3IUNA

Appep_d622n opened state
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
682
structure length
672
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETNPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
total genus 207
structure length 672
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iunA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iunA01
2O2IA 3H2IA 1TCCA 4LYEA 1ISPA 5ALVA 1SCKA 4FOLA 1XZHA 3G0IA 5AI8A 2WIJA 5LZ5A 4EUSA 3W2TA 5JANA 2GZRA 2Z3ZA 2AJ8A 3H2GA 5EFZA 1VA5A 2V9ZA 4OB7A 2CJPA 3L1IA 3ZI7A 5HF6A 1ZI8A 4WFIA 4UUQA 4FWBA 4FBLA 3KD2A 4YK7A 3X3HA 3ZLUA 1O6FA 1MPXA 5IVKA 4UBOA 4W1SA 2ECFA 1PV1A 2AJCA 1WPXA 3DLTA 4Q3KA 4BVJA 3WQHA 1J1IA 4GI1A 3M82A 4Y7DA 1R88A 3RARA 2XUDA 1H2WA 1WM1A 2B20A 3I6ZA 1QZ3A 4KYVA 2W22A 3GELA 2ZYRA 1OCEA 1GKKA 5AKLA 3M83A 1CUAA 1CLEA 3E0XA 3ESBA 1TQHA 4Z49A 4RNCA 2WFLB 4U2FA 4BATA 3H18A 3CCCA 3OM8A 1P0IA 5ALOA 3VJKA 1MJ5A 5IH7A 5JAPA 2HA0A 2XMRA 1FJ2A 1ZD3A 4Y2TA 4J3JA 4QWMA 3Q8WA 4QNNA 1Y37A 4OUKX 1VOTA 4OU4A 2WILA 4ZV9A 2DSNA 3AZQA 4MJ3A 5H3HA 4EHBA 5AH0A 4KR0A 1E89A 3R3XA 1CV2A 2JF0A 1MN6A 4H7EA 3WK8A 3G9UA 2XMDA 4N8SA 5E4TA 4M0EA 1XRMA 4UBNA 2HRRA 1UOQA 5JZ9A 4F5ZA 1QTRA 5CH3A 2PSDA 3I2HA 1F6WA 1WHTA 4WY5A 3H2JA 1DT3A 1YASA 5EHXA 2OQIA 4G4IA 5IVIA 1USWA 5LZ2A 4NZZA 2H7CA 4BYMA 3O9VA 3QPDA 1P0QA 3AFIA 2JGLA 1SOMA 4JYMA 1C7JA 5AI5A 5EHNA 1P0MA 3HI4A 4FHZA 5ALMA 5ALWA 5CXUA 2PUHA 3O95A 5HFAA 2B9VA 2G63A 2DHCA 3GUUA 5CT6A 1R50A 2HM7A 4UHDA 2Y2UA 5CRIA 1G66A 4CIBA 2HU5A 4KE7A 1T2NA 1Q0RA 3R0VA 2WHRA 4AN0A 1BE0A 4K6GA 3QZUA 5AK6A 4Q82A 2WTMA 4RPCA 3IBTA 3V9AA 1HKHA 1JJFA 1GQSA 5CXXA 2O7VA 2RGUA 2QMQA 5T4EA 5AM5A 1E5TA 1QIKA 4Y2PA 5AKYA 2I03A 5FOQA 2G5TA 2ORYA 1QIDA 3HRHA 2GBCA 4QDOA 4O08A 3AINA 5LZ4A 3OTQA 3CCBA 5AK5A 5EGNA 2P8SA 1VXRA 5AM0A 5FPQA 4ARAA 3HJUA 5FP0A 2XUGA 1XZLA 4A16A 2VJBA 4QZVA 4AX4A 2HIHA 1GZ7A 1CUCA 1XRNA 2WFMA 3IUNA 4ETWA 4DNOA 2WIFA 3FYUA 5AKZA 3WJ1A 1ORWA 3C45A 4A5SA 4S0XA 1IMJA 1YA4A 5ALGA 4DMKA 2O2HA 1THTA 1CIJA 4J03A 1JU3A 3O9MA 3G0BA 4G8DA 2WM2A 1LLFA 3NUZA 2LIPA 2WQZA 5ALLA 5C8VA 1ORVA 2H7YA 1UK9A 5AHXA 4I19A 1XROA 4B81A 1R3DA 4BP8A 3AILA 2WKWA 5LZ9A 3IVMA 2VEOA 5DNUA 4BZZA 2IIVA 5CBKA 3FLBA 4DGQA 2XUHA 4FLFA 4YASA 4J0KA 4EA6A 2VJDA 4Y9SA 1EX9A 1XKLA 1UWCA 4G8BA 4UHBA 4NVRA 5DTIA 3C43A 1YCDA 5YASA 2OLEA 3WI7A 4QDZA 2ACKA 5EIEA 5JAOA 1NX9A 1ZI9A 4CG1A 3WWPA 5A7FA 3OOSA 5K3CA 1B41A 1XRPA 1U65A 2CB9A 3SK0A 2V96A 1BU8A 4B0PA 3U0VA 3WWDA 1CQWA 2XMBA 1JT2A 1QLWA 4C01A 2HHAA 2HA2A 3STWA 5DYWA 1CQZA 1VJ5A 4LXHA 1EK2A 2ES4A 2Y6VA 2XI4A 4N5HX 4DYHA 1MO2A 5JARA 1QONA 1ZJ4A 3YASA 5HF8A 1EDBA 1CUHA 2XE4A 3ICWA 4ZXFA 1E8MA 1LPSA 5A2GA 4F21A 1MX9A 5HF9A 3MVEA 1C7IA 4KAJA 3FYUB 2VT6A 3GFFA 3KSRA 5BOVA 1WOMA 1R1DA 3ILSA 1E8DA 4PF1A 3ZV7A 3O4JA 1CUYA 2WFZA 2WIDA 1FSSA 3DYVA 4GLBA 1DINA 2R8BA 1AKNA 2AJBA 4GHWA 4B9EA 3NOXA 2XUPA 3B3QA 1W76A 5HCUA 3ESAA 4DSAA 4UHHA 4IH4A 3MUNA 2Z8XA 1XZDA 4X90A 3DL4A 4GEGA 2XB6A 4YPVA 5LZ7A 1UKCA 4TPKA 4X71A 5HK9A 1IZ8A 1LBTA 5IVHA 1XRLA 1XLWA 3I28A 4XX1A 4QEKA 4U2GA 4UHFA 4ARBA 3RK4A 2PU5A 5AI4A 3STTA 2YYSA 5ALYA 3JW8A 1AX9A 3EBLA 4UBJA 1DWPA 2QUBA 4LHEA 3BE8A 1HBJA 3C6XA 4Y2QA 5AKXA 3H19A 4FDMA 4BBZA 2WJ3A 4EY5A 4H7JA 1L7RA 3I2IA 3R3ZA 4J0DA 3EQ8A 4FTWA 5FXMA 3D3NA 2RHWA 1O6GA 2OXEA 3AIKA 3H1AA 4H7FA 1F8UA 3DKRA 1IUNA 4DMCA 3SX4A 2X5XA 4M0MA 1H2XA 1W1IA 1VKHA 5E4JA 3FSGA 2ROQA 4A23A 3KWFA 1Y7HA 3QPCA 4Y2JA 2Y1KA 3KXPA 4BC0A 1UT6A 1QIHA 5AM3A 2RHTA 4OYYA 3STYA 4BRZA 2OG1A 2XQFA 2CBGA 1CUUA 1DU4A 1JJIA 4UHEA 2OCKA 4E46A 2JGJA 3D0KA 3AJAA 3BJMA 3D2BA 4FNMA 4X6XA 2WHQA 4U2BA 4NS4A 1IZ7A 1ODSA 5T4HA 3A2LA 3I2JA 3ZLTA 2XQIA 3DEAA 1N5MA 4LIPD 4EBBA 3HC7A 4G4GA 2XUJA 3R40A 5DTJA 4X97A 1CR6A 2JEZA 2Z5GA 3P2MA 1GPKA 1GT6A 2C0PA 5AKEA 1Q0ZA 4H7IA 1WPRA 3TGLA 4ZREA 1ZGCA 4JUIA 3FWHA 2ZYSA 2JGEA 5AK4A 2CUTA 3PUHA 4JYPA 3STUA 4ZV7A 3HABA 1ZD5A 2HFJA 5J3JA 3BF8A 1EVEA 4G8CA 3M81A 4KJXA 1XZCA 3DDUA 1X2EA 3VXKA 1N5RA 1BS9A 4AQDA 2GZSA 3VVMA 3V1LA 4LXIA 5HK8A 3F97A 3F9CA 3PF9A 5FLKA 1S8OA 2WU4A 2AJDA 5AKHA 3N2ZB 3E4DA 4N8EA 4XIIA 4H0CA 1CUJA 5AKGA 3GA7A 4K6KA 3ZWQA 4HS9A 2EDCA 1H2YA 4X93A 5KREA 3G02A 1JMKC 1BCRA 2ACEA 1KU0A 2QZPA 2WG1A 2XLBA 1X2BA 4AMZA 4UFNA 1JFRA 1DT5A 3IULA 4H77A 3G9XA 2WUFA 3ANSA 4BB0A 3F96A 2VATA 5KBYA 5DYYA 2DQZA 4X92A 1WB6A 2WLSA 1QTIA 4BAZA 2J3DA 2PSHA 3C6ZA 2QXTA 5K3FA 1GQRA 2FJ0A 4F0JA 3W9BA 3QM1A 1IUOA 5FV4A 3DJYA 5A6VA 1YAJA 3CN7A 4H18A 3WA6A 3WIOA 3MGAA 2VTVA 5JALA 2XUAA 1N1MA 4PQEA 4QDTA 2I3DA 4G4JA 1QIIA 3FYTA 3G0DA 5DLPA 4UPDA 3DQZA 2VF2A 1ETHA 5CT9A 2ZVDA 2HA3A 4L0CA 3WWCA 2CEKA 1VE6A 2XUFA 4MYDA 1J06A 4INZA 4TGLA 3C8HA 2C4HA 2O7RA 3WYDA 2UZ0A 2XMQA 2VJCA 3FLEA 1J2EA 1MX5A 1UKAA 1XZJA 2GYVA 3N0TA 4W1QA 3QBJA 1XQYA 5SYMA 2QS9A 2Z8ZA 5CT5A 4HVTA 4UBKA 2OCIA 2XQKA 1IVYA 5C8XA 4H7KA 3V1KA 4Y2XA 5E2IA 3FAKA 4BCCA 1CUSA 4Q3LA 2QVBA 1LBSA 3O4GA 3T52A 4FNGA 4C4XA 4BC1A 2PVSA 1TKRA 4Q3OA 2BUBA 2YASA 3H04A 2DHDA 3HSSA 3BL8A 1YS2X 4OYLA 3D7RA 4UBLA 2AJLI 4UHCA 3S8YA 2FJPA 3O4IA 2VT7A 5JYCA 4BVLA 2BAGA 3PDCA 