3IUNA

Appep_d622n opened state
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
682
structure length
672
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETNPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
molecule keywords Prolyl Endopeptidase
total genus 207
structure length 672
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iunA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iunA01
4HRYA 1DTEA 4CFSA 3MUNA 4CG2A 4NS4A 4GEGA 1U4NA 4QDTA 2Z8ZA 4BCDA 4UUQA 3QM1A 4M0MA 1IZ8A 3H2HA 3WWDA 3I2HA 1AUOA 4L3WA 4BRSA 2XUDA 5HQ3B 4PNZA 2HU7A 1XFDA 2VAVA 5FOQA 3FVRA 1QONA 1TIBA 3MVEA 1BEZA 2WJ6A 4U2EA 1MT3A 1ZICA 3OG9A 2ZYIA 4JYMA 1J06A 2B20A 5CRIA 1Y37A 5HF6A 5AK5A 3O4HA 5K3BA 1PFQA 5JAHA 4BCCA 3G9TA 3VVLA 2IITA 1FSSA 2RAUA 5T4BA 1XZFA 3SWWA 3W04A 3F97A 4K6HA 3ESAA 4BZWA 2DCMA 5CT6A 2C5GA 1LGYA 4PW0A 3IIIA 4DMHA 3C6XA 3Q8WA 5ALGA 5I9IA 3C8HA 3R3ZA 4Q3KA 5JASA 5HKAA 2XT0A 5FUMA 4FBMA 3C5VA 2JGLA 4M0EA 2C4HA 5JAUA 1JJFA 2AJ8A 4E11A 2HDWA 3GZJA 3C8DA 3R3WA 1CQWA 2XMZA 2HRQA 2XMBA 5ALWA 1XRPA 4GXNA 3F98A 1BE0A 4UBMA 3QBJA 3RARA 1ZIXA 4PV7A 1WHTA 4BAZA 1MX9A 1SOMA 2AJDA 4AO7A 4MQMA 1EH5A 1TRHA 3JW8A 4EY5A 3W9UA 3ZWQA 3SC2A 3LP5A 2DQZA 1I6WA 1YCDA 4C4XA 4G4IA 2WFZA 1XQWA 3UUEA 1A8QA 1CUIA 1XLVA 4ITVA 1ZD2P 1BRTA 1E8NA 4L72A 4UBLA 1JMKC 1XQYA 2OAEA 3KDAA 4G9EA 2JIDA 2QXUA 3WYDA 3WK9A 3AZPA 5AK4A 1UKBA 4B0PA 1AGYA 2Y6UA 4U2GA 2H1IA 3STWA 4KEAA 5E4JA 2G5PA 1JU4A 3O4GA 3ZPXA 2WFLB 3RKSA 4AO8A 2RHWA 2GYUA 3O95A 1CUBA 1QOZA 4B85A 2X76A 2FJ0A 1XLUA 4INZA 4LIPD 5T4FA 3W05A 4HVTA 4EY6A 5JAPA 2ACEA 4LXIA 5EIEA 2JGIA 2HA2A 4BP8A 3WZMA 4BVJA 3T52A 1UK6A 4MWTA 3WK8A 1QJ4A 2WILA 2WIFA 4G8CA 3I6MA 1W4LA 5IVDA 1GPKA 1CUHA 3WKEA 2K2QB 3HACA 4EZIA 1ZIYA 1DT3A 2X8BA 5CTAA 5CH5A 3STUA 5AHXA 4KE6A 2OCGA 2DSNA 1ZGCA 2J3DA 1QE3A 5AKEA 2HADA 4QNNA 4YK7A 2WSLA 1EX9A 3PFCA 4DMKA 3H2KA 1QFSA 2WUEA 1CUUA 5EIHA 1CFJA 3A70A 4OB6A 2GZSA 2HA6A 1JFRA 3ESDA 1N5MA 1F8UA 4OYYA 4C6HA 1ISPA 4HAIA 3U1TA 3PI6A 1MX5A 1LPSA 4KE8A 1LBSA 3I2IA 3F67A 2OQIA 2DQYA 4HTAA 2Y2UA 5K5EA 5C81A 1XRRA 1ZI8A 5HZGA 1F6WA 4DMCA 2VJBA 3C6BA 3RM3A 5AP9A 4YASA 1P0QA 1LZKA 3G9ZA 3HSSA 3C87A 1R3DA 3H19A 4AZ3A 2ECFA 4EY7A 3C45A 1EDBA 1Y7HA 5JD4A 1LZLA 2VAXA 2NW6A 1YA4A 5ISMA 3C6ZA 3FVTA 1BROA 2I03A 5BOVA 1W76A 3AIMA 5AI9A 1FFEA 2QRUA 1QIHA 2BKLA 4H77A 1VJ5A 4PF1A 3UMJA 4C89A 1XKTA 3R3YA 4Y2YA 3DL4A 2YASA 3UUFA 1FFCA 2J4CA 5BV7A 1EINA 4UFOA 3DL7A 4MJ3A 4QE3A 2VF2A 5CXUA 1VZ2A 1R1DA 1XZIA 1MNAA 1K6EA 1CIJA 5LIPA 4C4ZA 1JU3A 4UBIA 5ALOA 4Y7DA 3QPDA 4YX9A 3DQZA 1HPLA 1XRMA 2Z3ZA 2OG1A 1JI3A 2QUAA 3K9BA 5HK9A 4F0JA 3WL6A 3BDVA 4AMYA 2XMDA 3HLKA 1QTIA 2CUTA 2V9ZA 2PBLA 5AOAA 4QWMA 4MWSA 3FYUA 1N5RA 1Q83A 2C0QA 2XUKA 1GPLA 2UZ0A 1WB6A 3QVMA 3D2CA 1MJ5A 2LIPA 4A23A 5DNUA 3I6YA 2OLEA 4G1FA 1FFAA 4TPKA 1QIDA 2C5FA 1FJ2A 4Y2VA 5JAOA 4Y2UA 3IUJA 5ALFA 3RLIA 4DMFA 1YASA 1GQSA 3D2BA 3BXPA 5H3HA 1LPMA 5LZ7A 4KJXA 1EDEA 1DX6A 1XZDA 1IVYA 1H2YA 3WJ2A 5FRDA 4H7HA 4GDMA 4WY5A 3VJMA 3CXUA 1ZD5A 4BE4A 4FLEA 4QLOA 1K63A 1MTZA 4U2FA 3WWPA 4MEBA 1AMNA 5ALUA 3IVMA 1EB9A 3K6KA 4KRXA 2J4FA 5KREA 3R3UA 2YH2A 5AIBA 1IUNA 4EY8A 1YR2A 1JJIA 5A7FA 5AKXA 5LKAA 2E3JA 3E4DA 4B81A 1H2ZA 4ZV9A 4BAUA 2PKYX 2O2HA 4OU4A 4BRZA 3NGMA 5AM3A 4AO6A 5C8VA 3ANTA 2ZSHA 1O6FA 3CCBA 4X3CA 1UOPA 2HU5A 2G4LA 2CMFA 4J0JA 3M82A 2QT9A 2O7RA 4HRXA 2B61A 3BDIA 4Q82A 1HBJA 1J2EA 1SCKA 3JWEA 4DGQA 3A2LA 5AJHA 1G4HA 1YA8A 1Q84A 3WA7A 2BJHA 1XKLA 3VVMA 1QFMA 4MEAA 4GLBA 2R11A 3WKBA 1YAHA 1JJBA 5AIAA 3C6YA 3HC7A 3DJYA 5AK3A 4H18A 4PQEA 1W6RA 5ALJA 3Q0TA 1XZEA 2XMGA 1CQZA 2YXPX 3V1LA 2HFKA 4AZ0A 5AICA 3PFBA 1QIEA 3IUNA 5JARA 2EEPA 3G7NA 4G4JA 2PU5A 3I2GA 4BC1A 2Z5GA 5EHQA 5ALMA 1AC5A 4ZGBA 3DOIA 3WKDA 1W1IA 1XZJA 1UK8A 3BL8A 5K3FA 2ORYA 4CI9A 3QMWA 2BUBA 2HM7A 4L0CA 1U65A 2WUDA 2V96A 1G42A 3I6ZA 3LIPA 1Y7IA 1VA5A 3C70A 3DNMA 4Q3LA 3B12A 4X97A 2WTNA 4BDSA 5AI6A 2XI4A 5E2IA 2BUCA 3WQHA 2C7BA 3FCYA 4CG3A 3MGAA 5D6OA 4FNMA 1E3QA 5ALQA 2XB6A 5A62A 3G9XA 3RK4A 1MO2A 2JEZA 4K6GA 3WLAA 3X3HA 1QIGA 4OU5A 4DLNA 4H7IA 3M81A 5ALZA 4ZWNA 1KEZA 4QDXA 1SFRA 4L9AA 3WK6A 4H35A 3W2TA 4N8SA 4H7KA 2V98A 4H7EA 1WPXA 5CT5A 4U2DA 3G8YA 3AIOA 1KU0A 1ODCA 2GBIA 2RI6A 2WJ3A 1YAJA 5FPPA 4DYHA 1UFOA 1GPNA 1H22A 1LBTA 1XQXA 1IUPA 4X92A 2Y1KA 3H0CA 3PDCA 1EHYA 3D2AA 3H1AA 1HQDA 5HF9A 1C7IA 3EQ9A 2ZJ6A 2BGRA 1HDEA 4CG1A 4ZREA 5DJ5A 4BBZA 1E8MA 1A88A 2VEOA 4B80A 4IH4A 4OPMA 1QGED 3EBLA 3CN9A 2AJCA 1AKNA 2H7YA 1DX4A 2XQGA 3AINA 4GWLA 3A2NA 5EIAA 1CUZA 1VXRA 7YASA 3FWHA 5ESRA 2JGJA 3R41A 1P0IA 4AB1A 1P0PA 2HA5A 4AXBA 5EHXA 3DDUA 3AJAA 3O9MA 2W6CX 1ORWA 2B9VA 4W1RA 3HRHA 2GYVA 1LPBB 1K8QA 4GBGA 3WL8A 5A2GA 2VA9A 3ESCA 5HFNA 2WIGA 4ZI5A 3I2KA 1YSCA 4M0FA 1N1MA 5CH3A 3IBTA 2QJWA 1UZAA 1CUXA 5FPQA 3U0VA 5K3AA 3G02A 4B7ZA 5ALLA 1ZJ4A 3BIXA 4XWGA 3S2ZA 1YB7A 1N8SA 3D7RA 1A8UA 1CRLA 4QEKA 2RIPA 5T4EA 3C5WP 4H0CA 1VKHA 3BF8A 5F4ZA 3QPCA 1WM1A 3EQ8A 2RHTA 1UKAA 2IX9A 4H7DA 4N8EA 4G4GA 2GBCA 3OURA 3H2JA 2OGTA 4KAFA 2XUJA 4BZZA 1WB5A 1ORVA 3WIOA 3F96A 4OYLA 1BU8A 1S8OA 1VXOA 