3IUMA

Appep_wtx opened state
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
684
structure length
668
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 187
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iumA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iumA01
3HJUA 1AX9A 2WHPA 2HHAA 1F6WA 4J0IA 4LHEA 4Q3KA 1DTEA 3F9CA 3C8DA 5AI6A 2JGFA 4WY8A 2XLBA 1JMYA 4UPDA 2RHWA 3JW8A 2VJBA 1E89A 4EY5A 2VQ6A 3W9UA 5FP0A 2DSNA 2ONCA 4BVLA 3PE6A 5LZ8A 3CN9A 1YS1X 2OXEA 2HA4A 5IVHA 4BYMA 4UBIA 5AIBA 2XQJA 4EZIA 5AK5A 2PSHA 1MN6A 3FCXA 3WJ1A 3F8SA 4OD0A 1A7UA 2G5PA 2XUGA 2CUTA 3I1YA 1SCIA 1H2YA 1QE3A 5DNUA 3VVLA 5BOVA 4CIBA 1ZJ5A 4EBBA 3Q0TA 1LPBB 3KWFA 1TCAA 5EFZA 4FDMA 2XUPA 2PUJA 2ZJFA 3H2IA 4QDOA 2HFKA 3PFBA 3H2GA 4RPCA 4X7BA 3ZI7A 2BGRA 3HEAA 3BF8A 3WKBA 2XMZA 2YH2A 4DM7A 1YA4A 3KSRA 1EINA 1TQHA 4FFWA 5T4FA 4JH0A 2WTMA 3YASA 4X6YA 1XQWA 4L3WA 2Y2UA 1HQDA 3IB3A 2I3ZA 1U8EA 3WI7A 2ZJ7A 4MJ3A 4Y2JA 3VJLA 3MVEA 3ZWQA 3WKAA 1QONA 2BJHA 5JD4A 2I3DA 1DQZA 2DQZA 4Y2UA 4X90A 1UKBA 4FFVA 5CH8A 2XMDA 1P0PA 4BZWA 1SCKA 1GQRA 1H22A 4L0CA 4MWSA 1ORWA 4E14A 5A7FA 1QIHA 3AINA 4X71A 1G4HA 3WA6A 4BDSA 5I9IA 2OQVA 2EEPA 4UBKA 5ALGA 3KDAA 2OCLA 3ESDA 3AZQA 3D2CA 5LLSA 4UHCA 1GPNA 2OQIA 2AJDA 1MT3A 4P08A 4BVJA 3M3DA 4WFKA 5FOQA 1GKKA 2D0DA 2HU5A 2J4FA 5ALEA 1U2EA 3T52A 1GKLA 3E0XA 4BAZA 3DKKA 4KJXA 4EB0A 3MUNA 2X76A 5JASA 4CI9A 4BCBA 2JIDA 2C0PA 3ED1A 1G5FA 4B9AA 3WZLA 4ARBA 3EBLA 1ZOIA 2B61A 4QLOA 3WK6A 2XQGA 5JATA 2ZSHA 5AOCA 1MJ5A 5T4BA 1W75A 2P8SA 1CEXA 4OYLA 3M81A 3W2TA 3LIPA 3I2HA 3WK7A 3BXPA 2R8BA 2CJPA 2VJDA 2C4HA 3D2AA 2GYVA 1DINA 1Q0RA 1DT3A 1A8UA 1BCSA 4CCYB 3WWPA 1YAHA 1RP1A 1HPLA 2HA2A 5JD5A 3QMVA 1H2WA 4L72A 2ZSIA 1XZFA 1UKAA 2C0QA 4MEAA 3DL7A 1XRRA 2XQIA 4JYPA 2JGIA 1XQXA 5EIAA 1CUYA 1XRMA 2O2GA 5AK3A 4UHDA 3A2LA 2WJ6A 1F0NA 4G4GA 2WG2A 4J3JA 5CTAA 1E3QA 1W76A 5ALVA 5LZ2A 2XB6A 1LZLA 4HTAA 4GEGA 1FJ2A 3FLAA 3V1KA 5DWDA 1IVYA 1M33A 1AGYA 2BUAA 1LPAB 4QEKA 4H7JA 1DU4A 3W05A 3HXKA 2V9ZA 4Y2XA 4ZGBA 5JZ9A 2OGZA 1WPXA 4G1FA 3DOHA 5AP9A 2GBFA 3WWCA 4KAJA 4INZA 3PF8A 3F96A 4J0HA 4LYDA 3QVMA 2XI4A 3QITA 5AKKA 1ZIYA 3BIWA 3M82A 3C45A 3AIOA 4PF1A 5C8XA 3WIBA 4BAGA 1WHSA 1CRLA 4DNQA 4X94A 2J3QA 4H7FA 4HZGA 2JGLA 3QPCA 1S8OA 3A70A 2GBGA 4KE6A 4DNOA 2WHPB 4KAAA 2CZQA 2XUKA 3FWHA 1XLUA 3WK9A 3WK5A 5AM3A 2HIHA 2HA3A 4YK7A 5K3EA 5IKXA 5T4EA 3R3ZA 3ICWA 1W6RA 2RHTA 4YX9A 1GZ7A 2QOEA 2BAGA 5ALIA 3JWEA 2G4LA 2Q0XA 1JMKC 1EK2A 1FFAA 4GDMA 4RGYA 1LGYA 5JALA 1SC9A 4QDTA 4O08A 3FCYA 1DT5A 3AZPA 5AKGA 3ZV7A 1IZ8A 1UT6A 2WFZA 4M0FA 3STXA 2BFNA 2QTBA 4B83A 1GT6A 5AM1A 2BUBA 4PSDA 1XRLA 5DTIA 1BN7A 1FFEA 1SCQA 1QTIA 4H77A 1ZD2P 1UKCA 5ALPA 4RE6A 1QIIA 5AOBA 4U2BA 1GQSA 2OAEA 4LKOA 1X2BA 2DR0A 2ECFA 3K6KA 4GHWA 2XDWA 2WIGA 3PUHA 5AHXA 3I2JA 3AIKA 1UZAA 2WLSA 3F97A 4DMCA 3ZLVA 4H7KA 4P9NA 1GXSA 4OU4A 4ETWA 5CBKA 2WFMA 3CCCA 2IIVA 1IZ7A 2H9YA 3LIIA 4AN0A 1K4YA 2RI6A 3L1JA 5SYMA 4UBJA 3FSGA 4K6KA 2AXEA 4DNFA 1R88A 3LCRA 1XZHA 3LP5A 4AZ0A 2H7YA 4X00A 1QO7A 1UXOA 4K5QA 1T4MA 1BEZA 2WM2A 1R9MA 1PFQA 4B7ZA 1HDEA 3C5VA 1ZGCA 4UHHA 2XE4A 3CXUA 3C6YA 1TRHA 5K3BA 2PPLA 3WKEA 5LZ9A 3GELA 2JGJA 2WIFA 1VLQA 4G9GA 4P93A 5AIAA 4LIPD 1XQVA 2BCEA 1QJ4A 2DFPA 2X8BA 5ALOA 3DS8A 4GI1A 4PW0A 5CT4A 4U2GA 4DSAA 5JAPA 4Q1VA 3O9MA 2WUGA 2WIDA 1MX5A 4M0EA 2JF0A 3W04A 1W52X 1DQYA 1LZKA 1JJBA 2XT0A 5KREA 2UZ0A 5ALQA 5HFNA 4KE7A 2DCMA 1H2ZA 2WG1A 3U1TA 2XMQA 4UFOA 2VATA 3G9UA 4UBOA 1TIBA 1UOPA 4KRYA 3OPMA 5F4ZA 2YASA 4MEBA 5ALRA 3O95A 4HRXA 3AFIA 3WWOA 5KBYA 1OILA 1Y7HA 1QIDA 3ESCA 2QXUA 3G0DA 4AO8A 3BJRA 3C6BA 3IIIA 5E4YA 4DMFA 4W1PA 4W1RA 5AK4A 4FWBA 3V1LA 3ICVA 1N5RA 3WKDA 5DNVA 3WYNA 2JGKA 4BTLA 1JJFA 5FV4A 4OPMA 5ALDA 1QIGA 2HL6A 3C43A 3BDVA 4E11A 4KACA 4JUIA 1YASA 2GBCA 4Y9SA 5K3AA 4ZWNA 1VA4A 5AJHA 5AM5A 4BP9A 2XUQA 2QRUA 4FHZA 1TK3A 4DSZA 2OCIA 1H2XA 7YASA 4KYVA 2VTVA 4DLNA 1QO9A 5IH7A 1J07A 3D5EA 2WHRA 3FLEA 2VT7A 4H18A 5HKBA 1LPMA 2GYUA 3DYIA 1HL7A 4JYMA 4PV7A 3C5WP 1VJ5A 5ALYA 2BGNA 5A7HA 2VEOA 5CH5A 5CRIA 3L1HA 3FAKA 3K9BA 2XMSA 4UBLA 2WKWA 4FLFA 3O0DA 5LKRA 3OTQA 4EA6A 2Z3WA 1T2NA 2PU5A 1XZMA 2XUAA 3D0KA 1CUZA 4JEIA 1CPYA 2BKLA 3GBSA 3AIMA 1XLVA 4G8CA 3STTA 4AO7A 3I2GA 3BWXA 5K5EA 4J0DA 3C6XA 1Z68A 2VAVA 5AICA 4H7DA 4DMHA 4KRXA 2XMCA 3I6ZA 5HF8A 4DYHA 3PICA 1K6EA 1ODSA 3RLIA 4YPVA 4X3CA 4CFSA 5LZ4A 4LXGA 2X5XA 4A23A 4GLBA 4P92A 4BE9A 1R9NA 1Y7IA 4PNZA 1R1DA 1VXRA 4I4CA 2HA0A 3R0VA 4J0KA 2WIJA 2XMGA 4AB1A 1C7IA 1MAHA 1ZJ4A 4QWWA 4B80A 3ZPXA 4OB8A 1AKNA 3MGAA 3IUNA 3DL4A 4HXFB 3W9BA 4KAFA 3BF7A 1AQLA 3PFCA 5K3DA 4X6XA 1YCDA 2C58A 4FLMA 3IDAA 4J0CA 3HC7A 2RGUA 4U2DA 1XZIA 4OB7A 2HFJA 4FNGA 4BCCA 1TCCA 3H04A 4DTCA 2Z3ZA 4Y2PA 4Q34A 1QIMA 1LPOA 1QIJA 1WHTA 1XLWA 3BL8A 1YAJA 5ALLA 2IITA 5HF9A 2H7XA 4C88A 5EHZA 2QUBA 1JT2A 1ACJA 2DHDA 3RK4A 2K2QB 3IA2A 3WQHA 1IUOA 4MXDA 2DHEA 4NZZA 2VSQA 5C7YA 4C01A 2XUOA 3OM8A 4QWMA 3H2JA 2QM0A 4MQMA 4WY5A 5BWCA 2RIPA 5HCUA 5FPQA 4RNCA 3C8HA 3AUKA 5JYCA 5KWIA 4GWLA 1QGED 4QLAA 2QVBA 3H1BA 5ALWA 1IUPA 5C81A 4BDTA 