3IUNA

Appep_d622n opened state
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
682
structure length
672
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETNPVAKLIEQSADIYAFTLYEMGYRELPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
molecule tags Hydrolase
source organism Aeromonas punctata
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
total genus 207
structure length 672
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iunA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iunA01
4CG3A 5A7GA 1MPXA 3EF3A 4H7IA 5BWCA 3DD5A 2Z5GA 1Y7IA 4PSUA 1XKLA 4KRXA 4B83A 5CH5A 4KJXA 1QIGA 4EY6A 1P0PA 3PFBA 4WJLA 4OU4A 5F4ZA 4JH0A 4NZZA 3BDVA 5KWJA 3OM8A 3WK8A 4C4XA 3HABA 5CT9A 5K3BA 1G66A 2YH2A 5JD4A 1USWA 1FFBA 3CCBA 2WIFA 5AKLA 2WUFA 2O7VA 3C43A 1W52X 3UMJA 1M33A 3P2MA 3F98A 4O08A 1ZJ4A 5BOVA 2PUJA 1L7RA 4IH1A 4WCVA 1CEXA 3BF7A 3C8DA 2H7CA 4BATA 4BCCA 4FMPA 4AO6A 2JGLA 2CBGA 5HFAA 4S0XA 4ARBA 3BE8A 4B82A 1XLUA 3IUMA 5I9IA 3I6ZA 1BROA 2RHWA 1XZLA 3QMWA 4TGLA 3E1GA 5LZ8A 1QIIA 1BCSA 2GYWA 2HA3A 4J7AA 1F0PA 5FP0A 3DLTA 3PF8A 5E4TA 1ZGCA 5DJ5A 5ALYA 2BUAA 2HL6A 4CFSA 2DHDA 3D59A 2BJHA 5CBKA 2HHAA 1EK2A 2VJBA 2YYSA 2WG0A 3WYDA 3RK4A 3H2IA 1VZ2A 1SFRA 2OGSA 2AXEA 2XUGA 3VVLA 5IVKA 1PJAA 1OCEA 2JEZA 1O6FA 2ZVDA 1YA4A 4GLBA 2I3ZA 4AB1A 2QMQA 1XRLA 2FJ0A 4QLOA 2Y6VA 3L1HA 2C0QA 3X3HA 1P0QA 4Y2YA 2ORYA 3Q8WA 1UOQA 1TIBA 2OAEA 3DNMA 5HKBA 2BGNA 3PI6A 2WHPB 3DYIA 4LXHA 2ZSIA 4X6XA 3G9TA 2JGFA 4U2BA 4P9NA 1ODCA 4XJVA 5ALLA 1LGYA 1AC5A 1L7QA 2XMDA 1GXSA 4G4GA 4BBZA 4Y2PA 2BKLA 2WTNA 5FLKA 2OCIA 2Z3WA 3EBLA 3AIOA 2ZYRA 3TRDA 5BV7A 2XI4A 1WHTA 4DIUA 1XQVA 5AKKA 2XUDA 2XUFA 4XVCA 3WKEA 4J3JA 5ALRA 1CUVA 2GBFA 1JU4A 3QMMA 3WIOA 2QJRA 5CT6A 5AOAA 3B3QA 4AO8A 2XT0A 5DNWA 1H2YA 1CR6A 2OXEA 2O2GA 1CUYA 2XQFA 4FOLA 1UOOA 3FCYA 2PSHA 2C4HA 3A2MA 5EIEA 1PFQA 1AMNA 1TAHA 3C6ZA 1YB6A 1AZWA 5AICA 1JMYA 4H18A 5ALJA 1DX6A 5CURA 1GZ7A 3BIWA 2Z8XA 3DOIA 3S2ZA 3WL7A 1EB8A 2WSLA 1AKNA 2JIDA 4C6HA 3WKDA 1A88A 3ILSA 4BTLA 3HI4A 2ECFA 3W04A 3W06A 4UHDA 3HC7A 3HZOA 3WWEA 1EH5A 3WWOA 3I2IA 4BDSA 4DTCA 3NUZA 4OB8A 4YK7A 2Y1KA 4UBNA 3AZOA 3UUEA 3WWCA 4AX4A 4B85A 2XQJA 3O95A 3STVA 4CIBA 3HRHA 1BEZA 4OB7A 3IDAA 1DWPA 3FNBA 5JZBA 3IVMA 5T4BA 2VTVA 3DDUA 3G0IA 4OPMA 1THTA 3ZV7A 1CUEA 3HYSA 3I1YA 2ZYHA 1ODTC 5K3DA 5ALDA 2XMQA 1GQSA 4N8SA 2DSNA 