3PE6A 3G0DA 4B0OA 3I1IA 4B83A 2OGZA 4X00A 5CURA 3G0IA 1CV2A 1TCAA 3ZI7A 1LPOA 1RWQA 4S0XA 5ALRA 1UK7A 5AH0A 2IIVA 1ETHA 4RE5A 5ALSA 4P9NA 3LIIA 1WPRA 3WK5A 1TKRA 3FYUC 4E15A 2QTBA 4JNCA 4BB0A 2I78A 4X71A 3WMRA 1E8DA 3WWEA 1CUVA 5K3EA 1E89A 5CT8A 4N5IX 1SCQA 5HF5A 4B9AA 4H7FA 3O0DA 4I4CA 1ACLA 1K5PA 2P8SA 3EIOA 1XRNA 4EA6A 2QOEA 1QTRA 4UFNA 4Y2QA 4WFKA 2WFMA 5SYNA 1XZBA 3FSGD 4MYSA 3F9CA 4AN0A 3WWOA 1VE6A 2XUPA 4WDRA 5ALHA 5ALKA 3GUUA 2C0PA 4OB7A 1GKLA 4UHHA 3S8YA 4JEIA 2VSQA 3HABA 4YPVA 4TGLA 5LZ8A 3ICWA 3ILSA 4X91A 5D3KA 2Z3WA 3HZOA 1QIJA 2CKMA 1EVEA 1IMJA 1O6GA 1CUDA 1OILA 4UHCA 5ALVA 1Q0ZA 3ZLUA 5EFZA 2XMQA 3PF9A 5ALEA 3BF7A 4XVCA 2HA0A 1EK1A 5E4YA 1ZJ5A 1AX9A 4BE9A 3STVA 1UWCA 2VT7A 2DFPA 3L1JA 1OCEA 3QYJA 1EA5A 1SC9A 4K5QA 5AI8A 2DHCA 1VE7A 2WM2A 3GBSA 3HI4A 1R50A 3HXKA 1QIIA 2ES4A 1EK2A 2XQKA 2WUGA 3WI7A 2FUKA 4BAGA 4C88A 3PICA 3VISA 1DQYA 4EY4A 4FLMA 2B4KA 5AKLA 4Q1VA 5IVHA 5FKJA 1GT6A 2EDAA 3VXKA 4RE6A 1RYYA 3OM8A 1CLEA 2XMRA 4O08A 3W06A 3JYHA 3VDXA 3C43A 3SK0A 4KAJA 1XZLA 3WK7A 2WQZA 1TCCA 3N2ZB 5FDFA 4D9JA 5AI5A 1NU8A 4ZRDA 4X95A 4WY8A 3AZQA 2XUFA 1CUAA 4J7AA 4W1SA 4AN1A 2BGNA 4QA9A 1GXSA 1AQLA 1OXMA 5FXMA 4DNFA 1CPYA 4KYVA 5IKXA 2XUAA 4Y2PA 1PJAA 2YYSA 2AJLI 5JATA 2XUQA 2PUJA 3G0CA 3DLTA 1UK9A 3QMMA 5K3DA 1WCYA 2CJPA 2DR0A 2VJAA 3H2GA 2HFJA 1GQRA 2HA7A 4F60A 3AUKA 4RPCA 1XZHA 5AOCA 2OCLA 2XE4A 2I3DA 5CXXA 5A7HA 1VOTA 2GYWA 5EHZA 5AOBA 2H9YA 2BFNA 4JUIA 4PO3X 2ZSIA 4UBNA 5LLSA 1LLFA 1NX9A 4QZVA 5HKBA 3H04A 5AKHA 4UHFA 4RGYA 1THTA 2WKWA 1UOOA 5E4TA 5AKYA 3FYTA 1LPNA 1X2BA 5AKJA 1JT2A 3IULA 3GFFA 3E0XA 4AMZA 1DWQA 3FAKA 4EHBA 4HXEB 5ALPA 2GZRA 5KWJA 1CUJA 4DSZA 3ZLVA 2PUHA 4X6XA 1BEEA 4N5HX 1F0NA 2CEKA 5BWCA 4X7BA 3B5EA 3DKKA 4G9GA 3WK4A 2WHQA 1SCIA 2ROQA 2OGSA 5BWBA 2XLBA 1CUCA 3FLEA 3BJRA 5LP1A 4Q3OA 3QH4A 2EDCA 2FX5A 2WU3A 3FYUB 1XQVA 1R9NA 4UFPA 2JGEA 5HCUA 2BAGA 5DTIA 1DT5A 4XJVA 1XZAA 3DKRA 3DYVA 5K3CA 4OB8A 4IH9A 2PPLA 3STTA 2XUIA 3BE8A 2JBWA 3A2MA 5I8PA 2HU8A 4KE9A 2WG1A 4MYDA 4WDQA 4HXGA 4BYMA 1R9MA 4N8DA 5IVKA 4OSEA 3BJMA 2FJPA 1M33A 4V2IA 2CZQA 1VLQA 5JZSA 3TJMA 5YASA 4GECA 1A7UA 1BN6A 1MNQA 1LPPA 1EDDA 3IB3A 1QZ3A 1ZD3A 4E46A 4Y2TA 2WHPB 5I7UA 5FLKA 1BN7A 1MU0A 4UBKA 2XUOA 3GROA 4EB0A 5ALTA 3CN7A 2QXTA 1PV1A 3QPAA 4W9RA 3O9VA 4A5SA 5C8ZA 1BS9A 1RP1A 1VZ3A 5J3JA 5A7GA 4FMPA 4HXFB 3DD5A 4B6GA 4FTWA 4ROTA 4G8DA 4J0CA 3ZLTA 4BDTA 4PSDA 2PX6A 2O7VA 3CCCA 3KSRA 1AURA 4BVLA 1W52X 1D07A 5CT4A 1MX1A 5AKIA 5AKKA 5JD5A 4MQLA 1NU6A 5AO9A 1XROA 4WFIA 1ZD4A 3LLCA 1H2WA 2WUFA 2XMCA 3D0KA 1ODTC 5AI4A 5CBKA 4AX4A 4ARAA 1MN6A 1EVQA 5LZ2A 1UOQA 5HQ3A 3WJ1A 4I19A 4Y2SA 2HRRA 3ESBA 4FDMA 1U8EA 2QM0A 1VA4A 2ZYSA 5HF8A 3KWJA 2ZJFA 4G8BA 2HL6A 5FV4A 5JZ9A 4IHAA 3DEAA 2XQIA 3ED1A 3G0GA 5DNWA 2Q0XA 3M3DA 4H7JA 5AI0A 4UPDA 3H1BA 3QZUA 4OD0A 3WL7A 3DS8A 4W1QA 3D59A 2X5XA 4BC0A 2ZYHA 4LYDA 3V1NA 3HYSA 3FLBA 4FWBA 1MPXA 4ARBA 2VJDA 4TVKA 3QMVA 1XZMA 1GZ7A 2PSFA 3MUOA 2HHAA 4GHWA 4GW3A 2VT6A 1ZOIA 4U2CA 1W75A 2CBGA 3TEJA 2XLCA 4UHBA 2AXEA 3E3AA 3AZOA 2DHEA 5LYYA 1DWOA 4ZV7A 5AM5A 5DWDA 3L1HA 4NZZA 2WLSA 1WHSA 4ETWA 3OPMA 4KACA 1EB8A 3WKAA 5C7YA 2DHDA 2VATA 2OCKA 2JGKA 2ZYRA 3P2MA 1TCBA 1E66A 2QUBA 1A8SA 3LS2A 5JALA 3R3XA 4WFJA 3GELA 2JGMA 4W1PA 3HEAA 5KBYA 2WIDA 5SYMA 3F8SA 5FP0A 4IH1A 5DYYA 3V1MA 4QLAA 4X6YA 1QIKA 1L7QA 5DLPA 4CCYA 3D3NA 2WIKA 2ACKA 1HKHA 2BUAA 1E5TA 3W9BA 4RNCA 4QDOA 5CW2A 4UBOA 4B82A 1QO7A 2PSDA 1R88A 3YASA 4BCBA 3FLAA 3E1GA 1MAAA 4JYPA 4B84A 1YS2X 2QVBA 4PSCA 5IVIA 2HA3A 4J0KA 2WG2A 5T4HA 1T2NA 5JANA 2H7XA 2V97A 2OAGA 3N0TA 4LYEA 1USWA 4B9EA 1X70A 3KXPA 3FOBA 2PM8A 4UHEA 4X94A 5D3ZA 4DNOA 2VQ6A 4U2BA 2ONCA 5AM1A 4MXDA 4IO0A 2RONA 4I3FA 1BCSA 5A71A 6YASA 5LZ4A 1CUEA 4HS9A 2PSHA 3EQ7A 4Y2XA 3D5EA 3HJUA 5CT9A 3M83A 3PUHA 1X2EA 4DTCA 2PU7A 2W22A 4P08A 5JYCA 1QLWA 4FKBA 3T4UA 5HK8A 4BVKA 4Y2RA 4A16A 5AKGA 1CUGA 2XQJA 4J3JA 1XRLA 3VJLA 1EXWA 3H2IA 4X90A 3H17A 2XDWA 2C58A 5JADA 3I28A 1XZGA 2PSJA 4P92A 5DYWA 3IURA 4FNGA 3PUIA 2PSEA 4KRYA 5DYTA 1YS1X 2WJ4A 3DCNA 4J0GA 1DINA 4DIUA 2G5TA 5EI5A 1H2XA 5AM0A 4KAAA 3VKFA 3AIKA 2HA4A 1AZWA 3BWXA 1DWPA 4NMWA 3EF3A 1CUWA 2PL5A 4BP9A 2OXEA 2QR5A 2WG0A 3KWFA 5ALNA 1ODSA 3B3QA 3AILA 4CCWA 2ZJ7A 4PSUA 4FFVA 2R8BA 3D4LA 2Y2VA 4F5ZA 1CUYA 2JF0A 1WOMA 3QITA 5HFAA 1K4YA 4X85A 3GA7A 3IA2A 4BTVA 4OUKX 3WZLA 1DQZA 4J0HA 2AJBA 5ALIA 4P93A 5LKRA 5EHNA 2RGUA 5AM4A 1UXOA 2J3QA 2O2IA 3V9AA 1CR6A 1Q0RA 1QIMA 3LCRA 4AQDA 2QZPA 4LKOA 5ALYA 2PVSA 4E14A 1B41A 4X6UA 3O4JA 1B6GA 4KR0A 3V48A 1L7AA 1XZKA 1GKKA 3OC0A 2ZVDA 1XZCA 2WTMA 1CEXA 4Q05A 4X93A 5AM2A 4LHEA 4G5XA 1C7JA 5EGNA 2O2GA 2VJCA 4XX1A 1U2EA 4Y9SA 1CUFA 4BTLA 3DOHA 1L7RA 3IUMA 3KOOA 2HIHA 1DU4A 3BIWA 1GGVA 5C8XA 2JEYA 4K2AA 5IH7A 5AK6A 2D5LA 5LZ5A 3DYIA 2XUHA 3WKCA 3ICVA 3ZV7A 4EBBA 3NOXA 4CCYB 2D0DA 4LXHA 3WA6A 4K6KA 2QJRA 2GBFA 2JGFA 4J0IA 4QDZA 1P0MA 4BATA 5DNVA 1ACJA 3L1IA 4UBJA 2QS9A 3TRDA 2Z8XA 5DTJA 3R0VA 3FNBA 4W63A 1TQHA 1QO9A 2Y6VA 3STXA 1J1IA 4GI1A 4FFWA 3A6ZA 4WJLA 2QKYA 4JH0A 4DNQA 4EUSA 4QWWA 4ZXFA 3R40A 1LPAB 3IUQA 2XUGA 1FFBA 