 1TFUA 4BN5A 2C7PA 2YHUA 3L8CA 3SZRA 2ZJFA 3SC6A 1Q15A 2Y4NA 1N0WA 4HAUA 1JR3D 1AY0A 4CVNA 3ADBA 3FPGA 1JQ5A 3HU2A 1P62B 4DSAA 1YDHA 2QVLA 1G16A 3A3NA 4PBZA 4M1YA 1IZZA 1Z2PX 1QE0A 4AS1A 3V7DB 1G63A 2RSLA 1RCUA 3N8GA 2O14A 1KO5A 4L78A 3ZZTA 5TXGA 1QBKC 2F1KA 4UBOA 1TCBA 5IKXA 5K0LA 3DHWC 1Z26A 3MSCA 4KYVA 4Q9NA 3ZHCA 2HIHA 2E1PA 2GD6A 4IOJA 3D2AA 3JQAA 5JTTA 4N7RA 5CYPA 3HC7A 2BR5A 5I5GA 1BDJA 1R4ZA 4OATA 2FWIA 3HL0A 3OZGA 5LA6A 3I32A 3C97A 3MRSA 3PD0A 3LPLA 3D4BA 2O2JA 3MGGA 4FX2A 3KJNA 1EDBA 3TXYA 4M76B 3PLRA 3MIZA 2WINI 5C4MA 3GFGA 2FPOA 1XU9A 1XVVA 3TW6A 3PPIA 2NLOA 4BVHA 4HADA 3N9IA 4JC5A 1IB6A 4D56A 5HCUA 3RIYA 2NPFA 1EB9A 3KAQA 2J6IA 3IFSA 4ND8A 4Z3KA 4GR4A 3A9UA 3WK5A 4B87A 2C04A 2GHQA 2WM9B 1EUCB 3FGBA 4DCSA 3MELA 4OK5A 3AVVA 2MSLA 3VR3A 5E9AA 5ICSA 2I2FA 1FZQA 1RJ9B 4AZTA 4HWTA 3OLCX 5IJWA 3RSHA 2RHMA 2C54A 3SZOA 3V8RA 4U0JA 1GG9A 4RIIA 1W4BA 1Z56C 5J40A 4LDAA 1F8FA 4YFVA 1YU6A 1BC5A 1JEJA 4PSKA 4BFTA 1IQPA 4BVAA 4XQ0A 4WXMA 1JVNA 1DUSA 1RD4A 3FCXA 4EVQA 3TAXA 1UOQA 2YY5A 5ALGA 2ZM6B 3DP9A 4ZVKA 1P2SA 5CVEA 3LYAA 4LJ5A 2R6CA 4XVCA 2A0KA 5TY0A 4LJ4A 2XIJA 3VO9A 2YQZA 1L7PA 5G1NA 3MTQA 2F4VB 4BJHB 3L0ZA 3LP6A 1YRLA 4OQMA 3QUBA 4KHPB 1LBSA 4I6EA 4KB5A 2ZCVA 1CS0B 2RCNA 1Q84A 3EGXB 3LC0A 2QQ0A 4B3IA 4OA8A 4HDKA 3F2IA 4YDSA 5GZ6A 3OIFA 1WG8A 3LHFA 2YC4C 1RC1A 3RW9A 4DSZA 2LGJA 4C5AA 4BFLA 5BW5A 1UPBA 3FDXA 3V1LA 1NNLA 2A33A 1L4FA 4KQFA 2AJBA 1DDIA 1ULSA 5TC4A 1CIPA 4K86A 4ZOLB 3EG9A 3KETA 2P5SA 3JZAA 4HAYA 3WHKA 3JQ7A 4YLEA 4ZOVA 2VC2A 1DAMA 1JQBA 3PGMA 1X15A 3REQB 4E3ZA 4NYMQ 1K3TA 3G2PA 1USVA 4AO7A 4GPAA 1NUQA 2WWHA 3SIPA 4OA5A 2BM0A 4BO6A 5EHNA 2C8KA 2DKNA 2FQYA 2ZIFA 4EO4A 3HVUA 3H84A 1Y5LA 3NTVA 2HNKA 3E3LA 1DAEA 3QWAA 1EX1A 2IHTA 4EG5A 2PWBA 1ZOLA 1MDBA 1SHTX 4FGLA 3K0SA 4WNYA 4YJGA 5LQMA 5HBGA 3AL2A 2XADA 2WPDD 3DR3A 3DO6A 1JDUA 1PR4A 