3IUNA

Appep_d622n opened state
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
682
structure length
672
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETNPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 207
structure length 672
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iunA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iunA01
5AM1A 1XLUA 4W1RA 3O4GA 3DNMA 1WPXA 3PF9A 5JZBA 3H2GA 1CUIA 4TPKA 5C8ZA 4MEAA 5HF8A 1BE0A 2XUHA 4PF1A 2AJLI 1JKMA 2PSFA 2XUDA 5DNVA 2GYVA 4ITVA 5FPQA 1UOPA 3FNBA 4DNPA 4NZZA 4ZGBA 2PU5A 1XKTA 4G4JA 5AI6A 3I6YA 3V1KA 2WHQA 1SCQA 1IZ7A 3HJUA 4X7BA 3G9TA 1R9MA 4DMCA 3T4UA 2VJBA 4QEKA 3Q8WA 1EB8A 1ODCA 1JJIA 1AMNA 4EBBA 3DS8A 4FNGA 3DCNA 4DNOA 3A2NA 5SYNA 3WK4A 4AZ3A 3QYJA 1R88A 3PUHA 3WKCA 1MO2A 1XRQA 3WQHA 1LPOA 4N5IX 4UBOA 2C58A 1WCYA 5JAUA 4B9EA 3ICVA 3STUA 2J4FA 5LZ2A 1H2YA 2ECFA 4XJVA 5ESRA 4MYDA 4BP8A 1W75A 5LZ8A 1XLVA 4B6GA 4CG3A 3I1IA 3H18A 3IUMA 1IVYA 4I3FA 3RARA 3G7NA 4MEBA 1XZIA 2PSHA 2VT7A 2WIJA 4WDRA 2XUFA 3I28A 2V98A 3LS2A 1UOOA 3WKEA 4P92A 1MN6A 5LKRA 1F0NA 5HZGA 3R41A 5LIPA 2QTBA 2WJ6A 3WZMA 4H7KA 5HQ3A 4Q3OA 5JD4A 1XROA 5ALQA 2WUEA 2OQIA 1FFDA 1VXOA 1ACJA 4J0KA 1W4LA 3H2JA 4J7AA 1XZCA 4CG2A 4HRYA 4CIBA 4GI1A 2WFZA 5FPPA 1EK2A 3HLKA 4JH0A 2OGZA 3STVA 4C87A 5AOAA 4XIIA 2WQZA 1ZD2P 4Q34A 2DR0A 4RE6A 4GWLA 4UFPA 4X90A 5I9IA 1XRRA 4B82A 2YXPX 2XLBA 4H7EA 1UT6A 2E3JA 3E0XA 4OYYA 3H0CA 4DIUA 5ALKA 2C0PA 1T2NA 1ODTC 3YASA 1CRLA 2V9ZA 5FOQA 3K2IA 1PJAA 1XRMA 1XQYA 2VAXA 3QM1A 1YB6A 1VXRA 1XRLA 1F6WA 2BJHA 1K4YA 1U65A 4IH1A 3CCBA 4Q3LA 5K3FB 1THTA 3BF7A 4EB0A 2BKLA 1D07A 1QIFA 4KE8A 3AFIA 4W63A 3F9CA 2QJWA 1AUOA 1EVQA 1XZEA 4UUQA 3AJAA 2ROQA 2XQKA 3RK4A 4CCWA 1QZ3A 5HF5A 1TRHA 4LIPD 5JATA 3BDIA 1Q84A 4B84A 5LKAA 5AOCA 1CV2A 2NW6A 3UMJA 2WKWA 1VA5A 2DHCA 1QIGA 2J3QA 2XDWA 3UUEA 1YR2A 1BEZA 4QLOA 2BGNA 3IULA 4UBKA 4XVCA 2QOEA 3BIWA 1GKKA 5AM4A 2CJPA 2Z3ZA 5DNWA 5EHQA 3I6ZA 1S8OA 3LCRA 3KDAA 5IVIA 3HABA 2FX5A 3G0DA 2HHAA 1DQZA 2CZQA 2Y1KA 1XZBA 5FRDA 1E66A 3P2MA 2G4LA 3HYSA 2VEOA 3H1BA 1CUBA 1TCAA 5HKBA 2HRQA 4KRXA 4DGQA 1GPKA 3CXUA 4CIAA 4F5ZA 4QNNA 3QPCA 4BRZA 4MQLA 3VVMA 5J3JA 4H0CA 3KWJA 4UPDA 5EGNA 4JYMA 1EI9A 5AI5A 1YB7A 4WY8A 1CUFA 3IURA 2GZSA 4P08A 2VJAA 4FOLA 5ALVA 1J06A 4Y2PA 5ALEA 3RKSA 2J3DA 2JF0A 5ALRA 1VZ2A 2WFMA 2C7BA 1SC9A 1DWPA 4DSZA 3C8HA 3TRDA 2X5XA 3WWCA 5AM2A 4OU5A 1IUOA 4OYLA 1OCEA 1ZIXA 2HADA 1KU6A 3VXKA 5SYMA 2DFPA 1XZLA 4X6XA 2QT9A 2VJDA 4ZWNA 5HQ3B 1GKLA 3M81A 2PBLA 2O7VA 1SCIA 4J3JA 1VOTA 1XZFA 4AZ0A 2ZSIA 1HL7A 4WCVA 3K6KA 1ORWA 3WL7A 4IQ4A 4BE4A 2XMGA 4ZV9A 3OG9A 4IHAA 2XUJA 2XMCA 3HEAA 3JWEA 3U1TA 1A7UA 1BU8A 3VVLA 4MYSA 1T4MA 4B0PA 4RNCA 1XQWA 3H2KA 3BJRA 5D7BA 4HXFB 1GT6A 4C4ZA 3QMVA 3IA2A 4QDOA 1CFJA 3WMRA 4X6YA 1QTIA 4OU4A 1W76A 1B41A 5DWDA 3WK8A 1UXOA 3WWEA 2ZSHA 1ACLA 3HZOA 1FFCA 2FJPA 1YAHA 3R3ZA 4HVTA 3AIKA 2JGMA 5HKAA 3WKAA 5BWBA 2OG1A 2FUKA 4WFKA 4B80A 4YX9A 4UBJA 4I4CA 5AI9A 4CCYA 1A88A 4WFIA 5CT5A 4WJLA 4UHEA 1H22A 4ETWA 3L1HA 2WU4A 1XQXA 3H2IA 5AI0A 5EHXA 1RWQA 5K5EA 2EDCA 4EY7A 4E11A 1TKRA 3CN9A 4FBMA 3F67A 3IUNA 2OCKA 5LZ9A 1AGYA 5JD6A 2JGIA 1XQVA 4M0MA 1VE6A 4FWBA 5A71A 1VLQA 3E1GA 4YK7A 3AZOA 5KWIA 1GPLA 3BE8A 2XMDA 3JYHA 3WJ2A 5K3DA 3MGAA 4BVJA 2C4HA 4C6HA 3B12A 3R3VA 3DKRA 4U2BA 5FKJA 5CMLA 3BF8A 4WFJA 1WPRA 1YS1X 4UBLA 1MU0A 5EFZA 5EI5A 1MX1A 1MX9A 4FDMA 6YASA 3QPDA 4UBNA 5AKLA 7YASA 4FFVA 4QA9A 1E3QA 1CUUA 2W6CX 3D2AA 3C70A 2O7RA 3PDCA 4OB6A 3O9VA 3GA7A 5BWCA 1XKLA 3D7RA 5AKIA 1DWQA 3H17A 2I3ZA 3C5WP 1DQYA 2QXUA 5H3HA 2HRRA 3STTA 3OM8A 1E8NA 1GGVA 3STWA 2XUKA 2RGUA 2OAGA 1R9NA 5CH5A 3WK5A 5C8XA 4AO6A 4BZWA 4Y2XA 4NS4A 2WG2A 3ESBA 5JZ9A 2AJBA 4ARBA 1JU3A 4W1QA 1IUPA 1FSSA 2RIPA 4A23A 4BYMA 4K6GA 3S8YA 1UK6A 3WWOA 5AM5A 1XZKA 4J0JA 2VAVA 2R11A 1ZJ5A 1EX9A 3C6BA 4AN1A 1XZJA 3DL4A 4GEGA 1W6RA 4LKOA 5ALNA 1OXMA 1CUDA 1C7IA 3NUZA 4EY6A 2WIKA 2IITA 3R3WA 5LZ5A 4JNCA 4M0FA 1YAJA 5AK6A 4AO7A 4U2DA 3ZLVA 2PU7A 1K5PA 3ESDA 3WIOA 3V1NA 1DT5A 1LBSA 3MUOA 4N5HX 1SOMA 3G02A 3FVRA 5LLSA 2G5TA 2WIDA 2RHTA 3SK0A 5HFNA 5AM3A 3WL5A 1X2BA 4DYHA 4UHDA 1QTRA 3LP5A 4X93A 4U2FA 4OCZA 1DU4A 4QDTA 4U2EA 2W22A 3R3YA 3QMWA 4H18A 3W9BA 4KR0A 4FNMA 1AZWA 4B9AA 4H35A 2XQFA 5JANA 1CVLA 3HC7A 1UFOA 3C6YA 4QWMA 4Y2VA 2G63A 3L1JA 1QFSA 4V2IA 4E46A 2HA5A 4PW0A 2Y2VA 1LPMA 1SFRA 3FYUC 4Q3KA 5YASA 2QKYA 4EUSA 3O4JA 3BWXA 1AQLA 4CCYB 4P93A 4MJ3A 3DJYA 1QIEA 3SWWA 4FBLA 5FP0A 1GQRA 3DL7A 3QVMA 2I78A 3ESAA 4CFSA 4HRXA 1EA5A 4X85A 2JGKA 2OGTA 5T4EA 2H7YA 3F98A 3R3XA 3S2ZA 1TCBA 3GUUA 5DLPA 1BN7A 1JU4A 2P8SA 4GXNA 5CT6A 4KAJA 1N5MA 5A2GA 3QITA 3FLAA 5ALWA 3UUFA 4E15A 3DEAA 3WI7A 1O6GA 3AILA 1RP1A 1BROA 2JGLA 3G8YA 1ZI8A 4Y7DA 4Q82A 2EDAA 2GBIA 5AICA 2QJRA 3DOHA 5E2IA 2BGRA 3AZQA 3V48A 5C7YA 5CH8A 2HIHA 1CUJA 1ZIYA 1DX6A 2VSQA 4J0HA 5AI8A 4JYPA 2QRUA 4L0CA 5ALGA 5HF6A 1CIJA 1ZI9A 4E14A 1MNQA 3I6MA 3M82A 1B6GA 4BATA 1DT3A 1EDEA 3DYVA 3IVMA 1CLEA 2RI6A 4G1FA 5K3CA 3STYA 3LLCA 3IB3A 3ANSA 5AJHA 4J03A 2QVBA 1EDDA 5ALUA 1G4HA 1K8QA 4FFWA 1FFAA 4QDZA 4UHFA 