2GBGA 3G9UA 3FSGA 4F21A 3IDAA 4C87A 3FCXA 4IQ4A 5LZ9A 3WIBA 4HZGA 3PF8A 4FOLA 4CIAA 1IUOA 2BCEA 4FBLA 1FFDA 3G0BA 4OCZA 3I1YA 5ALXA 3STYA 1TAHA 5D7BA 1MAHA 4FLFA 3V1KA 3OTQA 1WB4A 2OCIA 2WU4A 4Q34A 1G66A 2H7CA 2VTVA 3TGLA 4Y2JA 3H18A 5CH8A 2CB9A 4Z49A 1LNSA 3SX4A 3WYNA 3FBWA 1T4MA 5JD6A 2G63A 2XMSA 5A6VA 2I3ZA 1G5FA 3ANSA 4DM7A 5KWIA 1R4ZA 4CIBA 1HL7A 1HLGA 3VJKA 3O4IA 2XQFA 1H23A 4FHZA 1IZ7A 3WL5A 5JZBA 1ZI9A 3NWOA 4C4YA 4DSAA 4DNPA 1XRQA 1QIFA 1C4XA 4J0DA 4XIIA 2WHRA 1ZGBA 4QDUA 1CVLA 5AKZA 1THGA 1YB6A 1F0PA 4J03A 3R3VA 2WIJA 3I2FA 1UKCA 2QMQA 4UHDA 2OPHA 1UT6A 2WFLA 4KE7A 1CUSA 1JMYA 1TK3A 5ALDA 1J07A 1ZI6A 3OOSA 3I2JA 1Z68A 4C01A 1XLWA 5K3FB 4NVRA 1EI9A 3WWCA 5JIBA 3AFIA 3KD2A 2WHPA 2OQVA 3NUZA 1BCRA 1KU6A 5CMLA 1JKMA 4LXGA 4WCVA 3K2IA
chains in the Genus database with same CATH superfamily
2N42A 1MEOA 5JFTA 4LBZA 4V03A 2D62A 1E94E 2JJYA 3TR6A 4CFSA 1YJ5A 4HX5A 4GEGA 5JH7B 4UNNA 2N9UA 4QDTA 4Y1RB 4Y2GA 2P68A 4MS3A 1FXUA 3JVIA 3NJ8A 4OBEA 4TT3D 1FVXA 4FYIA 4LPSA 5AHWA 4B4UA 2Z1MA 5CU7A 1WD7A 4JJKA 4M0MA 2OZVA 3HO6A 1E2PA 4KQXA 3MCUA 4D9FA 1AN0A 3WLJA 3Q40A 3H2HA 4CMJA 4BASA 1M9NA 3I23A 3K4QA 5AOVA 3I2HA 4V1CA 3O38A 4G4SP 1AV6A 1DFIA 2BSAA 4AFNA 2G4VA 3OZBA 4MMXA 2HU7A 1XMIA 5FLYA 2OHFA 2A35A 3OQVA 4PY2A 3JD4A 5FOQA 4KQ6A 3RTGA 1ID8A 3QELB 1B8OA 5DDIP 3NTVA 4TL9A 3FTCA 4QJBA 4EAQA 4AQYB 2R87A 1RHUA 4L3OA 5FUBA 2BRUA 5LJLA 2W6JA 5A3SA 4OLBA 1MT3A 1S3GA 1X7GA 3W5JA 2WEKA 3HCNA 3COVA 2NT4A 4JOSA 2WVHA 1ZICA 1G8KA 1JPVA 2ZYIA 3JASB 4JYMA 4DQUA 1J06A 1WXXA 3EDRA 3A28A 4G86A 5C9ZB 5CRIA 5KTNA 4M1EA 1Y37A 2PBIB 1L8AA 1O8CA 2OBFA 3NXSA 4KLAA 4WMLA 3O47A 3RU2A 1ORDA 1V3UA 3O4HA 3B9RA 5AK5A 1KP2A 4AK9A 2Q62A 3DAGA 1ZIPA 1PFQA 4PHHA 3G9TA 1J8DA 1E7RA 3Q0EA 4BRUA 5BVHB 4O2BB 3Q8KA 4PGMA 2NO9A 5L3VA 1JFSA 1N0UA 1XZFA 1P4RA 5CLGA 3ESAA 2DCMA 2VNAA 4DYDA 5K4AA 4C29A 2RGNA 1I2BA 4D6YA 3D0OA 3JXEA 1Q2XA 2IHYA 3K0KA 4YJKA 3QIAA 1LGYA 3SKXA 5P8WA 1IHPA 3TQQA 4GX2A 2TMDA 2R97A 3EW9A 4H7PA 1KAMA 5TGZA 3GJTA 1HORA 4WLEA 3IIIA 5TS3A 3DYBA 4DMHA 1LRKA 5EERA 4Z1MD 1RM5A 5LXTA 4B32A 4UDOA 1N2HA 1JQJC 4KWEA 1MRZA 2G70A 3H9GA 1YHYA 5EA2A 3SN6A 3SN6B 2CL6X 3WGZA 4UPEA 3I72A 5I9IA 3H8VA 2FVXA 2Q6TA 3VI4B 4BO3A 4YRRA 5DTRA 4TLDA 3OH8A 1CXZA 1J2RA 3RUFA 2R8EA 2XT0A 1P5FA 3UGQA 4ZGWA 4R0VA 5JWOA 4FPXA 4ZYZA 2FRXA 1HGXA 4NMMA 4M0EA 4HAOA 4NU8X 4A8JC 2FV8A 2G0AA 3PEWA 2JHCA 1PGOA 4RHXA 3RS0A 4JQZA 1WUIS 3FR7A 2AJ8A 2QLBA 5EMNA 1M2EA 3OZ7A 1I30A 2HDWA 3QX7A 4I5GA 4UU8A 1Z0UA 5E1DA 3JY6A 3FD8A 4XDYA 2GA8A 1MXFA 5A0FA 2IUUA 3B48A 1SC4A 2ONKA 3GZJA 4TX1A 3C8DA 1NYLA 4YPFA 3UY4A 2DC1A 3R3WA 3DBLA 2XYIA 1REQA 3QI7A 3QV2A 2VHWA 3HJNA 2Q4TA 4N82A 4QUHA 2VRCA 1DKRA 2IVFA 2Q1SA 3VOAA 2E18A 1U8TA 2ID9A 1YS4A 5MF6A 3W8EA 1Q7BA 3F98A 1HYEA 5JBNA 5H9VA 1RMYA 2W8BB 2XDYA 3S7TA 2OC4A 5BV2P 2BI4A 4JHNA 1QH1A 3KZNA 1QDEA 1ZISA 2CDNA 1SZDA 1H6CA 2O0LA 1ZIXA 2OENG 2JAHA 1MMFB 2FQ1A 3H5TA 1WXHA 4WE3A 3U37A 4KHZA 1V8PA 1JLHA 2JFXA 4LJ8A 3VPSA 5J1SB 3DE5X 1E6WA 2R4TA 4FOPA 3OZWA 3OPQA 2JD2A 5D5PA 1SOMA 2ZI9A 1R0WA 1TC1A 1J8MF 3FNQA 2YJGA 3EA0A 1TRHA 4QRIA 4NARA 5E9JA 4E6EA 3JPWA 2N46A 3JW8A 1RQXA 3VU9B 1WUTA 3ZWQA 3P27A 4BMOB 1T36A 4H08A 3PEEA 3WBFA 1N8KA 3ZWLB 2PT5A 3NTRA 4J1TA 4KNVA 3SE0A 3AI7A 3JD0A 4TKUB 4BU1A 3MZLA 1WQ1R 3DLCA 5TB5A 3K0AB 3PS9A 2WPNA 5CCXA 2IYFA 5IC6A 2FA9A 3ABOB 1VJDA 1W5EA 3I37X 3ZDXA 1KO5A 3N05A 4BQFA 4YV2A 1KYTA 1Z26A 4GEKA 1EBBA 4RETA 2OAQ1 2Y1EA 1Q1ZA 2REQB 3UA3A 1D9ZA 4IDPA 3FJOA 5EMKA 3WLTA 4CLHA 3EOZA 5JVDF 1A7JA 1RAIA 1U7OA 2EJBA 4R16A 5GY7A 1Z47A 3C1TA 1D6NA 4L72A 4J86A 4HQNA 1XQYA 5DYGA 1HO3A 1YNSA 4MDYA 4J29A 4WCFB 1HSOA 1H5NA 1AN9A 3IQWA 1YKSA 2CVQA 2OAEA 4JLBA 1B7GO 3AUFA 4JITA 3RVPA 3ZQUA 2GZ1A 3D6TB 1ZR4A 1QTQA 5REQA 1W5SA 3DZIA 4NFYA 4RLQA 4YJ2B 4IIFA 3KT8A 4IZIA 1W0KA 1GG2B 3L8GA 2X41A 4NFSA 3WK9A 2H52A 2CXTA 3OLZA 3ZS8A 2UV8A 1AGRA 4HZUB 2NACA 3QE0A 4F4IA 5FXYA 1EM8B 1WLYA 5KEIA 4B0PA 4L0DA 3NANA 2QMZA 4C5CA 3ZTYA 4ECAA 4QPPA 3T9FA 2BCGY 2N75A 2Y6UA 3ZQ4A 3DDNA 4DSNA 3CNNA 2ZYAA 3K7EA 4NSNA 3ER9A 3GB9A 4W8HA 2QMHA 4GWKA 3W8DA 1DEXA 3STWA 4J16C 5J4HA 3L0YA 4L8FA 2FZ4A 3A1DA 2H3XA 4DV6B 2A33A 4RZQA 4Q4LA 3ZPXA 1TA0A 1QHNA 3RKSA 5A6SB 3D3WB 3IIEA 1U2VC 3ZBUA 1Y7TA 5AW5A 9ATCA 3N2GB 1B0UA 1JSRA 2X0KA 4FT2A 3BBLA 3AVUA 2AGVA 1M34E 2CNOA 3QG5A 4XLLA 4XOUA 3O95A 5EWMB 4CL0A 1OROA 4OJQA 1MOPA 3Q8XB 3MTDA 3NC4A 3W1VA 3T3PA 1SXJA 2LUOA 2R1VB 2R7KA 4FEAA 4IGIA 1I7DA 1KR2A 3VO1A 2BEUA 5JAPA 4Y0AA 4IRZA 3GXBA 2H3EA 2V7QA 3JAMg 4JP2A 4LXIA 5JO9A 1NE7A 1NV8A 3RWOA 1HEIA 1Z4NA 2W11A 2P41A 3GD7A 4YBRA 4JT6C 2JGIA 4KI7A 3WZMA 2BEWB 2RKOA 4BVJA 5IN5A 2DP4E 2VYCA 1NJ2A 4IXTA 1K8YB 1V4VA 2DFKB 2KLBA 1YCHA 4NKRA 4QFBA 4WAUA 4MWTA 4F4FA 2I91A 2DFTA 1MV8A 2W2MA 1TW2A 1NASA 3KQLA 3OM9A 2C92A 3BL5A 5FTWA 3TLXA 1MKYA 4GNKA 2JIQA 2NUPB 3HYTA 2JIZA 2AGLA 2HOQA 1W4LA 3A4IA 3IP5A 5E0OA 1GPKA 4YCJA 4YRDA 2XB4A 4KWCA 2K2QB 4MV8A 5EAPA 3HACA 1JHOA 1A2QA 2DWUA 3QUCA 3PNBA 1ZIYA 4GO1A 3UO8B 1XMPA 5JQGA 1GAWA 3LXUX 5AHXA 1A9TA 1EJ2A 2AKEA 1TTPB 4HUQB 1NW9B 3DF9A 3B7WA 