3ANTA 5D3ZA 4C87A 5JIBA 3AZPA 3D4LA 4AO6A 3JWEA 1DTEA 4BRSA 2D0DA 3WKBA 4P08A 2OPHA 1JU4A 1EVQA 4K5QA 5AM1A 4FFVA 1Q83A 4PO3X 2I78A 5HFNA 1TK3A 1VE7A 1UK7A 3SWWA 4KE9A 3OURA 3WK4A 3QITA 1BN7A 5JASA 4X85A 4J0GA 4OD0A 5EIAA 1YR2A 1JKMA 2BCEA 4W1PA 2B61A 3DOIA 4M0FA 1W4LA 6YASA 5SYNA 1QIFA 3HXKA 1XRQA 3H2KA 5LLSA 2IX9A 2HU7A 2WJ4A 4OB6A 3WKEA 1U4NA 2ZSIA 3WL5A 1TIBA 1XLVA 1EH5A 5CH5A 1W52X 3ZPXA 4J0HA 5DWDA 3AUKA 2VQ6A 1N8SA 3IA2A 1CUBA 4I3FA 1SCIA 5CT8A 1QFSA 1MAHA 1BRTA 2OQVA 4DTCA 4OCZA 3OG9A 1EI9A 3WWOA 3ZLVA 4EY6A 4F60A 3I6MA 2Q0XA 1EDEA 1MTZA 2PU7A 2DR0A 1XLUA 2DFPA 3FSGD 3B5EA 2JGFA 4MXDA 1J07A 4QDXA 3AZOA 5KWIA 5AP9A 4J0JA 4BP9A 3VJMA 4CG3A 5DJ5A 4FLEA 2PUJA 3H1BA 2HA7A 4Y2RA 2X76A 2QTBA 1XZBA 4BE9A 1HPLA 5EI5A 2D5LA 5E4YA 3D59A 3IUQA 4GXNA 3L1HA 2GBFA 2OCLA 2JBWA 4BTLA 2QM0A 3CXUA 5IKXA 2Y6UA 3GROA 1CEXA 1G4HA 3IUJA 1K5PA 1FFAA 5BWCA 5LZ8A 2WUEA 2G4LA 1LNSA 4BCBA 1TCAA 2PSJA 5I8PA 3C8DA 1JMYA 5LP1A 4EZIA 1DQZA 5ALRA 4IO0A 1QFMA 3DNMA 4UFPA 3BWXA 4AO8A 1ZD4A 1XZAA 5HF5A 5EHZA 4L3WA 3ICVA 4PSDA 1UKBA 3VDXA 1EHYA 4MEBA 4W1RA 1MT3A 3PE6A 4D9JA 4CFSA 3U1TA 1XKTA 2XMZA 3W04A 1HQDA 3LP5A 1DQYA 1ZGBA 5ALNA 1ZI6A 1WB5A 1TCBA 5HKAA 3G0GA 4X6YA 1HLGA 3D5EA 3IB3A 1XZGA 4U2DA 1K6EA 3D2CA 3BF7A 1MAAA 1KU6A 1L7QA 4B9AA 5ALZA 2HU8A 4P9NA 5I7UA 2ZJ6A 2J4CA 4IH9A 3WZLA 5CW2A 5T4BA 4B82A 5HZGA 5AICA 3OC0A 3FCYA 4KAFA 1QIEA 2WUDA 5ALDA 1YSCA 1D07A 1YA8A 2OGZA 2ZJFA 4WCVA 2ZYHA 3S2ZA 3I2GA 4BDTA 1FFBA 4JNCA 1UFOA 4LKOA 2H1IA 1TRHA 2C5GA 4CCWA 2ZYIA 4WDQA 4E14A 1K8QA 5CMLA 2PM8A 2VAVA 5CTAA 1SC9A 4WDRA 5DYTA 2RIPA 4RGYA 4LYDA 3H17A 3EQ9A 4PSCA 5A62A 5ALQA 3HYSA 2GBIA 3QYJA 2WUGA 2J3QA 4J0IA 1CUIA 2WJ6A 5JZSA 5LYYA 3VVLA 3FNBA 5LIPA 4RE5A 2NW6A 4I4CA 3C5WP 4HAIA 1XZEA 3PICA 5C8ZA 4FLMA 5AO9A 2DHEA 3JYHA 4OB8A 2X8BA 3QMMA 1QIJA 1XZIA 2QJWA 3MUOA 2XMGA 4P92A 1UK8A 1LZKA 4AMYA 2HFKA 3W05A 3LLCA 5C81A 1EA5A 1I6WA 2WFLA 5ALTA 1VZ3A 1AUOA 4W9RA 1UK6A 4UBIA 3IIIA 3H0CA 1UZAA 4U2EA 4IH1A 1AZWA 4C6HA 2OGSA 4N5IX 4BZWA 2XQGA 1CUXA 4MQLA 4EY7A 3I1IA 1R9MA 4BE4A 5JAUA 3KWJA 4QA9A 3DOHA 3E1GA 1BROA 4B84A 1CPYA 4H35A 1U8EA 2GYUA 5K3BA 4Y2SA 2BGRA 2CMFA 4IHAA 3K6KA 4BDSA 2WIGA 2AXEA 1BCSA 1A88A 5K3EA 4OSEA 4DMFA 1HDEA 2VAXA 2PX6A 2PSEA 1JI3A 2OCGA 1TAHA 3Q0TA 5KWJA 3A70A 2W6CX 4BTVA 3C5VA 4GWLA 1QO7A 4WJLA 1PJAA 4UFOA 1P0PA 2YXPX 4HTAA 3WKCA 4Y2UA 1PFQA 3G9TA 3IDAA 4EB0A 2G5PA 2QT9A 5AIAA 3W9UA 2VJAA 5LKRA 3PI6A 3FCXA 1F0PA 2XDWA 1CUZA 2GYWA 4ITVA 3UUEA 3WKDA 2QRUA 2EDAA 1A7UA 4MWTA 2OAGA 1CUWA 3DD5A 4W63A 3DKKA 4C89A 2C5FA 2ONCA 4KE8A 4L9AA 3DS8A 4QWWA 5ALXA 1GKLA 1AC5A 4Q34A 4HXEB 5EHQA 5D3KA 3WA7A 2C7BA 2PKYX 5ALUA 5T4FA 3D2AA 2JGKA 2OAEA 5AKJA 4HXFB 3ED1A 3EF3A 3LIIA 1CVLA 1B6GA 5FUMA 3A2NA 4CCYA 1EINA 3C70A 4E11A 3KOOA 5CT4A 2HRQA 3FLAA 1LPOA 3ESCA 1CUVA 3F8SA 5AK3A 1L7AA 4KACA 1E66A 1LPMA 5FDFA 1UXOA 3I6YA 2DCMA 5K3DA 2V97A 3AIOA 3HLKA 5ALJA 2HL6A 2C58A 5CH8A 1A8UA 1QOZA 5FPPA 1FFEA 2BFNA 4DMHA 2V98A 2E3JA 3G7NA 1CUGA 3I2FA 1R4ZA 1GGVA 1DWOA 2HDWA 1QIMA 4PV7A 3AIMA 3SC2A 3WK7A 5ESRA 3V1NA 3C87A 1QGED 3WL7A 2JEYA 4DNPA 3LIPA 3C6BA 4DM7A 3QMVA 3H2HA 4WY8A 4K2AA 3RM3A 4X95A 7YASA 1KEZA 3KDAA 4X7BA 3FBWA 5DNVA 1BEZA 4KAAA 1LGYA 4KEAA 1NU6A 1MNAA 3OPMA 3ESDA 4B7ZA 5CURA 2BUCA 3A2MA 1AURA 3G9ZA 1A8SA 3WK9A 4ZI5A 2BJHA 3R3VA 1FFDA 3WLAA 1YB6A 1U2EA 2XLCA 3BIXA 5AKKA 2QOEA 2XUQA 3PF8A 3PFBA 1Q84A 3HACA 4NMWA 4P93A 1VLQA 1M33A 1G5FA 1H22A 4CG2A 1XFDA 2QJRA 2K2QB 5AOBA 3QVMA 3UUFA 2QXUA 2PPLA 3QPAA 5ALHA 5JATA 3LCRA 4CIAA 4GECA 2XUOA 3PUIA 1VXOA 2J4FA 4MYSA 4MWSA 3WK5A 5AIBA 4AO7A 3G8YA 2R11A 3STVA 5K3FB 4WFKA 2BGNA 2XMSA 4G1FA 2CZQA 4IQ4A 4ZWNA 1YB7A 5FKJA 4Q05A 2XUIA 3R3YA 3FVTA 4FKBA 2WHPA 1YAHA 1QE3A 4Y2YA 4CCYB 2WIKA 1QIGA 2ZJ7A 1EK1A 3DL7A 1CUFA 2BKLA 3UMJA 5HQ3A 1LZLA 2PL5A 1ZIXA 1XZFA 1LPBB 5ALPA 5ALIA 1LPPA 5AM2A 1ZOIA 4OPMA 4GW3A 2JGIA 3HZOA 4J7AA 4MQMA 2XT0A 3I1YA 4HRYA 1XQVA 4XVCA 1YS1X 2RI6A 4N8DA 3A6ZA 4G9GA 3GBSA 1A8QA 1XQXA 1GPNA 2RONA 5IVDA 1W6RA 5FRDA 1MU0A 1ACLA 4DNFA 1ZIYA 5AI0A 3FYUC 1GPLA 1JJBA 2Z3WA 1ZJ5A 2DQYA 2FX5A 4KE6A 3NWOA 3IUMA 3BDVA 1UOOA 1BEEA 1XZKA 4AXBA 2IITA 3F67A 4JH0A 1EDDA 2WTNA 3K9BA 1ODCA 5JZBA 5D7BA 2O2GA 4QLAA 1ZD2P 4LXGA 5JD6A 1OXMA 5F4ZA 3V48A 3WMRA 1HL7A 3EIOA 5AM4A 1X70A 4YX9A 4ROTA 3WJ2A 2XMCA 3BXPA 4X6UA 4U2CA 4J0CA 1QJ4A 3QMWA 1K4YA 2H7XA 4B85A 2WSLA 5AKIA 1CFJA 1G42A 2XUKA 4X91A 2PBLA 1EXWA 1AQLA 3EQ7A 1AGYA 3NGMA 2YH2A 1C4XA 4BCDA 1WCYA 2I3ZA 2C0QA 2CKMA 2WU3A 1CUEA 4B0OA 3WK6A 3TJMA 2WHPB 1THGA 3R3WA 4PW0A 3WKAA 3VISA 4L72A 5HQ3B 1NU8A 1MX1A 3T4UA 3STXA 3R3UA 1LPAB 4C4ZA 2H9YA 3WWEA 4B83A 3BJRA 5DNWA 5JD4A 4DNQA 4HZGA 1DX4A 5ALFA 2WG2A 5BV7A 4AZ3A 4H7DA 2HA5A 4H7HA 5LKAA 4Y2VA 4HXGA 1UOPA 2EEPA 5AI9A 4AB1A 4JEIA 4GDMA 2VA9A 5A71A 3TRDA 1E3QA 3WZMA 2QUAA 4PSUA 4FBMA 2WG0A 5K3AA 1FFCA 4AN1A 1LPNA 4XJVA 1ODTC 3G0CA 3V1MA 3W06A 1CRLA 4V2IA 5A7GA 1QO9A 1F0NA 4BAUA 2ZSHA 4X3CA 3BDIA 4ZRDA 2HADA 4QLOA 3RKSA 2OGTA 4BAGA 1EB8A 3DCNA 4ZGBA 5JD5A 4GBGA 4UBMA 2QKYA 1RYYA 3WIBA 4B6GA 4CI9A 2PSFA 4E15A 1WB4A 2JGMA 