4LIPD 1MN6A 2BGRA 5D6OA 3GZJA 3TEJA 1GKKA 4Q82A 2CEKA 3C6YA 3GELA 2NW6A 2WIDA 3QBJA 4FBLA 1E8NA 1GGVA 3ZLTA 4C89A 2XMCA 1H23A 3VKFA 4F5ZA 5AM5A 1WCYA 3RLIA 4HXFB 1DU4A 2WFLA 5CT4A 3WI7A 1CUDA 2WTMA 2ZYSA 3A70A 4MQMA 1B6GA 1UK9A 3DKKA 1N5MA 4LYEA 5JADA 1IVYA 1F0NA 5LLSA 2RHTA 2XQIA 1XZJA 1CLEA 3QVMA 2QKYA 3WWDA 1XZCA 1YS2X 3R3ZA 4XIIA 3H2KA 1QE3A 4I4CA 3WK5A 1QIDA 5C8ZA 4M0MA 3KWFA 4MEBA 1R1DA 1UT6A 5ALSA 3QPAA 4G8DA 4X00A 5JATA 2WIJA 5ISMA 2XLBA 4BP9A 3C5VA 3I2GA 5JD5A 4X6YA 2H9YA 3EQ8A 1QO7A 2JGEA 5CXUA 3HLKA 5KWIA 3QH4A 3OPMA 4W1SA 1ZGBA 1BN6A 4JUIA 2QUAA 7YASA 2XUQA 1E8MA 2PUHA 4ZREA 2FJPA 3VDXA 4RPCA 5CH8A 3O4JA 4BE4A 5DYWA 4HAIA 3WKCA 3M3DA 4BAZA 3W05A 4RGYA 3BL8A 2JF0A 3G0GA 5HK8A 1JT2A 1IUPA 3D2BA 1CQZA 2WILA 5K3CA 4EY4A 2ACEA 2DQYA 1L7AA 2QTBA 3FYUA 1BCRA 3H19A 2HU8A 6YASA 2OCGA 4MYDA 4AO7A 4HXEB 3LIIA 1ZD4A 4EY8A 4L0CA 4PF1A 1MAHA 2RIPA 5AI4A 5AKXA 4NS4A 4G8BA 3T4UA 3AZPA 3FOBA 1XROA 2VAVA 3V1NA 1R88A 4FFWA 2XB6A 3WKAA 4BVKA 1NU8A 1HQDA 3ZLVA 1P0IA 4X91A 4DMHA 2XQGA 1JJBA 2WG2A 1MAAA 2XMGA 1W1IA 3WYNA 3W2TA 3KWJA 4Y2XA 5AI5A 4FWBA 5SYNA 4J0IA 3IBTA 4J03A 4QDTA 4WDQA 1CUAA 1XZDA 5A71A 4PSCA 1ZD3A 5DNUA 1VE6A 5AI8A 4PV7A 1AGYA 3K2IA 2Y2UA 1IUNA 2WU4A 3QM1A 1ZI6A 5IVHA 1FFCA 4N5IX 1LBSA 5C8XA 4W1RA 4ZGBA 2G63A 3UUFA 4Q34A 1Y37A 5HF6A 4UFPA 2HFKA 2Q0XA 4AQDA 5JYCA 1WOMA 1YASA 4EY5A 1K63A 3FSGA 4Q3KA 5ESRA 4U2GA 1YB7A 1E89A 4HVTA 2HRQA 3DOHA 4X95A 3G02A 1A8SA 4XX1A 3C87A 5ALFA 3C6XA 4QEKA 1RWQA 2BFNA 2VT6A 3DL4A 4BDTA 4QDUA 2Z8ZA 5FDFA 2VAXA 4GXNA 5FXMA 1LPSA 1TKRA 4J0KA 1CVLA 3PUHA 1WPXA 4FNGA 3ANTA 5EFZA 2J3QA 4TPKA 2G5TA 4H7FA 3E0XA 3STWA 2QXTA 3F96A 4X85A 4RE5A 2QZPA 4YX9A 1EA5A 5DNVA 4QWMA 4B80A 4IHAA 3BXPA 5AIAA 4MEAA 3W9BA 2XLCA 4FDMA 4PQEA 4GDMA 1XZMA 1UK7A 2J4CA 5FOQA 1NU6A 1SC9A 3PUIA 5EIHA 2VJCA 4PO3X 4L9AA 4LXIA 2V98A 3RM3A 3B5EA 2FX5A 3H04A 4U2FA 4E46A 4HS9A 3DJYA 4QA9A 1MX9A 5K3EA 1YSCA 3VVMA 4F0JA 4DMFA 1CUBA 3STYA 2ONCA 5FPQA 1SOMA 1R4ZA 3ICWA 3G9ZA 4PW0A 1QTIA 2QUBA 2BCEA 4BRZA 3I2JA 1VE7A 3FVTA 1WB5A 3G8YA 1XLWA 3A2LA 3VXKA 4Q1VA 2JGJA 4H7KA 1ODSA 1J06A 3DQZA 1DWQA 1ZD5A 4RE6A 1F8UA 4BZWA 4OD0A 4V2IA 4BCBA 2WJ3A 4EA6A 2AJBA 1KU0A 4H7HA 1HKHA 4ZRDA 5ALOA 3R3VA 3PFCA 3D4LA 3AUKA 4LXGA 1VXRA 1XZKA 3STUA 5IH7A 2WJ6A 1VXOA 2JGIA 2WFLB 5CT5A 3ESAA 1QIMA 4IQ4A 5AK6A 5LZ2A 3M82A 3FAKA 1QIJA 5HZGA 