3JTMA 3T3PB 5IARA 4A2PA 1GILA 2O8CA 1E92A 2DSNA 2PKWA 1ZGCA 4QO8A 3RREA 2C8VA 4YK7A 2HJBA 1Z5WA 4NBKA 2H2FA 3PFCA 1CIPA 1KPHA 4TL8A 3ZH9B 1T8PA 1O1YA 2VF7A 2XOXA 1DXQA 1JMVA 2A9OA 3FUUA 2CDCA 4HNAA 1ZNZA 3A4YA 1QFSA 1IHDA 2WUEA 3ZDYA 1Z62A 4K0RA 5JLAA 1WWKA 3HXMA 2BKUA 3BRWA 4FDAA 5LQNA 1OH8A 2WWHA 3IBYA 4OB6A 1GGKA 4PPNA 4J77A 2IK8A 3R74A 4HMPA 2PAAA 4RIFA 3VC1A 1NLFA 2F1KA 4XRGA 4YMHA 5JY1A 1XDDA 1NYTA 4PSVA 3CH7A 1E9VA 4YPOA 4N7RA 3EIQA 5B1HA 3PCXA 4DLKA 5LOVF 3DT8A 1AM4D 1W5BA 2H51A 2I4LA 4Q7JB 4U7HA 4XZ3A 4XUCA 3CZ4A 5KWVA 2FGKA 2NZ8A 2AN5A 3PI6A 1VJRA 1NP7A 2GH1A 3EZYA 4CM4B 5ARDA 3J80g 3LLUA 4D43A 4E12A 3IXMA 4FHDA 4JIMA 1GNSA 3N8IA 2UXCB 2HPAA 1WX1A 3KTAA 4BV8A 3PK0A 4I9NA 1Q57A 2YS7A 2OQIA 4G5QA 1LDNA 4HTAA 4MS1A 4PCUA 3HCBA 2Y2UA 5C2JB 5KWSA 1QU2A 3HTXA 4DVGA 2DUNA 1IXZA 5HZGA 4KFCA 3FVQA 2FR8A 4I79A 2MOKA 2VJBA 3HCDA 4J8GA 1M5UA 5DSTA 4MOWA 1XL1A 4ZI7A 3C3PA 3G5UA 2D0IA 1ATIA 3WLKX 1WVGA 2B3DA 4Q7QA 1J6UA 2ISCA 3G9ZA 1JR3E 4XLTA 4I66A 1N3BA 3TLKA 2ZI4A 3UJ6A 3JAWA 1R3DA 4HTFA 3H19A 3LRTA 3UJHA 4ZAVA 3H5RA 3R9KA 1PT7A 1G6HA 3BRSA 3MN1A 4LF4B 2CE7A 1EWQA 4LXYA 1ZP6A 5I01A 3L7KA 1KJNA 2XCQA 3B38A 3U7FB 1UDBA 2OHIA 1QQ7A 2Z0MA 3HSKA 4DC9A 5LWHA 3DOJA 1QK3A 3A04A 1KJJA 2DPYA 4ZEOA 4YRIA 2YINC 4EYSA 3FCEA 1PJQA 4JBGA 5IT9A 4QVIA 4IIYA 1QE5A 1JKJB 5A5VA 2RBGA 3C6ZA 1BROA 2GM3A 4FDVA 1JSZA 2ZYWX 1KBQA 3QYFA 3PVUB 4O1HA 3TVDA 3X1DA 4CU5A 3U1BA 3P26A 3R8FA 1EBUA 3SXJA 4PAGA 1JFTA 1IQPA 1W76A 1RPJA 3AIMA 3IAXA 2IP1A 5MN4A 3N8DA 1SUAA 2Q50A 4JEUA 1L8LA 1BXGA 5LFAA 4C07A 1QIHA 5FHRA 4UASA 2B5NA 3UMJA 4KREA 1XKTA 2JB9A 3DKVA 2AW5A 5B7PA 2GF0A 2X3UA 2W90A 3DL4A 4HD8A 3K0BA 4Y2YA 3TTTA 1XFAA 3TJZA 2ZB3A 3AEKA 5TXGA 3VSEA 3ULEC 3DH0A 2A4MA 2BGLA 2J4CA 3PB3A 4LPKA 4DAOA 5BV7A 2V7EA 3BH0A 2XF8A 4EGSA 4MJ3A 3Q7EA 1YMQA 2Q8PA 3Q2OA 4HEHA 4DBZA 2VF2A 1IZYA 1QCDA 1E1KA 2GHRA 2ZATA 3RIXA 3KE8A 5C8YB 4ARZA 3T1TA 1GOTA 2PCLA 3PGKA 4C4ZA 1ISFA 1ZMBA 1SUEA 3SM3A 4LRSB 5CCDA 3OLQA 1E9AA 4DDVA 1YR8A 5ALOA 1MJNA 2NVUA 5BW5A 1IDN1 1VPWA 4MO2A 4D42A 3S40A 4Y7DA 3KZMA 1BDMA 1BOOA 4GE3A 4FGZA 4HDCA 4D96A 2EJUA 4BV3A 3DQZA 1E3EA 3BGOS 1V26A 1Y9DA 1E2EA 2UYQA 1JR4A 2WVJA 3ONVA 2WR8A 1G98A 4LZAA 1D6MA 3F49S 3H5OA 5TMBA 4X66B 3WO1A 1QB8A 1FVFA 2XL3A 3ECCA 4YIHA 3WL6A 3K72A 4HNUA 3L4BC 4FYHA 1WZUA 5FLXA 3DTNA 4I5EA 5HTKA 1DP4A 4RFLA 5K03A 3LUDA 4DSTA 1I5RA 1Q92A 2W2TA 2QB5A 3K9HA 1PJLA 1Y5IA 4MWSA 1UF9A 1VE1A 3FYUA 3KL4A 3LBAA 2RFLA 4HGRA 1GP2B 2OLJA 5F23A 2UZ0A 1UT8A 1WB6A 1K8XB 4R40A 3HVHA 4W5TA 5AWFC 4Z4CA 4AUMA 3HU1A 1C3OB 1KPIA 2XSZD 1P4AA 2Q1TA 4FCCA 3C97A 4IDHA 4LMBA 5F51A 5HDBB 2D2XA 3TAXA 1E5VA 1ZN7A 3HR8A 4YRBA 1GTG1 3K9FC 5DNUA 1JHZA 1K9SA 2XB2A 2CY0A 3I6YA 2WJGA 4I50B 5EMJA 5FD8A 5HZHA 2SCUA 3PUZA 1BQ4A 2C5FA 1ZGGA 2HJRA 2R5NA 4YO8A 4Y2UA 3IUJA 5H9WA 2Y1FA 5JAOA 5ALFA 3VDNB 1DKQA 4CT0A 4P22A 1ECCA 2AR0A 1RAFA 2IW1A 3IAS1 4NBNA 4A5OA 3HGTA 3D2BA 4TTVA 1FB5A 4UCWA 3UOAB 3UXMA 1K8RA 3OQHA 4CYMA 5JSZA 1KC1A 3EXFB 2F3UA 2W4QA 4KJXA 3BGVA 4IS3A 2X0FA 3O4RA 2XWQA 3R7AA 2OFFA 1QV7A 4KQ1A 1HTTA 3BZUA 4IVNA 1FU8A 3T3GA 5FRDA 4WY5A 5EZYF 3VNAA 3ST7A 1ZD5A 1GZVA 4UDNA 1N9GA 4PRYA 4V0RA 3AF0A 5JXWA 3U4QA 2V7VA 1GNQA 1WQ4A 1G41A 3MFYA 4BGVA 5DCWA 2PT7A 1U8AA 1QQAA 2ZBPA 4FQ5A 3ZXIA 3JD1A 1M1XA 3TWOA 4M0LA 1N2SA 3UGKA 4CF4A 2IYSA 1L1FA 3U3DA 4B3XA 1SC3A 1HK7A 3EG5A 2YNMD 3AJEA 3DL2A 4YAFA 4MEBA 3THSA 2QAGB 3GNTA 2IUTA 1E3WA 3EYAA 1L4KA 1W8DA 1PT6A 2CYBA 3K0FB 3L7AA 1AMNA 3H4VA 1E63A 1U4OA 4QQRA 1XEXB 4HDSA 4FS3A 1ST2A 3D8HA 4EABA 3NZEA 3CSSA 2J46A 3EQ6A 2J4FA 4FKZA 2DM6A 2V7BA 4I5FA 2FXIA 3QW4B 4Q6BA 4PAWA 4YWHA 5GPBA 5HW0A 2Z6UA 4EG5A 1YQDA 3KT3A 4IG4A 4N5NA 2JCBA 4WESA 3FDIA 1CQIB 4HX9A 4QKQA 2M2IA 3P0FA 4NCAA 4YC7A 1YR2A 1W19A 3RGGA 3IXQA 3MJDA 1LS6A 1GNPA 1R0BA 2EW8A 4IP0A 5BNTA 5K09A 3J81A 2AI1A 3MTEA 2PUEA 2W48A 5HS4A 1N6EA 3OLVA 4I1UA 5CK4A 5IBCA 1Y6QA 3FFAA 3CRQA 4NOKA 1MEEA 2E3JA 3E4DA 5JEDA 1FP1D 5TPWB 2G1KA 2AS0A 1A9SA 3ZHCA 4B81A 5AVZA 2HIMA 3I9JA 3RS3A 5CLLA 4ZV9A 1SU4A 2O2HA 1THMA 2RB5A 1NNI1 3FUVA 3LKDA 4BRZA 4ER6A 2QG9A 2F2TA 2AIRA 4G23A 3VRHA 5C8VA 2WWRA 3VSDA 1OFUA 3DULA 4WECA 2ZSHA 3RVQA 4DCNA 2NZ2A 3CCBA 4KNYA 1Y1RA 1JG3A 4JOCA 1BHO1 2B6HA 3S55A 2HNKA 3A1CA 4KMRA 1GG8A 3NUGA 4CZXA 2JFNA 2OV4A 1RYDA 1ISGA 1T3TA 4GF5A 4HFNA 3COJA 4RJKA 1SD1A 1QF9A 1GZHB 1D2EA 5KTSA 3EGVA 3VH3A 4C4SA 2ISQA 5AVTA 4ECEA 2OCBA 2HBYA 3CIKB 4KWTA 3MS7A 3B7PA 4Z7OB 2WJIA 4DCOA 4BO0A 4BPBA 1TEXA 1Z5NA 2NYVA 4HRXA 4F9TA 3IRVA 2B61A 2Y76A 2OXFA 3EHDA 3GJSA 4FZ3A 1RXWA 2BMDA 3UHJA 4HDNA 2J09A 1XQ6A 3CFSB 5HBRA 4RTNA 2Z8YA 3EGCA 2MCFA 2VDQB 2FZCA 2DRIA 3HUTA 1FLDA 3OIGA 3KCIA 1DTWA 1YR1A 1K7XB 1AK2A 4PX5A 3L0DA 1V16B 2K4MA 4QAQA 2X13A 4DGQA 2XBUA 3VR2D 4HDRA 1KQ3A 1WO8A 1CZLA 5C2VB 3EGWA 1QQ5A 4CMGA 2JFYA 3AL3A 1UL1X 3EZNA 4MKHA 4ID9A 4OQMA 2BJHA 4URFA 3RD5A 3V8EA 4AWBA 3OO0A 1Q1GA 2ZTLA 4NC9A 3FDJA 4D56A 3DE0X 4CR8A 3V9FA 2PTGA 2XITA 4UKDA 2FMKA 4K03A 3SX2A 4ZDWA 1DAOA 2CLHB 2R11A 3IDQA 1T5TA 1F06A 4CL8A 4V1CB 3U56A 2OUIA 3IIKA 3PEUA 3MSCA 3K1ZA 1PR3A 3E9CA 1ZN9A 