2Z56A 4Q39A 2HI0A 5KUTA 1ENZA 3QY0A 2EX0A 4AYTA 2XB2A 1M6HA 2WEKA 1NI4B 2QX4A 4BNHA 3JB9L 4JT6C 1RR6A 3IBTA 1EQAA 5H4GA 1Z6GA 3R75A 1W34A 4I19A 3DLAA 3OE1A 4JHXA 1R10A 5KYUA 4ZD6A 5THXA 5SZHB 5AT1A 1UBOS 5EMJA 1AK1A 3ORHA 1N6DA 4RGQA 2ZAGA 2XGGA 3KXKA 4BLVA 3FOFC 4MW5A 2DFVA 1UMDB 1ZP6A 5JVDB 3WB0A 5K8LA 3M49A 1DBRA 4PINA 5HDQA 4IUBS 2K4MA 1IUOA 2P11A 3KRTA 1J09A 3UGQA 2GD0A 1V5WA 1Y34E 3LKDA 4NPAA 2MSWA 5CD1A 1ZM7A 1BXZA 4ADSG 3RFFA 3ZY2A 3W5VA 1DO0A 1KS9A 2C3OA 4YBZA 4ZYYA 3DYVA 4HVCA 4R98A 5JAQA 3DXYA 2GBFA 4JHNA 1JPJA 4JQSA 3EQ6A 3K71B 5JADA 2BEWA 4B3GA 2YVKA 4CKZA 4G8CA 1GNVA 3QX3A 1S7GA 1FP1D 1S4UX 5G0VA 2QV0A 1ECPA 3A1UA 4N18A 1OLSA 2GAAA 3OFNA 2ZIAA 4FKMA 1NOKA 1DIAA 4Q7QA 3NV9A 2V54A 1P6QA 3CUSA 4KXMA 5B58C 1DCMA 3ZQKA 1AK9A 5LOVB 3DOJA 2ZDQA 2A94A 5FBLB 2CNOA 1TZBA 3TRKA 4F8EA 3BICA 3RD5A 1QCDA 3AH8A 3LF1A 4EJMA 3JQGA 1B3RA 1MT0A 4V1CB 4TTTS 2MSKA 1SBHA 3H3FA 3FHTA 1CVLA 2HY7A 4DA6A 4DE5A 4NE2A 3EYWA 2V7TA 5LJIA 4H0NA 4RXTA 4MVXA 4KC0A 1H9CA 1IULA 1CPYA 5EWJB 4DV5B 2E48A 2Q0SA 1SOUA 3IIKA 5FTJA 3GJ7A 5IH7A 1Q7TA 2G1UA 3A9SA 2OE2A 4RAOA 4A09A 3JZGA 1RMYA 3O8LA 3IIIA 3ZHYA 5LQRA 3I5XA 1DXQA 4O4HF 1WUHS 1OLZA 3DB2A 4CMEC 3RAFC 1OASA 3OY2A 4KE6A 1QQ6A 3HA5A 4JJ7A 4FUQA 3OICA 4TMWA 3KPJA 1GDTA 1J00A 1WZEA 1Z88A 4R2JA 5KOHB 1G20A 3BXHA 1OB5A 3KOUA 1EAMA 4B2LA 3ONFA 3RS4A 2E4ZA 3G3EA 4MAAA 1CY0A 3MZ0A 4R6WA 3THXB 4BMOB 4R0MA 1TPYA 1XU4A 4MTCA 1E8NA 4K40A 4WJKA 3LPNA 4P7JA 2UZXB 4WY5A 3VYRB 2IZ1A 3IURA 2JD0A 2GJ9A 1L4UA 1NNUA 4EPYA 5AVWA 4A7JA 4QNNA 3BZWA 3OHMA 1X77A 4BDTA 2JVIA 1JA1A 2FR0A 5EXDA 4NBLA 3DBRB 4QUHA 3LSTA 3W5IA 3HYNA 2OCKA 2GVNA 2IYQA 1BRTA 3CJRA 4F5YA 5L53A 4YUVA 3QP9A 2EL7A 1FF9A 2R6ZA 3TL6A 3FGOA 4C03A 1Q0UA 2H5LA 3WMEA 4Z7OA 4MV1A 1UP4A 4H77A 1X7DA 3KOXA 5BWLA 3P19A 4NVRA 3A04A 1KK0A 4ZOBA 4J77A 1J70A 2IXGA 1QVZA 4J82A 3HJGA 