2IITA 2OAGA 1ZD2P 2PSFA 3BF8A 3JW8A 4CI9A 3LLCA 4Q3LA 2OQVA 5IVDA 2AJLI 1CUSA 1CRLA 1T2NA 2GBIA 2R8BA 4YPVA 1VZ3A 1MT3A 4W1QA 5T4FA 4FLFA 1IUOA 2CKMA 2WHQA 2C0PA 4X7BA 1G42A 1MJ5A 1YS1X 5AM1A 3DYVA 3SK0A 4BZZA 1HBJA 2OLEA 4DGQA 5C81A 1ISPA 1DQYA 5K3AA 2EEPA 2QOEA 5A7FA 4WFKA 1YAJA 2XUAA 4LHEA 3IURA 5EHXA 1XZIA 4FBMA 2D5LA 1UZAA 1JU3A 2HA0A 3PF9A 3B12A 2PL5A 3H18A 5AHXA 4J0HA 5T4HA 4K5QA 1TCAA 1N5RA 5HQ3A 3DKRA 3H2GA 4MYSA 4DSAA 4A23A 4FLMA 1Z68A 5EHZA 5DTJA 4DNQA 3ZLUA 1GQRA 1ORVA 4UPDA 3TJMA 1N8SA 1QFSA 1QIHA 3IB3A 4N8EA 4CG2A 3BJMA 1IMJA 4UBMA 5ALQA 3ED1A 1VA4A 3C8HA 4DNOA 5AK5A 2VJDA 4KE7A 4EY7A 3NOXA 2H1IA 2QR5A 3IUJA 5C8VA 3I6YA 1ACLA 1CUGA 1XRRA 2PX6A 2JEYA 1MO2A 5AJHA 2GZRA 5HF9A 1U4NA 2HA5A 2VT7A 1Y7HA 2ROQA 3QPCA 3VJKA 2WUGA 5H3HA 4UBOA 1UOPA 5HF5A 1MTZA 5LZ7A 1UKAA 4WDRA 2DCMA 4CG1A 3BDIA 3E4DA 5CMLA 4KYVA 4U2DA 4BCDA 3M81A 5HK9A 4BYMA 3GUUA 4C4ZA 3FLAA 1CV2A 1LPMA 3C45A 3WJ1A 4QE3A 2XUPA 4Y2UA 5AKYA 1J2EA 2FUKA 3N2ZB 1XQYA 3QYJA 5JAUA 5K3FB 5SYMA 4AXBA 2HU5A 4LYDA 4HZGA 3FSGD 5DLPA 3L1IA 3D2AA 5AKGA 4G9EA 2QXUA 2VA9A 1THGA 3Q0TA 5LKAA 3AJAA 2WQZA 1LLFA 5AIBA 3R41A 3WKBA 3GROA 3IUNA 3L1JA 1JI3A 4X6UA 1W4LA 3LIPA 2C5GA 2V97A 3AIMA 1CUUA 1QO9A 3F97A 3HEAA 5LKRA 5LZ5A 5AM0A 3SC2A 3I28A 3D2CA 1FFAA 2XUHA 4B81A 4AMZA 1TRHA 2RONA 3IULA 4J0DA 4G4IA 2OPHA 4KACA 1HDEA 3DEAA 1F6WA 5CT8A 1K4YA 3LP5A 1QZ3A 3FVRA 3D5EA 3FLBA 5AI9A 1LNSA 5DYYA 1JMKC 1D07A 4X97A 1XZBA 3H1BA 1EDDA 3A6ZA 5AK3A 1ZICA 2VSQA 1EDEA 4KE6A 2BUCA 1VLQA 2BUBA 2ES4A 4DMCA 1UFOA 2DQZA 3I2HA 4U2EA 2XQKA 2W6CX 4ZV7A 4Y9SA 5D3ZA 1BRTA 2C58A 3T52A 1EINA 2GBCA 2XMRA 2V9ZA 4QDZA 4WFJA 4P08A 2IIVA 3I2FA 5YASA 5ALMA 4QLAA 3PDCA 4H7DA 5EHNA 2VEOA 4WY8A 1QOZA 2PSJA 4UHFA 1RP1A 4UHCA 4E11A 3OC0A 1XZHA 2XUKA 2PSDA 1JJFA 1CIJA 1SCKA 5ALPA 3N0TA 4BAUA 4P92A 4X90A 4E15A 1CUJA 5CXXA 4GI1A 2QVBA 5AOBA 4MWSA 2WUDA 2H7XA 2HU7A 2C7BA 1QTRA 1QIEA 3CXUA 4KR0A 5K3FA 2DHEA 4UFNA 3FYTA 4GEGA 4M0EA 3V1LA 2ACKA 2WU3A 4DNPA 4UBIA 1Q84A 5JASA 1U2EA 2GYUA 3EQ7A 4GHWA 1HL7A 1LPPA 1G4HA 3O4GA 4EBBA 1NX9A 4XWGA 4Y2SA 3WK9A 1QIKA 4BVLA 3EQ9A 1OILA 3O4HA 3R3WA 3BJRA 5JALA 2XUJA 1IZ7A 1ZI9A 5ALHA 3WL6A 1XRPA 3RARA 1Q0RA 4BAGA 1DX4A 3HSSA 2PKYX 5AI6A 3O4IA 5CW2A 1EVEA 1E66A 3KXPA 1EX9A 3QMVA 4HRXA 1VA5A 3EIOA 4F21A 3U0VA 1TCBA 4MXDA 5HF8A 2DFPA 2IX9A 2VQ6A 2WUEA 4K2AA 3WJ2A 3BWXA 