5K5EA 2Y2VA 4RE6A 2HA6A 5ALKA 1XZMA 4Q1VA 4TVKA 3WL6A 3M3DA 4G5XA 3FVRA 5AJHA 3B12A 1CUDA 3VJLA 5A7HA 5JADA 1OILA 4AZ0A 3R41A 4EY4A 3QH4A 4HRXA 4KRXA 3GZJA 3IURA 5BWBA 1ZICA 1MNQA 4KRYA 5ALEA 4PNZA 2HA4A 1E8NA 1DWQA 1W75A 3E3AA 4G9EA 4EY8A 4X94A 1T4MA 2QR5A 5AOCA 5C7YA 4C4YA 1IUPA 3FOBA 1H23A 1RWQA 4QDUA 2FUKA 2BUAA 1BN6A 3O0DA 3CN9A 1SFRA 4FFWA 3O4HA 4MEAA 2JIDA 2RAUA 4K6HA 4B80A 2VSQA 3PFCA 1H2ZA 5HKBA 1Z68A 5AOAA 3BIWA 4DIUA 4X00A 3I2KA 4WFJA 4DLNA 1GXSA 2XQJA 4OU5A 4C88A 5ALSA 3F98A 1XQWA 1WHSA 1AMNA 5D6OA 3WYNA 1VA4A 4XWGA 3VKFA 4BVKA 3RLIA 4QE3A 3L1JA 1Y7IA 2GBGA 5EIHA 2B4KA 3LS2A 3K2IA 5AI6A 3HEAA 5ISMA 4DSZA 1DX6A 5I9IA 5JAHA 1SCQA 3DYIA 3C6YA 1XRRA 3WL8A 1VZ2A 4FMPA 1ACJA 1K63A 3TEJA 1RP1A 1EB9A 1R9NA
chains in the Genus database with same CATH superfamily
1F4LA 4TLAA 1HDCA 1KMHB 3V97A 2WIJA 3BHMA 4YBRA 2AJ8A 3H2GA 4C7BA 3MIZA 4EJFA 1FFXA 1G6Q1 3FPKA 2VSYA 2QL7A 2FR8A 5CA1B 1KMCA 5CB4A 3MKQA 3KD2A 4NCHA 5IVKA 1DRUA 1QRSA 2EL9A 5CA0A 3W4JA 1NXTA 1Y0BA 2B8TA 2C2YA 2H1SA 2O5RA 1XELA 4LNUA 3PE7A 3M6LA 4DSTA 1UQTA 1TJ5A 1VRWA 1ISFA 1MHTA 1Y4AE 2ZYRA 1RWPA 4D7AA 2HYDA 1CLEA 1M1YA 4QOGA 2VQDA 2H65A 1KRHA 5DGXA 1XHMA 4RDHA 1G4UR 1IJBA 5ILGA 2ADOA 2VDJA 4OHBA 1TM4E 4GGMX 1WD5A 5H3HA 5AH0A 3R3XA 4EBFA 4H7EA 3WK8A 1YUMA 1KYIA 5EJ7A 3IAEA 1DBWA 1GRQA 1GP2B 1U3WA 2FEOA 1AKWA 3AP1A 3U81A 2OZVA 4DV3B 2HBYA 4MGHA 5GM1A 4B4OA 3GN2A 4FAND 4B3DA 3TGPA 3OIVA 3GVXA 3EG6A 5AYVA 2NZUG 4PZAA 4MW1A 4XM1A 2PUDA 2R62A 3MERA 4L8WB 1OFVA 3D8BA 5B1DA 3V34A 1K8YB 3UK2A 3N7AA 4KXYA 3WFJA 2C1XA 4B4DA 5ALMA 5CXUA 3AXTA 1VIYA 3IQGX 2RSLA 1TLLA 3QU5A 5IJ8E 4KOAA 4MUAA 5JD3A 4BQNA 4ZCRA 4GVXA 3S6JA 3UG6A 2NQTA 1JYFA 1PHPA 1LK0A 1FL9A 3V8EA 2H08A 3JVDA 2D6FA 3RVQA 4DABA 1E1MA 5AM5A 1YJXA 2YY6A 1E5TA 4AW9A 4Y2PA 2JCVA 4IDOA 2FDCA 4M7RA 4LOLA 4O4HF 3GCXA 4TN1A 4I08A 5GOTA 2J9FB 2JKXA 1JDVA 1XD8A 4JEHA 3HHEA 3MCTA 4R9VA 5KYUB 4FWWA 4PIMA 1LY1A 1CUCA 1CJVC 1JKJA 1MJHA 5H7XA 2C29D 3F5DA 4I1VA 3A1WA 1GN9A 4GMFA 4FJ1A 5HKLA 3Q7TA 4OHRA 3IEPA 3CVVA 1FYFA 1TA0A 2B2CA 3HCFA 2WM2A 2GN9A 8OHMA 1QHYA 1VMEA 2P7HA 1S8FA 5DYIA 5LC1A 1JAYA 3O8QB 1FBNA 3BKWA 2QQGA 2VDLB 3QNUA 2EWMA 4Z4HA 5C86A 3BXEA 1EQUA 3HP1A 3KFXA 4CFYA 4ECEA 4C0XA 3L01A 1D7AA 3EUWA 5GTDA 4R8RA 4UHBA 4MAFA 2UUCB 2FKAA 3BCRA 1ZH4A 4DR5B 1S4UX 1QQ6A 1NXSA 3B5IA 2P2LA 4A6PA 3LZCA 3RWMB 1JFTA 5U9CA 1L6RA 1JDZA 2H14A 6GPBA 2XF2A 3DQQA 1POWA 3U0VA 3WWDA 1BFKA 2HSEA 3LKVA 2JG3A 1WUYA 1EE2A 3KB2A 2F1OA 4LY3A 1H9BA 2QG4A 5EJ5A 4XD7D 2AEEA 2QYOA 3A26A 1JPVA 1E94E 4LF6B 3SBPA 4F21A 1A69A 10MHA 4CODB 4RIGA 3Q7SA 1C3VA 3UO8B 3BD7A 1PR5A 3J81g 5E6UA 4LI3X 2PG3A 1POXA 2VF5X 4YUZA 4M7WA 5J40A 3KKQA 2NTYC 2R8BA 3BH7A 2XUPA 4H1TA 3ESAA 4RIIA 4MA0A 5JFTA 2YMMA 3VC1A 1VP3A 2C94A 5EA2A 4YPVA 1ZXBA 1TZJA 3OMXA 4M76B 1MOPA 1SC4A 4CEJB 1WXFA 4UHFA 1RE1A 1NUAA 3ILVA 5A4DA 1M54A 4HUJA 1KJ9A 4C4OA 2V65A 3I9FA 4W7SA 5IM5A 1SCJA 1UF9A 4Q1BA 3GLIE 3MT9A 4ZAZA 3ZHRA 4WZBA 5J47A 4HGNA 3NTQA 2C3YA 4J81A 1YL6A 1J8VA 2R97A 2VBGA 2W9XA 2ID7A 4ER5A 3QPBA 2QN9A 2BKUA 4ZI7B 1WXHA 4AUKA 5KNBH 3JALA 4JSRA 2ZYWX 2OFFA 2EKLA 1RZRD 2GS9A 1BH2A 3REQA 5JSZA 1QP0A 3OLXA 3MTQA 3D2BA 3H9QA 4KDCA 1W29A 1V2GA 3HSKA 4U2BA 1G17A 3JASA 3ZY3A 5H8WA 3PPWA 4TL9A 1G7CA 3AKYA 2V0CA 3DCYA 4RJKA 3D7MA 3TAXA 2NO6A 2QB5A 1YTUA 3MTEA 3W2IA 3UVEA 3DDUA 2YN0A 4LF9B 2PT6A 2Q6TA 5JCJA 1SXQA 4PC6A 4KTTE 3OZIA 4EX7A 1NQOA 4M2LA 3HCCA 2VNAA 4LFCB 3E4DA 4KFUA 3NH9A 4MX8A 1Y8CA 2X1HA 5BW4A 5JEEA 1RFLA 1S02A 2QTNA 1YK1A 5DM2A 3G02A 4CKBB 4HH1A 4QHTA 2V0NA 2DYKA 2H1WA 4RKYA 5K8UA 4ZAGA 3IULA 5JDIC 3VR0A 4ZJPA 3IA7A 2C84A 3PDIA 3C8MA 3PB3A 3SZ3A 3SYMA 1U4CA 1H8EA 3RSLA 2AOUA 5K3FA 1T8TA 1AN9A 4HPJB 2YY7A 5BMVA 1IUOA 5E3JA 2PS9A 1VJDA 1V8ZA 3ZTWA 5A6VA 1T9DA 1W5EA 3AL3A 1AGRA 1FPMA 3NI2A 4QXAA 3UOAB 4XPZA 2XTNA 4R8KA 2JIMA 5KU7A 5EIFA 2A78A 3L2OB 3NXKA 2PLFA 1I5OA 3LWDA 4INPA 1H8HD 1QCZA 2VPXA 3W6NA 2JW5A 2OILA 3QWHA 4TRMA 1MXHA 1J06A 1OJLA 5EEHA 4ZZ3A 1ZSNA 1T8YA 3NQ41 4WK4A 1VIAA 5KJFA 3O5AA 2VNSA 3MMPA 3N0TA 2YZMA 2CV1A 1R0KA 4R5HA 2OCIA 1DFGA 1X15A 3KTFA 1XV5A 2IUFA 3DLIA 3T6KA 1AT1A 3C16C 4J78A 4Y2XA 4BCCA 3HV0A 1A5SB 4EDFA 1LBSA 1LTHR 3OZVA 4YJHB 5FOSA 3KBOA 3CHYA 2BUBA 3CUYA 4A8JB 4TLMB 1BCRB 2FJPA 2BAGA 1MOZA 4AWBA 1NMYA 4RDCA 2ZOSA 5ED4A 1JE0A 4V3CA 4P08A 2AN5A 3DYBA 1GSIA 1RXYA 3TQFA 4IIUA 2CNWA 1P19A 1R00A 5I7AA 4S1VA 2HPHA 1E3WB 3RFFA 2C96A 3OUZA 2VJLA 4OYHA 1GTL1 3LCJA 5JASA 4X85A 3DJFA 4N5LA 4DSUA 3BGSA 4AY3A 3GDFA 4BECA 5KWSA 3JS5A 2EJVA 4G2TA 4A0QA 5CFZA 3A1EA 3A05A 3GEEA 1L0BA 3PXSD 7MDHA 3CE6A 1PK9A 5K19A 4W5OA 1RYDA 4URHA 4H3VA 4IV5A 3AI3A 1XLVA 1EH5A 1RACA 1XR3A 2RHHA 3KYDA 2AMLA 3VMMA 1O2DA 2NXJA 2HQSA 3BCHA 3IV7A 5ERYA 3IT3A 5CT8A 3I3OA 5AVTA 3OG9A 4O8CA 2IW1A 4IINA 3ZEIA 1EUCB 3D1VA 1AV7A 3DLBA 3ZK7A 4EIWA 1G20A 1ZUNA 1XLUA 2DFPA 4ERNA 5EMKA 5KOJB 3T41A 4NBLA 5KWIA 4CUKA 4IXWA 2R6R1 4QPDA 1KGDA 3I4FA 1K8KC 3EVNA 5E6SB 1XIVA 2AR0A 3ORRA 4DCSA 1O94A 1SIBE 3EZ6A 3HNOA 4KNVA 2WTUA 1XZBA 5ULLA 3UUGA 1YD7A 4C0QC 3ZZ1A 2I66A 1ACMA 3D3WA 5KO2A 2QX7A 