2ACEA 1QIKA 1WB4A 3LS2A 2FJPA 4Y2YA 2WUDA 4B81A 1J06A 1E8MA 2AJBA 3TEJA 5I8PA 4GXNA 5CMLA 5BWBA 5IVKA 3STYA 2PX6A 3DDUA 3W06A 5ALKA 4JNCA 1UK9A 4AQDA 5ALJA 2FX5A 5ALHA 3AILA 4C6HA 1VA5A 2V96A 2XMBA 4X6UA 2QKYA 1PV1A 3QPDA 2OPHA 2HU8A 1LPNA 3GFFA 1N5MA 3RKSA 1CLEA 1JFRA 5C8VA 2DHCA 2W6CX 4FMPA 2VT6A 4Y2RA 1JKMA 1UOOA 3UUFA 3X3HA 1UFOA 3QZUA 3I2KA 4AMYA 3IUMA 1UWCA 3VVMA 1AZWA 2PSFA 3R3YA 1VE7A 3WK8A 4ZV9A 1CUSA 1ETHA 4BB0A 5LZ5A 1CUDA 1USWA 5DJ5A 1L7RA 2Z5GA 3S2ZA 1E66A 4C87A 4G9EA 1BN6A 3FOBA 1K63A 1N8SA 2Y6VA 3HI4A 4WFJA 5E2IA 5IVIA 4OSEA 1ZD3A 1CUHA 1WPRA 1LNSA 3D3NA 1KEZA 1XZAA 4IH1A 1HLGA 4Q82A 3D4LA 5JANA 5HF5A 3WYDA 1ZD5A 1UK7A 5CT8A 2WQZA 4C4YA 4BP8A 5JADA 3WL5A 2OLEA 2XQFA 3PDCA 1F0PA 4PSCA 4MYSA 2IX9A 1EA5A 2PVSA 3FLBA 4IQ4A 3R3VA 5A2GA 3F98A 2QS9A 1XZLA 2EDCA 3KOOA 3I2IA 4DGQA 1XKLA 3DEAA 4A5SA 1HBJA 3DJYA 1QTRA 3R3XA 4QDUA 2PSDA 1CQZA 1P0IA 1R3DA 4BC0A 5JAOA 2E3JA 2ORYA 5HZGA 3I6YA 3O4IA 4XX1A 1MAAA 1FFBA 4N5IX 3SC2A 4HS9A 5AM2A 2BUCA 1DX4A 1UK6A 3RARA 4K2AA 4XIIA 2WU4A 5CT6A 3PF9A 4BE4A 2RAUA 5JZSA 5JIBA 1GPLA 5EHNA 5DYTA 2XUFA 1I6WA 2QUAA 3VJMA 4IH4A 4C4XA 5CT5A 3ANTA 2XUDA 5LZ7A 3G0IA 2NW6A 1XKTA 3WA7A 4FBMA 5FPPA 5AI0A 4MQLA 5CH3A 3NWOA 1CV2A 4Q05A 1MO2A 5AKXA 4QDXA 5JZBA 1XZKA 4B6GA 1X2EA 4J03A 3FVTA 5AM4A 1CIJA 3G9XA 5HFAA 4EY6A 1VKHA 1E8DA 2CBGA 3ZLUA 3N0TA 4F5ZA 1XRNA 1ODTC 4X92A 5EHQA 1BS9A 4H7HA 3NUZA 4EUSA 4UHBA 4X93A 1BE0A 3E3AA 1EDDA 1AURA 4Y2TA 2VAXA 1XZCA 1C7JA 3G0BA 1FFCA 4C4ZA 1JJIA 2ZYIA 1AMNA 2FUKA 1XZDA 1W4LA 3H2KA 4PQEA 4UHEA 1CUVA 3V48A 2HADA 4F21A 3PI6A 3VKFA 4CG3A 4UBNA 1J2EA 1F8UA 2VJAA 3G9ZA 4MWTA 1YR2A 4IH9A 4E15A 1KU6A 3CCBA 5EHXA 1XROA 2PM8A 1UOQA 2WG0A 3LLCA 1VZ3A 4CG1A 1ZICA 3FBWA 2OAGA 1CUFA 3STVA 4B9EA 3C87A 5AKHA 3H17A 1WCYA 2PL5A 1LPSA 1MX1A 1U65A 4Q3OA 4CIAA 5JAUA 4ROTA 1FFDA 3DKRA 4HRYA 4ZREA 3WL7A 4GECA 1Q83A 4X97A 3WK4A 4QE3A 3JYHA 1B6GA 3SX4A 5HQ3B 1EI9A 5LKAA 1Q0ZA 5C8ZA 5K3FA 4A16A 4S0XA 1EHYA 5EGNA 2QT9A 4XWGA 3TRDA 4WDRA 6YASA 2XUJA 5D6OA 1EK1A 4B84A 1LBTA 4UHFA 3DOIA 4BVKA 2HM7A 2C7BA 2I78A 4HAIA 3EIOA 5ESRA 3HSSA 5AOAA 1K8QA 4HXEB 1H23A 4TGLA 1JI3A 5HKAA 1P0QA 4GW3A 2H7CA 4L9AA 4OB6A 1DWQA 3UUEA 4G8BA 1X70A 2CKMA 4BAUA 1CUBA 3H1AA 5FLKA 2EDAA 3TGLA 2R11A 5FKJA 4Z49A 3QM1A 4FOLA 5K3CA 5AH0A 3R40A 2ZYHA 1JU3A 4EY8A 5JARA 2XMRA 3RM3A 5CXXA 2WHQA 2XQKA 4EHBA 3ILSA 2B4KA 2WJ4A 1CUJA 5AM0A 1EDBA 2VA9A 1IUNA 2HA5A 5AKJA 2C5FA 3PUIA 4Y7DA 4E46A 3WWDA 2I03A 5CW2A 2AJ8A 4Y2SA 2V97A 3DQZA 3D59A 3WKCA 5H3HA 2WSLA 1E5TA 2YYSA 3AJAA 4D9JA 4EY7A 2Z8XA 2D5LA 5AI5A 5ALTA 5A7GA 3QH4A 3ESAA 4QZVA 1SOMA 2H1IA 2HA6A 1QZ3A 4ZV7A 1ZI8A 3UMJA 3DYVA 5DYYA 1AUOA 5YASA 1ZGBA 3FYUB 2Z8ZA 4B0OA 4FBLA 4H7IA 3S8YA 1CUAA 2WIKA 2G5TA 5FUMA 2ES4A 2V98A 3E1GA 5A6VA 3E4DA 3WJ2A 1GPKA 4OU5A 1QLWA 1CVLA 4ITVA 4QA9A 4IHAA 2WUFA 3WIOA 3V9AA 2HA7A 2PKYX 3WLAA 1CUWA 4XJVA 4U2EA 5AI9A 1L7AA 4NMWA 3BE8A 3STWA 1OCEA 3HZOA 3FYTA 2O2IA 2Y2VA 4BRSA 2Y1KA 5ALFA 3ESBA 4OCZA 1EH5A 1ZI9A 2HRQA 4ZRDA 4B85A 2W22A 4NS4A 1E8NA 1XZEA 3EF3A 1MNAA 5IVDA 4UFPA 4KE9A 1VZ2A 1EVQA 3IUJA 3VJKA 1JU4A 2HU7A 1ZD4A 3BIXA 3QYJA 4Y2VA 2OG1A 2ZVDA 1R4ZA 1ACLA 1VE6A 1XZJA 3IBTA 1CUEA 3QPAA 4G8DA 3P2MA 1MTZA 4OUKX 1ORVA 4FTWA 1MNQA 3OG9A 2J3DA 4W63A 2CMFA 5A62A 3DLTA 2GBIA 2QXTA 1TKRA 1CQWA 2CEKA 5HK8A 1C4XA 1TCBA 4U2FA 1AC5A 1WB5A 5HQ3A 3HABA 3MUOA 1LBSA 5AKEA 1CUGA 5I7UA 1O6GA 4N8DA 3I28A 1THGA 3HACA 5FRDA 1BCRA 4AMZA 1EB8A 3C70A 3C6ZA 3IUQA 2OGTA 2Y6UA 1KU0A 4MYDA 4QNNA 3AZOA 1BROA 1XFDA 4HXGA 1BEEA 4I3FA 1L7QA 3V1MA 2GYWA 5ALSA 3GUUA 4LXHA 1B41A 2WTNA 2HRRA 5DNWA 4NVRA 4J7AA 1Y37A 4YASA 1SFRA 3BDIA 2VF2A 5LP1A 3L1IA 1GGVA 3EQ7A 2O7VA 5BV7A 5HK9A 2YXPX 4G4JA 1YSCA 5ALMA 2QR5A 1LLFA 1O6FA 2PBLA 1YB7A 1P0MA 1XZBA 1A8SA 1ISPA 4X85A 5T4HA 3WWEA 4ARAA 3QMWA 2QZPA 3H18A 4K6GA 5SYNA 2O7RA 3DD5A 3F67A 4C89A 3NOXA 3R3UA 2WFLB 5ISMA 4Y2QA 2WU3A 4F60A 4GBGA 4XVCA 3FVRA 4PO3X 2J4CA 5K3FB 3SWWA 1CR6A 1U4NA 3ANSA 1ODCA 3VXKA 4AN1A 5DTJA 1LPPA 2QMQA 2DQYA 2WJ3A 4DMKA 5ALXA 4AO6A 4UUQA 3GZJA 3NGMA 1N1MA 1G42A 4UBMA 4W9RA 2VJCA 1OXMA 3G0GA 5CXUA 2G63A 2GZSA 3VDXA 3HLKA 5EI5A 2OCKA 3FYUA 4AZ3A 4G4IA 5LYYA 4J0JA 4AXBA 2XLCA 3K2IA 3O4JA 1CUXA 5AKYA 1YB6A 4OYYA 2ZYRA 1ZIXA 3SK0A 3WZMA 4WCVA 4WFIA 4KE8A 3T4UA 3O4GA 5E4JA 1R50A 5AI4A 4BTVA 1PJAA 2WUEA 1XQYA 3I2FA 3KWJA 4W1QA 3G9TA 1CUCA 2PSJA 3D2BA 1D07A 5J3JA 2JGMA 2OCGA 3WL6A 3QMMA 1EXWA 1Q84A 4BBZA 2LIPA 1FSSA 3G02A 1NU8A 1WM1A 1EX9A 4FKBA 5AI8A 4KEAA 1G66A 2CB9A 2QJWA 4BATA 4AX4A 2AJCA 4V2IA 3O9VA 2JEYA 4IO0A 5JD6A 3VISA 3A6ZA 4I19A 1WOMA 1ZI6A 3HRHA 1IMJA 3A2MA 5FDFA 3DCNA 1QIEA 3I1IA 2PSEA 3G8YA 1NU6A 2C5GA 1RWQA 4WDQA 1DWPA 2PU7A 1YS2X 1XRPA 4LXIA 1EB9A 3IURA 3D7RA 4CG2A 4BC1A 1QFSA 2AJLI 5D7BA 4K6HA 3B3QA 3I6MA 4DNPA 2FJ0A 2ACKA 3N2ZB 4CCWA 4N8SA 4U2CA 3OURA 3B5EA 5AK6A 1MPXA 3A2NA 1QFMA 1CUUA 4QDZA 3KXPA 3Q8WA 2OGSA 3DNMA 3H0CA 3FYUC 1DWOA 3R41A 4H0CA 5JAHA 4UFNA 4H7EA 4N5HX 1MX9A 1UK8A 2JEZA 2JBWA 1XZGA 5E4TA 4RE5A 1K5PA 4B0PA 1VOTA 4EY4A 5AO9A 4TVKA 4N8EA 5ALUA 4KR0A 2JGEA 5AKZA 5CURA 3TJMA 4ZI5A 1BU8A 4DIUA 3OC0A 1XRQA 5KWJA 1WB6A 4CCYA 3QBJA 5HF6A 3IULA 4HVTA 1A88A 3WL8A 4WJLA 2B9VA 3B12A 2WILA 5CT9A 1BRTA 4Q3LA 4B82A 1A8QA 3EQ9A 3H2HA 3O4HA 3FSGD 1J1IA 1YA8A 1CFJA 1EDEA 5EIHA 4BZZA 4F0JA 4W1SA 2QJRA 5ALZA 4PSUA 1HKHA 2ZJ6A 4FLEA 2O2HA 1TAHA 3FNBA 5DYWA 3STUA 3HYSA 4LYEA 4TPKA 1RYYA 5D3ZA 4H35A 4ZXFA 1NX9A 3GA7A 1MU0A 4J0GA 4X95A 2WFLA 4FNMA 3BJMA 4BRZA 5ALNA 3U0VA 3IVMA 1W1IA 1THTA 4M0MA 5D3KA 3KD2A 5AKIA 5EIEA 5A71A 4X91A 3G0CA 2ZYSA 3CN7A 3R3WA 3OOSA 1QIFA 2B20A 3EQ8A 2XUHA 5AKLA 1EVEA 5FXMA 3ZLTA 3G7NA 2ROQA 3M83A 1DX6A 2RONA 3H19A 2XUIA 1VXOA 1CUIA 2PUHA 2HDWA 3WMRA 3GROA 4G5XA 3V1NA 4BCDA 5LIPA 5DLPA 2GZRA 1QOZA