3DLTA 4P9NA 4BBZA 4FKBA 2HA3A 4FLEA 1H2WA 3EF3A 1ORVA 5HK8A 5C81A 5CXUA 4PSUA 2H9YA 3K9BA 1DX4A 2ZYSA 1XFDA 2WM2A 4YASA 3VJLA 5CT8A 2PVSA 3G0IA 1Q0RA 2OLEA 2OAEA 4QLAA 4L9AA 3FYTA 5AOBA 3QMMA 4H7DA 1QE3A 2DHEA 5ALXA 1PV1A 3OTQA 3BJMA 1VKHA 2QUBA 2AJDA 2QMQA 4BAUA 4X6UA 1X2EA 3FLEA 4G8BA 2JGJA 2PM8A 4DNQA 4G4IA 5DJ5A 5A7HA 1LPPA 4C4XA 1QLWA 5KBYA 3H04A 5IVKA 1I6WA 2XUOA 1KU0A 1CUWA 4X71A 1QIMA 1AC5A 1VA4A 2YH2A 5FV4A 2XMRA 1M33A 1QO7A 1NU8A 1CQZA 1L7AA 2BAGA 2AJ8A 2RHWA 4GW3A 2X76A 4YPVA 2GBCA 1R4ZA 2CUTA 1YA4A 4Y2JA 4C4YA 4QE3A 2I03A 4FTWA 3FWHA 3WK9A 4DM7A 4IO0A 4AMZA 2GBFA 3WYDA 3AIOA 3VJKA 2CKMA 3H1AA 1MNAA 4NMWA 2DQYA 4DLNA 4J0DA 2R8BA 3PFCA 2ACKA 2DHDA 2HA0A 3WL6A 4ARAA 5K3EA 1QIJA 4AB1A 1F0PA 3GZJA 4U2CA 5AKHA 1YS2X 4BCDA 4Y2QA 5T4FA 3HRHA 3KWFA 2PKYX 1XLWA 1SCKA 1HLGA 5AKJA 4BAZA 5KREA 1WM1A 5EIEA 1ZI6A 1UZAA 2PUHA 2D0DA 2ES4A 5AIAA 2HFJA 4MWSA 2XUQA 2EEPA 3C45A 3EQ8A 4BTLA 4X91A 2XQGA 2HA6A 3W04A 5A7FA 3G0GA 1TK3A 2IX9A 5BV7A 2QS9A 2WU3A 3QZUA 3I1YA 3JW8A 2WJ4A 5AI4A 4BP9A 2PSDA 3I2HA 1CUGA 1QIKA 3HXKA 2GZRA 4Y2UA 3D0KA 1H23A 1Z68A 5JD5A 1WHTA 3HI4A 3I2JA 2GYWA 4F0JA 4LXHA 3IIIA 4DSAA 2OQVA 2VT6A 2BUAA 3GFFA 3FYUA 1XZDA 5D6OA 1MJ5A 3WKDA 2VA9A 4BC0A 1XRNA 5AHXA 5E4JA 2FJ0A 3KD2A 1UKBA 3LIPA 5A62A 2XUAA 4OD0A 2PPLA 3M83A 3DOIA 4Q1VA 3ILSA 1ZGBA 1U2EA 3O4HA 1F8UA 3I2IA 2C0QA 2AJCA 4X95A 4UFOA 1CUCA 1AKNA 3R40A 3W06A 1KEZA 4LYDA 5JADA 3GROA 5CXXA 2ZYIA 3TEJA 1TCCA 3WWDA 4AO8A 3QBJA 3KXPA 3EBLA 3H2HA 1EK1A 3FSGA 3OURA 4RPCA 4BRSA 1EVEA 1RYYA 2O2HA 3C87A 1A8SA 2V96A 2XQJA 1HPLA 5ALOA 4MQMA 1TQHA 2XUGA 4BCCA 3Q0TA 4Q05A 2CMFA 1MX5A 2WUGA 2ORYA 3WJ1A 3VDXA 1MT3A 4HXEB 1IUNA 2Z8ZA 2PX6A 1OILA 5JARA 4J0IA 3FCYA 5HF9A 2PL5A 4EA6A 5LYYA 1P0QA 3KSRA 1LPNA 4HS9A 5AK5A 2WTNA 2JBWA 3OOSA 4XWGA 2B9VA 1CUVA 1QGED 2HA4A 4N8EA 4UBMA 2Q0XA 1CUZA 3WA6A 4K6HA 3DDUA 5AKEA 3IBTA 4FLMA 3A2MA 3BIXA 1CQWA 4GDMA 3X3HA 5CBKA 3FAKA 3ESCA 4AMYA 5FDFA 3PICA 4KE7A 1Y7IA 4DTCA 5ALSA 5AH0A 2GBGA 5ALDA 4H7FA 4FLFA 4OUKX 4H7IA 3A6ZA 5LP1A 3N2ZB 4KYVA 3D4LA 3D3NA 4UFNA 1H2ZA 2ZJ7A 4JUIA 4BVLA 2JEYA 2DCMA 5JASA 3WYNA 3FSGD 5K3AA 1FFBA 4BVKA 2HL6A 4OSEA 3OC0A 2Z3WA 3SC2A 2XMSA 3A70A 3E3AA 1R1DA 1JJBA 4KE6A 2XB6A 3WLAA 1R3DA 4J0GA 1A8QA 2CBGA 4MXDA 4QDUA 4WDQA 5AO9A 2OCLA 2UZ0A 5T4HA 1MTZA 1C4XA 2WILA 1QFMA 5D3KA 4AX4A 1CUXA 3WK6A 4C88A 1JT2A 3E4DA 3WZLA 5AIBA 5AKYA 5DTJA 3FYUB 2HU7A 3O0DA 2XUPA 3B5EA 2ONCA 1VE7A 5AKKA 3ZPXA 4QWWA 1WOMA 1UWCA 4N8SA 2Y6VA 4BDSA 2ZYRA 3RM3A 1Y7HA 3FVTA 1UOQA 2XLCA 2VF2A 3O9MA 3D2CA 2C5GA 1K6EA 4EZIA 1LZKA 4H77A 4LHEA 4EY8A 4QZVA 5ISMA 2ACEA 1YASA 3H19A 3V1LA 4OPMA 4X00A 4DNFA 5FXMA 2X8BA 4IH4A 1LLFA 5JAPA 5HK9A 2O2IA 1H2XA 5CRIA 3G9XA 1DTEA 3PF8A 5ALMA 4GHWA 4KACA 4I19A 3DYIA 3HACA 5AK4A 4BC1A 4Y2YA 1EINA 2Y6UA 4B7ZA 1CUEA 5ALIA 4KAFA 1E89A 4RGYA 1E5TA 1ZD4A 1TAHA 4TGLA 1HBJA 1ZJ4A 4A5SA 2JGFA 2XMZA 1JJFA 1HQDA 2HFKA 4GLBA 2WIFA 3FBWA 5AKXA 1CPYA 3AUKA 4EY4A 1U4NA 5JAHA 1QIHA 4K5QA 1EDBA 1YA8A 1BCSA 2XE4A 4BTVA 3RLIA 2WG0A 5FUMA 2LIPA 2CB9A 1CUAA 2QR5A 1L7QA 3NOXA 1JI3A 2C5FA 3WWPA 4GBGA 2VQ6A 3BXPA 1J1IA 3FCXA 2J4CA 1E8MA 1Y37A 4U2GA 1HDEA 4UBIA 5ALJA 2HA2A 4D9JA 3ZLUA 3D2BA 2HU5A 4B83A 3GBSA 4HZGA 2CEKA 1J2EA 4Y2TA 2B4KA 4X3CA 4K2AA 2WG1A 5JALA 5BOVA 2ZJ6A 4Y9SA 3SX4A 1G66A 1L7RA 4DMFA 1R50A 3HSSA 3WIBA 2OPHA 3M3DA 4L72A 1LGYA 4GECA 2H7XA 5DYTA 3U0VA 5E4YA 4G5XA 5DYWA 4PSCA 3IUJA 1N5RA 3GELA 1QOZA 2Y2UA 3NGMA 5AKZA 1ODSA 3T52A 2WHPA 5IVDA 1FFEA 4AN0A 4RE5A 4UHBA 3PFBA 4PO3X 3I2FA 4B85A 4EHBA 1ZD3A 4B81A 1J07A 2BFNA 2OXEA 4G8CA 5I7UA 2QUAA 1XZHA 3F8SA 4K6KA 5CTAA 2GYUA 1UK8A 2WIGA 3BDVA 4HTAA 4W9RA 2ZJFA 1NX9A 1G42A 1JMKC 4CG1A 4X92A 1LZLA 4FHZA 3TJMA 2WFLA 5A6VA 1VJ5A 4DMKA 5IH7A 1U8EA 3ZI7A 2WUFA 5ALTA 3ZV7A 1XZAA 1GXSA 5JZSA 2B20A 4QDXA 2PSJA 2WSLA 2XMQA 2BUCA 4Y2RA 4KAAA 2H7CA 5EHNA 3AZPA 1GPNA 4INZA 1NU6A 4HAIA 4PNZA 5ALPA 1CUYA 1UK9A 3DQZA 1CR6A 2XI4A 1ZD5A 5ALFA 4J0CA 3BL8A 2WTMA 1G5FA 5IKXA 2OGSA 2XUIA 1UK7A 3WKBA 4HXGA 4BCBA 4O08A 1LPSA 1YCDA 2JEZA 1CEXA 5ALYA 2QXTA 2QM0A 5AKGA 5AP9A 3W05A 3MVEA 1QJ4A 2VATA 3R0VA 1XZGA 4DMHA 4C01A 3FOBA 1HKHA 1W52X 4L3WA 4AXBA 4AQDA 2BUBA 4KRYA 4ZREA 4BB0A 3C43A 1XRPA 4ROTA 1K63A 3L1IA 1FJ2A 2JGEA 2RAUA 4W1SA 3C5VA 5CT9A 4Y2SA 1JMYA 4LXIA 1WHSA 5CW2A 3ICWA 1WB6A 1ZGCA 3AINA 1E8DA 1LNSA 3A2LA 4TVKA 3C8DA 2Z5GA 1W1IA 2HDWA 1GZ7A 4ZXFA 3V9AA 5DNUA 1C7JA 1CUSA 3EQ9A 1QIDA 2HA7A 4ZI5A 1AX9A 3W9UA 3G0CA 4XX1A 5D3ZA 4G4GA 1A8UA 4BZZA 3G0BA 4MWTA 1EXWA 3DD5A 4UHCA 5EHZA 3WA7A 5LZ7A 5LZ4A 5K3BA 2PUJA 3R3UA 1DWOA 2ZVDA 5HFAA 1THGA 1BCRA 2XQIA 2JIDA 2RONA 5AM0A 3IUQA 5ALLA 2VJCA 2XMBA 4OB8A 3G9UA 4S0XA 5KWJA 1Q83A 4ZV7A 2G5PA 2I3DA 4B0OA 1P0PA 1EB9A 1IZ8A 1LPAB 2Z8XA 3WK7A 1IMJA 1P0IA 3QPAA 4F60A 2QZPA 3C6ZA 1EH5A 1ZICA 3VJMA 2YYSA 1BS9A 2WJ3A 4A16A 3STXA 3VKFA 2BCEA 2WHPB 1Q0ZA 5JYCA 4PQEA 1BRTA 2DQZA 1UKAA 5JAOA 4C89A 4BDTA 1MAHA 1P0MA 1QO9A 1CUHA 2V97A 1ZOIA 4N8DA 1VZ3A 5EIAA 3ZWQA 5C8VA 2O2GA 3MUNA 4G8DA 5DTIA 1MAAA 4OB7A 4KEAA 3F96A 2DSNA 1TIBA 1PFQA 4X97A 1ETHA 3EIOA 1BN6A 3B3QA 1WB5A 1BEEA 3PE6A 2WUDA 5I8PA 1QONA 2WFLB 4NVRA 5EIHA 3CCCA 5A7GA 3EQ7A 3I2GA 3CN7A 3PUIA 4H7JA 3QH4A 5F4ZA 2XT0A 4PSDA 3ZLTA 4KJXA 4LXGA 1LBTA 4X94A 5T4BA 3DKKA 3D5EA 1X70A 3WL8A 2YASA 2H1IA 4EY5A 5CURA 2K2QB 2PSEA 4W1PA 2ZYHA 2B61A 1O6FA 1EHYA 1YSCA 1QIIA 2WHRA 3OPMA 5CH3A 1N8SA 5DYYA 3NWOA 3I2KA 2IIVA 5IVHA 3C6XA 4ZRDA 4PV7A 3PI6A 2VTVA 4KE9A 3TGLA 2D5LA 1JFRA 3G9ZA 1ISPA 1USWA 4JEIA 1WB4A 3ED1A 2HU8A 2WLSA 5E4TA 3ANTA 4FMPA 4H7HA 1GQSA 1LPBB 3F97A 4BE9A 3N0TA 5AK3A 3O95A 3AIMA 5ALZA 4Z49A 5K3FA 1XZMA 4M0EA 4WY5A 1DINA 3W2TA 1UKCA 5FLKA 5CT4A 3IDAA 4G9GA 4BAGA 3KOOA 2HM7A 5HCUA 5ALHA 2AXEA 3VISA 1N1MA 2OCIA 4LYEA 4UHHA 4IH9A 2OCGA 4G9EA 1MPXA 1AURA 5JIBA 3LIIA 3V1MA 3FLBA 3O4IA 4F21A 4CI9A 3D59A