1GTJ1 3TEMA 4BLRA 5REQA 3A6PC 1M34A 3ZHVA 3HM2A 3WYEA 1NVUQ 5BWCA 3ZWVA 4P4UA 3U1VA 4QHSA 2J30A 4HZUB 3NBAA 1PL8A 1JMYA 3TIIA 1JJAA 3HVKA 1D1QA 2H2DA 2C8VA 3HYLA 1RBQA 4ZV4A 3TL2A 3HQ4O 1WKCA 2BI7A 2IT1A 4GMGA 3RVLA 1HLPA 2DBVO 3K1YA 1NSYA 4BFZA 3IOCA 3RRMC 3JAWB 4HLCA 2PT7A 5LUAA 3VR1A 3G0GA 2C9DA 4CIXA 4QBFA 2GGSA 1Z4IA 1ZVJA 2JIQA 2M98A 3PGVA 1L7QA 1M76A 2DF8A 3UJPA 1BE6A 2GKOA 2ZJ6A 5FD8A 3M5CA 2IUQA 3WZLA 2IUEA 4WOKA 3RTAA 5T4BA 2YWHA 2WB2A 2OFWA 2FEWB 1RYBA 2ZTHA 2HJHA 5EMLB 1YA8A 4WCVA 5BWMA 5JFOA 1BS2A 1NY5A 3G2MA 5IPFA 1NAHA 5ADHA 4IRZA 1SIOA 5G0SA 1M7GA 3B7GA 3GFGA 3DE1X 3Q9SA 4TXNA 2OIZA 4I1PA 1GA1A 3U7RA 4S0ZA 1RYMA 3BICA 3I37X 1PHRA 2C5LA 4RWZA 1LI4A 3FN4A 1VPVA 3C75H 4OGLA 2RDMA 3LQKA 1P3DA 4OQ4A 2H8KA 3AI1A 3VOBA 2OV3A 5AO9A 1CDOA 4RTKA 1OREA 4S12A 4TYPA 2QMEA 4I1IA 5KKCA 1ZN8A 1LZKA 2HWWA 3AL9A 2Z0MA 3AU9A 3CEAA 3PGJA 4W9RA 4L1MA 4RGBA 3T5AA 4UBIA 2B4RO 4TV8A 3NIBA 4KQCA 3R2JA 4KQWA 4U2EA 1TUBB 5L3RA 4S35A 5IDVA 4ZVSA 3KWLA 4H08A 4B84A 5C7IO 4H17A 2V5AA 4NV0A 1LVUA 5K3BA 3MFQA 1JR4A 1BKSB 1OLXB 3BOSA 4RQUA 2AXEA 1KHTA 2GNAA 2EIDA 2B5MA 3W3ZB 1TMGE 2ZT7A 4RFLA 1PFWA 3B51X 3PGLA 5TGTA 2JAPA 2YOGA 4CU5A 3AQ4A 4B71A 3FBGA 4FFBA 4Z7OA 5T6MA 2QT9A 1Y8QA 3OZEA 3FY4A 5EL0A 3N59A 3UUEA 5EWLA 4DR2B 2EOAA 4ITRC 4IIBA 2X0KA 4P4LA 5BVGA 3EVFA 1UDWA 2X3YA 3KVYA 4B79A 2PD3A 1EVJA 2C5FA 2ONCA 5E7JA 3WYAA 3QI2A 3KZVA 4QODA 1GKLA 2YBAA 4DZTA 3AYXB 3GLQA 3MHTA 1T5LA 4MOWA 3SMQA 3OQPA 3L06A 4CQLA 2ZIXB 1JEOA 5AKJA 1T1SA 4CR7A 4JI4B 4CCYA 3MCAA 2G80A 5KVCA 2CXQA 4I9NA 4LRYA 1KOJA 4QJ4A 2BTQB 4OA8A 5IM4A 2DCMA 4OFXA 1JDTA 1UL1X 5CGQB 5FFNA 1RAGA 1AB6A 3BREA 3HLKA 3CZPA 5LQMA 2X9QA 3KO8A 3R0XA 3ZCUA 2BFNA 2V98A 3L7OA 1E58A 1R4ZA 4YP7A 1SR8A 2VEDA 4PCUA 3V7FA 5C35A 2M6RA 3UQYS 4DM7A 1N6IA 3T0GA 1JLLA 3EVBA 4TKUB 4JDUA 4K2AA 2GM5A 5E9QA 2PRZA 1S2OA 3PX7A 1NE2A 1LVGA 3RWBA 2M2IA 4X7BA 1O6BA 1LW7A 5IUJC 1ZRHA 4UDYX 2JLXA 1O0SA 4P3OA 3VVBA 2QJOA 3HXOA 2FZKA 1FDUA 1N8KA 1YB6A 4ZEWA 4NG4A 5DCYA 3B3FA 3FRIA 1XIPA 3PFBA 3B52X 3DUWA 3ZCSA 3GT7A 3VZSA 3HBJA 1D2EA 1G19A 2PTGA 3MZKA 1PJQA 4IIGA 3PQ6A 4MTLA 3ZKWB 4MWSA 2BMJA 5JAQA 2AV6A 3STVA 4QT4A 1FXWF 4OLBA 4OI2A 4IHQA 1YB7A 4RL6A 1I1NA 3IQHX 4FDUA 1E1CB 1T6YA 2CVOA 4N3GA 2O6HA 3AB7A 2GXAA 2HX1A 1UANA 1G8SA 4LXXA 3TQQA 2IUUA 4W8HA 4CMCA 1YZYA 1LPPA 3T5DA 3RN1D 3KCIA 3ECCA 1XKXA 3HZOA 3OCUA 2QD4A 3BG1A 3SXUB 4EMSA 2C9OA 5A0FA 4HRAA 1YBHA 3NETA 3PFFA 4NCJA 3GGSA 3TVDA 1G0NA 1F06A 3BN3A 2I34A 3DWGA 1YULA 1XZKA 3ZGNA 3LPCA 1R8JA 3K9BA 7MHTA 5JZBA 3CFVA 4PX3A 3M4XA 1VMIA 5FBVB 1JFSA 5B7NA 4GI2A 1O9GA 3BQMB 1VGQA 2OHHA 3JYNA 2AX3A 5BR7A 4V38A 4ZYUA 2ZYTX 4BMXA 1YCGA 2EFYA 1R16A 3SJBA 2H7XA 5EP1A 4WMLA 2B1RA 3B6KA 2HQBA 2BFMA 2WUWE 1DPFA 3O2JA 2Z09A 2R8RA 3FHTA 4LY9A 4F84A 1L5GA 5KYTA 2JD2A 1N92A 3UVKA 4L57A 5IC5A 3C24A 4RPIA 1WP4A 2VPIA 2VOEA 4EEZA 4C7XA 2DLNA 3F6CA 4NCIA 5T57A 4AS1A 3IPRA 3CC8A 3AJ8A 1Y5RA 2BDTA 3QIVA 4AJIA 1B93A 4AVYA 2J55H 1R9GA 4Z3DA 1PEVA 4RZIA 2QDKA 4FBMA 3ZQJA 1RD4A 4IIVA 1JMVA 1ZWLA 4S05A 2UUOA 5K0LA 1Z6YA 5LXTB 1II8B 3IXMA 1VJCA 2FLKA 3V1MA 2CFSA 3AL0C 5IC6A 2VPQA 2AYZA 1ZHFA 4Z1OA 5AVZA 2R7NA 4CEHA 5CYPA 2H9AA 3ZX5A 5E9AA 3HMKA 4ZDIA 1TQ6A 1EMDA 4D41A 4Q6WA 3M6FA 4H1HA 3TX2A 2OWDA 1NSTA 3L1KA 2IW3A 5EMMA 2QTHA 3ZY4A 1EWQA 4YMVA 1HNNA 1FPQA 2YVAA 1L4KA 1E9DA 4F4HA 4L5YA 4CN8A 3ZCXA 3VUEA 4KODA 3IURA 1AO3A 4DKXA 2O0HA 1OE0A 5BSFA 3UC9A 3T35A 1X7ZB 5LQRA 3DBVO 3FNIA 4YUWA 1C1YA 4PPQA 1XMVA 5MDHA 4OHYA 1HE3A 4HTFB 3FPEA 4DIUA 3E61A 1DADA 1GXSA 1MB3A 1NVWQ 2ONZA 4EDHA 3O3OB 4OU5A 3QKRA 3CUVA 1U8AA 1ELOA 2EARA 1SOUA 1AMNA 4XWGA 3R8FA 4DIBA 2C1ZA 3AV3A 3L0YA 4KXLA 2E6KA 5EIHA 2B4KA 1NQXA 5A4FS 2AWNA 2AC4A 1KHHA 4XD7A 5CHEA 5BN4A 4IEEA 7GPBA 4BO5A 5FHQA 4I2VA 2VDQB 1J9GA 1HX7A 1NP3A 2VDWA 1XRRA 1T24A 4MUIA 2MMCA 1WPGA 4MUMA 4MV1A 1TCCA 5L3SA 4NNJA 1CYEA 2CO0C 2J4DA 3BZUA 3TTXA 3NIGB 3W2TA 5UKDA 3FPAA 3E22A 1ZK2A 4WXHA 4XJTA 3ZLUA 1Y1SA 3R6GA 3JWHA 2X2FA 1MUUA 2ZUUA 3PLAE 1RPJA 3B20A 1WM1A 1ESDA 5KSZA 3C3PA 1DC7A 1XVIA 2J3KA 5JDCC 3I73A 2AD1A 3OIWA 3OZTA 3TLCA 2Q0QA 4FVTA 4MINA 4JODA 4X3PA 4M8NE 1YJ5A 4J0XA 3V42A 2O59A 3FOAA 2FWPA 2B4EA 3I7PA 2C2WA 1KYQA 2RC6A 3HLTA 4UAGA 4AIIA 3S28A 2Z30A 1PEAA 4LW8A 1GT91 5AMXA 1FFWA 2PSDA 1RZRA 1PNTA 1HZZA 1DOAA 3KYBA 4MV0A 5EHXA 3P9RA 3A1NA 1VBMA 1H1DA 3LOQA 1L5HB 1Z2EA 3MLEA 1T2CA 1IXKA 1Z15A 1R4MA 4PAGA 2FW1A 1WVMA 2I6TA 2BE7A 3A1CA 4YAEA 2R7MA 5EWJB 5ENVA 3OTOB 6PFKA 4Y2GA 1T9GS 2WAMA 3BILA 4AN0A 2DY1A 3PQ5A 2IYQA 3ZXYA 5AVJA 5G4LA 3QZUA 3FJ1A 3LL4A 2RE8A 3FUCA 4EX6A 3M4JA 4MPJA 1B8NA 3Q7IA 2HOQA 2WYOA 1E32A 3QKTA 3ZV6A 3LVRE 1UXKA 2GBCA 1KOFA 2D62A 4A2QA 5DHAA 2NXEA 3Q3EA 1RABA 2P8SA 4IVRA 2AD5A 1I1HA 5GADl 4QZVA 4URVR 3K9WA 3EJ6A 2IS2A 1GZ7A 5J4VA 4DNOA 3WJ1A 1CRZA 3C3JA 4RVUA 4CWAA 1CIJA 1HDOA 5A5DA 2IX3A 3IX7A 1PDVA 2WD7B 2DU8A 4HG2A 3RYCA 3UT0A 3CH7A 4G25A 1RJDA 2X7XA 1UK9A 4LJLA 3S1AA 1G21E 5DHPA 2I99A 2WAXA 3H11B 2OYRA 3DEZA 2O2SA 3H5TA 4IUDS 3M89A 1XRSB 2PMFA 3CTPA 2VJDA 1E98A 4RK1A 3W7BA 4D4JA 2PN1A 1F2DA 4X60A 5EJAA 