chains in the Genus database with same CATH superfamily
4JSNC 1Z17A 3Q7EA 4DCPA 1JB1A 3GXOA 2R6R1 1U3DA 3ORFA 1GG5A 2RHWA 2E18A 5T67A 4AUNA 1UQRA 2G9VA 4CTMA 3L1KA 2PJDA 2DFTA 4KQMA 3DD1A 3UPUA 3BA6A 1YTUA 2GARA 2C3UA 3EGXA 3OCUA 3DL0A 3T41A 2IH4A 3QFHA 5AK5A 2QZZA 4ZOYA 3IR7A 2FUG6 5DNUA 4Z7QB 4EBBA 4ZI3A 3UG7A 2ID4A 3KWFA 3MLAA 1AM4D 3AHGA 4HDJA 1KI7A 1Z6XA 1P75A 3VZBA 4JXZA 3PC2A 4GX0A 1U63A 1SPXA 3WWYA 5BMOA 2OK8A 2VHJA 4TZ0A 2Q2WA 3PGVA 4AXXA 4D80A 2PMCA 3ZE6A 1HTBA 2M9MA 5I5EA 2RBEA 3GFVA 2H14A 1A4UA 4FW9A 1YCGA 3MRXA 3X1DA 3V80A 1I3KA 1FP1D 3OQPA 2R68A 2GD2A 1HQDA 4UNNA 3OIFA 4Y2JA 2WF6A 5KCMA 1FDOA 4ITRC 1BA3A 3K53A 3N2GB 1ESZA 3X1KA 3TBHA 4UQPA 1TMKA 3RVLA 1UBFA 1CZUA 3NKFA 1SM4A 5JZMA 1QKIA 1Y3CE 3I04M 3SSOA 3WDMA 4C7MA 3BMQB 4MA4A 3PC6A 5DYIA 4P7BA 3ULKA 3GEBA 5CXCA 3ZKWA 3CRW1 3HP4A 2JA2A 1GA4A 2FWRA 3CLSC 4KKXB 3HBJA 2J5KA 3ZE7A 4M7RA 2WF9A 3F47A 5FOQA 4RDCA 2H5EA 3BMOA 5CDTA 4X9XA 3E0XA 1UMCA 3MNFA 4L5BA 5EVCA 5JASA 4NBSA 2FG5A 4DLXA 1E61A 2YNPA 3JQEA 4BU0A 3OVMA 3OKWA 2CFRA 3G2NA 3A9CA 3GUCA 2B61A 4K9LA 3WK6A 4AEZA 3OOWA 4EELA 4M86A 4LGVA 3DLAA 4OL9A 3SIRA 3M81A 3X2EA 2ZB7A 4J94A 3WK7A 3MCAA 1EUZA 3TTTA 2B30A 2DWUA 1CY6A 1Q0RA 2HV9A 1CTQA 2BBWA 4GO1A 4E5MA 2PUGA 2Y9MB 1DC7A 5JD5A 1QQAA 1EQUA 1USGA 5EOVA 5EXDA 1Z63A 2GPYA 1K7CA 4JASB 1E3WB 3M4XA 1RE0A 1FLNA 4UHDA 3EVEA 3A2LA 3MYYA 1K2VN 2AOWA 4JSPC 4G4GA 4E5KA 4J3JA 2C97A 3EGCA 5CJPA 2W2VA 9GPBA 5JNRA 4AJOA 3RVJA 1A27A 4ALMA 3DBVO 3RMZD 3IEKA 1Z5ZA 2GTIA 1B16A 2EWMA 1PEKE 1HMPA 2FCRA 4INZA 5C46F 1SH7A 4J0HA 4HLUA 2OHXA 5AKKA 3RU9A 2K7FA 3SEZA 4IHQA 4MRVA 3S2IA 1UZUA 2O0JA 4R3NA 4DDVA 4YCSA 3FLMA 2ZYVX 2GJ4A 3D9QX 1XLUA 3FFWA 3AJ8A 4E4YA 1X8KA 1HKUA 2J7PD 3JASA 2BAGA 1NF3A 1F1JA 3PE3A 2IXBA 1JIXA 4AT1A 4TZTA 3A27A 3TLJA 1XDZA 4LFCB 3OCZA 1ENZA 1TYDE 4YRSA 2DM6A 2AG1A 1T5HX 4DVGA 3Q88A 3IUPA 3B6ZA 3ND5A 5B7QA 4EKDA 2CXRA 1VE5A 4B3XA 1HDRA 5IDQA 2X6TA 3VPHA 1ZVJA 5JMPA 1P2DA 2H16A 3Q9NA 1BIFA 3FZQA 5I45A 1NBAA 2DR0A 1NQXA 2A1TS 3LT4A 2WLSA 1CS0B 2OBXA 4CIWA 3LZDA 4H7KA 1ZUD1 1YDFA 3EXFA 2B99A 2J33A 4BGUA 2HSWA 5JOQA 2QGZA 2FWNA 4BXOA 1R9JA 2FZ5A 4AN0A 3BUSA 4R40A 3RSHA 1GP2B 1UAGA 2F62A 3AV0B 4FOTA 1IU9A 4NRDA 3KCNA 5WRFA 3QYAA 4HH4A 1QGOA 5JH7A 4FCVA 2FWJA 5GMOA 1W35A 2YV3A 3LT5A 2HEIA 1U2DC 5M3BA 3C8UA 2E5WA 3RF6A 5B2FA 2C1EA 1EZZA 1DOAA 1ATIA 2QN9A 4Z86A 3TUZC 3IPRA 4KFCA 1C80A 3I30X 3LW7A 5JNLA 1NDHA 1G20A 3AEQB 1AKTA 4MV9A 3NHWA 2H4JA 2NQTA 4Q48A 5HFNA 4FDLA 4A1OA 1RM4A 3K96A 3Q11A 2V5AA 2O2YA 3U1TA 2XMQA 5M7EA 1RHRA 4PIMA 1B42A 4M88A 4C76A 1YK0A 1ZHOA 4Z4QA 3GREA 4FCCA 4PPFA 4DG9A 4MEBA 5GGYA 3K0KA 4EJFA 3CNHA 1Y7HA 2DPLA 4KXXA 4XW2A 3G0DA 3LF1A 4MYUA 5CD9A 2I1WA 3GIWA 5FYQA 4X1YB 1DG1G 4RBNA 3WYNA 3GRAA 2LR0A 4BTLA 4J0QA 4X1IB 3HA3A 5FAXA 4MQFB 4O5AA 4HPXB 4H3KB 4MCHA 4ND6A 2GBCA 1EJ2A 1D6SA 1I36A 2H1FA 1N0UA 3R8CA 5EE0A 2HNBA 5AUQA 4RPGA 2NYRA 1R5NA 3C7DB 5TDHA 1G21A 4WINA 2H1VA 4UM9A 1OZGA 2J41A 4TRJA 2WHRA 3H16A 3DYIA 1FVXA 4X8OA 3L84A 4MRMB 5ELMA 2FN7A 3L01A 4DLPA 5IHXA 4EVRA 3IJPA 4YREA 1TZKA 3IH5A 1YMQA 2QMYA 4L5JA 2PRZA 2HGSA 4NMHA 3LY5A 5CCEA 1H4VB 2QNRA 2Z3WA 2IEBA 5BPHA 3OU7A 2O8FB 2NTNA 5JO0A 1ISJA 2BGMA 4RM2A 1F51E 4Q9LA 1IZ9A 3E9QA 2RAVA 1Z68A 1QZXA 1M34E 4A2LA 4JI0B 3BMNB 1FP6A 1PI6A 1OSNA 5CYOA 5BVHB 1K6EA 1U5BB 5F7OA 4N9QA 3NANA 1MV5A 4HAYA 4XVRA 4MV6A 2ZAYA 5IDYA 2Q9AA 3BQ9A 2B35A 3JD4A 3R7DA 4CM7A 1YB2A 3KKEA 2QUZA 4EHJA 2MIIA 1PJ4A 1TM2A 3K05A 5HDQA 1RLJA 1I2AA 1OFUX 3OA0A 1SA0A 4LK2A 3FWKA 1P8AA 4HADA 5K0LA 1UXJA 2VSOA 3TCKA 1LPOA 1Z7BA 5GV7A 1MDFA 2OO3A 2IU3A 5E95A 2NSJA 5DEOA 3CVWA 4KZKA 1MLDA 2NUTB 1N36B 3KJIA 4MW5A 1TW2A 3OM8A 4WACA 4Z4FA 1C0LA 4R8SA 5KNDH 5FPQA 3N2IA 2ONYA 2PUVA 2C98A 3IAS6 4F84A 3LPAA 2VP6A 4YT8A 3NMUF 3BGWA 3VKVA 1FNNA 5JT1A 4RQAA 3JSAA 2ZITA 2PKRA 4WQMA 1EUCA 3H9CA 1IRXA 1CJBA 1L5FA 4EYSA 4JLOA 2UAGA 3EZLA 4RD0A 4HS4A 2ZRKA 4F4IA 1T9DA 2JLQA 2JAPA 4C6HA 3SQNA 1Q47A 2H6EA 1IBMB 1RQXA 3FHJA 4NV3A 1V9CA 2O54A 3E0CA 4A6PA 4D8YA 3MRSA 4I5GA 221PA 4PLZA 5B3AA 1QQ5A 2YYZA 1PNTA 4HAXA 4XSGA 3TTSA 1Q1ZA 4BLUA 2Y93A 2Q41A 1FLDA 4I55F 2ZQZA 3OQ1A 5FBWB 4OP3A 3W5HA 4WJZA 3M6IA 4F9GA 3GGOA 5CPFA 2YBAA 2ZJ3A 4YC7A 1GZ5A 1S9HA 3ENZA 3EC1A 3OMLA 1U28A 3X44A 4F46A 1VYVA 1BX1A 2LW7A 3WMXA 1FRZA 3LUDA 2EKZA 1YE5A 3E3OA 4B6PA 5JADA 4M83A 5B5SA 4EPWA 2FE1A 3FLBA 2JVKA 