chains in the Genus database with same CATH superfamily
2YV1A 4AJJA 2BEWA 4R2WA 2PWPA 2YNOA 2CNOA 4A0AA 1O6ZA 1BCRB 1G8JA 4Q16A 1SULA 3RTEA 2D62A 2DERA 1S01A 1HNNA 1UOPA 5KQSA 2BM9A 4G25A 3R7FA 1P7WA 3WY9A 1IVSA 2ATVA 2YN2A 3ZR4B 1N3IA 2LP4Y 1D2MA 5BN3A 1C3JA 5JW6A 3ICQB 4MTCA 1Q1EA 4Q1BA 2Y27A 3MTJA 1X1BA 4ENTA 4AKHA 2QUIA 5KEIA 2WBLC 1DAKA 3I30X 1BWQA 4ZKDA 2ZRQA 2GN4A 2ZROA 1JQ3A 4Q47A 3QNWA 1I2DA 2IYAA 1XZIA 2QL9A 2WIJA 2X8JB 4FR5A 4N47A 1TUBB 2YV4A 5WRFA 2R60A 3CUVA 2OQ2A 3MXOA 4HDAA 4FILA 5HZGA 2GXUA 3NH9A 4JJ6A 2B3TA 3LCCA 2PD4A 1L8LA 3NHAA 3Q6MA 4N65A 4N12A 4YGYA 4A8JB 3TQRA 3HY4A 3LUFA 1PT8A 2CCGA 4HQRA 2O4UX 1ADFA 3THOA 3CIKB 4KQHA 2NUTA 1M1YA 3L01A 1EP9A 4QELA 3JVDA 2EP7A 1V1JA 3NAMA 3AFIA 4JJFA 3PIRA 5KS2A 3MBOA 2BFEB 3L84A 1XZEA 1ADBA 2ZSFA 1VKOA 4J2HA 4PG6A 3SLGA 1A77A 3GEGA 4KPFC 2QUKA 3RFTA 2FMTA 4X61A 2AUNA 4IWNA 5ADUS 2X2OA 5LKAA 1K5GA 4N5NA 2Y0EA 3ET5A 5GOZA 4PFKA 4RPJA 4NZPA 3SYLA 4RELA 3MC1A 4XFKA 3IEMA 2DU8A 4ZYZA 1BEZA 2BGNA 2WSSD 2XXBA 3IHKA 4KLNA 4ENVA 3UG6A 3LCRA 2YVUA 4ZRMA 1KEUA 2AXPA 3RSEC 3OL2B 2FX5A 4ER6A 3R5HA 3MRSA 3UMRA 2OFXA 4HPJB 5E7QA 4BBJA 5BR7A 4D98A 3KZCA 2YBAA 4O1IA 2GC7A 4XQGA 1JMXB 1EA7A 4XW2A 1CW2B 3IRUA 1Y9AA 5I7VA 2EC5A 2IZ1A 1FPQA 4KPGA 3LLUA 4MQLA 3ORSA 3RS0A 3Q9NA 4DLWA 1HL3A 3W2GA 1EI9A 1JH8A 4WY8A 3Q8KA 3I45A 4XIFA 3GB9A 3BBPA 1YMQA 1TXGA 1RXSA 3I0NA 3TCNA 4WW0A 2ZUSA 4NYMR 4F84A 1TJPB 2NGRA 1DXYA 2PLRA 3IE0A 2GETA 2Q7QA 1NGSA 3SG0A 3W3AD 3DBHB 2LPMA 3KT6A 1YB2A 3EC2A 3ID6C 4OQQA 4C6TB 2PMKA 4O4LF 4WV3A 3K70D 3HEAA 5EXSA 1W0KA 4GSKA 1U99A 3L8GA 2XYQA 2Z2PA 4CMIB 5DRYA 1WPGA 2VBFA 3SSMA 4FHFA 4F38A 3CLRC 3ZWLB 1PSWA 7MHTA 2JARA 4TWRA 3HKEA 1XALA 4R01A 4YCCA 2ENWA 1P4RA 1YE3A 2NMVA 1M1UA 2EJBA 5ANRB 1B6TA 4MMYB 3VAYA 1AN9A 4RTJA 1UMBA 4TQAA 1MUUA 1U2QA 3I8EA 3GUHA 3UK2A 4HWPA 2OG1A 2FUKA 1E2GA 1NN1A 4QOSA 2NUPA 1B1CA 5AI9A 5DK4A 2PWYA 1OC2A 3KWMA 1UFVA 1W34A 3L1HA 5CVEA 3WGNA 1QRTA 1KKMA 2EDCA 1K7XB 4LC1A 3KJFA 4B46A 1AGYA 1GSAA 3LKBA 3MINA 3EXAA 4LDQA 1VE6A 4EFDA 3LY7A 2QSJA 3G23A 2FPXA 3WJ2A 5BPFA 2H4HA 1ZYUA 3ANNA 3MGAA 3U7EB 1OU0A 2ZIZA 3IEPA 4RTRA 5FKJA 4PYJA 3TFWA 4X41A 4OI4A 3RYHA 4UBLA 2VF7A 1MU0A 1DEOA 1ULTA 1NIJA 1XHEA 4BHTA 4B73A 4RSMA 5FL3A 1E3QA 3KQKA 3L77A 1P6UA 2CFSA 4YECA 3Q4GA 3JQPA 3EA0A 1A2KC 1WVGA 3R7NA 4Q4HA 2WP0A 4TS1A 4G0QA 3L8DA 4DL9A 1IXYA 2JBHA 2CLSA 2HJ9A 4UJ3A 2QUJA 2ODBA 3H8JA 3ESBA 3HBAA 1A7AA 1KQPA 3LXXA 4D74A 3S1AB 1ZINA 4XM1A 1E0AA 4IEFB 2UZXB 5U1PA 1S9DA 2DH6A 1PR1A 3EQ2A 2P2DA 4U2DA 2DGDA 3ZZNA 3IDOA 2ST1A 2NU7A 4G89A 2QENA 3DC2A 2RHTA 1DC7A 1LC0A 3PGJA 2XMPA 5LQDA 3ZQKA 4FZRA 4FYPA 4DYHA 2VDVE 2PYZA 2HF9A 4KLCA 4K40A 1IN7A 4BQNA 2VJNA 3IQXA 2J6IA 1PFUA 1RJFA 4M1SA 4GXQA 2COEA 4Y2VA 4QOJA 5JWOA 1KI7A 4V2IA 4RW0A 2CFIA 2HA5A 2GWHA 3K9QO 1F60A 3R4CA 2ISSD 4DLBA 4L4ZA 4EUSA 5CXCB 2WVHA 4Z9YA 4O3MA 4DHEA 4FEGA 4XLZA 5AMXA 4OQLA 4YYEA 5DTMA 3OJFA 2GD0A 3WYBA 2VF5X 1IH8A 1L5KA 3RRBA 3TI9A 4JDUA 1QHSA 1Q1ZA 2IY7A 3R3XA 2XCIA 3BWYA 2BY4A 1NQOA 2AMVA 3A9TA 3HBNA 1GSHA 4KHZA 3NANA 3AC0A 4B7AA 2YWRA 3T7DA 1O94C 1O6GA 3E0CA 4TKZA 1SG9A 3DXKC 5L3ZA 3TJRA 5J4VA 4CKWA 4CF5A 1MRSA 1ZCAA 4FOOA 1Z22A 2VLIA 1NI4A 2J5KA 4Z0NA 3VA7A 3PHHA 1TTTA 4TQ9A 3GWGA 3C41J 1Z62A 1BW9B 2EERA 2OZPA 2XA9A 2YZNA 1YJ8A 2EKQA 5AHOA 2FMKA 4K7JA 5BN4B 3QIAA 1HI9A 1O08A 4XWWA 4JLUA 3DLPX 3NV7A 1WW2A 4QU5A 3RVQA 1NJ5A 3N2GB 3CUYA 1G55A 3AHFA 2ODPA 3UK1A 3U5ZB 3MXXA 1MXFA 3DAOA 1J0EA 3GDOA 1E1RD 2PVSA 2OAEA 1GL3A 1SQ9A 2JFBA 5C8YF 2CE2X 3LT0A 2ZAMA 3M4JA 4RO0A 1RJGA 3FCUA 3X1JA 3OLXA 3IO3A 3ZGXA 1FX0A 1FYDA 3UW3A 5JSUA 3CLRD 4J8GA 2M1ZA 2XE7A 2R1TA 1OA1A 1HLFA 2XGJA 1TYAE 2EJTA 5DK6A 4Z5XA 5HIKA 1NBME 2ZRFA 3QEMA 3FYHA 3PC4A 5BRAA 4A03A 4RZQA 3VV2A 4MSUA 5DLDA 4DJFC 4C4YA 1G9SA 2I03A 8AT1A 3WK9A 4QLBA 4JR0A 3LDHA 4V0RA 1A8HA 1JEQB 1Q7RA 3PHCA 3IL2A 5JUWA 1XKXA 1GOHA 5BN5B 4BGEA 5LDGA 4YRFA 3GZJA 2DWCA 4Y2QA 2YBEA 1XNHA 3GUVA 4BOYA 4Q5IA 5AKJA 4AJOA 3DVAA 2WM8A 1D2AA 3JQDA 1TYQC 4ZI2A 3LYUA 3D5TA 4PAMA 2IEAA 1VL5A 4B2LA 1Z6QA 3CQ9A 1V9LA 4JEUA 5EJEA 2PSDA 1CUGA 1TA9A 4LGNA 3H7AA 2Q9CA 1RRVA 3GD5A 1A9RA 3GGSA 2GYWA 4JSVC 4BLRA 1Z83A 4NJOA 1G16A 1Z06A 1GL7A 1IWOA 3NBYC 2I0RA 3IPXA 4L50A 1JR4A 4BUZA 4P3KA 3KQLA 4IQ8A 1OIVA 1XRNA 2GPSA 4Z4IA 2JAOA 1L7NA 1RM4A 4RCZA 5TQ0B 3LPAA 