2B20A 3ZWQA 4B9AA 3WZLA 1S8OA 3WK6A 1FSSA 2K2QB 1CPYA 1LBTA 5A7HA 3FWHA 4J0CA 1R3DA 4JNCA 3R3UA 2EDCA 3ZI7A 3R40A 1HPLA 4JYPA 4W9RA 1B41A 1GT6A 4H77A 3H2JA 2HM7A 2RGUA 1EVQA 1VKHA 4QWWA 5EIAA 3O9VA 4L72A 3F9CA 5FKJA 5ALZA 4AZ3A 5JZ9A 1C7JA 3WQHA 2PM8A 1SCQA 1DT5A 3DCNA 5AO9A 2HA6A 1WM1A 5JZSA 2ZSHA 1GPKA 5D3KA 4EB0A 3FCXA 4BRSA 3MVEA 2CMFA 2GYVA 1A8UA 2YXPX 2RI6A 4QZVA 4FKBA 4BB0A 1DWOA 2PVSA 2XUOA 3R3XA 4ROTA 1T4MA 3BIXA 3C5WP 2R11A 3VJLA 5AM4A 3FYUC 4G1FA 5KREA 1AX9A 3AIKA 2ZJ6A 2W22A 3DL7A 3C6BA 4IH9A 5JAOA 4Z49A 3NGMA 5CH3A 5J3JA 3SWWA 1YAHA 2OCKA 1E8DA 4G8CA 1FFEA 3JWEA 5E2IA 1LZLA 1DINA 4W1PA 5AKJA 5ALWA 1O6GA 4X3CA 1MX5A 2VF2A 2WHPA 4MWTA 4X92A 4A16A 1C4XA 4DM7A 2I3DA 2EDAA 4KAJA 1ETHA 1EHYA 3VISA 4FFVA 5AI0A 4WY5A 3JYHA 1BS9A 1A7UA 2CUTA 4GECA 3I1IA 4C88A 2QJWA 5A2GA 4OCZA 2OG1A 3G0CA 3WZMA 1EI9A 4PNZA 4U2CA 1Q83A 2YASA 4YASA 1W6RA 1XRNA 1FFDA 4Q3OA 5AM3A 2B61A 5ALGA 1TQHA 3D3NA 2BAGA 1XLVA 5T4EA 5FUMA 1N1MA 1TCCA 2VJAA 4OSEA 5AK4A 3WL8A 1XFDA 1UKBA 2AJCA 3ANSA 1EDBA 3V1MA 1K5PA 1AUOA 1UK6A 3R0VA 1Q0ZA 4KAAA 1H22A 4NVRA 3IA2A 1SCIA 1A8QA 5K5EA 1EK1A 1X70A 1LZKA 4KAFA 1AURA 1K8QA 3E3AA 4G4JA 2X76A 4Y2TA 3STXA 5EGNA 2HDWA 5IVIA 1C7IA 1WB6A 4NMWA 5ALNA 1MU0A 2WM2A 2O2HA 4ZV9A 5A6VA 4CCYA 3V1KA 4BC0A 3LCRA 1XZAA 1FJ2A 3HXKA 5JD6A 2AJ8A 4C01A 5LZ9A 2O2IA 5ALEA 1WHSA 2Z3ZA 3D7RA 5KBYA 1UXOA 4P93A 2QRUA 5AKHA 3OTQA 1H2WA 1E3QA 5LYYA 4ETWA 2G5PA 3OG9A 4UBLA 5IKXA 1LPOA 4JEIA 4OUKX 5HKAA 2WHRA 3IIIA 3AILA 1ZI8A 5E4JA 3H1AA 2OCLA 2OQIA 4H7EA 4F60A 4OYYA 5LIPA 1ZIYA 3CN9A 4IO0A 2VATA 4GWLA 1CFJA 5C7YA 1UWCA 5EI5A 2ZYIA 4H0CA 2AJDA 2HA7A 1VJ5A 3WK7A 4W63A 5ALKA 1DT3A 4HTAA 3YASA 3WK4A 4HRYA 5HFNA 4BE9A 1QIFA 3MUOA 1PV1A 1CUWA 2HA4A 1YA8A 2D0DA 3F67A 4Q05A 3WA6A 1MNAA 1OXMA 1VOTA 4WFIA 4QNNA 1EB9A 2JGKA 4C4YA 4K6GA 4DSZA 4DMKA 1CUXA 5ALXA 5LP1A 2CZQA 3M83A 4FTWA 1ZOIA 2OGTA 1BU8A 3I6MA 1X2EA 1P0MA 3QITA 5A62A 4KE8A 4OYLA 4Y7DA 1XZEA 3ZPXA 3IUQA 1LPBB 2B9VA 1H2ZA 2V96A 4ZWNA 4K6HA 4DNFA 3FYUB 2XDWA 4QDOA 5D7BA 4A5SA 4J0GA 3FBWA 5JAHA 1ACJA 4ITVA 3OURA 3F8SA 5ALIA 3K9BA 3O0DA 2Y2VA 2XMBA 4MJ3A 4H7JA 1EXWA 1XQXA 2DR0A 3NWOA 4I19A 4X93A 4B0OA 1CUZA 2X5XA 2CJPA 4JYMA 3ICVA 1BN7A 3C70A 3V9AA 3STTA 3OOSA 3KOOA 1XRMA 3VJMA 4QDXA 2XMZA 3GBSA 2WIGA 4G9GA 4CIAA 2GZSA 3H2HA 4B6GA 3GA7A 1LPNA 4B0PA 2HADA 1JJIA 2JGMA 4K6KA 4FHZA 