3NC1C 2ZCUA 1TUIA 4MQ6A 3KOZA 3KOOA 2EICA 1NMYA 1X92A 4N7RA 4O2AB 4MGZR 3DJYA 4D25A 1EP3B 4NFYA 4NKRA 4G0YA 1RRVA 5GP1A 1UZMA 4WN9A 1LW7A 2YS6A 2XGMA 3PXCX 4I99A 5ICCA 4KUEA 2QX9A 1Z4JA 5IK2A 1WY5A 3ZBUA 3ILVA 5ABPA 3Q1LA 2XUFA 3OPNA 2GLUA 1TAQA 4JY7A 2O6HA 2R85A 4EF4A 1TT7A 3D7MA 3G0IA 2NW6A 3MZLA 4FBMA 2WK1A 2Q45A 2O1SA 1VPVA 1HXHA 1Y1SA 1XZKA 4A0RA 1FXSA 3U3MA 4EY6A 4GPBA 4TTPA 2AN1A 4L15A 5HUQA 4Q7QA 5ITZB 4X7RA 4TKUB 1XRNA 2R8OA 2Z9DA 3NIDB 2X13A 1HSZA 3GJXC 2D59A 1Q3HA 3NUZA 3N75A 3EHDA 3E3AA 4WZZA 4Y2TA 3NTQA 2ISCA 4KIWA 1CUVA 3V4RA 4CQLB 3QBEA 1YR2A 4E15A 1P19A 1H3FA 1KU6A 4ZCPA 2JFNA 4PC3A 3OZ7A 2BSAA 4JAVC 1U7ZA 4R1QA 3KQOA 1NYRA 2IEGA 4G41A 1DAFA 3ZLJA 4CW7A 4KQGA 2CLHB 3IAHA 4L95C 1LPSA 4PG8A 1L4HA 1NBMD 4N18A 4RFSB 5DNEA 4LQDA 2ZBRA 4O02A 3U3RA 4FE7A 2A5FA 1E32A 4FS3A 4QE3A 3OZIA 4EZBA 4ERNA 3RUFA 2OTCA 1NYLA 3EHEA 3ZE9A 4IGKA 3WQQA 3SX4A 1I1NA 3DULA 4R3UC 3R7WB 2VPYA 2BFWA 3KVVA 3F8WA 3FUTA 4OLFA 4A16A 4XCQA 2DOKA 3ADPA 1RWMA 4Q1CA 3LHIA 5KOJA 1U8UA 1QTNA 5L3VA 1WLYA 1PL0A 3PENA 1Y42X 1QNIA 1SRRA 5B3JC 2F1KA 2Q0HA 3N8HA 1SQFA 4EWRA 4CT4B 1E9VA 1SHJA 1XWFA 1CE8B 1ULUA 4FOLA 4NPAA 4O4IA 1J7JA 4LUCA 1NQVA 5D5HA 1N77A 4MKHA 4YRLA 2JFFA 1VYHA 4HDQB 1EDBA 1KZ7B 2XF8A 1IUNA 3ONEA 3B8HA 3FDIA 3UXEA 1PK7A 1I4EB 1FLAA 2XF2A 4EG5A 5CCXA 1P62B 1T4CA 3GVHA 4OQMA 4BUJC 2XRZA 3F6CA 1Y4AE 2FG7C 1MA0A 5IF9A 4KQ1A 5CA0B 5EMHA 3UMJA 4WASA 1WW8A 3PWKA 1TVMA 1XFAA 1VPEA 3ILHA 3S8YA 3UK6A 2G5TA 2PRKA 4PYJA 5DN6A 1L7PA 4NOMA 2BTQA 2XWPA 2ZDGA 1GZUA 2CYBA 1HZZA 3PUVA 1OX4B 4MULA 2IUUA 4IM7A 3GT4A 1QWSA 1GUFA 1QBKC 2UYHA 1DV1A 3OZEA 5DTRA 4AMBA 3N07A 3D6VA 4N3GA 3K9FC 4E4RA 3EARA 1X9IA 2QN1A 1UXGA 1FU7A 4KMMA 4X20A 1YB1A 4HO1X 2Q5FA 2C2BA 3ABIA 2ZRIA 3I72A 4P34A 4KE9A 1Y9ZA 1FK8A 4NI5A 4Y0VA 1TEVA 3EZ7A 3L7OA 2CJYA 3MUFA 2BH2A 3AJ9A 3FIJA 4WNCA 1TD1A 1TQ8A 2VJMA 3K2EA 5B36A 4A7JA 2G80A 1U8YA 1S3SA 1X0XA 1B74A 3TRJA 1QOPB 1J2YA 5F2KA 3KAJA 5TARA 1IJBA 1ZP6A 4LGMA 3HACA 4ZVSA 5EXPA 1SD5A 3ZZMA 4CKWA 5AVJA 1USUA 3GNTA 4P81A 4NZYA 1OBFO 4C0LA 3IC5A 1D1TA 2QIPA 3R09A 1VL2A 1DARA 3D3JA 3U16A 1RM5A 3PYLA 3IJ5A 4N6NA 4UU7A 4DY4A 3F6BX 1TEZA 2IU0A 3E8XA 1V6CA 3HKCA 1E60A 3Q85A 5I7VA 3Q0EA 5JSZA 1JS1X 1G8YA 1VPTA 4FMBB 1L8OA 4G5HA 4FZ3A 1JSRA 4FYXA 5A3SA 3H65A 4P98A 1P9OA 3GT3A 4ARIA 3F67A 2P9JA 4MUJA 4I1YA 2GHRA 3RFFA 4A92A 4AM8A 3I76A 3LYAA 2IYLD 3SWWA 5HMMA 2VK4A 3BOSA 5D7NA 5H4GA 3ND9A 3JAWA 3QI0A 3HR7A 1RBYA 2WMYA 1Y3IA 1TZMA 3QEJA 3FKJA 4N82A 4LCEA 4B46A 4MI1A 4TYNA 1J90A 2GDZA 1NAHA 5CVUA 5HS4A 4J76A 1XDBA 1R50A 2G7MC 4FYHA 1DWUA 1DIGA 5B6JA 4Q16A 3UWOA 3LBFA 1NW6A 2ZG6A 1UFQA 3JATA 5C3UA 2I3SA 1WR8A 4LZPA 4QPCA 1XSEA 3ZK8A 2RI1A 1G66A 5DXAA 4IMPA 2PGLA 1L4NA 5TJHA 4EMBA 4U7AA 5EYPB 1HM5A 1BEUB 1S2MA 4MLDA 2O7NA 1IBSA 1VLZA 2WEKA 2R6GA 4LNAA 2PU7A 4NBKA 4RTNA 2JJ1A 1MHPA 3Q72A 3VPGA 4NCJA 1QFSA 3NBUA 3S44A 4K6HA 3PHIA 5IKOA 4ARSA 2OXFA 4YRCA 3B5EA 4R51A 1FRVA 1Z0SA 3PXXA 1CUUA 2YQ4A 3ITKA 2GFQA 4CM5A 4ETMA 1L4BA 4KXYA 4U8GA 1IL0A 5E4TA 5HBGA 3FSJX 1KPIA 4RZIA 1U94A 2BMWA 3O3MB 5FQOA 1NR0A 3D4BA 4R1NA 3VOSA 3JWGA 2PJUA 2P0YA 4JBWA 3A7EA 4B6EA 4MWBA 4F4CA 2CUKA 1E3DA 1CULC 1C50A 4R7ZA 2O3TA 1U5AA 2ACWA 2QF7A 1R15A 4Z7OA 2E87A 2DUJA 4H35A 3UK0A 2UYQA 4B3JA 3FTPA 5EJGA 1ZONA 2JFWA 5ALNA 1PSDA 5FI5A 3K0SA 2CY0A 3FHLA 2W6JA 4JL5A 4BLSA 3G0CA 1I3NA 1NC3A 1AQ6A 1GZDA 4CRWB 3WP1B 2WF7A 1OI7A 5J23A 3A6EA 4LV8B 4U2KA 1CUIA 3B7PA 4JJAA 4U7PB 2AF3C 4QXOA 2IPOA 1LI4A 1J0BA 1HOTA 2Y71A 3KSZO 3DDOA 2I8LA 3OLWA 3G7UA 3NM6B 4P32A 3F2VA 4IMJB 5CPBA 2F3UA 1JMYA 1Z45A 3PUKA 4NZNA 3CJTA 1NVFA 2WJVA 1M2NA 2VQ6A 5IC7A 1T4GA 5LZ8A 2QX8A 2D1SA 1SOVA 5AIBA 1W49A 4Y98A 2XJ9A 3FCXA 4NLLA 1IHPA 1VHTA 3Q41A 4OD0A 4KGXA 3OWXA 3VVLA 5ECWA 3HM9A 4LY9A 4ERYA 4BFSA 1XCJA 3IJEB 1DI0A 1F7VA 4JI7B 3MOIA 4FHCA 2WZBA 1U3WA 3RVDA 3E18A 2Y1FA 3ZY4A 4HI0E 2ZTHA 3BF8A 2YH2A 3BTSA 1W0JA 2QVZX 2ZI3A 1FUYB 1EFCA 3PITA 3LCVB 2ZP1A 3C7TA 2J4DA 1ESDA 5C4MA 2LZ0A 1BS1A 3FB4A 1L5VA 3IVCA 3N1UA 3M1AA 2Z43A 1U04A 4X1KB 3WI7A 4PXSA 1SG0A 5SY4A 2BJHA 2IEAA 1UT5A 3QVGB 4U9IS 4EOGA 1EXMA 3GGJA 5I4CA 4KTVE 3CE9A 2XYVA 5IAOA 5FWYA 4DWWA 2FZKA 1SCKA 3PHCA 2XV1A 3P0RA 4MWSA 2NXNA 4DJDC 1TF2A 1JIIA 3N86A 3JYNA 3RKUA 3DCYA 2WWYA 3L46A 5IAKA 4BDSA 1LNQA 4XEHA 1X1BA 4PR0A 3BRWA 2YY5A 5ALGA 3SQLA 1IEXA 3WLIA 4QEDA 4FX2A 1LK5A 3CNBA 3M3DA 3W78A 3G2MA 4MCAA 3T52A 1B26A 1VCMA 2OBBA 5DLDA 3OFNA 5JXIA 4V0NA 4CI9A 4D7AA 2OVPB 2B36A 4MUAA 1KMHA 4CKZA 2C3PA 4PCLA 1L4MA 3M0EA 3D54D 2X6QA 1LLQA 1W75A 4L2IA 3STHA 4UUOA 2ADMA 4GOLD 3DLHA 3AI7A 1U2QA 4A9AA 2A59A 1OIVA 3HVJA 4QUGA 4KZPA 2VK2A 3ZJ5A 4J1TA 2J9GA 3N53A 4XTRA 4ENRA 5DM1A 1CUYA 2YNMA 1SUWA 3FSRA 2FW9A 4OFWA 5FA5A 1NIPA 5FLYA 5AVUA 4AYXA 3DTVA 3V1KA 1TNDA 5JJLA 5KWEA 1VPLA 1PNQA 4P35A 5F78A 3EEIA 3B48A 3SBQA 3UMSA 3KG2A 3TD2A 1M0EA 3MZKA 1T8RA 4YJKA 3WWCA 2ESRA 3UAZA 5JC1A 2JBHA 5KO2A 1WD7A 4QJBA 2AB0A 4LVUA 2HYIC 5C8XA 5CFNA 4BAGA 3F9RA 4LYYA 3FVWA 4H1TA 3EH2A 5ED0A 2D3WA 2PD3A 4HZGA 4DDHA 2GBGA 1FDUA 3DB1A 2IYVA 2CZQA 1KRXA 2WMNB 3COYA 