3OVMA 3ROXA 3EVAA 3OJXA 4N3BA 4R4JA 3W06A 4P34A 1PDOA 1NRXA 1ONOA 2RCYA 1OIWA 3TZCA 3HHEA 3QBJA 4P2BA 3EZYA 1WXHA 5FORA 1EGAA 4XQEA 3OIFA 2WTUA 5IDWA 1JKFA 2XQJA 1I7SB 2IEZA 4IXMA 4UZFA 4Q9DA 1MX5A 3JSAA 3GFCA 2M2IA 2ORYA 3WJ1A 5TGZA 4HXEB 4LI0A 4ND4A 2V4UA 1OILA 4J0IA 2OXCA 3SLKA 4FQ7A 4PSWB 1OX4A 2V6BA 3KSRA 1OH8A 3I8XA 2X4GA 4YJHB 4IGKA 2OCXA 5AK5A 5AESA 5JQGA 1LBQA 4M0CA 3IOCA 2BFCA 2NYUA 5KSPA 3BTVA 4ZVLA 2VP6A 3HB7A 3CA8A 4WXYB 3RASA 5EKDA 2P4HX 5CK5A 2ZS7A 5LOVF 1AHIA 4US0R 3V4LA 3P9NA 5EE1A 1IU9A 4JUCA 2OHFA 5SZJA 4DQKA 1IM5A 4LRTB 3BS4A 2ID8A 5H02A 1Y7IA 3RNOA 1QU3A 3TR6A 4MYTA 1DTWA 3IV7A 4OQZA 1EVLA 3A6ZA 3KRWB 1GD1O 1N5KA 3CSSA 3WWYA 1N6KA 3D4LA 2AN3A 3IESA 1KHTA 5L9AA 4UFNA 1NJFA 2DUWA 1IBKB 1K9SA 5JJIA 4CMHA 1C8KA 2VKTA 3HJHA 2HYIC 1O94D 1RQRA 1ULUA 4RF5A 4DIKA 4C4OA 3KB6A 3OC0A 3KDPA 1IONA 4F4JA 4DN6A 4DNXA 2OD9A 2PTGA 2A9JA 5FYDA 3THWA 3EVBA 3RRMC 3UJNA 4XRGA 1NF9A 3II6X 1GCGA 1NBIA 1EU1A 2Q5JA 1X80A 4KYIB 3DMYA 4XUEA 3E4DA 1OFIA 3ROTA 4HQLA 1VE7A 3W8RA 5JC8A 5AKKA 2C2XA 1H05A 1OAAA 4Q7EA 2ZUEA 2OL4A 1NUSA 3MK31 1ZU4A 2FPIB 1CJBA 3D0OA 3E9QA 1ZUNB 4RQAA 3GT4A 4MUKA 3OWOA 2DQKA 3V2GA 1KRHA 4NYIR 1SK9A 2ONKA 4RMHA 1YASA 4ZAFA 5D01A 4E2FA 5L6LB 4KYUA 3QOWA 2PGJA 2B5OA 2Y0CA 3LHIA 3ZVKA 1JNXX 5JD3A 2ZR7A 5IKOA 1S96A 3QLUA 1RSZA 1E7WA 3THSA 9LDBA 2DJIA 1U90A 4GLBA 1U7OA 3RG8A 5K8IA 3QKRA 2DBVO 4HD8A 2RBGA 1RC0A 4AY3A 1FTQA 3JD2A 4B45A 4BTEA 1CUAA 2O5EA 3G89A 2Q9AA 3IT3A 1ZNXA 1W5FA 2VAPA 3MTBA 3BXPA 3OCUA 3UAGA 1KORA 3CF4A 4TL8A 1FSPA 4G1BA 3GFVA 4JHLA 2HU5A 2OEPA 3SAJA 1J2EA 1E0DA 1BQEA 2Q9UA 4O4HA 3GV0A 3A05A 4RABA 4D79A 1F14A 1UC9A 1VCOA 3CS3A 3JATA 4B7CA 1MVNA 5FTJA 2PX5A 2OECA 3W1WA 4X20B 3PFBA 1SBIA 4PO3X 1P3Y1 3THYA 3E2PA 3I37X 2VPYA 3S68A 4GC9A 4G8CA 5HNKA 3R3JA 3I9KA 4NHEA 3AJRA 3PGMA 3MRTA 4PO8A 2WE8A 1VJTA 3T3IA 4FYKA 5DLYA 1N4DA 4X92A 1FU8A 3JAKB 2DM6A 4WECA 3RTBA 4Y9UA 4RXUA 4F9GA 4M9XA 1BSVA 2DF8A 2VI5A 2B20A 3ICPA 5KNDD 5L40A 3JWJA 4BB6A 3NPMA 2PMDA 2J3EA 5COAA 2H5LA 2P9HA 4XVUA 1YOBA 3M5CA 5FNVB 3LYHA 4HAWA 5CYOA 1UK7A 5DOZA 1KFCB 2ODTX 1JV2B 4OHUA 2FPGB 1HFWA 4K3ID 1F6DA 3WTBA 4NBVA 5JO9A 3P9XA 4WMLA 4A11B 4M8IA 2QRVA 4LXIA 4L02A 8ABPA 3I01A 3UMFA 3A3OA 3U3KA 1QZTA 3Q0EA 2V6MA 1OKKA 1T5BA 3KZVA 2HDWA 3SNKA 4BMVA 3OIDA 4CHTA 1W2WB 4LNAA 3LF2A 1QTQA 1II0A 5F2KA 1T5IA 4GM4A 4CQJA 1MQAA 2I7CA 4C29A 3K30A 5IULC 1OZHA 4JSXC 3WA7A 2AEMA 4DUYB 2G88A 4XUDA 3C7DB 3EXHC 4F12A 3U4QB 1THGA 3JQ9C 3LPMA 2HJRA 1T2CA 5FO1A 5AM0A 2C5BA 5G3YA 1UDBA 1XCJA 1JE0A 4JOQA 2QQFA 4XPIA 2YRFA 4D7AA 1E7SA 5A5GA 1QG2A 3A7EA 3KEMA 4DR5B 1KDRA 4XJTA 1GRRA 4X1IA 1ZICA 3VJMA 1UDAA 1KMCA 1CY8A 3GVXA 1GPH1 2R79A 2JW5A 3KQUA 1XCBA 2DQZA 1X9IA 4MS1B 3NHLA 1TMOA 3MJFA 2GQ0A 3GAZA 4V0QA 1TEZA 2OB1A 1HYBA 2JASA 4JI7B 5E7IA 4O2AB 5KC8A 3E6AA 1YOVA 1MOPA 3G13A 3F0TA 1BEEA 5AXDA 1EHCA 4JYZA 3M5PA 3PJGA 2AUTA 4WJKA 1I1QB 3I2GA 4WE3A 1GXSB 3LG2A 4CV1A 1VJGA 1GP2B 4BNGA 4WT7A 5MN6A 1U0TA 4LRXA 2X2FA 1BRMA 4N1AA 2EW2A 4RQTA 3NRCA 3ZH9B 5DGXA 1QIIA 4MA0A 1SCJA 1PJBA 6PFKA 3INNA 1S7CA 3DM0A 3T0FA 5A3VA 1JFRA 2WTAA 3D3WB 1WB4A 2O2SA 3QX8A 2JCGA 5JZVA 1XTZA 3NHFA 5AJYA 4MV0A 2F90A 2XNCA 1ZL0A 4QO8A 4UU1A 2C31A 2Q4EA 1FY2A 2IH2A 2ISQA 5CT4A 1PWXA 2XD4A 3CMCO 4BAGA 1WQ1R 1VG0B 4WJZA 2V7VA 2C7PA 1SUDA 4BVEA 1VCIA 1VI5A 3HJNA 2HRCA 3PTLA 4OFWA 3VYRB 4G9EA 3DTVB 2O52A 1AURA 3AP3A 1H9BA 2R44A 5DGCA 4OATA 1KVQA 5CK4A 5F2EA 4W5WA 2V8OA 4TUYF 1WPXA 4LBZA 4WK0A 3KOZA 1X1QA 3L7YA 2MINA 1BE0A 1NG1A 3I04A 3UJDA 2BEUB 5ITSA 3KSBC 4OL9A 3TR0A 3M6MD 2BMAA 2IBSA 6REQB 4WOPA 2H4YA 3G5TA 3P9YA 1I5OA 1JYSA 4Y1RA 4QVKA 5DTRA 4WY2A 4X7BA 3G9TA 3NOVA 3T4UA 4H9GA 4CTOA 3H84A 1RAAA 1TECE 1WVIA 5SXMA 1YZVA 4PSVA 2HV9A 2A84A 1WU8A 3PR3A 1W36B 3SJZA 2EGGA 3UIEA 3OQNA 3BJIC 3SJ7A 1NN0A 2C58A 5GM2A 5FI3A 3T94A 3V7UA 4MYDA 2X2PA 3I7HA 3LQ1A 1XZNA 4JWKA 1K8YB 1UM8A 4YJ2F 4CG3A 2F9LA 3W15A 2DFLA 5D3QA 4MEBA 3WLQA 1JILA 1EXMA 4XM0A 5D00A 5BVGB 4LYAA 2C42A 4IJKA 3WZMA 1JIVA 2BMWA 4H7KA 4Q3OA 5ALQA 2Z57A 4D9EA 2FF7A 4COKA 3ELDA 1INLA 3R7WB 1VXOA 1E61A 3SE7A 2Q6TA 2IAAA 2HZBA 1D03A 1WBJB 4RWZA 4JL5A 1EP2B 3FJOA 4C87A 4GMBA 1F17A 1YQDA 4ZIRB 2DR0A 4RE6A 1OC4A 5IHXA 3CR3C 3FPBA 3RSHA 2Q3MA 4MCJA 2V6IA 3O75A 1JFTA 3NU1A 3CWCA 1O3YA 3H9CA 1VXRA 4DMMA 3JQ8A 1FF9A 1CS0B 2Y0DA 4YTEA 4RJIA 4A0HA 1SY7A 2DFTA 5KOJA 2ROQA 1K5HA 2X8AA 4CIVA 1G2PA 4KTTE 1VHDA 1SIWA 4GR5A 5IXYA 3L7BA 2NM0A 2CYAA 3CRRA 4F85A 2VH5R 2O3UA 3CUEF 3EAGA 3CH6A 2G5CA 4HQFA 3CO0S 1P60A 4XVCA 3PNYA 5EAPA 4MROA 5LR6A 1S02A 3F4BA 3NBKA 2WWTA 3MWEB 2Q8QA 1GPUA 2L0XA 4AY2A 2I6FA 1J97A 4NPAA 2EXXA 3ZY3A 3OLQA 2G4LA 2VEOA 3SN6B 5I5JA 1A9XB 4QBFA 5HKBA 2M1XA 3K0AB 3TX2A 4MUAA 2XOEA 2FGKA 5K4HA 1KFBB 4GR9A 1JQ5A 4GPEA 5HP4A 3NW9A 1N9KA 3IMCA 4QGSA 3FNEA 4L0DA 1P5ZB 2DBQA 3W8EA 4AZ3B 3FUTA 1E2IA 2HWUA 1M1NA 3M6UA 3BH6A 1IY8A 1I24A 3ZGYA 1HKUA 1OT3A 1O8BA 3EGOA 2GK7A 3I05A 3RIEA 1YB7A 3BJEA 3P71T 1U04A 4QTXA 2CVQA 4PXAA 5GJBA 1ZMRA 4G0PA 4JIMA 3L0IB 3WSTA 1DG9A 2RE8A 5D5PA 2F2TA 1XZLA 4NWIA 4L1QD 1W87A 3PRHA 3UCXA 5FWNA 1GKLA 