3WI7A 3BA1A 4FJ2A 2J0QA 1IYZA 3AHJA 3KV3O 3D6MA 3CWZA 3EEIA 2XOEA 1P4HA 3FZYA 1ONPA 2E1RA 2HHAA 4MP8A 3V2UA 4P34A 1JQKA 3TPCA 4YAJA 4FB1D 2I5PO 1ZITA 4L7VA 1EDBA 2YCLA 2X0FA 1S2NA 3AR6A 3PC3A 4RSHA 2D54A 3UYKA 3JWGA 4BVEA 1WA5A 2IIBA 3SDSA 1Z73A 3G0HA 821PA 1OH5A 3QVGB 1RAIA 3N39C 5FNVB 1P72A 1L4FA 4PF1A 1HFKA 5JCJD 3L0CA 3AGPA 2ZSBA 4LC1A 5JI3E 2A3RA 3THYB 1AKNA 4GHWA 1C7RA 1QXSA 1PK7A 3EGXA 4MYRA 2XCRB 1KQFA 1XDDA 1TGVA 1HOXA 4DA4A 1Q0LA 2ANCA 2RBKA 3N3AC 3OPQA 1H8ED 3UM9A 2WVJA 5KYVA 2I0SA 1RAHA 3QUCA 3NBMA 3I2YX 3RMZD 3E82A 1G41A 16PKA 1WDTA 4MR9B 2FSIA 4LHEA 4G0YA 2WNSA 3K4PA 4FDMA 1E2HA 1T9HA 2WJ3A 1NMQA 4O1QD 4PC7A 2BE9A 1L7RA 3K9GA 4RH3A 4WZAB 2LXNA 3HRIA 3TI7A 1SZCA 3TKAA 1N25A 2ABWA 3U61B 5EYPB 1QO0A 4A23A 5KC9A 1XGKA 4C05A 3NB0A 2Y1KA 3TB6A 3MB5A 1MENA 3AEUA 4LSMA 4HDQB 4I36A 2Z04A 1NP7A 4QT0A 4O4JA 1U0RA 2SKEA 2IYAA 2ZPTX 3E1KA 2X5KO 5T4HA 1SURA 1K66A 4CUZA 2WSBA 4JHXA 1NURA 3DHWC 1I0LA 4EW6A 3F0TA 4RPJA 1PQYA 4WHMA 3BFJA 4LDPA 2Q5LA 3HM9A 3RNLA 1SUAA 3W5UA 4P0QB 2Z8YM 4QVGA 1IC6A 1SHLA 3DWLC 1W85A 2C07A 1D2RA 4JXMA 3RYFA 5JRZA 2N1BA 4MR7B 3QTLA 1QUEA 1JIVA 4GI7A 1OHHD 1ZD5A 1O95C 2CNWD 2P2YA 1N5RA 3WHPA 2PTHA 1WU8A 4B34A 2H2IA 3LI2A 5FUVA 5FLKA 1YQTA 2J3EA 4IS2A 4XUEA 4KFTA 4RMJA 1VE5A 5AKGA 3S27A 5L53A 1ZNXA 3F4KA 4NE2A 3PDWA 1JMKC 3GH1A 2QZPA 5DCLA 3W5JA 3QU7A 5IN4A 2GFQA 4U1RA 1NBME 1JW9B 1C3OB 1R0YA 1VHLA 5H02A 4BBJA 1P2VA 2P9BA 4RKRA 4QYXA 1RMTA 1PJSA 3RF6A 1N6LA 4NWIA 2PUTA 5T3UA 4CKEA 1VHDA 2VUIB 4RZ2A 3HY4A 4M8LA 2CL6X 2VUHB 4JC5A 2I2WA 2XWPA 4IRUB 1U80A 3FF1A 2ZAGA 4IX1A 4H4DA 3N2EA 3G0DA 4E94A 2H2FA 1C3LA 3DQZA 4B32A 1E1KA 2JLUA 1P45A 3SG0A 4J1QA 2L2QA 1U8UA 4LDAA 5TR9A 1DIRA 4OUDA 1JYEA 3W5VA 5K7SA 2FI1A 1O94D 1RJGA 1G3MA 5F2OA 3WYDA 2UZ0A 4CIWA 3UJ8A 1NBWB 1VLLA 3QBJA 5SYMA 2QRMA 2OHFA 3WNVA 1GL9B 3OWOA 1FWXA 2L82A 1KNQA 3ZU4A 4EYSA 2OBLA 4BJHB 4CZ2A 2QXYA 1SGWA 4YDRA 5A05A 2EKPA 3P0IA 4D4KA 3WNZA 4RD2A 3UMYA 3DO8A 5KYYB 4X66B 4YUVA 3GVCA 2A4MA 2JI6A 4W7IA 4ZT4A 5D86A 3JATB 5L40A 1H94A 4NKRA 3FYHA 3QTTA 3LG2A 4BRSA 3INNA 1FFYA 3K0AA 3I30X 3EIEA 4EYEA 3ZDYA 2OEPA 2P1DA 1HQKA 5HMMA 1SXJB 3TR5A 1UDCA 2O2DA 1F20A 4KQ6A 5GOZA 1K06A 3DOIA 3AR3A 4IDPA 5GJBA 2V54A 5C37A 3O2QB 4MYTA 5H83A 3BTUA 3WL5A 1TMOA 3BCUA 1Q2UA 1IG3A 1KERA 5HCNA 2NVUB 4KQ9A 5JSKA 4QJIA 2P62A 4Z7NB 5A3RA 1UMDA 3IA2A 2CL7X 5I7EA 1KYYA 2IYWA 4O25A 2C3OA 1A9QA 1Z45A 3P27A 1JJUB 1EI9A 1SU8A 1GGMA 2WZQA 5C7LO 1AF4A 3IPCA 5CUQA 5BO5A 5C51B 1J8QA 3VGJA 3RS0A 5AJXA 3FSGD 2H0RA 2HCBA 2I7DA 1N5JA 4G65A 4QDXA 1H66A 2NPOA 3IRUA 3JAKA 5DJ5A 2JI7A 1YIDA 2ZI6A 3ZVLA 3UJ7A 1Y8RB 4KREA 3HKDB 4D0GA 1K3UB 1MQAA 4EENA 1ITZA 1FLVA 3NU1A 3EVEA 4NATA 5BSMA 5LA6A 3ZCRA 5AW1A 3IKMB 5JISA 4M0DA 1E2JA 2CMGA 1K5PA 4IOMA 1GSOA 1RIFA 4CLDA 5IUNC 5DLDA 2JZNA 3MWLA 4IO0A 4UFPA 2AGYA 4FHLA 1L5MA 3GDOA 3DBHA 1RLOA 1PZHA 3SHOA 2GN6A 1ODJA 2IXFA 4F72A 3LX6A 5CIYA 3F3SA 3GEPA 3BH6A 4D8VA 1CE8B 2DKNA 4S1OA 2XWBF 1HQDA 3AH8A 5ALNA 3SS9X 1JHOA 4D2IA 1UCFA 2M6KA 1BO6A 4XCQA 3IB3A 1CQIA 1EFVB 3KAQA 1PR2A 4GVLA 2ZANA 3GNLA 3K20A 4O4HB 3V4PB 2J4CA 2B2XA 5ARBA 2ZJ4A 1QIEA 1SZDA 4TYMA 5H82A 3LT0A 3OX2A 3FGBA 3DV0B 1RW4A 4U5XA 4WPGA 3KPYA 4FMCB 3FJOA 1BDHA 1HC7A 1L4HA 3FPHA 4MV4A 1NN0A 4I1RA 4LKOA 1TEVA 2H1IA 1YJAA 3BEDA 3RUHA 3S8MA 3PNSA 2WYWA 4OQXA 1B1AA 3BWMA 1ES9A 1SBQA 3IAFA 4HB3A 1NM5C 3TNFA 2FMTA 1YDWA 4YAUA 3QYJA 1OXVA 4C2TA 2W0MA 4J0IA 4ZVOA 1X7WB 1UJCA 5LYYA 3KVOA 5LNK1 4UQOA 3KEGA 1HK7A 3LXXA 5C5CA 5HKKA 2NO7A 3K8OE 3WJ7A 1ZC4A 5D3QA 4ZYTA 1QVRA 3UWOA 1MLDA 1WSBA 1N6PA 3B60A 4JR2A 3QBEA 5JNLA 2NO1A 1EXMA 2GEBA 5A4MS 1TC2A 4JJZA 4I50A 5IASA 3I89A 3AY3A 1R0XA 1WXXA 1F7UA 3H0CA 5COQA 2WQ7A 1FNMA 1H05A 1Z2NX 3U9TA 2QW8A 1J0EA 3PHIA 5KB3A 1CPYA 3AMVA 2A5FA 3X44A 3CRW1 1PP4A 3SYRA 2RK4A 1LWNA 4RZUA 1BCSA 1BFUA 4Y0VA 3F5SA 4MV7A 2A9FA 2FPPB 3RVRA 2VFAA 4XJSA 4TLEA 3ER6A 3WYGA 2WHEA 4WEOA 5D8DA 2RAFA 1ARZA 5KSOA 3SF8A 3EE6A 3GEMA 3RK0A 2IXBA 4LMBA 3IDAA 2CT8A 1FE8A 3GVPA 2A1UB 3GGDA 5JAIA 3DF9A 1Z12A 5EZ5A 4LVCA 2Q6LA 4EKDA 3UKUC 3I05A 4XQCA 4C89A 2RHCA 3GJXC 4BZQA 5KPJA 4WN3A 1AN0A 4GBJA 1RWMA 2LKCA 4XB6B 3CRQA 1A5AB 3LDHA 1WUJS 4QUIA 3VQTA 3OUUA 1RWVA 1BNCA 3CUKA 3L0BA 3IKVA 1B6GA 3CRRA 2GCGA 3PXTD 1LPOA 5FO0A 5BRAA 3G59A 1E66A 5HMLA 4L76A 5FDFA 2MIIA 5EAIA 3MJSA 4WN9B 4FBGA 5ALJA 2WWYA 4PSAA 4ZT3A 1P5HA 4N48A 2KBFA 1QOZA 3CEPB 2EF1A 2G28A 1GGVA 1FUYB 1VFPA 3AIMA 3C1AA 3F1LA 2E5WA 1N9GB 2KPOA 1KH2A 4UUBA 4B3GA 1TPZA 3UXYA 2HH9A 3ABRB 5IJ0A 3A14A 1IJFA 3E1SA 5CURA 3VU0A 3SGLA 2XY4A 3TSYA 3TOVA 2XLCA 4I0WB 5A4JA 1YFQA 4I2NA 3KCQA 2TRSB 2O5CA 1NVGA 3JPWA 3L8MA 1B73A 4DSOA 4CG2A 5AOBA 3VH3A 1Z4LA 3DSRA 1D1PA 5JATA 4NCAA 4GECA 5HEKA 2IEBA 2E4ZA 4QG3A 1DRWA 4Y0AA 2TMGA 3OJWA 4Q05A 2CUNA 1ZK1A 3PDUA 1DKMA 2H5JA 2CNNA 2WHPA 3DLCA 3JD0A 5IP5A 4XYHA 2V4UA 3HA5A 3N5KA 5EG5A 4NDAA 2GN1A 1QLHA 3FFAA 2WYUA 3EVTA 4NMXB 3A2KA 2BZ0A 1JWLA 3CZMA 3KJXA 1U0JA 4P2BA 2Q1WA 4FA5D 2FAXA 1Y4ZA 4RHXA 2J8ZA 1YMVA 2VNHA 1U2DA 1E9CA 1GAWA 2HCRA 4XSHA 3LVBA 2Z3WA 1SD5A 4JB0A 4BNLA 1Y4SA 2NZJA 5KVQA 