3AM5A 3MXTA 1G9TA 3ZZNA 4KIFA 2H1HA 3SVLA 3C5HA 2MR6A 3K0CA 4ZMRA 3QHPA 3LH5A 4Z99A 1D8AA 2UZXB 2AF3C 1TZ2A 1Z16A 1U3WA 2OKCA 2W37A 1LSSA 4L8LA 1C1XA 4ZQIA 1OH7A 4KR3A 3DUFB 4Z0PA 2VCHA 4EMUA 4P2BA 1O96A 5ALJA 4XCVA 3Q0TA 5CHEA 221PA 2B6NA 2XMGA 3MJSA 4YBZA 4EJFA 4U02A 2VF4X 4IDEA 3G2NA 4NY1A 4M0UA 4K9RA 3B1VA 2FTKE 2E4UA 3V1LA 4LFAB 1CJUC 2D4HA 2HFKA 4YRCA 5AICA 1ZU4A 3VMMA 4AZ0A 3Q87B 5KOHA 3IUNA 3L0CA 3ZU2A 2EEPA 3PVCA 1JDNA 1DO2A 2AD1A 2PU5A 3EGXA 3QOXA 3JVDA 4KOEC 4BP3A 3ZWNA 4C76A 4H1WA 2EP8A 3AI2A 1LI7A 1UBRS 2MR5A 3NWBA 3ZNQA 4R7TA 5BMVB 3MT8A 1BJRE 1GAXA 1UC4B 1X9GA 2A86A 5ENDA 4MDEA 4DV4B 2Y71A 4B2IA 2ZXFA 3E7FA 5DMXA 3F9RA 4KLRA 3VHQA 2ZKLA 3HN2A 5TY0A 4CQLB 3V3TA 4E5SA 2RJNA 3FF1A 4LK3A 3WBJA 2NSLA 3FMOB 3IBSA 4E32A 4OGGA 3FNIA 5AT1A 3HU3A 5C2WB 3MINB 1UK8A 1V25A 1NULA 2O5RA 2A84A 1YIAA 2ORYA 1C3EA 1ESNA 3BL8A 4FCTA 3VKVA 4IWYA 2XWJI 4ZJPA 2P65A 3NHZA 2JC3A 3OPYA 3QMWA 5DHAA 5E3JA 3P9RA 5EGSA 2BUBA 2GB4A 5BORA 1P1JA 5NULA 2G5CA 5L3SA 3WLIA 2ATXA 4CDGA 2V96A 1YBAA 2Z2KA 1X7XB 1G42A 1W96A 1DI0A 1KDZA 3NVDA 2AR9A 2NO1A 1MAVA 2I2FA 5DRTA 3CHYA 5CG2A 1OXTA 1VA5A 2BBSA 2WSSA 1NXOA 3CT6A 3GN2A 4W9NA 3CW9A 1I2AA 1JIJA 4EF4A 5E9QA 2XZPA 3M1AA 1UWLA 1PJSA 2B34A 3ADBA 4LTDA 4TMXA 1PHPA 4EKYA 4JSRA 5GIOE 3GF4A 4QRJA 3LTEA 5E2IA 5CBPA 4P82A 4D0GA 3EN0A 2H6QA 1CY1A 5JNUA 3S8EA 2PS0A 3MWDA 1DCKA 1UBSB 1EJ6A 1VSQA 4IMRA 1I94B 3WQHA 3VJRA 2BWJA 3F3KA 3SHFA 5H68A 1ZONA 5EJ9A 3DZBA 1N2XA 4RFSA 1KMHA 2DXIA 5LPNA 4QXRA 3VOSA 5J2TF 2XB6A 5IUKC 1TLFA 3H9CA 3IJEA 4TWBA 4DJTA 5LB2A 5KC9A 3DG9A 5EHGA 2HLHA 5IJ7E 3AQIA 2BFCA 1SCBA 3CWZA 1AVTA 4GRDA 4PZYA 4KB5A 2Y93A 5B12A 1GG5A 3UPUA 1RRVA 1US8A 4X8HA 4JT9A 1ZJWA 2AZ4A 4KO2S 3X3HA 1QIGA 2P11A 3KPVA 4H7IA 4UREA 5LA6A 1Z0KA 1CC1S 2EYUA 4QDXA 1E62A 4EELA 2BKAA 4UNIA 2IV7A 5LJIA 4DSOA 5CM2Z 5EIBC 4EQ6B 3NHRA 1FNNA 1YZYA 4XSVA 2VDMB 3RYFA 2WNIA 4RZIA 4RGBA 2ERYA 1UBLS 4H7EA 2D0OB 3GCDA 1FQWA 4M9SA 1WPXA 2SECE 4OHPA 3K8ZA 1NKSA 2H92A 3WOHA 2CB0A 3GRCA 2CNKA 4U2DA 4BVBA 3T3OA 1H9CA 3A6PC 2VK1A 3ZE9A 4GYJA 1T0UA 2WJ3A 3GVIA 1RWMA 1YAJA 5BQOA 2YMPA 3TNFA 3RQSA 5FPPA 4E54B 1Y6RA 3IA7A 4DYHA 5JNVA 1GYPA 1IHYA 2YZNA 1J7JA 4UMFA 3ZXSA 3CZCA 1YO6A 3C3YA 1TM7E 1IUPA 1QKIA 4O3FA 4X92A 3V3KA 2RCNA 2NTJA 4TKUA 3OT1A 1EDOA 2HRBA 2Q3CA 3H1AA 1HQDA 1XRJA 1DGQA 1C7IA 1QMGA 2FMUA 2QU7A 3PPWA 4I8IA 4RH3A 2EEZA 3PIIA 5H5JA 1I3KA 1VSUA 2JZNA 2XAAA 4RK7A 3UZUA 2ZJ6A 3LPAA 4B5LA 4EYEA 5MDHA 3PNVA 3T5TA 5B6IA 3CE9A 2JASA 3BIOA 1JIKA 2R7LA 1ZSYA 5DJ5A 3NT2A 3ILYA 3RT9A 5IDXA 2PBZA 3M33A 3TRFA 1UUFA 1WCV1 1NLMA 1XPRA 1E8MA 3QKIA 4QFMA 1UAAA 1A88A 1J39A 3NVNA 1D2HA 1EIZA 4RTRA 5K8UA 1J7KA 4E31A 1KBZA 1QFZA 4B80A 5LUAA 1TJPB 1DXHA 1PFGA 3IUBA 3NC1C 4H2DA 2GDZA 3PWKA 4IXDA 1UQRA 3A0RB 3SI7A 1XMQB 1VJ1A 2BSXA 3RFHA 4Q1BA 2HCFA 1RHMA 1QAOA 4G67A 4LV5B 1RPZA 3LRXA 2TECE 2WVAA 3KNZA 1NGSA 1ZXBA 3PXBA 3EPJA 1DX4A 2BF4A 2XQGA 3ORSA 4GWLA 4Q7MB 4ZO4A 3ZOZA 4KFSA 5B30A 5D87A 5F1YA 1ABBA 1A50B 3R0JA 1PZMA 4J8BA 2V7QD 4EA9A 3W2IA 2HDNB 3UKOA 3AHHA 2J87A 2V5UA 7YASA 4WBNB 5JI2E 2YOHA 3ACDA 3DOFA 3N2IA 1YS6A 2FR8C 1X9IA 3JTEA 3O2NA 4KXMA 4N6GA 2BPOA 3RV3A 5JSYA 4DPLA 5FAKA 2PUGA 3JZHA 3QA9A 1P0PA 3S44A 5EHXA 1BCRB 2MJLA 2G9RA 2IF2A 4O4IA 3AJAA 4NOLA 3TQSA 1GFSA 2VYVA 3G5MA 3F4LA 2O5VA 2W6CX 5I7WA 2EGUA 4IUCS 4KTVE 1X80A 5LQRA 4W1RA 2VUHB 1FNCA 1PL6A 1JHYA 2GYVA 2VTEA 3U4HA 1NXQA 1WVMA 2YNNA 3PFWO 2WJYA 2P4EA 4NS1A 1NM5A 3RYHA 1EPUA 1SIWA 4ZVOA 4GU5A 4GBGA 3BD7A 3G49A 2QN2A 2X8AA 3WL8A 5A2GA 1KEKA 5K4GA 2BR5A 2F8MA 3E58A 5EP1A 1VC2A 2I7TA 3ESCA 2ZIXA 2HI0A 3LF1A 1PTJA 1APBA 4M83A 4F3KA 1USVA 4JMPA 3FHTA 2MDTA 4WK6A 4ZI5A 4YQEA 2PX5A 3WIEA 2IXDA 4L5CA 4JHPC 2D8AA 1U0FA 3PNQA 1RRKA 1L5KA 1UZAA 4IAOA 1NF2A 5EKUA 2QAGC 3LUFA 2X15A 5FPSA 4BO2A 3VZSA 5FPQA 4PLPA 3ROXA 3HCCA 4RW0A 3GPDG 2O2DA 3D3WA 4Q1EA 4ZZ3A 3E0CA 3WJAA 3G02A 4R7ZA 1JEOA 4P7GA 3BERA 4PG4A 4OUDA 4XWGA 3ZJVA 2E37A 3RF6A 3AG6A 1ENPA 1U1FA 3ZHYA 3DFZA 1SPXA 4GYWA 4MKIA 4PWZA 4MDFA 3SOPA 1KI6A 4DUZB 1EP3B 3KM0A 1MRSA 3AF3A 1X7ZA 3DPSA 1GQ2A 1QYCA 3KLMX 2BBTA 2H0QA 2WUVA 1ENOA 4H0CA 1TEVA 3SJBA 2RK3A 4BKQA 4FFMA 3DHYA 1RLTA 5EVJA 5NLLA 3EQ8A 4DLVA 1GV1A 3IEXA 3U4CA 7REQA 3AERB 3MKSB 4JSVC 1N0IA 2PZAA 4AZ3B 2UYOA 5HILA 2FSPA 4AJKA 4F46A 5IHPA 1UXGA 2ZGVA 3Q10A 4MV1A 3RASA 4GM8A 4ETMA 1KKLA 1UXHA 2IX9A 1JHUA 3K0HA 1G8AA 3A4MA 3GI1A 3QVKA 2GBCA 3WLMA 3FYDA 3OURA 4LE1A 4QECA 2DBVO 1TFRA 2OD2A 4I7EA 3IDZA 4KAFA 1TTQB 4HYQA 4Q4HA 4ZCPA 4BZZA 1GQFA 1ORVA 1QH8B 3L0PA 3ZHQA 2I67A 1YMUA 1S1CA 1NOKA 1SXJC 4BQIA 4O0MA 1Y4SA 3ZU4A 3MRXA 1F7UA 1C41A 5AJUA 3TW4A 5J2TA 1W30A 1S8OA 3SMVA 1VXOA 4G6ZA 2EX4A 1U3VA 4NG5A 4OHWA 4ERNA 2PM9B 1VSTA 2KYRA 2QRJA 2ETXA 1XMJA 3CB2A 1EMDA 2J9GA 3G0DA 3QTLA 4QPCA 3KOUA 3PDJA 3EF0A 2FSHA 2OGZA 2QTWB 3MLAA 1RQ2A 4N9WA 2X0DA 5KOJA 3AR5A 3P8ZA 1I6MA 5J5CA 3DBHB 3DBHA 3RBVA 3PXWD 4OGLA 5ENVA 3SMQA 1GPH1 3ZZTA 3E35A 4QM6A 5AKKA 1PQYA 1PZFA 2NUBA 3HXLA 4BEWA 1F3OA 1RI6A 3RK0A 3SXPA 2H0RA 4EHNA 1GSOA 3IALA 2Q7XA 4WNCA 2FKNA 4NNJA 4DV3B 1XC7A 2C4MA 3IIYA 1R7RA 