1K6MA 2B4EA 2ZSIA 4IWYA 2FNAA 4IQ4A 4J76A 1ZSVA 1YBMA 4P3YA 1J49A 4FCTA 4S05A 4IZHA 3U1TA 1PNRA 1BWPA 3GVIA 4XJSA 3ZVNA 2CLLB 2BBSA 2PJZA 3G2KA 3LBHA 5ETJA 3KJXA 3WMRA 3SXUA 1A1SA 2C5EA 3D81A 1RZVA 5J9FA 4GZ3A 4JJKA 3NASA 4OKNA 3HRIA 4NBSA 2AKAB 2IQ5A 1UBTS 5B7GA 2JGMA 2I4NA 5B6PA 1NPDA 1U2GA 4I4CA 2FUEA 4FCWA 3R7SA 2EKDA 3DBRB 4XOUA 5C32A 4OBEA 1SGWA 3DSMA 3S28A 1TKRA 5T3YA 3ETCA 3F46A 2G1UA 5G41A 1Y1LA 4GI3A 4YCAA 1MB2A 5AVUA 3RO7A 4FGKA 5DYIA 4FMDF 5AVXA 1XFAA 2VZ9A 4WX2B 5AVRA 2F00A 2XMDA 1EUCA 2FW8A 3DDNA 4B6QA 4BZPA 2I8LA 2C4HA 4NU6A 1U0HC 1WMFA 4I0WB 4I66A 4GOMD 4AICA 4RVGA 3N8KA 1X1SA 4AZWA 3FR7A 4BX8A 5A9TA 1Z5VA 5DLEA 3BFPA 4BH6A 4QVIA 2IP1A 3A1VA 4LRUA 2G9VA 3Q5DA 3E9DA 1Q12A 2Z4SA 2VH2A 4ME6A 4QQEA 3ROZA 3DMNA 1ZWKA 2NZVG 2NVUA 2HWXA 3LOQA 5DXFA 4V1CB 4MV5A 1GGVA 2XUKA 5ECGC 1W35A 1QLHA 5IEJA 3THXB 5CH5A 4MGIR 3WK5A 1NBOA 3EIHA 5JI2E 3PPWA 4XGRA 2AJBA 3PYLA 2D2XA 1W0JD 2HCJB 1T0IA 1KS9A 3F47A 2AVDA 3EDQA 3U7QB 2PZKA 1A76A 1NVEA 5HCIA 3T9FA 4ZI7F 5B57C 3JD3A 3TW6A 5AK6A 2X5KO 4M6WA 5JXWA 2UV8A 3U3JA 4PLVA 3V55A 3ZLVA 3VQTA 2YC2C 1W48A 3ZE2A 2AFIE 3FVRA 4P8RA 2G5TA 1ZK0A 4NPCA 2X86A 4LZPA 5JLAA 3PEEA 3NTXA 3QUBA 4M55A 5JDIC 3I5YA 1G1MA 2A9RA 3W9BA 4ZEVA 3JZIA 1MH1A 1M5UA 3DZIA 3KKLA 3UXEA 3MLAA 4BFXA 1JHXA 3OKWA 2RI0A 1P2VA 2ZB2A 2CNWD 1KSFX 2JCSA 4GLFA 5KYXB 5JOQA 3EEQA 1KPIA 3O3CA 3OT1A 1KDOA 2B8TA 1NQVA 1MIOB 3F90A 1C29B 2C98A 1IK6A 2HLDA 2P91A 4ALJA 3A6KA 1V43A 2I4TA 1JHUA 3IQIX 1F1JA 3CH5A 3QITA 1RRKA 3QVGA 1Y34E 3EHEA 2XITA 2OO5A 1E5VA 3NDRA 3FCSB 1E9DA 3PPXA 2C9BA 1T0PA 5KJCA 3W6NA 3KKEA 1W73A 1CNEA 3EVNA 2IBMA 1MC4A 1ZIYA 2I6UA 1WZ2A 3EBOA 2BGIA 4EKEA 3I6MA 3K0FB 2OZLA 4D6PA 4GMHA 4BNLA 4FOTA 4TL7A 3OKCA 1JZTA 3PNBA 5AQ1A 4MVJE 5KX5F 1UFKA 4J03A 3SNHA 1Z7EA 1DBVO 4WN9A 4AS2A 2XCQA 5DW0A 4YRZA 5KOHA 1WUTA 5L45A 5L3VA 2C92A 1P29A 3G88A 5FKSA 3G82C 4MUHA 2GCIA 2IUTA 4Q7MB 3P94A 4R7TA 2NZXA 4C3OB 1D0IA 4F96A 2QWXA 1D2EA 2ACWA 3FYTA 4D9FA 1CU1A 3QMMA 1Q74A 2OMEA 1HO3A 1WD5A 3E2MA 2QV7A 4DZTA 4OK6A 1XDDA 3G2IA 1X2EA 2JGJA 3HYNA 5A7HA 3SJAA 5I3ZA 3AL3A 4NJMA 1KFEB 4RPIA 1JZQA 1BMQA 4OGWA 4DG9A 3COZA 1KI6A 1DQPA 4PIVA 1CQZA 1KBOA 2H2AA 2PZLA 2FUG6 2GD6A 3EVTA 2AUMA 4O4IF 3AEKA 1PW5A 10MHA 5KNCH 1YA4A 5JS6A 4G2NA 3FWHA 4RTNA 2E4AA 3RSGA 5MFZA 1DS6A 5ULLA 4TZKA 4OQDA 3M1AA 4B71A 4J0DA 2IKQA 3ZXUB 3HBMA 2AE1A 5A6SB 4DAEA 2GOYA 2H0RA 1YS2X 4GX1A 5EZQA 1Q47A 5T6BA 2UUOA 3ON5A 4QODA 2EGHA 4FWTA 3P2KA 5EIEA 2FWNA 4OBXA 4EFLA 2MYPA 4C78A 2HFJA 2FEWB 1KRXA 4M1KA 1V3TA 4IIJB 1NLZA 3IT2A 3IHLA 1DBQA 5DT9A 1XL1A 3AFGA 4G63A 2GZ2A 3VPHA 2P9TA 4RSHA 3EULA 4TV8A 4GLOA 4OHCA 4EO7A 4HSGA 3QVJA 2QRMA 3HCNA 3ZLBA 2D13A 1Z7BA 2DE0X 3G5AA 3IIIA 3VI4B 3LX4A 3OZVA 3QKTA 5DDIP 4B3JA 5KTTA 4HDSA 3RTAA 3ZDXB 4AJ2A 4MQFB 3CBGA 3R3SA 3SVLA 2IP2A 4CEIB 1BKSB 3K1TA 5T3UA 2VQ3A 1SKYE 3OJ0A 1NSYA 3P9KA 1RYFA 4XYHA 1NVWQ 2AH1A 3SBDA 1B8OA 1KEZA 3JQAA 2ETVA 5KVQA 5CXXA 5DBOA 2Q7DA 5J4YA 1KJNA 1IHOA 4ER3A 2H4WA 2IUUA 4L8FA 3FZNA 1WMEA 3RUPA 2E5LB 4L76A 1E9AA 4MQMA 1GCAA 4UPEA 4LZOA 1TT7A 4RD4A 3ORRA 4L4YA 5EJ9A 1WQ4A 3H1FA 4K1XA 2PX6A 4DMGA 3DB2A 1KYWA 4DV4B 5TDHA 4B7XA 3ROKA 2QTCA 2R8OA 2JLAA 1JIKA 3SCZA 5F77A 5FTWA 1ONSA 1QHNA 5DU2A 3K1AA 5GZ6A 3W7VA 3V4VA 1PLKA 4NEQA 1I9GA 4Z7OA 4KOAA 2C54A 2JATA 3VU3A 2R6FA 5HDBA 1LS6A 4K6HA 2JAXA 4G4SO 4M89A 1DKUA 1Y5IA 3QU4A 4QGHA 3ZGOA 5ENVA 1U3TA 1UDXA 1ESZA 4W9MC 3MPUA 5LUAA 1J8QA 5ARCA 1JTEA 5LP1A 4G4SP 4TWJA 1GNQA 5IUNC 5LQUA 3FFAA 4DC1A 3FCEA 4JVLA 3RVRA 3LX8A 3BMQA 2WTBA 3COVA 4BVLA 3NATA 1FS6A 4MNTA 4OMCA 3QKUA 4LZWA 4MWBA 2ZTUA 4P33A 1XDUA 4IHJB 4AP6A 2HIGA 3EYWA 3P0JA 3T1QA 121PA 2ZBQA 3LWDA 4M76B 3IMEA 5JECA 3OHPA 4J0GA 1A8QA 2OCLA 2I8AA 4BVAA 1P73A 5DTJA 4IZOA 2JFGA 1TNDA 4L85A 2OXIA 2ONCA 1VDZA 2GCGA 4DWJA 5JFTA 1VMDA 1QPZA 2Z6UA 2FUCA 3SM3A 1QVAA 4LY6A 4PLTA 1DXOA 4EG6A 3EG6A 4BQFA 4EHIA 4WESA 1BTOA 2FR1A 3A36A 1N7GA 3R8CA 4RDXA 4O59O 1S4UX 5CNJA 4DJDC 3LQRA 2EZ8A 1UIMA 4ZMBA 2I3SA 4MOWA 1XZ8A 4FW9A 5CIQA 1NPYA 5EE3A 1K92A 4R51A 4B7ZA 4AF8A 1E89A 1NV8A 1RNLA 4BQRA 4JOSA 4IMPA 5AKXA 1CPYA 1K4MA 4H1UA 4YWJA 1L8QA 3HB4X 4GQIA 2FE1A 5TF2A 2I2FA 3RUHA 1CYEA 7REQA 2QLJA 1IDOA 4L9RA 3MJVA 1KI2A 1VIDA 1SXJE 2Q1XA 4L0MA 1Z2PX 1KAOA 4PQYA 2H54A 5DULA 3WLIA 2QL5A 3DLHA 1EGQA 4B83A 3CRMA 4OO3A 3ZHVA 1JPNA 1VIMA 1I13A 3CFYA 2WG1A 2OVFA 4RKYA 1SIBE 3IKTA 1HH4A 1LEHA 3HSSA 4JSTA 2PMFA 4EBFA 3E3LA 2VYQA 2VHCA 3BFVA 4U7FA 1EFVA 5KNCA 1REQA 5IVDA 2G08A 1N75A 4ZYWA 3I2FA 5MHTA 3V4SA 1GUBA 4GQ1A 1J07A 2YJ3A 1CF4A 5BQ5A 5A0TA 3GJ4A 2R00C 1VYHA 5ER6A 4JUDX 5A1TA 1DG1G 3I2NA 3ACDA 2LV8A 3LRTA 4DRXB 4DLZA 4IFEA 1VJ5A 1C9MA 3AB7A 1A7JA 4YV0A 3N07A 1W44A 2IW1A 3NO4A 4KQKA 3HM2A 3DCJA 4X63B 3HJFA 4LX0A 5JMWA 2BMDA 4C05A 3V6MA 3PV0A 1UK9A 1Y3IA 1U8YA 5DOVA 1YFLA 2OGSA 2XUIA 5IU6A 2QLMA 3C3AA 2AS0A 2QM0A 2CSXA 4MEJA 2XE6A 3AKEA 3R0VA 4DMHA 2R84A 1XVVA 3NYWA 4G5SA 3W2IA 2OHXA 4ETIA 3KFLA 3VPDA 4Q7JB 2BUBA 1X7GA 4ZEOA 3ESZA 4RBNA 1E2PA 1CY4A 3UFXA 2H29A 4BKMA 2J4DA 1QCZA 4JUAA 1FU4A 4OQYA 1MOZA 4POOA 4RVSA 3ORHA 