4MA4A 2PXHA 3QKRB 4GHWA 2QRGA 5KNCA 3UGKA 3E3AA 3C3JA 1X94A 1XLWA 5CNKA 1DFHA 4QECA 4BRWA 4FQ8A 3HVHA 3GFOA 4IIUA 1FFXA 1Y6ZA 2EWWA 2G67A 2JJQA 4RORA 4FS8A 2WM3A 1N5RA 1J8QA 1BWRA 3TRHA 4EWLA 4F7WA 2KX7A 4ECAA 3PWTA 4OP2A 4JLBA 3RUFA 4GQBA 1K6IA 3CR7A 1O94A 3BL5A 4YRZA 2VRCA 4HLNA 1M8GA 5GM1A 3ZWCA 1PGNA 2C4MA 4UUNA 3RSZA 3RYIA 1EFPB 4YAGA 3CMCO 4TS9A 4IFEA 2F3PA 4HK4A 3AF1A 1GOTA 1BS2A 4D74A 4CQNA 3R6WA 4I14A 3O8OA 3DZCA 4O25A 1K2VN 3UHAA 4BZXA 1N9KA 3HLTA 3KBBA 5T4HA 2I7VA 5JPDA 3CE9A 2FPGB 3H8JA 1G3IA 3WIBA 3HY4A 2O57A 2ZZMA 3IQDB 3A70A 3OZAA 2F62A 1YONA 4NDNE 3MKSB 4TT8A 1N2HA 1KVSA 3OQHA 2KB0A 1RZUA 4TLLB 1V1JA 3V1KA 3AF2A 3ANYB 5G4LA 1AV7A 4PO9A 3A0RB 1XQXA 4PX3A 4XLLA 1U2VC 1KI7A 2EFJA 4MP3A 2HLHA 1IONA 4TLDA 1U3FA 1NT2A 2FRDA 4H1HA 4KJXA 4TLBA 2NU8A 3R5KA 4GI1A 2GA9A 2NZJA 2H07A 4AKTA 3T5CA 2NO5A 3SFTA 4P92A 2N3ZA 3OZBA 2RGEA 2TMKA 3V1NA 1OI2A 2JATA 4YUWA 4EPRA 1X7XB 4QM7A 1O97D 3F98A 1W85A 2PX6A 5K0GA 4RE6A 5COAA 1YK1A 3W5AA 3E3NA 4YWHA 1Q1AA 2H16A 2YN0A 1MPXA 1BVYF 3UYLA 3RVRA 3EA5A 4B45A 1OH7A 1LDEA 4W5QA 1KI3A 5FNVF 2WFLA 4RW0A 3KXDA 3O03A 3RSGA 3OECA 1S02A 4HGNA 1SQSA 4Y3UA 1I2DA 1ZGJA 2BJVA 5JAOA 3QKUA 5IBPA 3L82B 1G7SA 4RQBA 4BMXA 1J07A 5GONB 4DB4A 1QHGA 1Z2DA 2V7BA 2KYRA 3HYTA 2SBTA 1MC4A 1FTQA 4G0VA 3AUUA 1P29A 2R5WA 1LSJA 1DHTA 1KJ9A 1LKZA 4I0WB 3K9CA 4LOHA 4ZQBA 3DOCA 1ZK4A 1DNPA 1CFJA 1EBBA 2CE9A 1GXSB 2X8JA 4XVHA 3DZJA 1P3Y1 3LD9A 4AS2A 2WLSA 5IANA 2DFPA 4ZP1A 5DRTA 3VR4A 3BE4A 5JLJA 3RBXA 3P27A 1BE0A 5CAEB 1PG0A 1DC5A 2DG2A 4ARSA 3HUEA 3TQOA 1A9XB 3CVXA 4J7CA 5JROA 1TAUA 2WTUA 4N3CA 1L6RA 2YMLA 1NC1A 4OU5A 4ZXFA 3WV4A 4AF6A 4NEHB 3LP8A 3GUHA 5JCJA 3OX4A 3U3ZA 4DLLA 1K0FA 1EAYA 5LL6P 4NYJQ 1KC3A 4Z7NB 5GPBA 3IQEA 1M1UA 4QOIA 2D5LA 1T35A 4JYAB 4ZHSA 4US2R 3AOEC 5HE3B 1YQWA 4QO7A 2PFKA 1IIBA 3M81A 3WAGA 3TKYA 2Z3ZA 4FKBA 2J3EA 