4B9EA 1W76A 1KEZA 5I7UA 4OU5A 2PU7A 1I6WA 2GBGA 2UZ0A 1IZ8A 1UKCA 3D0KA 2WLSA 1ZJ5A 4RNCA 4AN0A 4UBKA 4G5XA 1DTEA 2LIPA 4Y2VA 2CB9A 3O9MA 1KU6A 2E3JA 3AINA 5ALVA 4L3WA 5AP9A 5E4YA 4DLNA 1X2BA 1HLGA 5AKZA 3V48A 3G7NA 1JFRA 3WMRA 3U1TA 1DQZA 2ZJ7A 1H2XA 2PBLA 3MUNA 5AM2A 2XMSA 4ARAA 5AKIA 5CRIA 2HA2A 2WKWA 1J07A 1QONA 3KD2A 1MX1A 5AOCA 2XE4A 1J1IA 5DTIA 3ESBA 3H17A 4MQLA 4LKOA 1GPLA 1LPAB 3DS8A 2WFZA 5ALUA 4CCWA 2WIKA 3QPDA 1YR2A 2PU5A 4X94A 1XZGA 2PPLA 3SX4A 1QLWA 5FV4A 4N8DA 4UFOA 3GFFA 5HCUA 4C87A 3MGAA 4EUSA 1CUFA 4B84A 2QM0A 5JANA 4OB6A 1W75A 5HQ3B 5DWDA 4I3FA 4DYHA 1BEEA 3WWPA 2C5FA 1XZFA 4KE9A 5FRDA 3RKSA 1U8EA 1XKTA 3G9UA 2H7YA 4AMYA 4EZIA 2QS9A 3PE6A 5CTAA 3CCCA 5JIBA 2O7RA 4B7ZA 1JKMA 1ORWA 1QJ4A 4GBGA 1XQWA 4GW3A 1ZIXA 3S8YA 2Y6UA 3AZQA 2HIHA 2J4FA 1QFMA 1R9NA 2JBWA 5JAPA 3AFIA 4N5HX 4TVKA 3WL5A 4KEAA 1CUCA 1CUHA 1R9MA 2J3DA 3H0CA 1UK8A 3R3YA 3WIBA 3W9UA 1WB4A 5ALTA 4BP8A 1WPRA 1CUIA 3KSRA 2OGZA 5AH0A 3TGLA 1QGED 4X71A 1RYYA 4UHEA 1U65A 3FLEA 4BTVA 5EHQA 1BE0A 3PICA 3WLAA 4Y2JA 4ZXFA 5JARA 1CQWA 1G5FA 5I8PA 4KRYA 4EHBA 4INZA 4FNMA 2G4LA 3ESDA 4H35A 2RAUA 2WG1A 4UHHA 3KDAA 4M0FA 3G9XA 3WA7A 2ZJFA 1R50A 4ZI5A 3HJUA 1TK3A 2X8BA 4AN1A 3LS2A 3G0BA 2HFJA 4Y2RA 2WFMA 2QT9A 4UUQA 2P8SA 2WJ4A 1YCDA 4Y2QA 1AQLA 2B4KA 1GPNA 1E5TA 4BC1A 3A2NA 2I03A 2XUIA 4E14A 4PSDA 4J0JA 4IH4A 1XRQA 5LZ4A 4CCYB 2I78A 1GKLA 4D9JA 2HRRA 5BWBA 3HACA 5FPPA 3ESCA 3CN7A 4FLEA 2DHCA 2PSEA 1K6EA 5DYTA 3G0DA 4BVJA 3K6KA 4HXGA 4AZ0A 3QZUA 4UHBA 3I2KA 4UBJA 5AKEA 1MNQA
chains in the Genus database with same CATH superfamily
4LNUB 4C4AA 1J8VA 1DBQA 2X9VA 1RXUA 1FL9A 1QV7A 3V2GA 1I4OA 3W3ZB 1JKIA 4N0QA 5KYTA 5FWXA 3F47A 2OHHA 2JLWA 1CS4C 4TRMA 1RRPA 1T2UA 3QXSA 3ZI0A 4H5JA 1QG6A 1W8IA 3NUGA 3FIUA 4KO1S 4LDQA 3QEBZ 1AGPA 1EVKA 2LV8A 1Y7IA 2HLDA 1XKLA 2Z5GA 3HBAA 1TCVA 1F9EA 1TKCA 1WMAA 2QTZA 4BJ5A 4KRXA 5CPBA 3FPLA 3CF2A 1FJGB 4B83A 3VOAA 1RWBA 1RHMA 1KFBB 1YRWA 2QQFA 4MGHA 1WXEA 4P5DA 2EJTA 3IBFA 2X9GA 2N9UA 4KJXA 1QIGA 3EY9A 3UV7A 3CH7A 1U7TA 4L28A 4GX1A 1AV7A 4FMCF 1I94B 2O48X 2WD9A 1J42A 1SKYB 1PT8A 4OU4A 4KIUA 2Q0SA 4KQ6A 4BO2A 4YAOA 4QVIA 3M5PA 4XJTA 5JY6A 1VL6A 3CLTD 3UJNA 3QVWA 1PUXA 3HABA 4UHFA 4C4XA 3DOCA 2B8NA 1G66A 3OA2A 5JD4A 1ONNA 5LQNA 3ZBUA 1USWA 2OCBA 3T7SA 2FWRA 4HDRA 5CA0F 1G291 3RQIA 4CZYA 1IJFA 1P3DA 2B4YA 2WM3A 3QLEA 5KKCA 