4Q1BA 4RH3A 1I7LA 4YX9A 3BJEA 2XCSB 2HHLA 2SCUB 3L7AA 4JQOA 2DVMA 2ZM5A 4RD2A 1ZJ6A 4GDMA 4MUGA 1C41A 1ZCAA 1ISIA 2G76A 4RTPA 4BO7A 2H2FA 5PGMA 2LPMA 2QRNA 1COWD 3M7IA 1JL3A 1WQ1R 1I14A 1TUEA 4TRRA 2F9MA 2Q5QA 1UT6A 4TRMA 4M89A 3IKMB 4JUBA 2HREA 5FULA 5AW4A 1X7HA 5SZHB 3DPSA 1XJ5A 1UJCA 3D4PA 3G2KA 1QIIA 2OZPA 3K6RA 5HQGA 3K6KA 7MDHA 4Y1RA 1HDIA 2GAAA 4FONA 4BVHA 4D2IA 4B3FX 5IS2A 2HT1A 3VPXA 2QRVA 1HT2E 1BRMA 5A6SA 3TXYA 3NJ8A 1E64A 3AH8B 5FA8A 4REMA 3RUCA 4K9QA 3MG9A 1L2TA 3A7DA 2FEWB 2YWGA 4ND3A 4KWEA 1UM9A 1U6IA 1T4MA 3T6KA 2VDLA 2PPLA 3B9PA 1NLZA 4NCBA 2IOYA 3KQYA 4OHRA 5KSOA 2X4DA 4WD3A 5CBPB 1DTSA 1P6QA 2PGOA 4O1MA 1BDJA 5A4IS 1TW3A 2G09A 2VRCA 1OA0A 1A9XB 2QA5A 2GKGA 2J5QA 2J48A 4Q4JB 2UZ0A 2F1HA 2XWBF 4EVIA 3MELA 4KE7A 1ZBQA 2D2FA 5BYJA 1W4CA 4MP3A 4CBVA 4JP8A 2DUNA 3M9WA 3ORVD 4UBOA 1A2KC 4BVAA 3BG5A 1MIOA 4RZHA 2OXRA 1OTHA 2QMHA 4X63B 3CWQA 3O95A 4G55A 3B6IA 4J78A 4B35A 4QGFA 1ZQ1A 4ND1A 3EQZA 4R9SA 3A1CA 1HG0A 1ZIOA 3QE4A 1JXOA 3CRZA 1X14A 3BJRA 1JU9A 2W7TA 5CVJA 2QAGA 3JWPA 2ZIVB 1CSEE 2XB9A 5ECGC 4QG7A 5KNCA 1P7CA 3ZKAA 2ZBEA 2UUBB 5FV4A 3KOUA 1V8FA 4FM9A 2YZ7A 2HL6A 3WLSA 3K5IA 4TZKA 3OX4A 2ZBQA 3WIEA 3JZDA 3RT9A 3QU7A 1FTGA 3TLGA 3VO8A 4ZWNA 2R44A 2PGIA 3OE5A 5ICGA 4YV0A 4OLAA 1YHZA 4TTRA 1IZ0A 2VT7A 1C3JA 2VR1A 1OWOA 3G68A 3U3ZA 3AB7A 5F1OA 2QE7D 2F7SA 5A4FS 10MHA 4KRFA 4L6CA 5CVCA 1I0LA 4D9EA 2FH5B 4URVR 2BM1A 4IS2A 1MVOA 2DQ4A 1O95D 2IV2X 2I4OA 3IUBA 1SUBA 3G1WA 3DCIA 1PZGA 3ZE1A 1C9DB 3C6XA 1JF8A 4LHYA 1XALA 4KRXA 2C4KA 2RBKA 3I6ZA 4DYHA 1BVHA 1ODSA 3FRJA 3HHPA 2X23A 4HZUA 2YHIB 2C8JA 3PPVA 5CB8A 2IV3A 4CLRA 2J07A 5G4LA 1TF5A 1XZQA 1FNDA 4MVJM 4NNJA 3Q3JB 4ZAYA 1AQNA 4MR9B 5FOXA 3B2QA 4KLNA 3M6XA 1QG4A 3IDAA 4J0CA 4U2DA 1XCLA 3IUYA 2PM9A 4YRNA 2RGWA 4LBZA 3NIGA 1RYMA 4JMLA 4I50B 2H7XA 5EHIA 4YAJA 1A5TA 4KSYA 3IOCA 3AC0A 1ACJA 1Z29A 2WSMA 2DHEA 1O87A 3B36A 1LJLA 5CB6A 2H9IA 2JANA 5HCUA 3EXHB 3F3YA 3C8HA 1PJBA 1TJ5A 2QSYA 5FBLB 4GWLA 3WJ7A 1EBUA 3EZFA 1T13A 5JNUA 3BWSA 4CKCB 1N2CA 3CQ9A 4Q47A 1BOOA 3JQAD 3MYRA 3EU7A 2EX4A 4YP9A 2R79A 2W8BA 3F7NA 2KE5A 2WUDA 1UBSB 3VHXB 4HDRB 3QVWA 2CCKA 3DDUA 2R6DA 4DR7B 1OW3B 4Q4CA 3ZJUA 2VRWA 4BNVA 4X45A 4M9SA 3DLPX 4RVOA 3VPSA 4YRJA 3ZCQA 4DJTA 2QLTA 2ZWPA 3VR6A 3PPIA 1Z6PA 4XYLA 1QHGA 1QUFA 3KZCA 4GOND 2X22A 4C4TA 4F2GA 4UHKA 4D4GA 3BGDA 4EQZA 3AF0A 3E9ZA 1USWA 1YRHA 3BXEA 4QPZA 1DAPA 1P9RA 1HC7A 2RGEA 1KOFA 2VQDA 4V38A 2PMKA 2YWRA 3L18A 1JFVA 1SZPA 3SXUB 5DX0A 2X9NA 3R7BA 2IA5A 1QVZA 3LHSA 1T2EA 4KDFA 3H75A 3OT5A 3WL5A 1YFKA 2BP7B 5CLIA 5CXSA 1LD3A 3SJAA 5A2GA 4A8HA 2QENA 2JRLA 2JGRA 1Q5PA 2G5CA 3NH6A 1RP7A 3N7TA 1MA3A 4Z0TA 4W5QA 2B4RO 4C43A 4PTLA 5D01A 2QJFA 5IJAA 3O4IA 3TLEA 3AI3A 2C3OA 3CZ9A 4RORA 1NSTA 4N0MA 4ZDJA 4PHTA 1UQUA 2XAAA 5FOWA 4KV9A 3TI9A 1UP4A 4QFBA 5FH9A 1DQSA 4IH4A 1CEQA 2HNAA 3WLLA 2O8EB 3THXB 4EB3A 4PNKB 5CR9A 4U7WA 2F8MA 4Y9TA 1OZHA 1VJGA 4DG8A 1F14A 1CP3A 4XASA 5FQNA 1OC4A 1EU1A 1PWZA 2K87A 4IHJF 5AM4A 4JBIA 3A6PC 1OUMA 5TF0A 2FUEA 4XR4A 4K9DA 4H4CA 5EHQA 1M2VA 4ZP1A 1GRCA 3CT4A 5C52B 1YCFA 1UBRS 1XMPA 4EG1A 4DNXA 1AURA 1RCTE 2CD9A 1E1CA 3SAJA 3TIVA 3TQSA 3T4EA 2PZLA 1AMNA 4U5XA 3V48A 3T7AA 4BLVA 4F21A 1NRXA 1XXLA 1JPUA 1J8VA 1Y8AA 3HE3A 3PHBE 1RKXA 3DVQX 4JHXA 4FHEA 1RWBA 2HHCA 1RWVA 3PCXA 4IIJF 3LLCA 3DV0A 2OAGA 4Y30A 4MJLA 2B9EA 4AIIA 3L7CA 2DPXA 1MEEA 3HFGA 4MMZB 1R66A 2R1VA 5E0OA 1D2RA 1U65A 1FUUA 4ROTA 1Z3IX 4HRYA 3KO8A 4QXMA 4MA0A 5CG1A 1I2MB 3SQOA 1U2PA 1ULBA 2XL3A 3BHMA 5DNDA 2QTVA 3O90A 2OE2A 2FLKA 2SKDA 2D5BA 3FNGA 1VHWA 3CVJA 4XWGA 4LDNA 4AN4A 4BGEA 2Z8YM 2C78A 4MLZA 1ZINA 4JHLA 3FJ1A 1NXQA 1YIOA 1LVHA 2ZZMA 3T12A 5J4LA 1UL1X 3KK0A 1X13A 3WV5A 2BGLA 2P79A 3N6XA 1W5SA 1V39A 1X8XA 4GUAA 1PZXA 3UMFA 1H4QA 1JAXA 3GX1A 3RU2A 4UW9A 4TS1A 2J0SA 1DFHA 1LJUA 2ZTMA 1JQDA 3E81A 4NF2A 2Q5CA 2AQHA 5CEJA 1GZVA 3BXXA 4TMTA 3AUJB 1XTSA 4JUDX 4YT5A 1U31A 1LBHA 2ZGVA 2AJ8A 1WCWA 4G5SA 4F1KA 1Z56C 5H3HA 2EKQA 2VPXA 3AJAA 3ENQA 1Z6ZA 3F7MA 3QH4A 1WSWA 2F8TA 2AH0A 2ODEA 2E1PA 1AZLA 3R5KA 2JJQA 4NE9A 3H3XA 4XFKA 4C07A 3NOQA 1N9ZA 2FW1A 5F3RA 5C86A 3OHPA 3P0HA 3ESRA 5BWNA 1DIHA 3HP1A 3UF0A 3WIOA 1KZ1A 3HUEA 3L0YA 2REBA 4AULA 2CLIB 1T6NA 3TECE 3OZVA 2X7XA 3DEYX 5CCDA 3EZYA 2V5UA 4MVJA 1EAYA 4MROA 3WVNA 1GZHB 4EI7A 1YQGA 4XGIA 1RWOA 3EN0A 1R27A 1ZA2A 3PGKA 2HU7A 1RBMA 2PKQO 3BWCA 3BIXA 1E9SA 1MG3A 1CY1A 1R4ZA 2HQ1A 4C5CA 3TYXA 3FZEA 2OC9A 1UADA 3MGCA 5C1OA 4IXMA 1LS6A 2GVDC 5H68A 4NFHA 3CLTC 1WEHA 3ROTA 3DR5A 3T5GA 2XA9A 1LA2A 4L5CA 5KSYA 2VSYA 4KXVA 4AECA 4EHAA 4BQNA 5KVAA 1ZXXA 4MPDA 4N5NA 2OT3B 2QSZA 5NLLA 5FRDA 3SYNA 3KOXA 1BCRA 1KVTA 2VXBA 1UPXA 3BA1A 5I9TA 3QIAA 1BC5A 1SQGA 4XB6B 3TIFA 4GQIA 2IOFA 1MDAH 1T2VA 1PYDA 1RXIA 1AXEA 2BKAA 4EGFA 2VF2A 3GZTB 3UJHA 1XL0A 2C59A 3BWVA 2A1UA 3GEDA 4LBVA 1LLFA 2WAMA 1AQIA 5CB4F 1A8SA 2NVBA 4R7GA 2PSSA 3LKBA 2BLLA 4NC4A 3H18A 2AV6A 4NARA 1IEQA 3QOYA 3PTAA 4BKRA 3JR3A 4MQEA 4V2UA 4F60A 5LPNA 3FDZA 3VDNB 3AHCA 4JLUA 5TPWA 2GPTA 4CT0A 1ZFNA 2JKZA 1UMDA 1LPPA 3ZHTA 1PTJC 3TQIA 2E48A 3GZJA 1R8YA 