1HYEA 3KDPA 2R1VB 2BGMA 4AXBA 3C39A 1B15A 4II7A 1GUFA 1GM5A 1DKQA 3ETJA 1I2MB 4CTKA 5LMCA 1TADA 1OBCA 5JI2E 4ERYA 2BFCA 1DI0A 3HFSA 4E12A 2H1CA 1E4EA 2HNAA 1TEZA 4N0EA 3ZI4A 1D8AA 2QP4A 4HQ0A 3ZZNA 2V0GA 4HWOA 5FOTA 1EVIA 2B0JA 3BEOA 5CCDA 4TUYF 2WSLA 2VTBB 3KETA 2O8CA 5TDHB 3HI6A 5DTQA 1H3NA 2YX1A 4IIJF 1LBEA 3PFWO 2LDXA 3BAFA 1PVVA 1SRRA 3LPNA 3S2IA 4JL8A 3WKAA 4HAOA 4L72A 2OBYA 3K1AB 3WNDA 3V7UA 1EE9A 1Z33A 2ZRLA 3ZUGA 2O0MA 2GVZC 2P9KC 5B6IA 4NOJA 2X5JO 4E5ZA 2O1SA 5IJZA 1R6XA 4U7JA 1V96A 3WZMA 3IDZA 3ENZA 3KHTA 3L49A 1JG3A 1EZ1A 4LYHA 1KJYA 3VPAA 3A0FA 5LFAA 1CRLA 1XN1A 1E1RA 3L6OO 3O8DA 5A9SA 1F2TA 3TZLA 4GYJA 5C8YA 4YYEA 2BLLA 3DCNA 5JD5A 3AHHA 3RRBA 2WSSD 3NONA 5K0BA 1OWMA 1RTTA 3FWNA 4HLUA 3OQ6A 3F73A 2ORIA 3BXFA 2P6MA 3VU3A 1V1MA 1JXAA 4V0LA 1IH8A 2Q1SA 3TECE 1XU9A 4U7AA 4X6LA 4GKBA 4QTZA 5TMDA 5FBKA 4JYZA 2UU9B 4J3NA 3VR6A 3OC6A 3U6BA 3E7FA 1IZ0A 1H23A 1XNGA 3AXSA 3FROA 1Y9AA 5BSRA 5KTRA 3CN9A 3UCEA 2BFBA 4CM3A 3AERA 2JIDA 4MZXA 3W5BA 2GX6A 4WVLA 1K75A 1M9NA 1T0UA 4PBTA 4ND5A 1EWKA 3O1IC 2VT3A 3PLRA 4KR2A 1LA2A 3DXZA 4TTSA 1YCFA 2ZREA 2VJYA 2HU2A 2DR3A 3D8HA 5JV5A 1ZGJA 2C2GA 2QL5A 2HJWA 3VKFA 1PNQA 1KO7A 1ZJWA 3ZVNA 1V8DA 3LT2A 1XTRA 4U0KA 1DX6A 1H0KA 1EM6A 3FB4A 4JWKA 2ZVQX 2QHXA 2CVFA 7ADHA 2IBMA 3ISVA 3TLYA 4JSTA 3PU6A 1K63A 3FTQA 2DPMA 1WVIA 1EB9A 2JGDB 2IWHA 1EGHA 3P4XA 4OBWA 4BEJA 5FWYA 5LZ5A 1BDBA 4XFDA 2CN3A 2VHEA 1Z0JA 1DL5A 4OB7A 2CJPA 1JWBB 1N5DA 4B31A 3OO0A 4O9DA 2HIAA 1YZTA 4G5RA 4Z1MA 4FWBA 4AZVA 1HDXA 2Y4NA 4M60A 4KWEA 1WPXA 3FH0A 4B47A 1RHQA 4JBIA 3N0WA 2Q1XA 2GA8A 2F3SA 2B8EA 1ENOA 1KYTA 2RGCA 1E9BA 1OCEA 3QYPA 4KR7A 3VU9B 3RCBA 3PS9A 5K4AA 3O7MA 4RMIA 4MLDA 2B83A 2IF2A 1XCGB 5JWZA 5EQDA 4J3JA 3TMAA 2WILA 4OH7A 1GUYA 3JYQA 1DRJA 2YZ7A 2JFYA 1AHHA 3P4UA 3FX2A 3RTDA 4N8SA 3ZGZA 2C3UA 3AF6A 2O23A 5J5VA 4PLYA 2VN8A 2C2XA 3VDMA 1QU2A 2CJFA 1X7XA 1GUZA 2PM7B 4RY0A 1USWA 4ENRA 5DM1A 4QM7A 1IN1A 2YZGA 1P0QA 4Q5IA 3KPVA 2IF0A 2V7GA 3H8SA 5IXJA 1JJVA 4FHZA 5ALWA 5KYXB 2PUHA 1QZXA 1YVEI 5HFAA 4A8PA 2L42A 2HWXA 1L9KA 3KS9A 2G63A 4IJWA 5HE1B 4J87A 3ZHXA 2TECE 2AGWA 4PBYA 5G0WA 4C04A 3TINA 4BV3A 1T2DA 4QYWA 1RZ3A 3PT9A 3EIQA 4JVNA 4Q82A 4REOA 3SSAA 4FE3A 2OB2A 1WJGA 4G0PA 2BRUC 4FSXA 4JKYA 3WZ2A 1KEVA 1OHHA 2OY0A 4CGZA 2YZNA 2ORYA 2PZFA 1T3LA 2FPGA 4LS3A 3WIEA 5BY2A 2PUBA 4DMMA 2SCUA 4G5FA 2V7VA 2XUGA 1QFYA 4A16A 2FFQA 3FWZA 2HIHA 2CLHB 4QUBA 2GBLA 1T5OA 2TSYB 1CJKC 1THTA 2O8FB 2NV6A 5EIOA 3CSSA 4QBTA 2IEYA 4MWEA 4G56A 3HA7A 1LLFA 4I5EA 3CT4A 3MLBA 1TDJA 4XWTA 1NVXQ 1A9YA 4L8VA 5AHXA 3N76A 2E5LB 4WW0A 2N9UA 2QX8A 2IHBA 1IZYA 1IATA 4GLFA 1X7GA 2IYEA 1F5SA 3GLHB 4WBNA 5EWMA 2BMAA 3BGVA 3PHBE 1QO0D 2QPOA 4N47A 4NVRA 4C43A 1U28A 1U0EA 3C43A 3W2GA 1P8AA 5YASA 4EI8A 2UZ1B 4WD3A 1R6VA 2PFGA 3Q6NA 4B4KA 4CG1A 5A9RA 4KO2S 4AK9A 1Z06A 4N3AA 1TLTA 2V96A 1EWRA 4BNGA 3IV6A 1ZH0A 1CQWA 1QLWA 1N6FA 3STWA 1T2XA 5I8WA 4QO8A 3L43A 4LFAB 4B3FX 1V5IA 1E8MA 1XP5A 2Q2NA 2NTEA 3FMOB 4Q1CA 3VO8A 2HHLA 3MVEA 3PL1A 5DFAA 2VK4A 2PGAA 4OIMA 1XXHA 2JJMA 5CYKB 1OUMA 1OZAA 1MJGM 2J6BA 2YUTA 4MULA 4YJFB 1C9NA 3ILSA 4ZCSA 5LB2A 3VI4B 2WFZA 3JYPA 3W8NA 3KTAA 4V0MA 1QFXA 4CMIA 4RHEA 2FSPA 5CAEB 5LQJA 4KSYA 2YZKA 2V3VA 1WQ3A 4IH4A 4KLZA 1VE1A 3X1WA 2W6NA 1X7YB 3DL4A 2BZ1A 1UKCA 3U7GA 3UAOA 1XRLA 2O8BA 1RCFA 5D1NA 1A7AA 2P3LA 3JQ9A 4JJ7A 1HR0B 1AS0A 4ARBA 1JQJC 5FL3A 4WKNA 3DDOA 3C74A 1HFEL 4HUTA 1YR6A 4KBYA 2EBSA 1J0CA 3BE8A 5AKXA 3NVAA 4D97A 1U31A 1R0BA 5JH7F 4J0DA 5JCPA 2F43A 3D3NA 5KWEA 1CS0B 1JE1A 4XWYA 1HRDA 1CY6A 3BFKA 3N5CA 4DNWA 5IAGA 3SX4A 3DMFA 1WPQA 3N0RA 2AG5A 4R41A 3FSGA 1MRSA 3KWFA 3QPCA 1NKVA 2VRCD 2KJQA 4TWRA 3NYQA 2RHTA 3SYKA 4B6FA 3D7KA 1TYQC 1AZTA 3P2OA 2Z5VA 3COVA 1SK9A 3FCSA 4F2WA 2D1RA 2VXBA 3DOCA 2IKSA 2CSXA 2QL6A 3FPLA 4L0DA 5HIJA 5I7VA 3ZXSA 4LIPD 1JNYA 2R2AA 5T6BA 1B9YA 1JLRA 1GYRA 1ABBA 1N75A 3O4VA 4L4UA 4TT3D 2V6FA 1TQDA 2ODBA 4WOCA 4EZBA 2JGEA 4JYPA 2W48A 2P5YA 1JS1X 3TH5A 3HABA 2WF9A 1V43A 3WIVA 1DFHA 4X1IA 1PLKA 3PGA1 1VYUA 4NBWA 4ZVVA 1JQEA 1XEWY 1DUVG 1V1RB 4IGKA 2NO4A 2TMDA 4UCFA 4QOHA 3GMSA 4NFLA 1JQBA 4F9EA 3RT7A 3U4CA 5M3BA 4S2EA 3GZNB 2QZ9A 3G7SA 5EP2A 5JWOA 3T1OA 3I2NA 1X2BA 2EJUA 2A1TR 4B8ZA 3ZDAA 3AG6A 4Q4JB 5LOVF 1RZVA 3QKWA 4HDMB 1CZOA 1BAPA 2DQZA 2P6UA 4URXR 3FE2A 1J70A 2Q3DA 1EAMA 1SQSA 3GPDG 3C4VA 4ES0A 1DUIA 2ZTLA 4LY0A 1OU4A 4E21A 4DWVA 2IWFA 1VCMA 3DONA 4BNMA 3Q41A 3CEMA 4IXDA 1FDTA 2W42A 2FW9A 2AC2A 3L8FA 2GZ3A 2I3DA 4W5HA 4HO1X 3EA5A 2VH1A 4ESHA 2QJFA 2FXVA 2Q3EA 1LC3A 1CY1A 3LUJA 4GOMD 3UA4A 3CWQA 2HA3A 2Y9PB 4Y5RD 4YRAA 1P3Y1 4B6SA 1HSOA 4R6XA 4B3CA 3PHJA 4FN5A 3I4CA 5FKQA 5AXCA 4XFJA 1YBMA 3A3NA 1GWNA 4PO8A 4EP1A 3TIXB 3G1TA 2YINC 5IH3A 3BC1A 2PMEA 2Q7OE 3R5FA 1D9ZA 2J0UB 1O03A 3TEFA 3U48A 4HLDA 1I7LA 2SECE 1TKRA 5KS2A 4CIYA 1NSFA 4D9GA 4JGGA 3W4IA 3OD1A 4A91A 3BMNB 1PK8A 2UDPA 4R3NA 5JIBA 2VDRA 4WJKB 3M6UA 2YWEA 1VB3A 1LLUA 3WKBA 2RG1A 1TEHA 4M38A 3A25A 1AQNA 1OFIA 1T15A 3G5LA 4KDEA 5AM1A 2I4NA 5CDFE 2ZBEA 5T67A 2EJBA 2JHCA 5ABPA 2VRNA 3N70A 3PNQA 3K0BA 1GYPA 3LUCA 5JYEA 4HDSB 1N4DA 