4O4IB 3OU6A 2AWNA 2IHBA 5AOBA 3G8YA 4HAWA 3UMGA 2YV5A 2VWQA 1ZL0A 1II8A 3HCEA 2QTGA 2HUPA 3LU1A 2FQXA 2VSNA 3HP7A 3ABOB 4DIUA 4RAQA 3U62A 4Y2SA 4E21A 1LWNA 2NNWB 4Z54A 1Z0SA 3SDZA 5B4TA 2PG3A 4PQRA 2QRQA 5DULA 1R66A 3PNLA 3SF8A 3BWBA 4XZ3A 1UBFA 3B2QA 3I39X 3A4LA 5A2QA 1SQJA 1MJGM 1KYZA 3BCRA 3PUWA 1SBYA 4IXMA 3LC1O 3VGZA 2RGNC 1ODLA 3LT0A 5BP7A 5BY2A 1O8CA 1MV5A 4MR9A 3HJFA 3HXLA 2WG0A 3O90A 1FX0B 4IIBA 1G64A 3CO5A 1DCFA 4WK2A 4B32A 4OAPA 4S05A 3PNPA 3KD2A 1AKRA 3OT1A 4GR5A 1DQRA 2HEIA 1R12A 4IS3A 4B2YA 4HFJA 3TMYA 2ODAA 5EM2A 2PZJA 4CTJA 1V6AA 3BULA 5EGSA 1KETA 4M8LA 3I4CA 2ODNA 4IH1A 1YVUA 5BRAA 4JT9A 2HLDA 4EITA 3RRBA 3TOSA 4C4YA 4BNYA 3WBJA 1Q50A 3RFUA 3PA8A 1A97A 2D7DA 4D6PA 3KLOA 4MK4A 2YV3A 3UMMA 1WXFA 3AYZB 3ENWA 2OO7A 1CUSA 2WD7B 4FYJA 1NRJB 2VP2A 1S1CA 3NTUA 5CXXA 3HR8A 5BMVB 4EY6A 2V3WA 4TL9A 2AXNA 1PR1A 3EK2A 3K5HA 3LUJA 4UE3S 2VNJA 5MF6A 2J32A 3SBQA 4A0GA 2JLWA 4UMDA 2P9GA 4XM0A 1J4AA 3BJIC 1C9IA 1G3QA 1S8OA 2QG4A 3TFWA 4JEIA 4BLOA 4G3XA 1J0XO 3O5AA 4KPEC 1CYEA 3L8EA 4BRZA 3P26A 4UXJA 2RBEA 3AHJA 4X64B 2YFQA 1IIRA 2XNCA 1J22A 1U98A 2IHZA 4IDAA 5DBEX 2DETA 1E2IA 4BWFB 3L9XA 1Y6GA 4IO0A 1VCOA 4X00A 4Z4GA 4L2IA 2GB4A 3Q7TA 1OFGA 1TA9A 2HKRA 4IJ5A 3BYZA 2BUAA 1B15A 4AMBA 1GNTA 1ESEA 3RJMA 4DFDA 5C1DA 1OYWA 3ZJVA 5KQLA 3NQ41 4FLEA 2PUVA 4JWTA 2I3AA 4U2DA 4N5LA 3AUKA 4MUYA 3QUQA 4KPUA 3M70A 4HNUA 3MILA 3LP5A 4P31A 2YINC 2GUGA 1WY7A 4YDHB 1R0WA 2D2VA 3U3XA 4WBNA 2GAIA 4NMXB 3RYHB 3SMQA 3LECA 4CFSA 4BB9A 4YV0A 1C7FA 1SGWA 4B5KA 1PZMA 2YFHA 1HG1A 3D6VA 3U3DA 3ZI0A 4RULA 3BSSA 2RGUA 1B42A 1RQPA 2FR8C 4ZZ2A 1JNXX 3QVUA 1RKVA 3ZY5A 3DEFA 3IJEB 1HYBA 4CDRA 3GUUA 1FJHA 1AS3A 5E1DA 1AUPA 1SFRA 1ZMOA 4GSLA 3TNLA 3AY3A 5DGTA 2M1XA 2OXTA 1OV4A 2YWRA 3EUAA 2W4IA 1YQQA 4D3ZA 2QXVA 4RF4A 3QXCA 2I71A 4EF6A 4MVJI 3A6PC 1PW5A 3DH0A 4RVGA 1F0YA 2HF2A 2BLLA 