1N1MA 5GJCA 2RHCA 2ERYA 2REOA 4W9RA 4Z4CA 1RACA 4Q9AA 3CZPA 1XK7A 4ZI2A 2BMEA 5C2JB 4K28A 2J57G 2QI9C 2P91A 3IA7A 4CODB 4EB6A 3ZHXA 4EUHA 4GVLA 2SNIE 3VU0A 4JDUA 4AJ2A 4ZALA 1CUCA 3JPYA 4CI8A 1XK6A 3WL6A 1Q84A 3FB1A 1WXIA 1FSSA 2CXNA 2Q9BA 1N6LA 3HSYA 5IZCA 2PUBA 4Y6RA 4FR5A 4K7JA 2H0QA 2XXAB 3V4VA 2Q7QA 1XD2A 3H9JA 4I19A 2JFXA 5FWNA 4XH9B 2H9AA 5KQGA 1NU6A 2HK9A 1YS2X 4QGGA 2FR8A 2Q62A 1D4ZA 4V0MA 3PKIA 3A3KA 2Z2ZA 2R8RA 1RHUA 4HGRA 3EA0A 4KQIA 2WZQA 4D9MA 2QTGA 3KKZA 1XZ8A 5F9MA 3FYHA 2CHEA 4YCCA 4AYTA 5CX1A 1JAIA 5GM1A 3RS9A 3KBOA 3I7PA 3PUWA 1GA6A 1DWOA 4K3UA 4H7EA 4N5HX 4S24A 4UCXA 1XZGA 1QR2A 1VOTA 4HP8A 2ISSD 1SC4A 2YRXA 3RHSA 1EEHA 2QRZA 1J70A 2E1RA 4IQFA 1T1EA 4C0SA 3IMFA 5BY2A 4RD4A 4DBLE 2G83A 1EE2A 3TJZA 4HN4B 1G6OA 3ZHRA 4LECA 4B82A 4D0GA 1TZCA 5FUYA 4EQ6B 5JBQA 1WO8A 4RVHA 4ZQCB 4E94A 3LOQA 3TSAA 1N2IA 4EM6A 4FLEA 1TMYA 1ZLXA 3LQQA 4C0JA 3BT7A 4TPKA 1M5UA 521PA 2QLLA 4JEUA 3Q98A 2FHPA 1S2NA 3CUSA 2WKQA 3GA7A 1NFRA 3P2EA 3L0BA 2IWFA 1LC3A 2Z2OA 4L1MA 5HYVA 2H1HA 4KX5A 5JWHA 1R6AA 3QEKA 2BEVA 5A1JA 1V4VA 4R2MA 1ABFA 4OXYA 1N2OA 2EVWX 1DX6A 3G17A 3NP9A 1NFQA 3Q4GA 4BX0A 4D4IA 4PFSA 3L6DA 4AZSA 5HS6A 4S1OA 2Z8YA 5K8CA 1K7YA 3LD9A 1IQPA 4C2UA 1F20A 1WZIA 4PXYA 3ZWMA 4P0TA 5JV5A 5FBKA 2WQ8A 4B4UA 2WWTA 3Q3EA 3AKEA 5JY1A 1ZM2A 1EZ4A 1S1CA 4GZ3A 3R74A 1UAAA 3AU9A 1IH8A 2BFEA 1T6BY 4WK0B 5E2AA 1D2NA 1ZUHA 2Z2IA 3CLUD 2YNNA 4ND7A 4O4JF 3WJ1A 1W8IA 2X40A 1PGNA 4EHFA 2V4MA 1H2YA 4KQ6A 1GSHA 5J2UA 5FNZA 2WVGA 4BO6A 4O6VA 1SKBA 7ADHA 1DIAA 1YL7A 1O6ZA 4DDWA 5K8VA 4PYKA 1E3JA 4YAOA 3AVYA 3QF4A 1C3OA 4JT8A 3AR9A 4DSUA 2RGDA 2X2EA 3EY9A 4GWKA 4BLRA 4Z7JA 1AF7A 1XTZA 4AS3A 4U3JA 2G71A 5CNJA 4WNAA 5K9ZA 3HN7A 1LV7A 4DEYA 2JIRA 5AVZA 2YCBA 3MHTA 2OZLA 4RL4A 4X6YA 4RESA 1KSHA 5HKLA 5AVWA 3HN6A 5FFOA 4S12A 3MVEA 1ZR4A 2GFHA 1YZUA 1XHEA 4GPTA 2X14A 2FEXA 3PRHA 4U1RA 2Q4DA 4QU5A 5KYWB 4P53A 4LWOA 4LTNA 4XYHA 2VFAA 1K5DA 3KDPA 1ARZA 4Y6SA 1U8ZA 2H2GA 3RUPA 4CI2A 1GU0A 1X9HA 4NTZA 3DWGA 4L28A 3P97A 3RT1A 3WA6A 1FLVA 4NU8X 2CSXA 1RMQA 4F6LA 1JDBB 4EFNA 3QXJA 3CVYA 1JPVA 3I9MA 3I04A 1G8FA 4GSLA 4UI9R 3UVLA 4DEXA 3CLVA 2QSUA 2IH2A 7MHTA 1OC2A 1AHHA 3DONA 4B2YA 4BCBA 2JIDA 2P3LA 4Z9AA 5CA1B 4EJSA 3DBRA 1K5HA 1CY7A 4QLOA 4HQFA 1KDZA 4OQQA 4CLEA 2X3FA 1TU4A 4H08A 1N2JA 3THSA 1Q7BA 1I7NA 2FN3A 3M4ZA 4CG0A 3OLVA 3BXPA 4RKYA 1XTVA 1HQCA 3V42A 4MP8A 1HYBA 4XQGA 4HB2A 2GNPA 3WWPA 1RP1A 2ZE7A 1ZN2A 1GZ6A 2A58A 1W5TA 2REQA 3OMXA 2XQIA 5F5NA 4I6EA 5DGDA 2RK4A 2Q49A 5IARA 3P5SA 1UTCA 2CXUA 3ESZA 3TGWA 3FR8A 4UD6A 1YS4A 3LFHA 4ZHQF 1T3SA 4QGBA 1BHO1 4YECA 1BFKA 1ZPDA 5A5FA 5TEVA 4IVQA 1I0IA 1IRIA 2ICAA 4PN3A 5DBGA 5TR9A 4OSPA 1M0SA 3W05A 2LUOA 2VHZA 5JZ9A 5EM2B 5BMVA 4F2HA 1SULA 4M1TA 4MMYA 1WIWA 3HFQA 2HJBA 1B76A 4DAOA 3JD3A 4KLCA 2P2NA 1LLDA 2CD7A 3MCTA 5TQ0B 2CHGA 3AIOA 1HRKA 4DNQA 4G0PA 1QV7A 1POXA 1FSPA 3H99A 1ULHA 4CM3A 3RFXA 1JW9B 5L3ZA 2EIBA 1IMOA 3SBOA 1FNMA 1Z0IA 1G20E 1REQA 1P61B 3ICWA 1T5OA 2QOEA 3PZRA 2ERXA 2OV3A 2YOHA 1G9TA 2IYYA 2Q4EA 3BGSA 3PDIA 1JFFA 1A9PA 1WJGA 4GE3A 3TE7A 3ZK9A 4DLZA 2PGNA 2I6FA 5JI3E 1DPFA 2WFZA 4YJ2A 3ZDZB 3O1LA 2ZSKA 4MGEA 1JVBA 5IP5A 5G02A 1PCXA 1T3GA 1C5KA 2BUBA 3GUZA 5DTIA 1L8QA 2VDOB 3GW8A 3C8ZA 3GNQA 5H9WA 1PJ8A 5KNBD 4QT4A 4IUYA 4XKJA 2GXQA 1A7AA 2GYYA 4NECA 5JNVA 4DMCA 1L4GA 1S6YA 2BBTA 3E1KA 2EBFX 1G21E 4PLFA 4R2KA 3ZIUA 1TQDA 3PDWA 4PYNA 3R8XA 5SYMA 2QUJA 5EJMA 4TQUS 4Q1DA 4F6CA 4MPRA 1N6NA 1JQ5A 3S5JA 4Z51A 1J2TA 1DV2A 1NVBA 3AB3A 3QHYB 1XVIA 1R9MA 1ZGCA 4WZAA 1RWWA 3C6YA 4D6PA 3LUJA 3GELA 3DMTC 2Z30A 1XQVA 1YL6A 4CI0B 2AGYA 4HJRA 2O9KA 3L8DA 4DLLA 1P72A 4DSAA 1DEOA 4Y6GB 2CUNA 3U39A 3JYQA 3WAJA 2VJLA 4N0QA 2WIDA 4EG3A 4KO4S 2PV0A 4KUGA 4Q4LA 1U0RA 2NN3C 1JJBA 1BPOA 4KGDA 4ENVA 1GGNA 1UWVA 4LK3A 2WG1A 4EFLA 3NHPA 3HVKA 3NDJA 2ZE5A 1HV8A 3WQBA 1LU9A 5EMMA 3X1MA 2F48A 2Q7XA 3HZZA 1GEGA 2D4HA 3E2IA 1NXXA 3BSWA 4GRAA 5DHAA 2QXUA 4TV8A 1WTAA 1PBNA 2ALJA 1DS6A 2QX7A 1KK3A 5FBQB 3T5BA 4W1RA 3RYFB 5DNVA 5JZVA 2OLKA 5AFSA 1QG0A 4U6NA 1H1LA 2VZ9A 3FF1A 2BE7A 4EO4A 3L4BC 4LE0A 2H68A 1GEEA 3SGLA 4Z53A 3HBNA 4RQTA 4UEKA 1MFPA 5LA6B 4REQB 1ZJYA 1YJXA 1BKYA 3H83A 4EX6A 4MW2A 3JWHA 2A5JA 1G41A 2CMGA 3OPYA 3HJCA 1SCUB 4CMEC 3N76A 3N2KA 3HJNA 1KR5A 3BCSA 4YACA 1E3IA 4ZOLB 2PTHA 1XWIA 4MKZA 3CUKA 2Y0BA 1HT1E 1W85A 2WWGA 4ZPJA 1ESCA 2A35A 4XUCA 2XBLA 3MD9A 1MO3A 2ORIA 1Q1BA 4D9IA 6REQA 1FP7A 3STTA 4FWTA 5JJBA 1KDVA 1XVTA 5AUOB 4DMHA 1YS9A 1X7WB 2XZTA 4X3CA 4CFSA 3R9XB 4R9VA 3QTBA 2Z6AA 3CTPA 2XMGA 3NTOA 4QWWA 3KQQA 4U4AA 1U0EA 3I1JA 3ZH2A 1E9EA 4MIOA 1QVVA 1G59A 4NHEA 1K6IA 2C7QA 2J0QA 3ZE0B 1G7SA 1PGJA 1J42A 3KRTA 3B1JA 4I14A 4FLMA 2RGUA 4GBMA 3OJ0A 4P0PB 4UTPA 3JD2A 3TTUA 3KHSA 1O6BA 2XSZD 1LSSA 4P2BA 2FJUA 3EUFA 1WHTA 2N3ZA 1ZEJA 4AJ4A 4YJ3B 1P7WA 2AI1A 4C88A 1I6MA 4IICA 3NTRA 3JQ7A 5M34A 4EPTA 1ZCBA 1OGJA 4I1UA 1ZIDA 2WJYA 1VGVA 4M6WB 2JFPA 3H2JA 4BOYA 3LQFA 4IEEA 2XMPA 1U4OA 2ATEA 4FINA 2OVRB 3AF3A 1OKKA 4FIZA 4G1CA 4E5UA 3VYSB 4QUIA 1ZMOA 2YFHA 4IL5A 5K6AA 2R97A 2WY2D 3PT9A 1UT8A 4IJ6A 5TPZD 5L9AA 