3LT1A 2J0QA 3TR0A 2HLHA 2QRPA 4BLPA 2WP0A 3ITNA 4KFUA 1CR0A 3UB4A 3A6GA 2B83A 4MDFA 3SZUA 2WUFA 4NCHA 1UM8A 1SKYE 2L42A 2EX0A 5A3SA 2GBLA 4BB9A 3GX1A 3U7RA 4CIYA 1FP4A 3TSZA 1M33A 3P2MA 1RYDA 4HL6A 1QCYA 1NZDA 1POWA 1RXSA 4Y6SA 1F2TA 2YWXA 3E5HA 5BOVA 5JVDB 2QNRA 3LBAA 1H8HA 2Q99A 1CEXA 2P5TB 3H97A 2PT9A 2RB5A 2XV1A 1FYXA 2J5RA 4L8FA 4Q21A 2QAGC 3DC2A 5SZJA 3VU9A 2G36A 3RLFA 2H7CA 5HKLA 1ZXBA 1IB6A 1QQTA 4R2MA 2CBGA 4BEWA 4KVAA 2CK3A 1V47A 4FI3F 5IHXA 2PFGA 1WUIS 4LRSB 1U0FA 4O5AA 4WL0A 5KJEA 3KZKA 2ZIWB 3BGWA 2F64A 2R25B 3A1NA 2DTXA 4ES6A 5KU7A 3VA7A 1AJEA 4EKNB 1VHWA 4YP7A 1BROA 2PLWA 3PHJA 4IJ6A 4A6EA 5AVUA 4C6TA 2IQ5A 5MN5A 3WGYA 3PYMA 2G6BA 2I54A 1JIQA 4HWPA 4KO4S 1XYGA 1A82A 4NYMQ 5CLIA 2QRHA 4CF3A 4F11A 1HNZB 2YYZA 2JFXA 1L1EA 2C5EA 3BG0A 1XPUA 3C3BA 1TPYA 1WMBA 1SQ9A 4GMKA 3LG2A 2XKKA 5LP6F 1QIIA 1AXGA 3GJTA 1H6DA 1QHHA 4J7AA 1M9NA 1QG2A 3ZDQA 1XD8A 4D4KA 4G07A 5KNBD 2NQTA 1F0PA 1RJFA 3B1KA 2EFJA 4R8LA 4N49A 3T7DA 2J56H 5DJ5A 5ALYA 5E4TA 4ZDKA 3FY4A 4H60A 1J9EA 5TQJA 2BUAA 4PPYA 1ZQ1A 3SDBA 1Z74A 4A5OA 4MR7A 1E2FA 4KKVA 2XA1A 2BJHA 1PR9A 4GKAA 4B7CA 2CUNA 2NTYC 3OWXA 4YNBA 1GNQA 2EL9A 5AVTA 2A6PA 5GZ3A 3ZDRA 2CNKA 2H9IA 2VJBA 3T3PB 2C8KA 4IEEA 1SCDA 1ZN7A 3P2EA 4FNOA 2A92A 1KE2A 3HVRA 2AFIA 3WV5A 1A9TA 3U1VA 2O0HA 5LMCA 2OGSA 3J81A 4MMXB 2XUGA 3NAZA 2QUHA 2PRYA 4NRDA 1Z28A 2F9LA 2XTNA 3N2GA 3RSHA 3R09A 2ISQA 1Y9DA 3K92A 1UPCA 1OCEA 2JEZA 3I9MA 4B3GA 1O03A 2IBMA 1W35A 5HE1B 1HV8A 4K6CA 4EDFA 5H4GA 2IT1A 3T3OA 4DIKA 2WNIA 1YQGA 3QKIA 1G3UA 2QN6A 4OJYA 5TF2A 2YV4A 5FTKA 4GR4A 1XRLA 5TXGA 3I1FA 4JI8B 4IV8A 1PCXA 1BMQA 3GHYA 3V55A 1KOFA 5A4DA 1BU5A 4XR4A 4IDAA 2P27A 3Q7QA 1TO1E 5C5EA 1ZP6A 2F17A 1FFXB 1U1DA 2FMHA 2WU8A 3Q2OA 3Q8WA 3RNOA 1QKJA 5EXSA 4F71A 3PXBA 4UTVA 2OAEA 4P81A 4QM6A 3DNMA 2BGNA 3EMVA 2IGBA 2HX1A 1D5CA 1CBUA 1KRWA 1U7PA 3PI6A 4WCFA 3CLHA 2Z2JA 3GD7A 4N18A 1N2GA 1RPNA 1L5SA 4ND8A 1UWLA 1F17A 1MGPA 4CUJA 2AFIB 3B1XA 3C3CA 3IAM6 4XJVA 3FI0A 4Z7NA 2ONKA 3H5IA 1KWGA 4JI0B 3KPWA 4JVNA 1DOHA 3PDIB 3U48A 2NUBA 4BX8A 2R7NA 4R9SA 5BVHB 5HOEA 2XE7A 3E48A 5I3CA 2O50A 3EZ6A 5KYUA 5KJ6A 2BKLA 3K6SA 2WTNA 2IYOA 5JCXA 4N3CA 1Z39A 1OXXK 4ZN6A 2OCIA 2R6HA 5KC9A 5KTPA 1BVHA 1REQA 1M1YE 5IUNC 3PWZA 4KWIA 4S35A 4EL0A 1JG3A 2VKQA 1T2CA 1V43A 3S40A 4YJDA 5ADHA 2B2XA 4N7MA 4QRDA 1NC3A 4KRGA 2Z3WA 5KQMA 3AIOA 1HRKA 