3NAQA 3IFSA 4X1YA 1M2VA 4F92B 1D2NA 1ZHFA 3PXCX 4KTVE 1AX9A 4EA9A 2OK4A 3L93A 4JZKA 3GIWA 2Y05A 3NC4A 4ND5A 4CL2A 1GPWB 1M6YA 4LVNA 3HJCA 3E53A 2FEAA 1POWA 3FNIA 1U80A 4LVOA 1K5DA 3I7NA 3L46A 3M6LA 1EZ1A 3PVSA 5L4SA 1IN4A 1J70A 2XQIA 3B9PA 1U63A 2V45A 3R5FA 3W0LB 5ARDA 4S0XA 3UM9A 3CX4A 5FA8A 4ZVPA 3UFBA 1LPAB 3MXTA 4YJKA 1RKBA 2PCJA 3RJMA 3GGDA 1EH5A 4E5DA 2GNOA 2RGNC 2DY1A 2I4RA 2VT2A 1SHUX 1I0LA 2UXDB 4P36A 4WZAB 4R6XA 1RU3A 3HKBB 2JHFA 5C8VA 4Z8LA 2O2GA 1Z36A 4UMEA 3BWBA 4RDHA 3B3QA 4ZT6A 4DVGA 2PRZA 4JNKA 4HDCA 3K6RA 2JFYA 5E6RA 3M6XA 3TQHA 4NXMB 4HP8A 3L0CA 4R3NA 4OHPA 1SC1A 4PSDA 4UNIA 1JDVA 2BKUA 4GYJA 2R85A 1LBTA 3KUXA 4W5RA 1IY9A 1K2WA 4CT5A 1O6FA 1GJRA 3C8MA 3D6AA 3A9CA 5H7XA 4UTZA 1R0RE 1C8LA 4ZRDA 2Q0QA 1QP0A 3INGA 5KDLA 2B0CA 3B48A 4EPWA 3FAZA 2R7MA 3ANTA 1RJEA 4K0RA 4ZQBA 1BX1A 1WHSB 5KQLA 2WWYA 4M3NA 2JD0A 4H60A 2MT9A 5K2OA 1EWRA 3J81g 3Q8LA 3B52X 4OQNA 1SVLA 1E9RA 1RE0A 5FKRA 4HUQB 4IIHA 3VISA 3U6KA 2OTCA 2OXFA 3AUUA 3PNMA 4BP1A 3O8CA 2F1IA 4A0QA 2ORIA 1HC7A 3O4IA 4PAQA 3ZG6A 3K92A 4N3NA 2XUAA 3W77A 2DZDA 4C06A 4UM8A 1KAQA 1USUA 3ZWXA 1CJVC 3E03A 3IJEA 3FX2A 4DDKA 1JKMA 5M3BA 4UPVA 3CNNA 2IW3A 4K87A 2P1RA 3Q85A 3ZIAD 3HNOA 2QY6A 1XX6A 1A5ZA 2QTWB 5EP4A 3ONFA 4ZYTA 1J8FA 1P74A 2NPOA 2LZ0A 2OHIA 3F2IA 5CG1A 3LLSA 4QEKA 3QX3A 2W8BB 3QELB 1ODCA 1PDVA 3DS8A 4INAA 3DCNA 4PZLA 4DNOA 1PVDA 4V24A 3OZUA 3WKCA 4RK0A 5EPUA 4IG9A 5KOYA 3MMZA 1DBRA 2WFAA 3ICVA 3RQSA 5ESRA 3OE7A 4EVSA 1OYYA 1MJGM 3G9QA 1F2TB 1FRNA 4EG4A 5J59A 2Y67A 1SHTX 1QU2A 1IVYA 1SQ5A 3D43A 4W7SA 3QBVA 4MVJG 4I5EA 3WKEA 3AI2A 5M5TA 1ECPA 1YFQA 2OORC 2QTBA 3E81A 4NV3A 3NIDA 1A4UA 1XROA 2WEKA 3HFQA 5EZYF 2FPMA 1IG0A 1W19A 4LWPA 4C2UA 1WUJS 4F46A 4XASA 1N2JA 4TXJA 3OIGA 1YC5A 4B4KA 3LKDA 1U8ZA 1P6XA 4KG7A 3N58A 1VQ1A 2WJPA 1T4CA 2OV4A 5A05A 1G60A 5BSUA 2ZRAA 3TZQA 3FPFA 5JVDF 3K9CA 3TD6A 4OHXA 3K2IA 2PRIA 4KLZA 4U7JA 1N2IA 3HA5A 2A0YA 1U65A 1PHPA 2P5TB 3OE4A 1KO8A 3C14C 3O8QA 4Y6RA 2PGXA 4WXEA 1EVQA 3PEWA 1G41A 3AEUA 5C2VB 1PWZA 4FSDA 3R2JA 3S81A 2OCAA 3QTBA 1L8AA 2FSIA 3IP1A 1OX5A 3DO8A 3ZXYA 5DTQA 2FZEA 1SH7A 2O6LA 3EOBI 4AY5A 1XL0A 2QRHA 5FCDA 5I5GA 1WOYA 3F5QA 2UYGA 1ABEA 1D2HA 3KQSA 2H51A 2NSYA 5H0IA 2P9IC 1M34B 4KDEA 2B7CA 3IDZA 3KDAA 1C9YA 4OIFA 3A9SA 1PCXA 1UZMA 4YRNA 2HHAA 5FRDA 2WYWA 3F5DA 3COYA 3IIMA 1MGOA 4FKZA 5LMZA 3WGZA 1M2OB 1XA3A 5KJEA 4DGQA 3MB8A 4ZTZB 2GA9A 1AB5A 2XZTA 5JNLA 3QKIA 2VCYA 4C0SA 5CNKA 1YGYA 4MWGA 2G80A 1V7CA 2VDPB 1T2DA 2YWCA 1JDJA 4X7PA 1J8YF 2G9NA 1T0BA 1CD5A 3IP9A 4KU4A 1P7VA 5FBWB 1H3FA 3OEYA 5D84A 4FOLA 2ZT8A 1HQCA 2RGWA 3CR7A 1JAXA 1TF5A 1UEIA 1XNQB 3BPSA 1APBA 5EYPB 2HYDA 3LZ6A 1Y48E 2OO3A 4X6XA 2NZ2A 5HBGA 1B7GO 1V7PC 4ZWNA 4DEVA 1PEAA 2YNMC 1T8RA 4UAUA 4MV7A 1JNYA 1DBWA 3NT2A 5HVNA 2HUNA 3H11A 3U16A 4PFQA 3OY2A 4LPKA 1I4WA 3BJRA 3L9WA 1KSJA 4C7BA 1ILEA 3K4PA 4OEHA 5FWXA 4YVFA 5F51A 3DEFA 1GAEO 4ES0A 5HEKA 3F5SA 1SBCA 3MMNA 2J9GA 2DR2A 4QARA 2QR2A 2QC5A 3VO9A 3ZWBA 1CTQA 1LTHR 3H0KA 4WJLA 4UHEA 4MARA 5JTUA 1ZR4A 5IBRA 3RVDA 4WBNF 1AQYA 2J45A 1LQTA 2FOLA 5JD6A 1RQGA 2X0KA 2JGIA 4EI2A 3T4EA 3E1GA 1P1RA 3DDZX 1QGUB 2PT5A 3BE8A 5LP6A 1ZA2A 3KPJA 2XDQB 1ST2A 4UJ5A 5C5EA 1F2UA 3UNXA 4EKYA 1H0HA 2XGMA 3RGGA 1FNMA 1JVBA 3GQBA 5ENDA 3Q2IA 5I7SA 2H6EA 2P4QA 3AEQB 1K68A 1KZ9A 6YASA 3UKUC 3H9BA 1X3LA 3NYIA 1OLZA 1ULHA 5TF0A 3E9EA 5DTEA 4Z4GA 2O7RA 4FZ3A 3BFXA 4HVCA 3U9LA 4KXMA 3EDYA 5AKIA 1QNFA 3V7WA 3DOUA 2HRRA 3KCIA 2F9FA 3STWA 3DG9A 2A67A 4KO2S 2NNLD 5IWAB 2TMKA 1N0WA 4J9UE 1JLSA 2NO1A 3S8EA 2DYKA 3URMA 2WMDA 4NS4A 3G2PA 2WHYA 2B2XA 1R10A 4NBMA 4H59A 2OHHA 4GRDA 5FA5A 3QUCA 5TSDA 2VAVA 3C6BA 2GO1A 3DL4A 2JHPA 4M38A 5D5QA 1ANKA 1SUAA 1P1JA 4H3KB 4I9UA 1JF8A 1PFGA 1WEHA 2OLJA 5L3QA 4UMVA 5CW1A 2FZWA 3DMRA 1PD1A 4AO7A 4ZAXA 2PU7A 1N2CB 3K09C 4I6EA 3FTDA 2GSDA 1E0SA 4HYTA 1A9YA 4RH1A 4JL8A 1QYIA 2B8EA 4JDPA 2C5SA 2M6KA 3U3ZA 3OTGA 1NNUA 3DHNA 3UGKA 3WL3A 1YZKA 5C35A 3ONWA 4R16A 1BZYA 1CVLA 1FE8A 2GN1A 3AUTA 1A82A 3C6YA 5CFRA 3WRXC 3DWEX 3C6QA 2ZJ3A 1Z0UA 3NVMB 2ZAGA 2JCYA 1NRIA 3LCVB 3QU5A 3QUSA 4Z0TA 3ZJTA 3C6KA 1UT5A 1YUNA 1QV9A 1QFJA 3LC2O 4NP6A 5B1YA 2HHHB 1X9HA 3H6KA 1FRQA 3X1KA 4ND7A 4N5DA 2BFPA 4MKIA 3BSYA 1ZH6A 4QASA 5EXPA 3UO8B 3JAWB 2ZU0C 3DVQX 2IYVA 2QPAA 1BN7A 4X1KB 3SC6A 3UUFA 3R9WA 4F9TA 5TJHA 3CLTC 4M7OA 1NE7A 1QH9A 4C7OA 3LUCA 3AZQA 4CQMA 2BR4A 1M6EX 5JCJD 2HIHA 4MVJP 1QZXA 5CCEA 3FRIA 3LC7O 1D3AA 1CIJA 4NE9A 2QX7A 1YD7A 3M4NA 5H68A 4QECA 2Z98A 4YAFA 1RZUA 2WWFA 2ZXFA 4O2LA 2RI6A 4YRAA 1RWOA 1P9LA 4JLOA 1UM9A 4QPNA 1I3OA 3D3EA 4D26A 4BLOA 2VPZA 5CVUA 3P9SA 4DCMA 4GIBA 3L6DA 2HLPA 1CQJB 2H9YA 3IE2A 3LYLA 1VIAA 2YNMD 3G0IA 1WR8A 3VSEA 4TL9A 2CLIB 4ND3A 4NDZA 3CWZA 2JAPA 3RS5A 2AD5A 2EGUA 2ZGVA 1SZDA 1SCUB 1OXSC 4INOA 3VH1A 1T5DX 1BXGB 5FKQA 5AJUA 3G3EA 5IVKA 3CJRA 1CUWA 1TF2A 4X71A 1VA4A 3IJ1A 3PUKA 4ALMA 4YRBA 1T9ZA 3UOWA 1KO4A 4QQ8A 1T6YA 4KN5A 3RREA 4H1TA 1MEOA 2CUTA 1AKWA 3RHSA 1N5JA 1JR3D 4DM7A 2BE7A 4H5IA 1M75A 1DLJA 4GE0A 2O8EA 4N6GA 1OA0A 2R8BA 1DOHA 4I6GA 3ZHUA 5JYBA 4OZUA 4AB1A 5CB8A 3FUWA 1RYHA 