4O2BF 3MN1A 1I7SB 2V6JA 1ZN7A 1DP4A 2VDJA 2BGTA 3LLMA 3ZNNA 1PV4A 2GD0A 4D96A 4Z1MA 1VA5A 1OLOA 1LPNA 2JIBA 4CMGA 3U3XA 2VH2A 5FTNA 2DHCA 3TQHA 1KI9A 1E63A 3T7KA 5BV8A 3OFJA 2AMJA 3UC5A 1M2EA 1W581 3T5TA 2O59A 1IQRA 1UWCA 3IUMA 1L7OA 5JROA 3PR1A 3OJLA 4YRFA 4FS8A 2GN6A 3PB3A 2D3TA 1CUDA 4MMXB 3A1EA 1Z8NA 1M83A 3KEGA 3QVSA 1K63A 1UMBA 5E2IA 2EERA 3NBYC 1CUHA 3AHHA 2E6UX 3GRFA 3F1LA 2B21A 3D3NA 3R0QA 1JX6A 4QPNA 5IAJA 2D1QA 3DM5A 3I2NA 4IKPA 3TX6A 1BE1A 2C9BA 1T3HA 1TPZA 4YAEA 3IAEA 2JVIA 3W2FA 3DEAA 1UCFA 3I45A 5K1CC 3GP5A 1YZNA 1XTQA 1B9XA 2ORYA 3VNVA 1ZITA 2ZPTX 3OO0A 3RARA 2PZJA 2ZQ5A 1NQTA 5GV8A 2O2SA 4TS3A 3IP3A 4LTMA 2QUAA 1P9LA 4LC9A 1V5IA 3MB5A 3F9IA 4RIIA 2EJVA 1ADJA 1D2MA 1N57A 2FPGB 3CO5A 3LUKA 1WY7A 3OEHD 2OAQ1 2FYTA 2VNAA 3PXTD 2BIFA 3H4MA 3KKPA 2X2FA 4Y5RD 4ZO6A 1FMFA 4RYLA 4RMGA 4LX8A 2FQ1A 1L7DA 4ZCLA 4OKNA 4R1OA 2X1VA 3TSYA 1NXWA 2XCOA 3ST7A 4H7HA 2Y1GA 4ZICA 1L1FA 3AL2A 1KQPA 4B43A 2HW8A 1O5TA 4C4ZA 4KOEC 4HUQB 3THWB 5G53C 4LKRA 4YUAA 1K7XB 3NBZC 1Y7PA 1ELOA 4E0BA 3KSAC 1F8UA 1SC6A 2VJAA 4YWHA 2PH7A 4DV7B 3QI2A 4QBTA 5KYNA 2DXIA 1F6DA 1DFGA 1YONA 3MILA 1UOQA 4IS3A 1FTQA 2RARA 1XYVA 3MWLA 1SXPA 1MC1A 3C9CA 2EIDA 3LOPA 2NUBA 2AT1A 4ZK2A 1JDPA 3JQAB 2J3EA 1E0AA 4HT3B 2VRBA 3INGA 4XLTA 4GBJA 3CIFA 2QG9A 5JVDF 4JGGA 2G1KA 2I2WA 1D09A 5HQ3B 4PWYA 3QNWA 3MC1A 2C9YA 5E8JA 5JISA 3PR3A 2QTFA 2I6XA 3D6AA 3EXHC 3C5CA 2ZSBA 3E05A 4MV3A 5CFPA 3HSSA 2BHLA 4RVUA 2HCJB 5JCPA 1JBKA 5I5MA 4XZ3A 3SR0A 2GPNA 4H9GA 4UCFA 3JVEA 2JI8A 2VNHA 4KXMA 1M74A 1CF4A 1O54A 1AA6A 4BO9A 1DOZA 3IAM1 5K3CA 1JKJA 1KAOA 2ZRQA 5KCZA 2IWRA 4A0GA 1DUIA 3OE1A 3VRHA 4D02A 2B4KA 1JTVA 2WJ4A 5EN4A 2QLJA 5AM0A 3RBXA 2EG5A 4EFKA 5J2TB 1FSFA 4YVDA 3F6YA 3RYIB 2BFOA 1HR0B 5TVGA 3ERCA 2FPSA 4YRAA 4HB0A 2QQGA 2QX4A 4NS1A 1SUAA 2GC4A 1K08A 2DZDA 5HEKA 2Q5IA 2ZEJA 4CL0A 1ST3A 2ZWVA 2UXBB 2Q3LA 5TGTA 3BGOS 4WRRA 5B7NA 1BE8A 1Z2NX 2YFYA 1HEIA 3CIOA 4JX9A 3PNLA 2H1IA 3UXYA 1NSYA 1E6UA 4QAQA 3U56A 1YQQA 2V4ZA 3ZU4A 5C1IA 3NVKI 4DWVA 1RADA 1U0BB 3UAGA 1ZGBA 3EXAA 3CLUC 2QPLA 3EFBA 3RC1A 3GGDA 3WAKA 4FWIB 4NBUA 1CUAA 3KSUA 3LHKA 1GPKA 5IVPA 4HLQB 4LSWA 4XI9A 2P65A 4L4YA 2JJ2D 1T9BA 2XL2A 3EYAA 2QV0A 3WLFA 2W11A 4U2EA 3NHBA 4TL8A 4Q66C 2WQ7A 5A2Qg 5IJ9B 4MEJA 3G6KA 1RLTA 4RJJA 4NU5A 4H0FA 1URPA 2H1LA 5JWOA 1E6CA 3EF3A 1RYZA 2BW0A 2NV2B 1OBHA 3VAZA 4F5WA 5D6NA 2LP4Y 4DRZA 2ATCA 2C84A 5EKSA 3VOTA 2ZWOA 4YO8A 1X3LA 1E7WA 1VCOA 4ROSA 3K0FA 1RABA 2O4CA 3QJ5A 1O3YA 3AFMA 1EGAA 3ZDEA 5B1IA 3REGA 2GZ3A 4UU0A 4HAVA 2X41A 2AQIA 1FU8A 3OZFA 4S0ZA 2CMDA 2YV2A 4Y6LA 3K1JA 2XRMA 1GL9B 4QRIA 3UAOA 4P3YA 3OF2A 2PKQP 2VA8A 3C8MA 1DTWB 5ADVA 4NBTA 3GLGB 1BROA 4O5OA 1JHOA 1FFWA 2ZUDA 3FZGA 3LZ6A 3V4LA 3MMSA 4JKOA 1N5IA 1OVGA 2O7QA 4UAJA 3FPHA 3ZW9A 4YASA 4MCIA 4CF3A 5LP1A 2Z6VA 4O59O 4YPOA 1K3TA 1KFCB 4OHPA 4WBXC 5LDDC 3VR0A 1HORA 2FPIB 3K1AB 2OVQB 4PZPA 5T7BA 1D7AA 1P5RA 4WEQA 3IT2A 1XX6A 2QZPA 2M6KA 5FWDA 1XDGA 4HG2A 5K4AA 2C42A 5F98A 3KEMA 4TMKA 3IOEA 2WPDA 3U4QA 3CUTA 1J9EA 1P6XA 2X0KA 1U81A 3WLJA 1ICIA 1U4NA 3ANSA 3NQ41 2Z04A 4EYKA 1JJ7A 2C1ZA 1M1XB 4UBMA 2YW9A 2AGWA 3ES9A 1NATA 2Q3DA 3G49A 2JHPA 5LYYA 2DQKA 1AK1A 4QAMA 5H83A 3O4JA 2O3RA 2ZR7A 4EGJA 5E4JA 4Y6QA 2IZ0A 5AI4A 4XVUA 5B12A 4R71A 2BL4A 1SVWA 1R4MB 4A0SA 1FXUA 1YVEI 2B1QA 1TDJA 3HXPA 4FYVA 1EXWA 5BT8A 3UOWA 9ATCA 4AROA 3KU4A 1F8FA 4FKBA 2OHOA 1I4TD 2CB9A 4KW7A 1PR6A 4IO0A 4DLKA 3LBYA 4HYQA 6ABPA 3DCNA 5JPIA 1Z08A 4DQLA 3QUQA 2DHRA 4CFYA 4IDFA 4C21A 4E5NA 1HT0A 2EHDA 2YVKA 4JT5C 3RS4A 3CEAA 1F2TA 3RC8A 2BJVA 2ACKA 2Y0PA 4DDTA 4DQDA 4TRNA 1ZNQO 1KP9A 3OURA 5D5QA 5AK6A 2HCRA 4GEKA 4URYR 4COOA 1XMVA 2Q28A 4M4SA 1K5PA 2YQZA 4BPRA 5HIKA 4OBWA 4LZAA 2NZVG 4FOSA 4ZRNA 4DT1B 2NV6A 1MO6A 4D6VA 2AI3A 1T36B 3K0EA 4AMVA 4CLOA 3VHQA 1MW8X 2GT1A 2B7BA 1QV6A 2I65A 1OLSB 1KJWA 2IHJA 2AK3A 1O2DA 5FADA 1EDEA 1JWBB 1KEVA 2ZROA 4W1SA 3AKYA 2I33A 2BRUC 4YRKA 1TAHA 5IM4F 2DULA 3UBTA 3KBBA 3K0HA 1AQJA 1X9GA 3IE0A 3CY6A 3L7LA 4DEVA 2C5EA 1UBEA 3QKSA 3RTAA 1R6XA 1Z4LA 3BGIA 2AFVA 3LUBA 3PPWA 2BFDA 3R3WA 4TSRA 1J39A 4JLJA 4J8PA 3BAZA 3R6DA 5FTJA 3VX4A 4DCUA 3B3FA 4CDMA 2HRZA 3HY3A 4BCDA 4C0AC 3KPYA 3K3PA 3TAUA 4GC9A 4RVCA 3CSUA 4FWWA 4FUTA 3RJ9A 5D3MA 3KOWA 1R00A 4XB1A 1ZHFA 4BX3A 4PC2A 1TTQB 2NLOA 1V1MB 2IYNA 4IOLA 1U7TA 1RQNA 3TKAA 4HNGA 4NBLA 4F04A 3JALB 1M54A 4HTFA 1JV2A 1U1GA 3Q6IA 1VPWA 1IN8A 1QCYA 5GONA 3L7YA 3O2SB 5LXTA 5L40A 5KUTA 4RFLA 5D00A 5GGXA 3T7RA 2YZGA 2CXOA 3H9BA 5G1NA 4KG7A 1SHYB 5LP6F 3W2HA 4FFWA 1HE2A 3B1WA 1QH1B 4R84A 3NFYA 1TKAA 3ZWWA 1TYEB 2Y1EA 4W8GA 5GZ6A 2ZJ7A 5BO5A 3NALA 2NTEA 4I4TB 4D43A 1TM5E 2MTBA 5ITSA 1V8PA 5JFOA 4NFLA 5CH8A 1RRFA 3PTZA 1AE1A 4BMPB 3L8CA 1TM7E 2VP0A 1I2DA 3D2CA 4UHCA 3GMSA 3MRTA 2AZXA 1S5PA 1NZDA 2IYFA 1GZ3A 1R0LA 5JRZA 1ODFA 3ZV4A 3OSUA 3QXSA 3RBZA 4RTQA 4BAZA 2GSDA 1P5HA 1U4SA 4R1PA 4FD3A 1V16A 4DM4A 1NXPA 2AFIE 1U9IC 2F1OA 1HZJA 4YQFA 3OECA 3WZ2A 1G4AE 4K8RB 3E48A 2RH4A 5FUXA 2VSFA 1OXKB 4IKOA 4ACAA 3V9FA 1QJCA 2C77A 1XU7A 3WRXA 2VJDA 2C4HA 1NVDA 2WJGA 3ZHBA 3GUVA 2RHLA 