1Y7PA 1EFTA 2BLLA 2QYTA 2RH9B 3IQGX 3M5CA 4N4AA 4O4JA 5AH0A 5C51B 1GZSA 5JSQA 4EKNB 1BC5A 4ASUA 3TW8A 2B21A 3HXTA 4KITB 4YP5A 3I7KA 1L3IA 4BS9A 1PX2A 1EUQA 1Y5LA 3H7IA 2WSMA 2Q07A 3ID6C 1R0CA 2WJJA 2XCUA 1F9AA 1S8NA 3FYUC 3MTGA 4HCJA 2IU0A 4AECA 4FE7A 1SD2A 5M5RA 1DRWA 2I78A 3G9QA 4H1VA 5F5NA 4RV5A 3VBEA 3T4PA 3S2UA 3FOWA 1JL3A 5K3EA 3IODA 3IPXA 2I55A 1TVKA 2QLJA 1ZXXA 4NX2A 2PTHA 3KR2A 4JT8A 4HAZA 2B83A 4EPWA 4I4CA 4Z4GA 1K5PA 2B4TO 2IGBA 4GBJA 4IDBA 4OY3A 1ISHA 1XRNA 4RM2A 5GAJA 1DIOB 2JI8A 4UFNA 3OC6A 4CLEA 4YY3B 1EXDA 3JYQA 3X43A 1KEVA 2A4KA 2IEDA 3AWDA 3NAQA 3H13A 1R6VA 5G41A 1XZBA 3HB4X 5SYNA 3U9TA 3VTKA 4MYSA 3IE1A 2QN9A 2PUDA 1ZNYA 3NEPX 1DAHA 3A6GA 1T9GR 2E48A 3CT4A 1GUFA 3V7NA 2PQ0A 2VHXA 3MGKA 4IBOA 3Q72A 4RK6A 5JAMA 1NSFA 2IUEA 1BHQ1 1VCHA 2Z6VA 1YQQA 1C50A 1Z0IA 1CS0A 1TUGA 1ONSA 3MFQA 4KX3A 4PPYA 4QTYA 5IWCA 4KXXA 4OB7A 3QX8A 1GKLA 1H9BA 4UHHA 1RLOA 4Y6PA 3S8YA 4KYTA 5KUTA 2XVAA 4FFRA 1U8FO 5IF3A 4CMCA 3C85A 5JO0A 5HUQA 1NIJA 2R8RA 2YZMA 5LZ8A 1XTZA 2GOYA 4GGAA 2PR7A 4RK4A 1KH1A 1XWWA 4EMTA 3ICWA 5LXTB 1A9XB 1AK9A 3ILSA 4OFXA 3E0QA 4G1VA 3BG5A 1J8VA 2W0MA 3CURA 4G1BA 2Q1XA 3FH0A 4CF3A 4UNRA 1DB3A 4X1KA 4WL0A 3UK1A 1EVEA 4YCNA 5BN3A 1IMJA 3NLLA 3H3XA 1R4NB 4S1WA 1O6GA 3HUDA 5GGXA 1MVLA 1LSUA 1JLLA 3ZHOA 1G21E 1OILA 4R98A 3ENNA 2JRLA 2OLKA 3Q1KA 3V33A 5ALVA 3R75A 4R3WA 3KV1A 5EFZA 2XMQA 3IL2A 1LQTA 1JN0A 4JI2B 1EWRA 3PF9A 4KGVA 2VH1A 1DBWA 1RPTA 5D3MB 5ALEA 1R64A 1L5WA 1B42A 4FMCB 5E4YA 3IOCA 1X15A 3RNLA 5I4KA 4TTJA 2CXOA 5CNMA 1AX9A 3F90A 2QTZA 4BE9A 5D51S 3GP5A 3N07A 3QPWA 3TSAA 5I7RA 5KNDH 2ZRCA 3L8ZA 3DHWC 2CFRA 3QEKA 4RENA 3L1JA 4UNPA 1NUHA 1TJ3A 2EF1A 1LXCA 2CCJA 1UZNA 1PDVA 4K5QA 2DHCA 2IUQA 3U7QB 2O8CB 3HP1A 3IEVA 1NJSA 2WM2A 1HG0A 1CE8B 1X74A 2XXBA 3LBYA 4UU7A 1ATZA 3WAJA 1R4MA 1QIIA 2ES4A 3CVOA 3NS7A 4PX2A 4Y6QA 1IWBB 3NHSA 1P2BA 5CNIA 5JSKA 5EZYB 2XRMA 1SEPA 3BIFA 1TADA 4OQPA 3FDFA 4BAGA 4KO3S 4MVJD 5ED4A 3FOEC 1G3MA 1QMPA 4X8MA 2YC2C 3ENKA 1NKTA 1M5RA 1PD0A 1LTQA 4ALMA 5FA5B 2AMFA 2PRSA 2VDWA 3AFOA 1Q0QA 4EY4A 3GLHB 4TYPA 3I34X 4QTXA 2Q3DA 3T7TA 4G9BA 1EA7A 1O0SA 2HDOA 2J41A 2LKDA 2R68A 5GONA 3GC3B 1XTRA 1DC4A 4R9SA 1GFIA 1W2HA 3LLSA 4OBBA 4LRQA 3GUZA 1WETA 4K46A 1IEWA 1NR7A 2HMTA 1R15A 4BLQA 5JV5A 2IPMA 4CTJA 5A3VA 5IVHA 3MB8A 3NH6A 1DELA 4GRIA 5FKJA 4AROA 2WICA 4DJAA 2C5LA 5JPIA 2D5CA 1XU9A 1N6HA 1E2DA 2I0FA 4FMDF 2I2AA 3PX3A 4TV8F 4F6CA 3MAJA 3CISA 3EULA 4BGEA 4WOPA 3PLRA 2GNQA 1HH4A 4UM7A 1KQOA 4RE6A 4RYLA 3RIGA 4IDOA 4KBGA 2YZGA 3NP7A 4RA6A 3OM8A 1CLEA 1L4LA 4C20A 4ZJYA 1X42A 2ZTMA 3TW0A 4DY4A 3DBRA 3JYHA 4D74A 1F48A 5JYBA 4R2HA 1S7CA 2IDKA 1C9EA 2XVZA 4W7IA 5U1PA 3SK0A 1G8HA 1HTWA 2YJTD 4ALKA 4KOAA 4G09A 3SYNA 1RI3A 1VMIA 4Q7KA 4YMLA 5K6TA 2WQZA 1YVPA 2Q9CA 4WJKB 4Y1EA 1YOBA 2FPIB 4D9JA 4WXRA 1SRRA 5KYVA 3RLFA 3O8NA 2D5IA 1GL7A 4HBGA 4M0CA 1NN1A 2WBLC 3H1EA 4WY8A 4ZRDA 5M5BA 4GMKA 2ODPA 2CJWA 4MWBA 4O63O 1GQYA 3TQOA 4NBRA 3U44A 3MJTA 3B1KA 3OQPA 2BGNA 1J9ZA 2HHJA 4K05A 1C1HA 1VMAA 4PONA 1BYUA 4J16A 1QHEA 4EEKA 2IYPA 4Q9KA 5KTKA 1V43A 3UIEA 3BE5A 5BV8A 1CNFA 2WOOA 2R85A 3BWVA 4H5IA 4MI3A 1KFJB 5FXMA 3VU0A 3UEOA 4E2FA 4ERZA 3W5BA 4CEHA 1ULHA 3FPHA 3C1UA 2JHAA 4UD6A 3AMVA 3W34A 2BH9A 4PIPA 3K96A 1Z5ZA 3RVOA 3RAEC 4ZYWA 5U4QA 3EVEA 4Q0MA 1OWPA 5EM2A 4EO4A 2X9GA 4K9SA 2AN4A 4FSHA 1DAIA 4QFCA 1J23A 2XEDA 5H83A 5KNDD 4CZYA 4D6VA 5EHIA 1RTKA 1UK9A 2ZSAA 3AI3A 4WOBA 3UB4A 1QWOA 2BTQB 2ZUWA 3AR6A 4IJMA 3TMYA 1FXWA 4BFZA 3RS8A 3ESRA 2ZB4A 3W1EA 5B4WA 5IBQA 1C9MA 4X7RA 2WIBA 1C9JA 3KOMA 4C7XA 1HDYA 2ZWMA 3W9SA 4BO4A 3UXEA 3ISTA 2W2PA 1GQRA 2EIBA 3AUKA 5ESXA 3LUCA 1U4SA 2GLTA 2XRYA 1XZHA 4D3XA 3B60A 4M8NE 1GDDA 1KEWA 3E5RA 4KMMA 3EI2B 3EI2A 3EUEA 3RDPA 5KQMA 1PLLA 2FN9A 5CR9A 1NBIA 4GUDA 3JALA 4WK0B 4R83A 5ITSA 3TSYA 5JZMA 3BJIC 1B74A 4ZQGA 3I8SA 4ME6A 3KSUA 4OHKA 8ATCA 4R1MA 3HBJA 5DTQA 1G8GA 4LRXA 2CHGA 5AOBA 3UN1A 1YDGA 2BFNA 1U6JA 2MYNA 3RJZA 2XYPA 4C43A 4E2WA 4E2YA 1T8WA 4FW9A 3QBEA 5DHPA 4J1TC 2H1OA 1RWXA 2ZSIA 3OF2A 4M1OA 3R9IA 4HWRA 2LE0A 4B8YA 1NX9A 4RDHA 4N40A 5IT9g 1KQGA 1PJ8A 3H04A 3T8YA 2DWCA 3PTLA 4IQGA 1CYEA 1SKAA 2Q4DA 3EJ6A 1LW6E 1DNPA 1GCOA 2WKWA 3ASYA 1UOOA 4RGYA 4LZZA 4ZZIA 3FYTA 1VG1A 1T35A 4HHEA 3OAAD 3ADKA 3R0QA 3L7YA 1YTUA 3PXUA 1I3MA 2HSEA 3GLIA 5AKJA 2QTHA 4JUFA 4KDRA 4XVUA 3GEHA 4O29A 4OAPA 2REXB 4KR6A 2O5CA 5ADWA 1O96B 2IYEA 3KYDB 3AETB 3E0XA 3JROA 3L93A 4L85A 3B78A 4XD2A 4DNXA 4WEQA 1H6BA 4BNLA 2VJKA 1FFGA 4RQBA 1JEYA 4FGLA 3PYLA 4PFSA 1UINA 4AJOA 4NECA 1ZDMA 4L4UA 4EUHA 2Y0DA 3F3YA 1WZ2A 5KWJA 1ZAYA 2QTCA 1YFZA 3AONB 4YRKA 1CVRA 1WA5A 1FTNA 4MKZA 4BUZA 3OEHD 2W4IA 3ZLVA 2R00C 1TT5B 1Z0ZA 2PUHA 4MGIR 3Q5GA 2BHTA 3JV7A 4X6XA 2RHRA 2DTDA 4KMOA 3ZHVA 1T6YA 3IX7A 1K08A 4G9GA 3DEJA 3UJNA 3KKKA 3V34A 4DWJA 4NK5A 1M8GA 1QO0D 1YQTA 1Z6GA 1XDSA 4MR8A 3GPIA 2QNIA 2W6IA 4HYYA 1WMBA 4KPUA 2JCGA 3PPXA 4WGGA 4X3PA 3H1PA 2WU1A 1WSAA 4O4LA 2ZE5A 2R66A 1AV7A 4YLGA 4UAJA 3HKBA 1MO4A 1BE8A 1PJZA 5EEGA 3UKUC 3X1WA 2J1LA 1CUCA 1FTWA 5IBRA 3FLEA 5H82A 2AH1A 3WYCA 4KQIA 5BYAA 4WLOA 2IS2A 4M8LA 1VGVA 