2Q6LA 4HX9A 2PRSA 1HLGA 1TEXA 5KREA 3O8BA 5F12A 4P4NA 5KC9A 1FDOA 1ULSA 1BEUB 5FI0B 3VKVA 4IJUA 1QMGA 1KJIA 3IQHX 1RYNA 1NXVA 4B3HA 1U8FO 3G0GA 4WK2B 5BR4A 3JW8A 3TW4A 4X60A 4D0SA 4RHYA 5TIIA 4A10A 2O14A 5ESWA 1TA4A 4ZEWA 1MA3A 3D1LA 3NORA 1Z6XA 3AR8A 4DREA 2I54A 3I32A 5CHEA 1JZSA 2H1VA 4IVPA 3BCHA 4L16A 1KEPA 2W2XA 4J91A 2VCHA 4N9QA 5K6AC 4JHNA 2Q29A 1UPBA 3EVCA 1PR2A 4E22A 2BF4A 4B3GA 3N39C 3TNLA 3EH2A 3HYRA 5KKAA 3T3OA 1EFLA 1E59A 2UZ1A 4LDRA 1MJHA 1ZGBA 1UZLA 3O4HA 1R5NA 2O59A 2EL9A 3EXG1 2EX0A 1FP4A 4BIMA 1ZXXA 2J3KA 3M9XA 4LYDA 3CG4A 2GH1A 2RMKA 3H2HA 1OI7A 1L4BA 4N03A 5DHTA 3H05A 3WGLA 1XCGB 5KWVA 1TM5E 1NDHA 4DSUA 3ZH2A 1E5XA 5IHPA 2OLKA 2H9NA 2C2BA 2V0GA 3LCJA 3HGTA 2C2HA 2DULA 2UYQA 1QNLA 4PHCA 5BOSB 1HTTA 2QN8A 5F3WB 4N3GA 2IOFK 2CMDA 3IALA 5G4KA 4PCAA 3WNZA 1FS5A 4JENA 1SK8A 3CNOA 3RU2A 4LHVA 4EECA 4KKVA 1HSZA 1XB2A 4UBMA 3FGPA 3W5IA 4EG3A 3JQBC 4QQNA 3TW8B 2B7BA 3SZGA 3QVVA 2DFVA 3WA6A 2F8TA 3W2EA 3AQIA 3M1LA 4O02A 4NEHB 1TM3E 3EI2A 5AKEA 3PSAA 3AOGA 1YI0A 5HUQA 2D1FA 4Y98A 1RQPA 1KTVA 4AMYA 3ZBPA 3ECSA 4A08A 3FTEA 4L3VA 1Z7WA 5ALSA 2PMEA 3IAM6 4NYJR 3N2ZB 1R6AA 2EQ5A 2BRUA 1GGEA 2PLNA 3RVLA 4IXNA 4YP5A 2UZIR 2P11A 3SC3A 4ZAGA 1WABA 1ZUHA 3VYWA 3CLTD 5CVVA 1ZH8A 3BFJA 2XCOA 4PX5A 3DWLC 3AGQA 3K7EA 3PR1A 1FMTA 1E3SA 5KO2A 4ZI3A 2DWQA 3GLRA 3VZDA 6CHYA 3KSAC 2O20A 5FWYB 3FBGA 4WDQA 4QDUA 3R9KA 3I23A 3ABOB 1MB0A 2W2OA 1W93A 3QLTA 4BLUA 5CYFA 2R4UA 4XLTA 3K27A 1KQOA 2ODAA 1P62B 1W96A 4O9DA 1NVVQ 1TD9A 3ODTA 2P9JA 4IXTA 4G0ZA 3J7AC 4NENA 3AFHA 1VLVA 4MKRA 3ETNA 2A35A 1UCFA 2VUHB 4XUCA 1DKQA 5IJ9B 5ADHA 1C1XB 3WSVA 3D2CA 3AVXA 1BGWA 5HR5A 3R9XB 4JXMA 1L5HB 2JD2A 3QVWA 2YNPA 4G85A 4DNFA 2JC3A 2X0JA 4J90A 4KR3A 4WZAE 3UWKA 1HTWA 2H57A 3JYNA 3OTTA 5TS2A 5J2UF 1E5TA 3JQEA 2ZRPA 1L4NA 4MWCA 2HJSA 3T99A 2ZXUA 1XP5A 2XMZA 1QGYA 4EY4A 3TTWA 3W8DA 1IJBA 1SOWA 4XYLA 2C5LA 5DGIA 4J87A 4FWWA 1LXCA 1O0CA 5C52B 1E9BA 1Y4ZA 3ZWYA 4XYIA 2H5IA 3QNMA 3E3NA 1AKRA 3HEBA 1ENYA 4TYNA 3MCWA 3KBOA 4NKRA 3GEIA 4EDHA 1Y37A 3WYEA 4D9JA 1CEYA 3D6UA 3S7TA 5B30A 1GKIA 2RDMA 3EIQA 4Y9SA 2VXCA 1HT2E 1MABA 4BQQA 2UVPB 5DYTA 4JLDA 2C8LA 2F67A 3TE7A 5LQNA 3N0WA 1T8TA 2ZDHA 2WYUA 4UVHA 1N7JA 1U7PA 2FSFA 3WXMA 3HDGA 2OXEA 4IRMA 1OOEA 4HH4A 1I33A 2CD7A 1FFYA 1FZTA 4ZOLA 4GGAA 3Q7PA 4UMFA 2A1IA 1UPUA 2ZPUA 4TSKA 2ZJFA 3FXAA 1MR3F 1CJCA 4GYWA 1LZLA 2O8BA 2LKCA 4QUJA 3HB0A 1PJLA 3DEZA 1Z0ZA 3TOZA 1DFIA 4EA8A 2YZKA 1SVMA 1W85B 3SOPA 2W2MA 1JKJB 2J59A 1DKMA 1MA0A 4E1BA 3TGWA 5I7OA 3HB5X 2JK0A 4INZA 4HAIA 3L1VA 3B82A 2XI4A 4R2KA 2MSCB 4CY1A 1OV4A 2BKXA 2SNIE 3WKBA 4O08A 3QXXA 2JEZA 5ALYA 3FI0A 2L19A 3LQYA 4PEVA 2G8LA 5BW6B 1AUQA 4Z0HO 3H5LA 3LP6A 2X2EA 1R8YA 2H1WA 2XTZA 1R6DA 4IMMA 1HZZA 1VM6A 4QQFA 3CZAA 4IDBA 3ELBA 4R2IA 4E32A 3DV0B 2OD7A 2CFTA 3GP5A 4XOIA 5G02A 3VPXA 3KV1A 2QM3A 4BFTA 3PCRB 4ZGWA 4R1OA 3ROPA 4MGHA 2X3YA 1AE1A 1C7FA 4MWTA 4F91B 3DL2A 4O1HA 2W6NA 4V02A 3H5WA 1DWOA 1NDQA 2ZBRA 4MLCA 5BW5A 2PL1A 3QK7A 5CUQA 3H86A 1QH1A 1CHDA 4QT8A 4PGMA 5ALLA 3FRJA 4OAPA 2OFFA 4DA0A 5EHIA 3JQQA 3RAFC 2YYYA 5C80A 4QUAA 4JSRA 1UKVY 4DXDA 4RAQA 4XEIC 1V8OA 2DLDA 4B79A 4Z54A 2X8WA 4IOMA 4UQLA 1ODKA 3UG7A 3X1XA 5K0NA 3QIVA 1B93A 2DECA 2G6TA 3P2OA 2O1XA 4MRRA 3WYGA 2V97A 2HV8A 4KIUA 1S8NA 2P69A 2VYND 3MVDK 2DSNA 3JZMA 4ZDIA 5HTOA 1M76A 1CR2A 4HDRA 1H8HD 1IHDA 4U1EI 5CPFA 1FTSA 3OX1A 4PLZA 1HNWB 1KDYA 1U11A 3KOYA 3L7AA 5CA1F 1G20B 2VP2A 2FVYA 3PQ8A 4ZJYA 2W90A 3D6FA 5A1JA 1RRMA 4LJAA 4NG5A 5FWAA 4ENSA 3GP8A 4A1OA 2PNJA 1JLLA 2OC4A 4EHKA 3C6XA 2ZVQX 1Q77A 2JH8A 1OB2A 4V3CA 4FWIB 1YIOA 5DNEA 2YL2A 3G9ZA 3QW4B 1N6IA 2BI7A 1K7YA 2REQB 3LUPA 2IZ5A 2J46A 3QTTA 3CVYA 3W2TA 1AO3A 1B9YA 3MSCA 4QFCA 1K75A 4CKBB 1KC3A 1NQUA 3EEFA 3AI1A 1EWKA 1Y1RA 2XNDD 3X1ZA 1UXKA 2ZREA 3IPCA 2QZZA 4MLZA 3NTQA 4AL4A 1GZ5A 3VNBA 3CEHA 4BKPA 1QO0A 4O2RA 3K0BA 2DPHA 4M1TA 3W5SA 5JIBA 1G8MA 3F4KA 4JZYA 1VL6A 5JYDA 1E2MA 2JANA 4NAAA 4M54A 1GTZA 4CKCA 1MOSA 2W0MA 4MV4A 3PL1A 4O4JB 4KAXA 4TVBA 3AVVA 3GYBA 2P79A 2VTBB 4FDUA 4KQEA 1MG0A 1OZGA 3A3NA 4ITVA 4CW7A 4WASA 4DNPA 2J30A 5IMSA 1RJ9A 1XKTA 1C30B 3E3MA 3VR6H 3VDQA 4CJXA 3ADBA 2IYOA 4PZZA 3I3SR 3BHMA 4XGNA 2VJBA 4FIZA 4A0RA 3BWEA 1JJIA 3SX2A 2XIQA 1X7YB 1ECLA 4FNGA 5SYNA 1U5BB 3EY9A 1H5NA 4L4SA 3R7DA 2IXEA 3OZXA 3MCZA 1T35A 1QG4A 3AJ8A 1HDIA 1HEIA 3IUBA 4HFMA 3VH3A 3V6LA 5A4MS 3IUMA 1GCOA 2IHKA 4KRGA 5F5LA 5LDDC 4JU8A 2GAAA 1TGYA 4LC9A 3P9PA 3SMRA 2VK4A 3GLTA 5GOTA 2WUEA 4R1QA 3O03A 2FRDA 4EJSC 1OLSA 4ZVQA 4EHLA 4DG5A 1YZNA 4ZFNA 3PTAA 4GI1A 2PR2A 2WFZA 2IH5A 4MQUA 5EIXA 4D4GA 4LYGA 1MB4A 4XIIA 4E2WA 3JB9L 4L2IB 4HB0A 1V71A 3GDWA 3RSZA 2C8VA 1BA2A 1H6DA 2WKSA 3EZ7A 1LLDA 1GEEA 4ESHA 4DB4A 1THZA 5FQDA 4R2JA 2W4IA 1XRMA 2GFHA 3FPHA 1XRLA 4KXNA 4I1PA 1B3BA 2D6FA 4HI0E 2Q41A 3HWWA 3OU6A 1P3DA 1RKUA 1SPXA 3DLAA 3AJAA 4HQNA 3PU6A 2NT4A 1VECA 1DC5A 2EAUA 5CBPB 5EE9A 2HNBA 3F9IA 4NBKA 1J4AA 1J33A 4LFBB 2R68A 4I8IA 5F73A 2BI8A 4EF4A 4WK4A 4DLSA 3B7WA 1T8PA 3QVXA 2I5PO 3SCYA 3Q9LA 2A5YB 2XDWA 4CM4B 2V3VA 2GF2A 1GAJA 4B6OA 2DFKB 4UBKA 3QF7A 5GGXA 