1F3OA 3QELB 5DCLA 2VDQA 4B32A 4LNUB 3LVRE 1JLLA 1US8A 1E6MA 3IUSA 2PQMA 1Y34E 2ZQYA 2HSJA 4RHTA 1ZSYA 1GD1O 3EIUA 3UKOA 5C8YA 1BMFD 3CVOA 4F86A 3IS3A 2YY7A 4LQCA 1AV7A 4W5OA 1T0HB 5LZ2A 2XB6A 4YMSA 3WLQA 3KEFA 1V48A 3I2YX 3O8QB 2ZYAA 2ODNA 3L43A 5FCDA 3NIFA 4EFDA 2ABWA 6AT1A 4F8YA 3KTAA 4FDTA 5HIAA 4YRBA 5IJZA 4JI3B 3MTDA 2IW3A 3PXDA 3COVA 1M1YA 4X1OA 3PIIA 4IUBS 5FEMA 4JLSA 3M5WA 3HDTA 1H1DA 2MOKA 1RJDA 4UZFA 2ZWMA 4YUVA 1A97A 4DMGA 3BORA 1H05A 3OQVA 1EM6A 4YO7A 3I4LA 3N8IA 1CRLA 3DKIA 4JNKA 2IEZA 1GPYA 4KE6A 1AHNA 1EJBA 2Y0DA 1J1UA 3QX3A 1ZIPA 3FUVA 1ZO8A 3N3AC 1RQGA 4WOKA 2AWNA 1C14A 3U80A 2IU4A 2C7PA 2RIRA 3HM2A 3TZHA 1CRWG 3UKRC 3FKQA 3BE5A 1KI6B 5JCJA 3CUWA 4F5DA 1NULA 3MXOA 4B3DA 1EX6A 1ZMBA 3GBVA 1DAKA 2QL5A 2FMFA 1GRVA 1FW6A 4L16A 5BV1A 4BPBA 5JQWA 1U8TA 5AM1A 4DUGA 4Z99A 1NP7A 3OQ6A 5EZ6B 4QQFA 1KOGA 3GVCA 2BBKH 2OCDA 3ZCUA 3JQDA 3N28A 3Q9LA 1UINA 4LMAA 2GCGA 4D8TA 1G8MA 3CXRA 5HSGA 4HQLA 2ZUWA 1ZW6A 3BSFA 4HDCA 2W8ZA 1FFHA 2NU7A 1Z2PX 4M1KA 4GZ5A 2R00A 4IDNA 3H87A 4YFYA 4KC0A 4ETWA 3TRHA 3BS4A 3ZJ4A 4C4OA 3GLFA 5FFFA 4RFVA 2RI6A 1CCWA 3SLRA 4Z0HO 2JDID 2ORWA 3GUYA 3DLBA 1P1FA 4YRPA 1GLVA 3LWZA 1TZ2A 3C5VA 2CHQA 5K3BA 2J30A 2F4NA 1VLQA 1SUIA 3UT5A 4GGCA 1X86B 4Q7JB 3RU7A 3ZKWB 4KN6A 1D1QA 2AOUB 2BSQA 1U1CA 4GI1A 4PW0A 3EUEA 5LN1A 1RAGA 4R8KA 1ZN9A 4JODA 1DC3A 4GQ2P 2G72A 1JDBC 2QZSA 3BMOB 2JF0A 3TLKA 3WGQA 1UMCB 2G08A 5BNIA 3B1XA 1AB6A 5FL7A 2QC5A 2GEKA 5JMWA 5MGBA 3OEED 4RX1A 4BMZA 2BMAA 3IPYA 3NDBB 4X8LA 1QYWA 3TQRA 2VYNA 1UOPA 1VIAA 1NJ2A 5CTJA 4JYCA 4WSOA 3ZY2A 3ESCA 5G0VA 3TZEA 3LK7A 3PUXA 4TT3A 1HI9A 3QXGA 5JG7A 3IL2A 1U7WA 2PQ0A 4B6FA 3SY8A 2JGKA 4RVDA 5DASA 5ALDA 4B7UA 4L9OA 1M6EX 1MRZA 2B83A 3MFYA 4JLVA 1EUDB 4E5ZA 1GADO 1PGOA 1M34B 4LWZA 2EQAA 4M60A 4V0SA 5AJHA 1S96A 1EFRA 4KL8S 4GXRA 3D5EA 4AS2A 3ZDBA 1LDNA 4Q12A 1X7YA 3AR3A 3C7CB 3CFYA 4PRLA 1T1IA 3CR7A 2VWQA 1O96A 3AFNA 1PS8A 3UAXA 1Z4KA 3URKA 1N2CE 3A4MA 4NBVA 3SZOA 4B09A 5C2VB 3K9BA 4WOPA 4FLFA 3FTFA 5LMNB 1NXVA 3SIXA 1NQWA 2YZKA 1YA6A 1J20A 2DKFA 4GPAA 1QBGA 1T3ZA 4PANA 2HN9A 2WJAA 3F49S 6NULA 3M5DA 3B13B 4LGNA 2Q9CA 1M8FA 1WSBA 3FETA 4JKYA 3C1OA 2MYNA 2VAVA 3D6UA 1JYEA 4FR0A 4DIFA 3JASB 3OE7A 3RLIA 1PQPA 3S2YA 2X6RA 3PFIA 1BDHA 4DIMA 1NF8A 2JIZD 2HA0A 4J0KA 4YXWD 5J5VA 1ZJ4A 3P0IA 3ZPXA 3JVIA 4AJPA 1KY4A 3UHPA 1VLJA 2D2XA 3DL4A 3IBGA 3ZXXA 4R3WA 3EVZA 3U40A 2OMEA 5L3RA 1SBQA 3OI7A 4HBGA 3IILA 4O33A 4CGZA 1MEJA 2CBZA 3U3DA 3ZHZA 1NTOA 3H04A 4FA1D 2ZLBA 4N6GA 1OT3A 1BXGA 2J5RA 4MUYA 2CFIA 1XEXA 1QIMA 4IXWA 1QIJA 1E79A 4QRHA 4C3UA 5HF9A 1YC2A 1HQKA 3GT7A 3V1YA 4G67A 3ZBQA 1NYTA 4GM8A 2FW0A 3CUUA 1OLZA 1RZRA 1FDSA 1S3IA 4BMYA 4DG5A 3SLED 4P4TA 4ZEWA 2RKBA 3MGBA 4P6VF 3TZKA 3D1JA 4WESA 3IDQA 1NE7A 3IELA 2IP1A 4PLGA 5I6DA 3FDJA 1PT7A 4MRSA 5JYCA 3S0JA 3N6RA 2FSFA 5CYKA 3MXTA 1JDTA 1MPTA 5HE2B 3IMEA 3O84A 1J7KA 4C20A 4TLLB 2PUCA 3CH4B 3M6LA 3TOZA 5BWBA 5IJ7E 1VL5A 3WY9A 1R8SA 4LRQA 3OFSA 1SHLA 5EP2A 1GG9A 2CN2A 1NR1A 4UC0A 3AILA 1GRQA 2V96A 4J90A 1G17A 1G20B 4YDQA 3AG6A 5BQ5A 3IV9A 4WZBA 1GHTA 1XXHA 3MGGA 2W6QA 1ZCFA 2R0QC 5DOVA 2C2XA 5TEEA 3UB4A 3RDPA 3HCBA 5A3VA 4DIDA 3NVXA 3EXEB 2JLVA 3DPIA 5FPSA 1ENPA 2PNFA 3ELYA 3HO8A 4JVNA 4DR4B 4JJ6A 5JANA 1T1GA 3HXTA 2DUMA 5CT8A 2OXIA 3ZWCA 1U2ZA 1X1TA 4P38A 2ZIUB 3PDCA 2IYUA 4B7AA 4MS1A 4HLDA 3W5IA 1RSZA 1XKLA 4DYVA 1NURA 1HBJA 1Z0ZA 2W2LD 1U0TA 4MHTA 4JA2A 3B20A 4P0QB 1G21B 1CQZA 1PK8A 3OL2B 3H1FA 1D03A 1II8A 1BX3A 4HS9A 4NAAA 4BFZA 3JQ6A 1Z82A 3MWJA 3R6TA 4OGKA 4BNYA 5CP8A 1GPLA 4LMPA 4LV6A 2AGVA 3KQLA 4KFMB 4OGFA 4EECA 4V0OA 4G1MB 3WYCA 2WD8A 2HLDA 4EF5A 4JJFA 4MRRA 3ZDDA 4FI3C 4KFUA 3KL4A 5K0JA 4MQLA 5ITWA 1UDBA 2JNWA 4O4HA 2Q1TA 2ZAMA 4ZYTA 5DTMA 3B1KA 2OB1A 5DGIA 5BN4A 2Z1NA 3D7NA 1FC0A 4HMOA 2HWUA 1X74A 2CBGA 4PXWA 4DV3B 3J81A 4A0HA 1Q7TA 3REQB 3UGTA 2L17A 4QG3A 1JTFA 2AKEA 5BW8A 1N5JA 2A9OA 4U7DA 3DZJA 2KLHA 2I54A 1RPJA 4W5RA 2CB0A 2RHGB 3NXKA 3FE2A 3G0BA 4IPTA 5CFOA 2QDXA 2D0PB 4BKUA 2C5LA 2JCVA 1VFPA 3VKFA 4ER5A 3KSDO 3QPVA 3KQWA 5JXJA 3M3PA 5J58A 4AP9A 5J4VA 1SA0B 2WU8A 4I0WB 4KI0A 4E54A 2WVJA 2PZ8A 2X8JB 3NONA 1H2BA 4QASA 3FBWA 3HB7A 4GGOA 1XMJA 3D8UA 2Z5VA 5HE9A 4ENSA 5IT0A 3NKVA 4ZOEA 5E1BA 2YRWA 3LVQE 3JQ8B 1KAEA 3C15C 2GNQA 3LX8A 1PR1A 1VQ1A 4F72A 1K6XA 3BH6A 3RHTA 1B8PA 3HNOA 3K15A 3OZWA 2F17A 1ZS9A 3VR5H 4JU8A 1CIVA 1EUCB 1FMCA 4MVJE 2R6CA 3NNSA 4LDRA 1T34A 4B84A 1FQKA 4RELA 5AOAA 5JCXA 3P4XA 3ACCA 1WPQA 3F8TA 1SKQA 4ZMBA 2EDAA 2R11A 3B5IA 2FZGA 4L4ZA 4Z49A 2JC3A 4WH0A 2RH5A 1E5VA 1GFSA 3UFBA 4JUCA 1JU3A 5EARA 2Q3CA 2JAWA 3JR7A 2XQKA 4G86A 2BD0A 4NDZA 5K3OA 3EC2A 5J43A 1X1EA 2VA9A 4JBYA 4AG6A 2CSUA 2F6RA 1P73A 4XGQA 1QLJA 4C0XA 2GI4A 4PLPA 2AL7A 4I3GA 4TN1A 1T35A 1OY1A 3WIUA 4HQ0A 3I9NA 1I3OA 1KVUA 2D5LA 1JYFA 4BMVA 4AP6A 4KN5A 4Z3DA 2EEZA 4EO7A 1X38A 2CXSA 4PG5A 3K5PA 3LM8A 3QF7A 3KSMA 3N7AA 3H7AA 5ESDA 3I58A 2Z3VA 1RI3A 3RN0D 2GASA 5SY6A 2C8LA 3R3JA 4K88A 4XJVA 4PHCA 3JPXA 2B82A 3X0DA 3FYTA 4UJ3A 3BFJA 3W4JA 1O9GA 1RC0A 2IYWA 3ESBA 4HSGA 3R1IA 1O95C 1ISGA 4UE6A 2CEAA 1WBBA