2H63A 4POOA 2ZYRA 1DTSA 2ZSEA 4RPLA 4ZI7B 4J6EA 1NRIA 2Q1TA 4YQEA 2PMFA 3GUVA 1VI5A 5AKKA 1U28C 1DC7A 1WSAA 1YJ5A 3WGMA 5ICMA 2BM9A 2QF7A 2X1HA 4R84A 4HDKA 4EG5A 3HJGA 3RYHA 2N1BA 2HF9A 2X6TA 2FMKA 4DUZB 3RUAA 3VTZA 2R8RA 1UC4B 2QVLA 9MHTA 5BYJA 1LX6A 2ZCUA 4HP8A 4JNKA 4DHEA 3W5AA 1JU4A 1VPWA 1M2WA 3JVIA 3AETB 2VDUE 3QMMA 1M6VA 1SKBA 3DAYA 4RY0A 5EJ2A 4E5NA 2QJRA 3V6LA 4GMDA 3RS2A 4WVFA 3AVUA 2O3SA 4C0XA 2XCOA 3VR2D 2XT0A 2WJPA 1IRIA 5DTRA 4F5EA 3DE7X 3G23A 4CM9A 1CR6A 1ORRA 1KC3A 3K72A 2B4TO 3NT5A 5TQ0A 3RCBA 3G2PA 4FOLA 4JSYA 1VLVA 4LJ9A 3GQBB 2A5JA 4X20A 4AVYA 1ISSA 1U1CA 3T4PA 3A2MA 4PE5B 3UWKA 3VVCA 3KQVA 1RABA 4H0NA 1PFQA 3MW8A 4R5HA 4RZUA 1FDWA 1P7PA 1TAHA 4D3FA 1ISJA 1LTKA 3C14C 3C6ZA 1IZYA 2ET6A 3FDXA 3K2EA 2QWXA 4GZMA 4NJMB 5FI0B 2AT1A 2Q45A 2XY4A 2RH5A 5IDQA 4A36A 3OZTA 2IV3A 3TPFA 5AICA 5E8JA 3RSCA 1OU4A 1MC8A 4ESGA 3AGPA 4UZSA 4ITRC 2HSJA 3SX2A 4JU9A 4UPVA 1X74A 4MWCA 1FS5A 1DX6A 3KVOA 1VKZA 5GY7A 2VK2A 2XNJA 3BIWA 1L4GA 3V4FA 4B2YA 1OLSB 2Y4OA 3PGVA 1QNIA 6LDHA 3TECE 3GN2A 3QTTA 4WASA 4XPIB 2Z8XA 3DOIA 3TNDA 3WL7A 4E5YA 4L74A 5CDTA 3MTAA 3EWSA 1BHQ1 1O8CA 1QGOA 2C4NA 3PX3A 4YJHA 3FMVA 1RM5A 1XMXA 2JIDA 3C15C 4C6HA 1A8PA 4JEHA 4REMA 5FUBA 3T4EA 1AF7A 2OHOA 3OOJA 3ZZTA 4BTLA 2JCBA 2V65A 4CQJA 3H5OA 2IH5A 3CUEF 1EFVB 4UM9A 2ZYUX 5KYVA 2HDOA 3WBBA 4JBWA 3CQ9A 2C97A 3LQYA 4FMDF 3ZWBA 3WWEA 1HY3A 1FU7A 2ASEA 3L4EA 5F2OA 2IZ1A 2XRMA 3RVQA 2HCRA 4NSXA 4NCXA 3I2IA 3DDCA 5AOVA 3HFJA 2F2TA 3KOZA 3NVAA 3GJYA 2P2GA 1BD3A 4YK7A 2H14A 2QRJA 3JVEA 1RZ3A 3A3YA 4PSKA 3I7PA 1LUAA 1NATA 1KIMA 2P9ZA 4LV5B 5E0OA 4EDHA 4FZ5A 3HUFA 1X3LA 3EAGA 1DBIA 4AX4A 1TVKA 3K0AB 3EK2A 3O95A 4O02B 3RSOA 4B3BA 4IIUA 1PFVA 3HRHA 5FEMA 3ZK9A 4RVCA 3SM9A 1DEHA 4BIIA 4G0UA 2XAUA 4NXMB 1XA4A 1HFJA 2G7MC 2YINC 1S2IA 1T2AA 4IXWA 3RFFA 3ZG6A 4BO3A 3KXLA 721PA 1OTXA 3WGKA 1OV4A 4D9CA 5JZBA 5EPUA 1I9CA 2IEYA 2HRCA 2VYVD 4YXWD 1PJ3A 3OJEA 2VTVA 1PUJA 2VFAA 2O8CA 3OU2A 4L6AA 2OO7A 1JG1A 1IQUA 4O1QD 3BTSA 3GJQA 1M2NA 4L3OA 5DF1A 3TW8B 1U9CA 3IXQA 3I2NA 2G4CA 3AJEA 2PWZA 3WB1A 3H5TA 2YCLA 3CRNA 3RRXA 1RS0A 2Q6LA 3QYAA 1CIVA 1K5HA 4H17A 3UTDA 1SIWA 5H83A 4FA1D 3HYSA 2ZUWA 3BAZA 3R6GA 3ZNNA 1NEXB 2V7VA 3IUSA 4LWPA 2HPVA 1UWVA 4FIDA 1EE2A 1A4XA 4PWZA 1DARA 5EVCA 5A3JA 4EEZA 1QK5A 1U1GA 5ALDA 3TX2A 2V58A 4J3FA 1GQSA 5DX1A 2M2IA 1XDBA 1AHIA 4N8SA 1C3XA 