4MVJG 2Q5OA 2C9OA 2C7GA 2PV7A 2QEQA 5AVVA 5FWXB 2JH3A 4MITA 5GTDA 5M04A 1S9HA 1W9MA 3TN7A 3X2EA 3B1WA 1OX6A 1R9NA 4UE2A 4I55A 2O0KA 3HCEA 2UVDA 4EWLA 1QCYA 3NJRA 3LYLA 1HNZB 1DT5A 1NXSA 2TMGA 3TVYA 1H1LA 4KH0A 3NRCA 4F6LA 1TUEA 1X86B 1N0WA 5LSAA 4WBXC 1AKEA 3F8TA 3IH5A 4OA5A 5B2ZA 4MB6A 3M6IA 4AN4A 2BF7A 1KFCB 2FQXA 2FW7A 2JAOA 1H5QA 1KY4A 2ID7A 2PUWA 4G01B 4IH9A 3VHLB 3AOEC 4R05A 1AGPA 2Q5CA 3UBTA 1M2NA 3WGTA 4G07A 3GFBA 1VL0A 1QB7A 3WISA 4ZCTA 4MUMA 3JARA 3UFXA 1TM2A 2IZOA 4JVSB 2C42A 3RJ9A 4EFDA 3EVDA 4DMUB 3B2NA 1Q44A 1V39A 4LNAA 3REGA 1PVDA 2IWHA 4GC5A 3WAKA 3O2JA 5I8PA 3I5YA 2H9IA 2HU8A 1KOJA 3GMDA 4UZSA 4LHVA 1G3RA 1PN3A 1ZH6A 4KE9A 1V5GA 2YVLA 2X2OA 1PSDA 2P91A 3OT5A 1TNDA 2C3MA 4HXGA 4WDQA 2GHTA 4L27A 4N8DA 1X1QA 2OORC 4URXR 3UV7A 2RH8A 3TKYA 1M1YE 2VCYA 4BFXA 2NU6A 2Q2WA 3NDPA 4EFLA 3TPZA 3W5IA 2P7HA 2O0HA 3P9QA 5YASA 3UGTA 4LYAA 1FQKA 2GXSA 3U4IA 3IMEA 4Z4IA 2FDRA 3IBCA 2HX1A 1A7UA 1M0TA 1RQGA 1TQ2A 4E2XA 4KSYA 4L5AA 4M0DA 4AL4A 2N1BA 4LYJA 2R1TB 3TDNA 3V6LA 1I4TD 5LR6A 4QO7A 2WB2A 1RZRA 1ZUIA 1QS0A 3LPMA 4K9QA 5K05A 3FKSD 3NV9A 4DN6A 3ESQA 1SBTA 3F4KA 3IJCA 1BN7A 1GQOA 1TCUA 1U11A 2YBDA 4FYKA 4OQNA 1JRLA 2BI7A 4Q1AA 2PV0A 2NTNA 1JJUB 1I01A 3MMNA 4R8RA 5TEVA 3V4VB 2TMYA 4F3RA 4ESVA 1J2UA 1NSYA 3GROA 4N7JA 5ALTA 2QXTA 3ZU5A 4LGMA 5DN6A 5A4KA 4ZOZA 1RACA 4XGKA 1VLVA 5B37A 4IQ0A 4CM6A 1V1JA 1GJRA 4MKXA 3GGGA 2WZBA 2B2CA 4I36A 4W9RA 2LTAA 3QV1A 1JVBA 2JFWA 2Y1WA 4PWYA 4H6WA 4Q3AA 4A5SA 3ILHA 2AUMA 2JLCA 5C7OO 3PA8A 1RP1A 2NLOA 4XVRA 3SGLA 2WSBA 3AHJA 4JGGA 2WMDA 4R8VA 1PWHA 3C3AA 3IIWA 5CP8A 4CIYA 2C7RA 4XDGA 3E61A 3L1KA 3DD5A 4B6GA 3VH2A 1HDIA 3T4UA 2QW0X 5B1IA 1X3SA 5I9BA 1T5LA 4WN3A 1B3BA 1NJ8A 2YDXA 2VDLA 4B4DA 4PSDA 4BFWA 3T5DA 4C30A 2GEFA 2AGWA 2FPXA 4GE0A 1I80A 1LJ8A 4LDZA 4JB8A 5EY5B 3TL6A 3V2GA 4BVLA 4RSGA 3Q3EA 3RODA 3V6MA 1UKZA 4CT4B 2W71A 5DXFA 1W73A 4O4IF 4FINA 1NU6A 4KFUA 4DMRA 2DPGA 3IPYA 1G8FA 3QW2A 4HSGA 4HPXB 3THWB 1L4MA 3RB8A 3QVJA 3FMVA 5L3QB 1FRZA 1P1BA 4N54A 2FSIA 3U80A 2PH7A 5IUNC 1NEXB 3KJXA 3SHQA 4RFVA 4ZZ2A 3TUJC 2QP9X 1NVEA 5LNK6 4Z51A 3CC8A 3DXYA 3EXFA 5IM5A 2HCTA 2WUFA 4JOQA 1JDVA 4WLVA 3LRPA 1BO6A 2GR9A 3NC0C 4L4XA 4U6NA 5AI4A 2Z83A 5CBKA 1YRLA 4UTOA 4L8WB 3DVAB 3VYTB 5JXIA 1EVQA 2J59A 4PZCA 2QX6A 1SJ9A 3KOWA 3VBCA 5BPFA 3HB7A 5CD9A 5LZ2A 2Y8EA 2GM4A 3A6HA 2IUSA 4I19A 4YCMA 3TTXA 1PJ4A 1FUIA 2GCEA 2HK6A 3HSYA 3NUQA 4L5IA 3PEYA 4MIYA 1NRWA 2DPMA 3EB9A 3UWMA 1IXKA 2HRRA 3ESBA 1ZUNA 3MCTA 5H3CA 2QI9F 2Y0BA 1DFHA 1Z8DA 2BEUB 4WZZA 1WNTA 4P7BA 1S4UX 1BXRB 2ANBA 4XFDA 1U8EA 2BZ0A 3L4OD 1VA4A 2P9FA 2P9EA 2ZIGA 1MIOA 3EEYA 3KJFA 4IFBA 2ZIXB 4MJXA 5HF8A 5THXA 4BMPB 2A67A 3QXSA 3GZNB 2BGJA 2OGWA 3SQNA 5EJ4A 3OY7A 3ZD7A 2X7JA 3SIXA 3O8OB 1N1EA 2HESX 1ZZEA 2HF9A 5ESDA 1ZVQA 2QAGA 4M60A 4W6QA 3RNOA 4YT8A 5JZ9A 1JIUA 1N2ZA 2E5WA 2G1JA 4I3HA 4BFUA 3DEAA 3NJ4A 3PX2A 4II2A 4B3IA 4UOZA 1OI2A 3CG4A 2NN3C 2ZREA 1J1UA 2DLDA 1Q21A 4F92B 3CA8A 3LWDA 1J2TA 1HYQA 3TAUA 5AI0A 4UPDA 4YHBA 1CG6A 4TUYA 3ETGA 3NBKA 3HFQA 1HQYE 2DKNA 4IRXA 3QZUA 3RE1A 5GZ1A 4XH9B 4JL6A 1TQDA 3D59A 4HVAA 4TMYA 5GZ3A 3GMIA 2X5XA 3A25A 3DZCA 4HRAA 3WYEA 4BC0A 5CBPB 2J9RA 2Z58A 3GREA 1GR0A 1GTMA 3BJEA 1TBGA 4M53A 2IHNA 1R0KA 2X2PA 1VLZA 5KNCD 3A58B 1KVUA 3OJXA 3ITKA 4JK3A 4OG2A 4QTTB 1CDZA 3KVNA 3N59A 2C7PA 5JC1A 3HYSA 2DETA 3FLBA 4RFSB 1NDHA 1MPXA 3DCIA 1UP7A 2QA5A 4EFKA 2PGLA 4G5OA 5DT9A 5A3QA 1UJ2A 3PJFA 3TQTA 2GAJA 2M6KA 3LA8A 3DFIA 4E4TA 3QMVA 5ADVA 4X60B 5GZ6A 4BWGA 2AG6A 1PAUA 5F98A 2HXYA 2CVFA 1U2PA 4MW1A 2LR0A 4X44A 1OFTA 1KYQA 4N1AA 3ESYA 1Z6PA 5KQPA 2P9ZA 2YOFA 4BNKA 1NVDA 4XQ0A 3TQFA 1ZWLA 1FP6A 4C1NA 2JIZD 1OLUB 4IOJA 1JR3D 1WABA 2FPLA 2PD4A 3C7DB 2X77A 3TL2A 1TD9A 2DKOA 2XLCA 2VZ9A 1F2DA 1LJLA 1W5TA 3HJAA 5G0SA 4QAJA 4DPMA 4RACA 4UHBA 4ZOVA 4JX8A 4CM3A 4TZ4A 2EKQA 4OKIA 2DHEA 1QG6A 3K5WA 4P8RA 3RRBA 3T9AA 1M6NA 4JS0A 3GC6A 3BTOA 5DHUA 4WNAA 2DLNA 5CA0A 2WJVA 1JYFA 3FFXA 2I7CA 3M1YA 5CJ2A 2GZMA 3SBQA 4IUYA 4ETWA 1N3LA 1A95A 3RUIA 3A10A 4K8OA 3DE4X 4KACA 2L69A 2OFOA 5HE8A 2QN1A 1WRBA 3L0ZA 1JEAA 3VR6A 4LK2A 3HWRA 3WKAA 1GPDG 5FWNA 5C7YA 3E9RA 3JZDA 1NRXA 1U8XX 2CSUA 4Q1FA 2BP7B 2BP7A 2OCKA 3KQQA 1RZVA 2VBGA 1RRMA 1M3SA 4U7PB 1KSFX 1TU0A 3LKBA 1RP7A 4W9MC 1Y33E 4NOJA 2ZBRA 5EJ8A 1AK1A 4B09A 1ISIA 1E66A 1A8SA 1JWAB 3LS2A 5CNKA 4F9GA 1QYRA 3GELA 1K32A 2H14A 4E5MA 1J0EA 1MG0A 1S2IA 3PC3A 1QVZA 1Z2AA 2O2XA 2A0UA 3F8SA 4PTZA 4B6RA 1X1BA 3KYIB 4O4JF 5DYYA 1K6XA 2X5KO 1FU4A 3KIPA 1CF4A 1T5IA 2Y9PB 4PHCA 3CYFA 1L7QA 2FPSA 5ER6A 1SUSA 4DCCA 1FUUA 3HKEB 1LNZA 3HKEA 1VG0B 3HP4A 2RGXA 1ZD9A 4IVPA 3SZMA 3D3NA 1F38A 2D13A 5JG7A 2ECKA 1FYXA 2PX8A 5C8YF 2BBKH 3AEQB 4HRVA 2D1QA 3JQ6A 2QSUA 4K3ID 1BX1A 3T95A 3K4HA 2G7MC 1KBOA 4TLMB 3PDHA 1LWNA 2XA2A 4RNCA 5CW2A 5LP6C 1SGWA 2GAIA 3MW8A 2OJYA 4OA8A 3KSDO 4Q4JA 1RDFA 1H8HD 3BH7A 2CZCA 2Y4OA 3W5VA 1Z4QA 5CX1B 3GGCA 3WADA 1QVVA 3S8MA 1Y8RB 5HIKA 2P7IA 3TSCA 2PSDA 1S2MA 2CHUA 1JR2A 1R88A 2BMEA 3MJEA 3OF3A 4BCBA 3VAAA 3C4VA 3OJCA 5JS6A 2ZFUA 2ZYUX 4JYPA 3ZJ4A 4BMCA 1YS2X 1O9BA 1PQPA 1C9LA 2QIPA 