2QOEA 3BIWA 1IPEA 5DN9A 2Z3ZA 3S6JA 4ZCIA 3GWZA 5FTLA 3TH5A 2P1ZA 4BVGA 1XIVA 3RGWS 4TWZA 4YRQA 3H1BA 1TCAA 2PANA 3B9QA 3Q7SA 2H92A 4TLEA 5JLJA 1GPKA 2IPLA 2V59A 3ZDQA 1E60A 5B2EA 2Q3FA 4MINA 1LDBA 5BV8A 2VS1A 1C9DB 5GONB 3OLWA 4ZANA 2UUCB 4I9FA 4RUKA 1FQJA 5J3JA 4LYJA 1OY1A 5I9LA 4UPDA 5HRUA 2FI1A 2YQ5A 5JXIA 2JA2A 5MFPA 3LTEA 1WVMA 1G7CA 3H16A 1P2FA 1U7ZA 1J06A 3RC8A 3SS7X 5KYWB 2J3DA 5ALRA 4P0PB 3BWVA 4PICA 4TKVB 4YT8A 3JPXA 1HDYA 2HJHA 3GPBA 4OYLA 4TVOA 3FDFA 1X8JA 2QY9A 3S55A 1OYOA 4D3DA 2VFAA 5EA2A 4HEJA 2QT9A 5HQ3B 3BX1A 1Y9EA 3RVSA 1OSNA 1SCIA 2M6RA 1L3BA 4ZVOA 3ENZA 4OBBA 3LGAA 3GUCA 2ENUA 2HF7A 3TBHA 3CVVA 4RNCA 1YNOA 1Z4NA 5CHYA 1DDGA 3OKPA 5KJFA 3WVNA 4K6OA 3LUHA 2HPAA 2XHZA 1C9LA 3TBKA 2ZATA 2QTZA 2CXHA 3AO0B 4EAQA 2FWRA 3WSWA 1RWVA 2HR1A 2GBPA 2AEJA 2PZFA 4ZN6A 5DWQA 2P9PC 1H8ED 3GOHA 3B6EA 2LR0A 3NHKA 4U8HA 3GRZA 4NJEA 4ZZIA 4CCYA 5C18A 3B6MA 3VZPA 1YDGA 3VPSA 4ZYXA 5AI0A 3SBXA 4QG3A 4LEIA 1KI9A 3N28A 4H6PA 4NU0A 5A71A 4XCQA 1MJGA 1EHIA 4YRLA 1UOEA 4BVJA 4ALKA 2IZ6A 3DKRA 4OP2A 3IUPA 3F8TA 4DCCA 3DPIA 3CW2A 3H75A 4F6RA 1OX6A 3BF8A 2I6SA 3VOAA 3QFHA 3DZDA 1E1MA 3S2GA 1KOFA 3F7OA 4MYRA 1S89A 4UBNA 2Q3BA 1RTTA 4KQIA 1WX1A 5A3JA 1VHLA 2CO0A 1MFZA 3M6IA 3T3DA 1CR0A 3AB8A 3A9RA 5KYYB 2J0UA 4Y6LA 2XNSA 5LYJB 3P4FA 2R8XA 4YO8A 1QH8B 3FSJX 4CM5A 4A15A 3BCSA 2BE9A 4U39A 3V97A 5C31A 3VR6A 5A5FA 5EP3A 3BCUA 2DRIA 4TMXA 4Q4JB 2ET6A 3QNUA 1Z0DA 1SA0A 3N0RA 4B8ZA 4AJ1A 1CC1S 1C1DB 4YHBA 4LZAA 1YDFA 1Z6TA 5LXTA 1OXMA 5LB2A 3RC9A 4JLJA 4EY6A 4OL0A 1HYHA 3FKSA 2FSHA 1E64A 1QX4A 1JA9A 2CVFA 1ZUWA 2GBLC 5FB3A 4BGIA 4FUQA 3BUSA 4BEWA 4ND8B 5IYZA 1I3LA 1G21A 1XDBA 3JARA 4KR0A 2FEXA 2P9YA 2JKYA 4IKPA 3IEVA 3S29A 2H14A 3WDMA 2HMWA 1NBHA 4MIKA 5FYQA 4YRKA 3NIGA 1FSZA 4DV2B 3IJPA 5C5IA 4DIFA 5YASA 4FCCA 3H2ZA 4IVNA 1AQLA 3N7AA 1MZVA 4LJ4A 1UADA 1X7ZA 4IIXA 2WJVA 4NHOA 2WWGA 2V9CA 2VDJA 2GCPA 1GTVA 1GV0A 3NUGA 1IRXA 2FFBA 3PUWA 1J21A 3DEJA 4OFZA 3CZ4A 2CMGA 4KAJA 4EB3A 1PYOA 2Q62A 1KPHA 2F4VB 3HVKA 2ATXA 4TT8A 1NPTO 4L51A 2OAQ1 1F6BA 2UYYA 2L82A 1M66A 3KTOA 2CE8A 4YXWD 1XIPA 2YWJA 1R6BX 3IODA 1EXDA 4YCNA 3QVLA 1QHGA 3NHYA 5HQJA 4E14A 4LPSA 1BH2A 4HC4A 2JIZA 2WOOA 3VUEA 2F8SA 5CFLA 4DKJA 3SMVA 1W29A 4M60A 3PC8A 3VKWA 4EWLA 1KGSA 2H1CA 2QVBA 1NAIA 3PLAE 3OZDA 3UJCA 2H18A 4FFWA 4GOND 2BFMA 3RWOA 4FYVA 3HCDA 3L0OA 2ERYA 2PMBA 2WM2A 1L7BA 4UNQA 4AJIA 2KHZA 4GP6A 4RHTA 3CTMA 3L0YA 5AOBA 3GUYA 2VLBA 3QLJA 5DGHA 2AJDA 4E09A 1LI4A 2HRBA 1MRZA 5EUBA 4YAGA 4C4XA 2QTGA 3DZJA 5KBYA 3X0DA 4TZ4A 2GRJA 3CPSA 2XMRA 2BM0A 3UJBA 3G2NA 2W70A 1H5QA 1SQ0A 1P72A 1BS2A 1O95C 2VP5A 4DBVO 3QEBZ 3E84A 1W4ZA 2GBFA 3VJKA 3UTCA 2QSUA 3V3KA 4X0EA 3L7JA 2VKQA 4CF7A 2DHDA 2R6DA 2N0SA 3BVPA 5LSAA 3DZ8A 2DXIA 1N7HA 4RA6B 3INRA 2JAHA 3EG9B 4BAZA 2BGJA 3NBZC 3ZS8A 5LBIA 1E5LA 4CLRA 2O7SA 2GESA 3A11A 3CLKA 2ORED 1YJBA 3DMDA 3RYTC 2GJ8A 3H5IA 4CTKA 3MJCA 3V9PA 4CLOA 3I2HA 2B2NA 2GZRA 4TWAA 2XXJA 2JI4A 4F8EA 4EYKA 4NOJA 1WY7A 3VHXA 2BTOA 1MVLA 3BRWD 1FRVA 4IAOA 4XFDA 3DO6A 4LNUA 5JJKA 2YDXA 3RK0A 3PSLA 4MMZA 4BC0A 5TR9A 4NCXA 1SZPA 4BL5A 3FZYA 5A62A 1U2DA 1GM5A 1Z6ZA 5CR9A 4NU5A 1OAOA 4M53A 1WDLA 4HF7A 1YI8A 5C3MA 1GFIA 5KJ1A 4AO8A 4I4NA 1Y9ZA 3A10A 2XXAB 1EK1A 4BZQA 3P9QA 3I7OA 3PHIA 1I1OA 1J20A 4R1NA 1Y89A 2ZUDA 4PPFA 3PUVA 4ZHQF 4N40A 2PFSA 2WSYB 2A1UA 1TQHA 5EJIA 2L69A 4L7QA 5ITZB 1IDN1 5H81A 1VG8A 4KIFA 3K70B 5THKA 1OAKA 1E7YA 2ODEA 1B00A 5GSAA 1ESNA 4WH0A 3CNEA 4GD3Q 1ZLXA 2IS2A 5JSZA 2X0RA 2ZI6A 4MVJM 2D1QA 4Z1MA 4JBXA 3PWSA 5CYKB 3A28A 4FDLA 5C1BA 1QK5A 3DDUA 1UDCA 4GKVA 3A2MA 4HNAA 2YJNA 3U7GA 3OQMA 2DOKA 4IDPA 2BBKH 5FDFA 1T5LA 1O0BA 3ZE0A 4RK1A 2FPWA 3T0IA 1TZKA 1TTPB 4JY7A 3JWGA 3PFWO 3T9DA 2E89A 1K3IA 2WAMA 3EC7A 4L28A 4JT8A 4HNQA 1ZHOA 4M7PA 4PIMA 1XD8A 4O33A 4A8HA 2DCMA 2JBAB 2UVDA 5AW5A 3K32A 3FSGD 1H4SA 3DA8A 1Z6PA 3WMWA 2CL7X 3DFMA 1O96B 2Z3WA 3SC2A 1WNFA 3PNVA 3PGVA 1J24A 3AUSA 4I81A 3A70A 1B43A 5CDUA 4JVSB 1JFLA 4XD2A 1WHTB 1CVIA 5AO9A 2UZ0A 4LY3A 3T38A 1YKFA 4AX4A 4BWVA 2N9UA 4TLMB 2VHVA 4D3XA 1MG2A 3PL5A 3IAUA 1FVHA 2X1MA 5EWLA 3WFZA 2WT8A 5KTPA 5TVGA 3I83A 1D6SA 2SECE 4EG5A 1WOMA 3HB9A 4HDJA 3R7AA 3MTQA 3UJ9A 1H69A 1P45A 2BD0A 4KSCA 2XLCA 1QANA 1MGPA 4IS2A 3R6GA 3O90A 1ELOA 2Q5CA 2XOXA 3KKQA 4LHEA 2JIRA 3WICA 1SNYA 3PRJA 1JDUA 1DHRA 1VHJA 1JLMA 2X8BA 5JMTA 3VZBA 3FDJA 3LVQE 2AB0A 1POXA 4OXQA 1S2NA 4BC1A 5EWMA 2Y6UA 5IANA 3HADA 3L7IA 3O7MA 4UM9A 5DN6A 1HBJA 3G5LA 4BFZA 3DB1A 3CNLA 3P9RA 4EJ0A 5JAHA 2KQUA 4REQA 1JAZA 1CG6A 4K5QA 1STOA 2RHGB 1CERA 4QDJA 3VNVA 3QBDA 4WERA 2NZYA 3QF4B 5F5NA 2HHCA 1NY5A 1E8MA 4BNMA 2ZYDA 3TSAA 1T1RA 2HQ1A 2HA2A 3H6HA 4DR6B 2FXVA 1V3VA 4L5CA 2F48A 2PXAA 1I7LA 2NAPA 4F9FA 2AOVA 4A92A 2FWAA 4BE7B 2ZJ6A 4Y30A 4DMFA 4URXR 5TGTA 3LC1O 3BB1A 3KKPA 2FZCA 4CF4A 1YQXA 4V0LA 2W4MA 4GH5A 1N5RA 4G81A 1QOZA 5AKZA 3HN7A 3PX7A 1TAGA 1THMA 4B85A 3GGOA 4E08A 5C2JB 1J0BA 4PHGA 1QX3A 5KTSA 5E2AA 5C9ZA 4E5MA 2Q7XA 1Z0AA 2QJTA 2Q2OA 2QM8A 1W0CA 3RH0A 1F9EA 1GDHA 1JAYA 2EEZA 2ZJAA 3D7NA 3E3OA 4DSTA 2WFLA 2QZ9A 1I10A 1JDBC 4WQMA 1TDJA 2VUS