1GQOA 1FTSA 1RXWA 1KDYA 4JP2A 2TMDA 3MT0A 3CIOA 3ORQA 3W2FA 3HCBA 1SOVA 3VYVA 1ULTA 1NBEA 3QFFA 4C07A 1FDVA 1PUJA 2VYCA 4UPDA 1VKJA 2XNSA 1NZJA 3ZY6A 4RESA 2HSJA 5G1OA 3AERA 1WY5A 1BKSB 3IHKA 1IWPB 1EGMB 2QZPA 4P32A 3EZLA 2CFCA 1G2IA 4YRPA 1C7ZA 5EXSA 4HSGA 1CUFA 3EEBA 2P9CA 3PA6A 3RHSA 1H1TA 2X14A 3AM3A 5KYYA 1GPDG 3KLMX 3LAWA 4CNQA 4JOQA 4H1UA 1IBKB 3RFGA 16PKA 4WZZA 5LFAA 2ZYRA 3T0GA 3F47A 4OV6B 4B2PA 1P4RA 4D79A 4JX8A 4WSOA 4F92B 4N0MA 4K6HA 4RQUA 4MK0B 1XYGA 4FYIA 2PQMA 1EK5A 1JAHA 3GH1A 3TRIA 2YOFA 3VR5D 4EY7A 4XLZA 5CIYA 1E7WA 1DEXA 4RIGA 3GXBA 4MAMA 1DJPA 4D8TA 3SHVA 1Y4ZA 1O5OA 4LYAA 1U7UA 4FHDA 4RFLA 2G3YA 1LTHR 3BWSA 5KNCH 2X4LA 3TS1A 1BEEA 1DL5A 3QELA 4P81A 1JSRA 2Y77A 5LB4A 4HEJA 2H0QA 3QVOA 3QSGA 3SI7A 3U09A 5ICFA 5K1CC 3NKLA 2BFNA 3GP8A 3MHPA 4PAGA 4FGZA 3SXPA 1CUGA 3I34X 3QEAZ 3QU2A 1IB0A 3OFSA 4JNCA 4YCJA 2VP0A 3CUKA 2BL4A 5CXSA 3A1EA 3T5GA 4MWCA 3FUXA 4RM3A 1KORA 3P96A 1LX7A 3Q72A 4YCLA 2EERA 3V7FA 2VAPA 3G8DA 3IQZA 2VHEA 3DXKC 1XWWA 5K01A 4U2EA 4ABTA 4ZMBA 4BN4A 3IEXA 2H92A 1JFTA 1VRVA 3LX6A 3M82A 3WWPA 4URHA 4ZCIA 2XPCA 1N25A 5GJVC 1VJRA 4LGYA 1E61A 4I4TA 1ZD3A 1A12A 1C9NA 1PT6A 1OH6A 2REQA 3PUZA 3Q6MA 1NAIA 2PT9A 3MB5A 1UP7A 1AV6A 1J6UA 3W1WA 5DHTA 1XRNA 5C53B 1DAOA 2ISCA 3LIPA 4H18A 1DU4A 4DUZB 1Z38A 1WBJB 4RTJA 3H1AA 4IV5A 1O97C 4B82A 1YB7A 1GGEA 1DRKA 3KQMA 4Z4QA 4R16A 1D2MA 3N76A 4NCXA 3Q11A 3BWMA 4RABA 1GM5A 2WHXA 1GPWB 4HH1A 2Q4RA 4DLSA 4PHFA 4UUQA 5CG1A 4R01A 1NZFA 1ZH2A 1KU6A 5JS1A 2Z0MA 1EFTA 1VHWA 3R9XB 1FXWA 5TSDA 2YOGA 1XFAA 3DVAA 4Y2TA 1W4LA 3T3PB 4L4ZA 3DOUA 1DJNA 4RIEA 2RC6A 4O0LA 1HO3A 1Z6AA 1BFDA 4I4CA 4WNCA 5K6AA 4EFKA 4ZPXA 2NU6A 3KVVA 2P40A 3O4HA 4YUZA 4NU8X 4EQZA 4GS5A 4B83A 5ALIA 1UBSB 3GN2A 1X7WA 1MUUA 2P9UC 1A1VA 1C4XA 5HUQA 2C2HA 2WWRA 3N07A 3PNQA 4QOJA 2XE7A 1GZ7A 2Z1DA 1NXXA 5H9VA 3KWFA 1ZESA 3C39A 3V34A 