3WK4A 4KMSA 1T0BA 3VZQA 1BD3A 1P1BA 2HSJA 5E0KB 3T8YA 2O2YA 1NTOA 2YRXA 2IX9A 2FPIB 2WJ4A 3PSCB 1U4NA 1MABB 2ZSIA 3EAQA 4MUBA 1W52X 1FVXA 3ZPXA 4DDMA 1JHMA 2VQ6A 4MQBA 1DELA 2OZLB 3MQ4A 3OMLA 4Q9DA 3AT1A 1M5TA 2BN4A 5F9MA 4WX2B 1QFSA 3VZRA 3MWJA 2QP9X 5C8DA 1SKBA 3UGQA 3D7SA 3B5EA 1G3QA 3KWMA 4J0JA 5HKKD 1WX1A 2PUJA 1BMFD 1DO0A 1ZDMA 3QSYA 3RN0D 1RXWA 3M2TA 1T36A 4YB8A 2P9FA 3AETA 3T3HA 5ERGB 1GZVA 3STHA 5CIQA 3L1HA 4QU8A 1AF7A 2JBWA 1VSTA 3O8BA 3DEYX 3IUJA 2WI8A 4BGUA 1UM9A 3H1TA 4BLQA 1FDOA 2NZXA 1ZD4A 4P31A 2HTFA 1CDDA 1V39A 3OIDA 4PSDA 2VRBA 1J22A 3RPEA 2HJ9A 3PE6A 5F3WB 4AKIA 3ACDA 2ZULA 3L0ZA 3ROFA 3F6SA 4JZYA 4WAUA 4P4SA 3UATA 1HLGA 1OLSB 1B8PA 1J23A 4BLPA 2VP9A 4PRYA 2H1LA 2WT8A 3MWDB 4D4HA 3EFEA 3MT0A 1KI3A 4LRQA 5AICA 1Z4QA 1OT5A 2G8LA 3QQ5A 4V3BA 4B6QA 5KJ1A 4JWTA 1ZK4A 1H6BA 3NDPA 2YJ5A 1E2EA 1FFBA 3I5MA 1WW3A 2QE6A 2FMIA 3DOEA 3KJHA 2ZYIA 3KXIA 1F2VA 3C5MA 3EFOA 4WZ6A 5DLQC 3OLZA 2Z8YA 3UHFA 1GY8A 5HFJA 3DZGA 2OLJA 3BE6A 4BKPA 5ALQA 4MWBA 2AE1A 2XGJA 4ODIA 2G82A 5G0UA 4I4CA 1JEAA 2V7PA 2C7GA 4ZAWA 2Q1TA 1U63A 4W6ZA 3GRZA 5G4KB 1OXXK 1Y9DA 2JKVA 3BVPA 1YRQA 3PNPA 1I6WA 1BGVA 2WFLA 4K9RA 4N40A 4CHGA 5DGIA 3GN1A 2E55A 4NL4H 1U3TA 3DBLB 2OGSA 2PYDA 4CM8A 3R9XB 3JQFC 2FNAA 4X24A 3UMMA 5TT0A 3TW0A 4PG4A 4H35A 2HLHA 3CUSA 4Y2SA 1T3ZA 4HKTA 3SQOA 1RBZA 1F7VA 4A08A 4Q03A 1M2OA 3D8SA 2PIAA 2C9ZA 4DMFA 5KHAA 4P5PA 4YMLA 4RC9A 1XTBA 5J43A 3GFBA 3GUYA 4W8GA 4QOJA 2UVQA 4HDOB 3PR1A 2ICAA 4LOAA 3V1TC 3OE4A 4XX0B 1PFQA 1YRWA 5JDIA 3ADCA 1GPMA 3NEPX 4G1BA 2W2XA 3M9LA 3GDHA 1ZNWA 2D7JA 3UWSA 4MWTA 2B6HA 3LY7A 3B9RA 2RH8A 1FEZA 3DS8A 2OESA 2VYVA 4URZR 1R0CA 1BKYA 4DA6A 4H0NA 1RLJA 1FW8A 4ZKDA 4UVEA 3QVLA 1DQRA 3HB7A 4L2IA 3LKZA 4U02A 2TMYA 3ZDQA 1L7NA 1CJUC 2I8CA 2WSSA 2OCPA 4YPFA 2OAEA 1Q7BA 3A2NA 4ESVA 1BJKA 3C70A 4R31A 1VG0B 4ZEMA 5JZVA 1V3QE 5K0FA 1AK1A 3QX3A 2PUVA 4MQ6A 3D2LA 3E3MA 5C2VB 3UBTA 1P74A 1P80A 5FTWA 2HK9A 1YR3A 4N9WA 2GJAA 13PKA 1ZR2A 4O2BF 1MAUA 2PEZA 5A03A 4I4TA 3IDOA 1TYAE 2I6XA 2G1PA 3QEMA 2DLDA 5GINE 4BQOA 3ND7A 3IHKA 4I46A 2OD2A 1KSGA 4DNPA 1X42A 2XXBA 2G9RA 4UHKA 5LMNB 4A0SA 1GNLA 1VPDA 1IMOA 2PKXA 1TZ2A 4BY9E 4TZ6A 4DJAA 3WK9A 4XTCS 4CHTA 1U2EA 5DNYB 3RRNA 4GYWA 3M5WA 3PF8A 4Y3UA 4A92A 3AJ9A 2IS6A 4KIJA 4K3UA 4OAOA 3WQRA 1PYOA 3TTSA 3BMOB 1YR7A 1VHQA 4N1AA 1L7VC 2BJWA 1K5HA 4XYBA 3CISA 5I3ZA 2B36A 4K9NA 3H2BA 5KX5A 1YONA 3H1GA 3QNWA 1Z2CA 4ZEVA 3JU3A 4DC9A 1H85A 5EIBC 4I4LA 3FVTA 4KKVA 4RLSA 4MMXA 2FF5A 4Y2YA 4R16A 3U56A 2V59A 5CEFA 4YMHA 4WSOA 4C2AA 4MV5A 1SWWA 1E1RD 3A37A 2Q5IA 3B7WA 1OB5A 1WY7A 1CU1A 4XIYA 2AOTB 4ZU6X 2YMQA 3E6AA 4NBNA 4JUCA 3PWTA 1G5RA 2JGRA 3BZWA 1OAAA 1QPGA 3U4GA 4N8DA 2P8JA 2WPNA 1EK6A 1E6UA 3EY4A 2NZYA 3TI9A 9ATCA 1QDEA 5L3QB 1ZJ5A 2IYLD 3ST7A 5JCOA 2AEFA 4TTPA 2WB4A 1ZCJA 3SNHA 1UBTS 5ITWA 1I5EA 2NGRA 2A58A 1JTDB 3NOVA 1ZM7A 4QUDA 4YJ3F 5JVDF 3ZVMA 1MORA 3VR6D 1Z82A 2FSFA 2HSGA 3LH5A 3VAAA 4HGRA 2PGXA 3C4QA 4YX9A 5K0EA 3C5HA 1VMKA 1NNEA 3PHGA 1KRWA 2B1IA 2O1WA 5TEWA 4Q4LA 1K4YA 3MT8A 4ADSG 5ECYA 5AKIA 4CLXA 3TXXA 4IW3B 1X80A 1Y3IA 1RI2A 5M5SA 3AVPA 4AS2A 3G88A 4DY4A 4F6LA 1N6OA 3AFOA 4D3XA 2MOKA 3Q8XB 5CCEA 4MW4A 4JLBA 5B4VA 1SBNE 1TYEB 1JILA 3SQMA 1A4RA 2ZKIA 4OX9Y 1GAJA 1LCIA 3W6OA 3WICA 3IT1A 3Q3HA 3B9PA 2Q2OA 1DTWA 3R3UA 1LW6E 1WE2A 4OJQA 2Q6KA 3MKSB 3P97A 3KBBA 1A27A 2WKQA 2WYIA 3W5DA 1D6NA 3QF4B 3OQHA 2Z9CA 4PSUA 5K3AA 1KFKB 3KYCA 3AF1A 3AM5A 1IQRA 4Z1MD 4KBGA 1SXPA 1NR7A 3G0CA 5F78A 1M6WA 3KD3A 3FNFA 3IALA 2ZSHA 4CV2A 2NQ8A 2B8NA 4BLUA 4P5DA 4ENTA 4EMBA 5AMSA 4DBLC 1PW5A 1A5TA 4GGDA 4YR9A 2G99A 1NVKA 3TQCA 2GJKA 5HOEA 2Y2VA 4CQJA 4RIFA 4G5XA 1ZRNA 3PKJA 1S9DA 1II0A 4Q00A 3E18A 1CSEE 3B85A 1YF3A 4ZALA 1T25A 4NJOA 5IKOA 3U4QB 4MYHA 2BGGA 3H13A 3GRCA 4MA5A 3VHRA 1EP3B 4ND1A 1RWQA 1MO6A 4CJXA 4CKWB 4FFWA 1FUIA 3LQQA 4MEAA 3G8BA 5FUQA 3AF5A 2ZDHA 3EI2B 3WNCA 1F9AA 4LRTB 2XXAB 3SU8A 4FILA 1Z68A 2FPMA 2QD2A 1P1RA 1JTFA 5EM2A 4P7FA 3I2KA 4H3HB 4A82A 4G6ZA 5I4BA 1UJMA 2WP8J 3D6HA 3ESRA 5CPBA 4QU5A 4JY7A 1S0UA 2GM9A 3MELA 3A0RB 3OFSA 5L8VA 2PA0A 1C1DA 1JXOA 1PR9A 5JTUA 1QGDA 4HWPA 1P2UA 1RKVA 4FFOA 2E1PA 4UZEA 2EIBA 3OKYA 4CMHA 1YI8A 3VR5D 2B69A 2WJYA 3IQDB 2V6BA 1ACJA 3TEJA 1O1YA 3T9BA 2V1XA 2BEUA 1RRPA 1WETA 3QEKA 3SC3A 3NHFA 4Q4AB 2R84A 4LI0A 3FJYA 4EHDA 5LSAA 2V9ZA 5JXIA 2W00A 2P2GA 3KLOA 4UUQA 2EW2A 2YNMC 4TKZA 4DCJA 1E6LA 3P0EA 3HL0A 1IHDA 1PD0A 3IPYA 5CLIA 1MX3A 4D96A 1YE5A 4PLFA 3AKCA 5AVVA 4MSUA 4NBKA 3FPSA 2FZLA 1XHFA 2EXXA 2RD2A 4JP2A 5DASA 1DJNA 1Q0UA 3UK0A 2H54A 2ECOA 4A3SA 4N7BA 1GKKA 3PIDA 2CLDX 1CUAA 3IERA 1LSJA 4J3FA 4U2FA 2ODPA 3CCCA 3M4YA 3CIOA 1N2IA 4BX9A 4M9SA 4UTXA 4H1VA 3I9V6 4AWXA 3UJCA 3DKIA 2ID8A 4UM8A 2OP0A 2K7ZA 3GFCA 2FG6C 1CV2A 1RC0A 4O02A 2W7TA 3TLEA 1CQXA 4YUAA 1UOQA 5DTEA 5T64A 2YQZA 2RJ3A 3GLGA 2VRCA 3EZLA 1Y7LA 1TUIA 5DN9A 2F64A 1QUFA 3BQ9A 3EDYA 1THMA 1YASA 3PGKA 4ZAFA 3ER8A 3GJZA 4MGZR 5DIZA 2IOFK 5DI3B 4NZZA 1DJMA 5I51A 4EB6B 2HDNB 4KPUB 2QN6A 4JJ6A 1YH3A 4ZCMA 3KEMA 4PSXB 3V1YA 1GL7A 4BKRA 1CEYA 3MXTA 1W7AA 1C9MA 4Y30A 2DHCA 3OT4A 