4HG2A 3RC9A 5JMOA 1AGNA 3F71A 2AMLA 3GUVA 3VSCA 4J76A 4FC6A 3PWZA 1U0TA 1HMYA 4ND8B 4NPHA 1GU1A 1IG3A 3ZWKA 4KVAA 4IIBA 3N0TA 1G8SA 2CK3D 2BJWA 2RGWA 4DMMA 5ELXA 3KKNA 1RJGA 1USWA 5KVSA 4L4YA 4KQEA 1Y6FA 5DM4A 3RC8A 2B5WA 1E1RD 1T2AA 1E5XA 1EXMA 5F5LA 2G3YA 3U48A 2X4IA 1FJGB 3TGPA 1U2TA 3I5UA 1OI3A 2EKZA 1JEQB 3IHLA 3EODA 4M88A 5I9NA 1KGSA 4QGFA 1GZDA 3TIFA 1NA5A 5C46F 3KVRA 3GBVA 4MTLA 4MARA 5TQJA 4C3ZA 2XCIA 3BICA 3BWEA 4U39A 4OHZA 1KJ8A 4MVJA 3OE7D 1PL7A 3PFNA 3PRJA 4I3FA 4JI3B 4LBVA 5HWSA 3TBHA 5A71A 1DRJA 1R6AA 5E7IA 4ZOAA 1BWRA 2YJ5A 4J4HA 6YASA 2QPOA 1ULZA 1RCFA 2PSHA 4V0MA 4CQMB 4OUDB 4A6DA 3EQ7A 4PN7A 1NBWB 4H6XA 4B7XA 1JYEA 4B8WA 1IM2A 1NW3A 2I6TA 4P31A 2PM7B 2WC1A 2CN3A 1SXJB 4ABYA 2XYGA 2YN4A 3GJ8A 2GFHA 4MIKA 3MXOA 5IFLA 2HHCA 1NFRA 1SC6A 1RXYA 2RGEA 1MJFA 2ZR7A 3EDYA 3L4EA 3FW1A 4OATA 3ZY2A 3RN1D 1X2EA 5IKMA 4QYIA 3ZE1A 2E6KA 5F9MA 2V0GA 3WNBA 4KH1A 1WZCA 2NUAB 3EGOA 1ZITA 2A0FA 4UE6A 3SVTA 1O0CA 5F3WB 1PCXA 4HATA 4TUYF 1IE3A 2P9CA 2W22A 1Q1EA 4C05A 4P08A 2WQ8A 1LF0A 1CULC 1QLWA 2CF5A 2Z4TA 2QMOA 4WD3A 1PE0A 3SPXA 4DUGA 5D3MA 3JVUA 4RDIA 2GKGA 4RV4A 1CUGA 3BXGA 2ATEA 5MN6A 2I22A 1PGJA 1IQ0A 3H17A 3OA2A 4DG8A 3L7BA 4XD7A 4NCNA 4J94A 4ZVNA 3C7TA 3I5XA 2YWBA 2AFIA 3LFUA 3PR2B 4P2GA 2VDRB 1FMLA 5CFRA 3LVFO 5HIIA 1ULUA 2WQ6A 4ZO9A 4A6EA 3GPBA 1NF9A 1E5QA 1Z75A 1ADBA 3ASVA 4H6PA 5DYNA 1N2CA 4ZU6X 5DYTA 1X6VA 4O02A 2GVNA 2X40A 3JQFA 5DE3A 2CLLB 3DCNA 2VEDA 1ZM7A 2A94A 2EFEB 3SQXA 3EVCA 4NZMA 4DIUA 2DFNA 4HAYA 4PN3A 1ZGZA 1Q7GA 5JU6A 1H4VB 2ZI6A 2B8NA 2DOKA 1JHXA 2ZSUA 4KAAA 3VKFA 3I61A 2HA4A 4QHYA 4CW7A 2Q2QA 2WD7B 3BWXA 2DR2A 4ZEMA 3HUEA 4BNHA 4EHFA 1CUWA 2VG8A 3L4BA 1Y9EA 5DGIA 1LD3A 1Z0AA 4HPJB 1FU7A 1AS0A 1LDMA 2ZSBA 1SAYA 1O2DA 1XCGB 3O31A 4QBTA 2EW2A 3IV6A 4EO7A 4NNOA 1SRQA 4OSPA 2QIOA 4RKQA 2WWVD 4TZ0A 5A06A 4CCWA 4BKMA 5C86A 4MHOA 1KKMA 2FUEA 3ZYCA 5GQSA 4FFVA 1VP3A 1ZD1A 4UVEA 1P91A 3AXSA 3D4LA 1VQ1A 3KKPA 3TI9A 2XCTB 2UYHA 1EFDN 4PPGA 2WV9A 4URHA 4P3NA 8LDHA 5FYDA 3PYMA 4B7CA 2AN1A 2Q6IA 3G6WA 2FUNB 2WJHA 1X7DA 3JQPA 1CUYA 1NF8A 3QELA 4LQDA 1WBBA 4XEHA 3GGSA 4ZTZB 2W6QA 1MO6A 2YHIB 4X64B 4B3SB 3JZNA 4DJJA 4ZRNA 4BQRA 1CF2O 2ZJZA 4IVRA 4XW2A 2OMKA 3H2YA 5TQVA 2EP7A 4C5BA 4O1QD 3N2KA 4DA6A 5LQUA 3EZ9A 4P80A 4JQOA 3SCYA 1H65A 4A2MA 1NPYA 5HE2B 1Z25A 4L0MA 4ZP1A 2FWNA 2YICA 3E7PA 1LK0A 3SFVA 4C78A 2PMBA 2AQHA 3G1UA 3WZLA 4OX9Y 1Q77A 1U3FA 1W85B 3DT6A 1TVCA 3HFSA 2AJBA 3JATB 3KLNA 3M1LA 1OGJA 3UTCA 2XGJA 1QH9A 3DTVA 5KJ1A 3ZNNA 4O1IA 2KQUA 1PEYA 1NLZA 4UJ5A 1SQ0A 1P1CA 4M9UA 4MGYR 1A12A 2ZYGA 3CUWA 2FPPA 5FO0A 4TMZA 3OUUA 5G40A 1PBNA 5AW9A 4QUKA 4ND4A 4UTRA 5LQDA 4JSNC 1Z17A 1KK0A 5TPWA 1B41A 5HIAA 4F2PA 3O4JA 1FXWF 4MUHA 4LNHA 2VBCA 4K2HA 2XH8A 4UM9A 5AXAA 4E21A 2UU9B 1A8HA 1HE1C 2IZ5A 2MSKA 2O23A 3DE6X 3VQTA 5KYKA 1WUHS 2FWBA 3UPDA 3R7WA 4XJSA 3VFDA 1CEXA 1QNFA 2VAWA 3BMOA 4Q05A 1Z39A 3N74A 3H99A 4G1MB 4YXFA 3JQ8A 1DBPA 1AUQA 3K72B 4R9RA 3IAM6 5EGNA 5EINA 3SZOA 3UV3A 4BO9A 3GGDA 3BGIA 3HY6A 4DRYA 5K8TA 5SXMA 4R7AB 2C77A 3UYLA 2X5OA 4N3BA 2F48A 5EXDA 4CI1A 4AS3A 1H3EA 5F9FA 1MFPA 3AY0A 3WS7A 1IOVA 4B6QA 5AMXA 3IUMA 2HIHA 1J9GA 2ZP1A 1T5DX 4WX2B 2CO0A 4EX6A 3UJCA 3JQAD 4CZVA 3SU8A 2H4WA 1P39A 4GICA 2P1DA 4LXTA 4J87A 2JEYA 5C8XA 1DVRA 5KNBH 5IHXA 3GV0A 1GKUB 5IH7A 3PVZA 4YCAA 4NI5A 2H1LA 2RK4A 2EIXA 1AS2A 2GI4A 5IM4A 3KO8A 1Q3KA 4LVOA 1QM5A 2O8BA 4BXOA 3DYIA 4D4IA 1HWYA 4RGQA 1JBKA 4Z53A 4OK6A 4O6VA 3DLBA 3LT0A 4LSZA 3NEAA 2GNAA 3IQZA 3LL4A 2QBYB 4F4CA 3SR4A 3UH1A 4KFMB 4XQ9A 3PRYA 1OAAA 4QL1A 4D9KA 5JBIA 1N1GA 4JLWA 2Z6AA 4EBBA 1JLMA 3LT2A 4IGFA 3CINA 3QUTA 3HFJA 2FE1A 5CB0A 4KPGA 2BFFB 2XA1A 4F8EA 3WIDA 3WA6A 2WF5A 4U6QA 4K6KA 5F3DA 3RU3A 4MZDA 4JV5B 3KBOA 1MJGM 3GLKA 4FCVA 5IX8A 1BJKA 1IHOA 2JGFA 4MS1B 4GQIA 3DZ8A 4CLXA 1ULSA 1KAHA 4OP3A 3TK1A 3CPHA 1P0MA 3UJDA 4C7VA 1H42A 1XV5A 3DXMC 4RSMA 4HWKA 4XPIA 4INPA 1TIKA 4HQFA 2F1JA 4Z4EA 2IOFA 3FOAA 1UJMA 3L1IA 5KOHB 5COBA 2AR7A 2QS9A 3CF4A 3LD9A 1GSHA 3QKSA 4KDEA 3TRDA 1YR6A 2Z8XA 3O8CA 3RRMA 2DE0X 1A9YA 1F4PA 3DMDA 1L4UA 4O4LF 2QE7A 3ZI4A 1I10A 2FRVA 1MV5A 3ZU6A 4BV9A 1TF5A 4QD3A 3USCS 1L5MA 2ARKA 4RTKA 3GRFA 1VSBA 1PVOA 4H16A 1U0NA 1XN1A 3STXA 3SHVA 4AULA 1SELA 3GRKA 3L7OA 2QQFA 1E6KA 1WV1A 2D2FA 4L3HD 1J0BA 2C95A 4CR7A 4CIXA 4WJLA 2QKYA 4JH0A 1PGQA 1RM3A 4QQEA 2GPWA 2P4HX 3E84A 5DN6D 3AQ4A 3G88A 1WMEA 3Q0IA 1E2NA 1CQJB 1OBFO 3KB8A 4AQ7A 5I3CA 2C03A 3IUQA 3QTBA 1F1JA 1HZZA 2RBKA 2RHMA 5HVNA 1M0WA 1BIFA 1PKEA 1U8YA 1AE1A 2GBGA 2ZIFA 4RMHA 4LCJA 1HTBA 4TMFA 3OCYA 5DCUA 2RKBA 3ZDBA 2K6GA 3W7VA 1BH6A 1TKBA 3I05A 3IDAA 4LJ9A 4C87A 4DUGD 2QL6A 3D3QA 4NU5A 2HNBA 5BPHA 5JWZA 5IBPA 3WIBA 3EUWA 2IRWA 2DPXA 1E99A 4HZGA 5JXGA 4FOLA 4UUBA 1V7ZA 2WYUA 3QVXA 1HA3A 4Q4DA 4CDRA 4JLSA 1J5XA 1KFBB 3G0BA 4IHKA 2H07A 2Q9BA 2EATA 4F72A 4UTPA 2X22A 2PQMA 1EBFA 3I1YA 2V4MA 1YZTA 1N3YA 1T9AA 3E2IA 4MRMB 4V0LA 5KU1A 1RM0A 3R0IA 4BB5A 3UCEA 4DIFA 5LMUB 5IJZA 3P52A 1Y8CA 1N92A 4IICA 5FKSA 2J9FA 3T7DA 3OJWA 2JIPA 1HFEL 2BFMA 2I4TA 2VT2A 3C14C 4MSUA 3VHRA 4AF6A 2LXNA 5E6RA 5EIFA 2XOKD 1HM5A