5KJEA 2XJ4A 3ISTA 3FPLA 1IEQA 4U6NA 5CCBA 4C0WA 2VSQA 3VZQA 4LKRA 1TGVA 4JB2A 4XVQA 1AUVA 4UM9B 2LVBA 2C29D 2EG5A 3ORYA 4HLUA 3JATB 1Z4IA 4MGKR 4J0FA 1MG5A 2ZWOA 3TSZA 4NI5A 5UKDA 2I5PO 3R7WB 5HIAA 3OZRA 2I3SA 5BV7A 1BQ3A 3OIGA 2CJWB 1R0CA 4PX5A 3VR4H 1DKNA 2B6HA 4Z3OA 2W2QA 3DWFA 5AVSA 1E18A 4LC1A 2XUKA 2COKA 3FKQA 5TARA 1SD5A 4PC1A 1UJMA 1G8PA 4JSNC 2NW6A 1N2EA 4J7AA 1LLFA 4YROA 3NWBA 4BEWA 1CDEA 1OX4A 2IEZA 2QYOA 1ND6A 3WK9A 3KSRA 1I51A 3NIFA 3CLUD 1U2GC 2MR5A 3DEJA 3KKQA 4P38A 5KTPA 5DE3A 3CB4A 4A1FA 5LYYA 3GCGA 3Q9LA 3MRVA 5JNWA 4NZPA 5KINB 2C0QA 1Y89A 3DFZA 2C3MA 2YNPA 2Q99A 2B61A 2A92A 3BWEA 3PTLA 3BEDA 3K6SA 1E2NA 4CMIB 4K8RB 3I2HA 1M8JA 3K20A 1QIGA 1JB9A 4RK1A 4U9UA 5KQRA 4CF7A 4C3UA 2ZSKA 2H1OA 4GXNA 4L6CA 4R7GA 1GLGA 3BUSA 1VYHA 3T0IA 1RAGA 4XJSA 1ZBQA 2X4IA 5EP3A 3CPJB 1XPRA 4NL4H 5G0TA 4D6XA 1LRLA 1L5VA 1ZBDA 3V4VA 2ZRFA 3D3QA 2A5GA 3LWBA 4RVOA 5I4IA 2VPWA 4E94A 3A9VA 2ZT6A 5D00A 3T3OA 1JEQB 3SQMA 4WLVA 3DW1X 1C9LA 4TZKA 5M29A 4ZGWA 5K0BA 2C2XA 1QHHB 2QR3A 5U4XA 4WA7A 2OFFA 2O3QA 2ASEA 4EG0A 2VZ3A 4M1MA 2ADOA 2W22A 1I7LA 5GJCA 1US8A 1KMMA 1XEXA 4TXJA 3K0AB 2PDAA 2A7XA 4R3NA 2YWFA 4Q4AA 4LRQA 1GD1O 4KO2S 4A0SA 4PC7A 2C7GA 2EQ5A 4G23A 2HZBA 1LWOA 3K5IA 3OOSA 2Q3BA 3PYLA 1JX6A 1XTPA 4OAOA 1HH4A 2GD1O 2YWEA 1TQ8A 4YRSA 1QUEA 2I1VB 3FFTA 3QPWA 2POQX 2JJ2A 3Q15C 1H23A 2DWPA 1A4IA 5LDHA 3V42A 3I1FA 4GECA 3C48A 4FN4A 2GK7A 1R9GA 5IEJA 4G5XA 4C0BA 4UPEA 3Q9UA 4QPDA 2QP3A 5BPHA 2EKPA 2EIHA 1UT6A 3T7AA 3JQ8B 1RRGA 4ZDKA 2CNKA 1SN7A 4BFYA 3WQHA 2YJ5A 2ZAMA 5C0OE 2GZ3A 1GTJ1 5LZ2A 1JIQA 2QRZA 1TKAA 1M1ZA 1VG8A 4CY1A 3R3UA 3MNFA 1XIVA 3FKJA 2YZKA 3SLGA 3L8HA 4PBTA 1WQ4A 2H7VA 4DWOA 4EB3A 1FXWF 2CE2X 2QN3A 1VLVA 2FMTA 3G5LA 4RENA 3A1NA 3AMVA 4FJ0A 3PXSD 1NE7A 4MICA 4FSDA 4ITRC 1YJCA 3M3PA 4OXKA 2ZETA 4N7MA 3T3MA 1T36B 2BGTA 4RUKA 5A1JA 1YA6A 2VS1A