2HM7A 2FZCA 1ID1A 5EXDA 3D3EA 1U9JA 4BNKA 4DLRA 1Z0SA 2PNJA 1XZNA 1UWKA 2WHRA 1KS9A 4TT3A 3O1HB 1OVGA 3WMXA 2VZ3A 1UC8A 5J4KA 2GQ0A 1GQFA 2RGUA 1FSPA 2XE8A 2RHBA 1NONA 1O89A 1M3SA 3G2KA 4GZ6A 3LPDA 3OJOA 4QDOA 3C7CB 3H87A 2Z2IA 3DLAA 2RGGA 5HKOA 3OTQA 4YRSA 3MAJA 2FX3A 4X7MA 1Z0IA 3CLRD 1IY0A 5D00A 5FWDA 5EKTA 2CC2A 2WKSA 4CXMA 1QANA 4F71A 3SDBA 1WXWA 2JRLA 3HDJA 4CMJA 1OROA 3IDQA 9MHTA 4ND8A 1KDYA 4F1JA 2R8YA 5JEDA 4C76A 4J03A 2OFPA 4MICA 1FMCA 1H4VB 2P3QA 1NPDA 3PJEA 4ARZA 1S2LA 2XX3A 1QKIA 2HJGA 1ZBQA 3T3PA 3JXEA 4GQBA 2FCRA 2Q4BA 4LYGA 1CC1S 2I29A 3EI1A 2D5IA 4BZZA 1LSOA 5E7IA 3BXHA 3SCYA 4WLUA 1DCFA 4LE0A 1DBPA 3ZWBA 3JQDA 3QG1A 3EOAI 2NQ2C 3HTXA 5FYQA 1XU4A 3O90A 2OLEA 2EKDA 2AA3A 3MZ0A 2IP2A 2HMYB 3SK0A 5KNCH 2EATA 3H3FA 1M2VA 5L3VA 2PBRA 1GNSA 3NW9A 4PAWA 2HUNA 2J5BA 3WB0A 1JFVA 2YNNA 4E1AA 5DYWA 2N42A 4GEKA 2XE4A 1UPXA 2ZYGA 1LWOA 3Q3VA 2ZGVA 5I7OA 2A5JA 1NASA 4MCIA 3GUZA 4XEHA 4X1YB 5HTOA 3QF7A 2QF7A 3EXEA 2ODTX 4XM2A 3NWJA 1Z0AA 2KWIA 3NFRA 1R0SA 5JO9A 2P7IA 2NU7A 1SVIA 3O4JA 2B1JA 3EXHC 4DCVA 4GLBA 2DWQA 4OHFA 2EP5A 2C99A 4DRZA 2IEIA 3T1VA 2BCJQ 5AVUA 3FDXA 1U0HC 3IOEA 2VDOA 4UHHA 1JKFA 4LYAA 1P6XA 1ZS9A 1EEXB 3WLTA 4QOSA 1P17A 3LPMA 2YXNA 2AEJA 3WLNA 4EECA 2I55A 4L6AA 3T7EA 5K9ZA 1A3CA 2GAAA 3P2JA 5KC8A 5KOYA 2CLOB 3QKSA 3KK0A 2FUG6 2QMOA 2R85A 1COWA 4X8MA 1A7JA 1GQQA 4WXPA 2XVXA 1O6GA 5AK0A 4H7FA 3Q15C 3P5SA 1SJ9A 4RTOA 4QTTB 3ASYA 2HIGA 3BE5A 2X7HA 4GNKA 3GL9A 4BC0A 3V4VB 3AR7A 3RFGA 2Q4DA 4GKJB 5CXCA 5BN5A 2XHZA 1BMFA 4OBBA 4MVJF 3BTVA 3BJMA 1PZXA 3A6LA 4LJ6A 2JCYA 2AN4A 1JEEA 1CF2O 4TUYB 4BFXA 2FVYA 5KI6A 1PWZA 2HRDA 2W2NA 1KJJA 4IIJB 1X7HA 4H7IA 4C6TA 1GPWB 2CO0A 4HBGA 3GRYA 2A7QA 2NAFA 4J2HA 1OTYA 4OHZA 1E4YA 4MQFB 4MKHA 2E0IA 4HMQA 4AQDA 3SIXA 4GOKA 4BO6A 4E4TA 3V1LA 5TS2A 2FP4B 3N2ZB 4TMKA 4MPDA 4Z8XA 3THWB 3O73A 3K8ZA 1ML3A 1IJEA 3ZHYA 2XSZA 2ACEA 3NXSA 4O5OA 2K7FA 3ZWMA 3HDHA 1U0TA 1E5LA 4IYRA 3B2NA 3M8KA 4ILKA 5K1CC 3OZUA 5M2QA 3B1WA 3G9XA 3KKNA 4IIFA 2QPTA 3IP7A 3ZNPA 3U62A 4R8LA 2X58A 4AFNA 3CZ9A 4O63O 4MW5A 2JFOA 1GQRA 5LD2C 5E95A 4U5QA 4MB6A 1Z0UA 3NV7A 1SC3A 4CF5A 2XGGA 2YV5A 4D5GA 3OSZA 3U9LA 3SXTD 1UKEA 4XGNA 3B3JA 4R0VA 4NCNA 3MGAA 4CL2A 3TDKA 3VPFA 3BG5A 1H2HA 2HO5A 5JALA 3C15C 4EI2A 2AKEA 1SUBA 2I80A 2O06A 3EGOA 5BNFA 5CJ2A 3I7NA 1ZR4A 3EPKA 2PZEA 4ZVRA 3CLTC 1VLZA 3K16A 4YWHA 3LHDA 1IWPB 4CG0A 3C7AA 1KF0A 5GWXA 3M70A 3ZE0B 3KP1A 2NSHA 4RAOA 4IGEA 4UARA 2H47A 1JUDA 5G40A 5CT5A 4Q48A 4CV3A 3FPFA 1AS2A 3WR5A 3Q5GA 2QRLA 3F6YA 2VDKB 3AR9A 3AW9A 2YMLA 3ROTA 2CY0A 4HNQA 1U0FA 2CJXA 1X6VA 4A11B 1P8JA 4MUHA 3BL8A 4NAUA 4MQEA 4UMVA 4AXXA 3O4IA 2AQKA 1O5TA 4BPBA 2G9UA 1OI4A 3PGXA 4O4IA 3PPVA 1DAPA 3LUHA 2NU9B 1KJQA 2CHVA 1EPUA 2D0DA 1VI5A 1ZOLA 1BXRB 1NW3A 2XCUA 4D4GA 2D3WA 3JYOA 2FEMA 3FETA 4ZCLA 2ZBDA 2BFFA 3ZS8A 1CK4A 5F2EA 5EIAA 1YR2A 2WLTA 4O3FA 2BR5A 3H75A 1XJCA 3G8CA 2QAGC 2ZRPA 3S2EA 4Q4HB 2NNWB 3LC0A 1P2FA 3I0MA 1ZC3A 1BD4A 3JQQA 2VJKA 4MCJA 2WWIA 4Q19A 3L4BC 1N8SA 4RVNA 2JAUA 4WGGA 4D8UA 2IGTA 2OO5A 4POOA 1YUNA 3V4RA 4GPBA 2ZU0C 1G21A 2E4AA 5IZ4A 5HBRA 4F2PA 2YHIB 1J2JA 2IHKA 2REQA 3L79A 1P77A 1D1TA 2ILTA 3CNBA 1J07A 1MJGA 1YDEA 1YJCA 3H42B 1W5FA 3SHTA 5EJEA 2HK6A 4G24A 3W34A 4W5NA 4FB4A 4Q18A 4C7KA 5FTNA 1DWUA 3QLJA 4L1KA 1ZEJA 2GXUA 4BE9A 1ADYA 4WNAB 2ZZMA 1JBEA 4REQA 2FQYA 3SYNA 3NTUA 1EBBA 3T38A 4HDNB 4A4DA 4KJZA 1UZUA 1VJ0A 3OP1A 3FMFA 1VCNA 2PSJA 1NZFA 3CT6A 5ALRA 4M8SA 1QFMA 4PCLA 3IJRA 3OY7A 4AO8A 1Q1EA 3D31A 4NZNA 4XUDA 1I36A 5FQNA 1SCDA 4QYIB 4KYTA 1E7QA 4JJ4A 1MT3A 2H6NA 4IWXA 1XEWX 1ATZA 1H2BA 1KFJB 3LRPA 1D4FA 3C8UA 2GXSA 2PZBA 1WMAA 2GPTA 3QXSA 4U7WA 5ALZA 4YV2A 1S2GA 1UZLA 1O5OA 4P9NA 3G89A 2NUAB 1WQ4A 1Z4NA 5CW2A 5HZGA 2VYVD 4F6CA 1IEVA 1KETA 3OZFA 3SXJA 3OJ0A 4G5GA 2JJ2A 5CDGA 1DCMA 1J39A 4EOGA 3SN6B 4PR3A 1XPJA 1PI3A 1XO1A 4BDTA 1EUDA 1ONBA 1F3OA 3V32A 3D02A 2YIJA 1ADFA 2W2KB 4EJSA 4FE7A 4Z54A 3U09A 3L8HA 1OXKB 3X1YA 5K45A 3EOBI 3ZD9A 5TPWB 2QRVB 1FRZA 3DAHA 3H17A 1EFCA 1L7MA 1NXVA 2ONYA 1ORRA 3QVVA 1R5OA 3HYSA 2GBIA 1W9HA 5JYDA 3N2GB 2HR1A 3WNQA 4OJMX 3GCWA 3VTAA 4QFDA 3O26A 3RU2A 3MUOA 1I32A 2HMUA 5K3SA 3EHDA 5TGDA 3OWXA 5FUWA 1XA0A 1O96A 1VZ3A 1XFAA 3FCEA 4NC4A 2NSJA 3KKMA 1FS6A 4RK4A 4E5UA 2JLRA 4CTNA 2PLNA 1ISIA 4GF5A 1CUXA 1R9MA 2QM3A 4O3UB 1IY1A 1NMXA 4DT1B 4DHWA 1IRIA 4FU0A 2OHJA 2DJIA 2JVIA 3TIFA 2IIQA 1M8PA 1NT4A 4EMUA 3I53A 3CLKA 4LTDA 3O21A 4XVQA 2O0JA 4BTVA 1D6MA 1CNEA 1QO7A 2VA8A 2MYNA 3PNVA 3WADA 4AKSA 4GS5A 3P0HA 4YHBA 3VI3A 2LCIA 2GAOA 3NGXA 2QROA 4YRDA 1NUPA 2C2ZA 4N41A 3PDJA 3V2IA 3MINB 5GZ6A 4ITVA 1OYOA 1RXIA 2QRUA 3EMVA 3RJ9A 1EUYA 2VZ1A 1CUWA 1QVAA 4M36A 3ADKA 1FUKA 4MQ5A 1T10A 4F6RA 3MMSA 3AONB 4ZVTA 1NWCA 4M1EA 2W2MA 1V3TA 2J48A 4QXPA 2RCNA 2QQ0A 1XEXA 2QTVB 2UVDA 1A95A 2W8BA 1CUVA 2ZM6B 4AP9A 4JT2A 1E7SA 2DT5A 1A9TA 1TKBA 4GMKA 2QT1A 2B6NA 3L93A 2CLMB 5JH7B 1FFEA 1LK7A 2Q3HA 3CNNA 1J25A 1UIMA 3EG9A 2RK6A 3T1QA 2FSGA 2J67A 1SVKA 1QGED 4A15A 3HFJA 3JSAA 3NHMA 2GEFA 2VWGA 2AX4A 5BW5A 3QMVA 3E8XA 2Z9BA 1E2BA 2NU8B 1FZTA 4Y18A 1BEZA 4EGAA 2HZBA