2DSNA 3SJZA 1VC2A 2C98A 4GM8A 4CEJA 1LV7A 2MJLA 3GAMA 4HKTA 1F8YA 1MA0A 1G21B 4DE5A 1E7SA 1MN6A 3UWOA 4JROA 1WV1A 3ZDXA 2FZ4A 2X40A 3GZJA 1MT0A 2AUTA 1OVMA 3HXLA 4Q82A 4Y18A 2CEKA 3QVTA 4XYMA 3ZLJA 3GP8A 1K9SA 2Y93A 2GJAA 3C4QA 4CNQA 3VOTA 2QRMA 2O5CA 3E0CA 5FFGA 2NIPA 3GLUA 4FI3C 1ARZA 1GGVA 1XXHE 2GPNA 4ZXPA 4HV4A 1IBRA 4QQRA 2PQMA 2IUEA 3LX8A 4O1IA 4P3KA 2RB4A 1NNUA 4Z7JA 1YRLA 2VR1A 3EXG2 4RTSA 4KQMA 2FEWB 1VBFA 3CA8A 4XTCS 4DV6B 2WZDA 3RFHA 1O89A 2HQBA 4GOJA 3VKFA 5ED4A 3BQMB 4MRMB 3SG0A 5IX8A 3OKCA 4F5ZA 1UZLA 3IMFA 3H8WA 4WK0B 5EWMB 4GM9A 5AM5A 1BA2A 4N03A 2YS7A 4QUIA 4MARA 2XHZA 4DJJA 1N0IA 1NYRA 2WFLA 5CT4A 5HPYB 1S8AA 3EW9A 3KXIA 1K2VN 4PZZA 3ZN2A 1T13A 3HCOA 2IL1A 1JDUA 1Z0IA 3K1AB 3NM4A 4EF4A 5I9NA 5FBQB 5CD9A 4MQMA 4HLDA 3V8PA 1T9CA 4HWKA 3DKKA 5JADA 3DXKC 1IVYA 2WSMA 5LLSA 3ETLA 2RHTA 4Q7LA 1YIOA 1Y6ZA 1NF3A 2REQA 2PWBA 3QVMA 1WOYA 2P67A 2ZB7A 1UODA 1C30A 2AG1A 4KPUA 3ZH9B 4KPGA 4M36A 3QA9A 1Z08A 2IYUA 1K8YB 3LXUX 3OUUA 1CP2A 2YMPA 5CDHA 4HK4A 2MSNA 4P54A 4XIIA 3H2KA 7AT1A 2IXBA 4D41A 4ER5A 1P6UA 5L3RA 1NBHA 4GXQA 4FUTA 4QBGB 1SWWA 3ZS8A 2Z08A 5F5LA 3TS1A 1Y82A 3JRNA 1V1RB 4PXAA 2P65A 1Q19A 4P35A 3MC1A 3QXHA 3OMLA 4MEBA 4ZQCB 3VOBA 1UT6A 5ALSA 3OQPA 4ENSA 3QPAA 2WIJA 2YW2A 5ISMA 4KR7A 4D9SA 1XHLA 3ECAA 1S9HA 2XA9A 3H75A 5AHWA 4B35A 4E88A 2HMTA 2XLBA 3X1KA 4ESOA 5F2NA 3I2GA 2BLNA 4XAQA 2ZBRA 1Q7CA 4UEKA 2FFAA 4MVJH 2NP6A 3EQ8A 4PS0A 5JAMA 2YJTD 1KZ7B 3PQ8A 5BW8A 2W2PA 3OLQA 4EUKA 4TSFA 3RQSA 4EPVA 3QH4A 4Q01A 5A2QA 2QM3A 1T29A 4ZC1A 4A2MA 1B73A 1ULUA 2UZAA 4RQAA 4W1SA 3RS8A 3ZTWA 3V34A 3ZCSA 4EF6A 2QUAA 4ODIA 4WNYA 5TIIA 4YDRA 2OK8A 5A03A 3NBAA 2G25A 2V74B 2AR9A 1D2HA 4ITUA 1NVGA 3GA5A 2WJWA 3VDXA 2ZU6A 2X23A 3GRRA 4RPCA 5CH8A 1Z7WA 4C04A 4EENA 4HGOA 5C9ZA 1LVHA 3IBCA 3QF4B 2AF4C 1QNLA 3HXTA 3BA6A 3SHVA 1ONOA 3WKCA 2ZTSA 3NHAA 2TMGA 2J5XA 4DLUA 3FDZB 4RK0A 1C9DB 2FSIA 2BC9A 3G2KA 3ZDZA 1PGQA 3TRKA 1VIDA 2Q3HA 2BR3A 1UQRA 4MVXA 3KZCA 4LV8B 1DJLA 4XGRA 3JAWA 5FPYA 3EI3B 2JF0A 2OP0A 3GEDA 3GH1A 3NT4A 2CL6X 4M0DA 4Q24A 1ADCA 3T0GA 3CLRD 4W5TA 1MPTA 1WP4A 1ZBQA 3QY9A 4IJMA 4F96A 5CIWA 5SZKB 3GJ4A 1M8GA 4R31A 5BUCA 2WHYA 3EGVA 5JC8A 2BPOA 2NSLA 2O2SA 3EVTA 2WILA 2J5QA 1IJBA 1N0UA 4Z1OA 3OZCA 1AVTA 5H0IA 2XGSA 1GZUA 1I14A 3RLMD 3F5QA 1Z5ZA 2CCGA 2CF5A 4HFNA 4IKPA 3U09A 1FRNA 2GPBA 5I9SA 2R62A 2GESA 1XJ0A 3LUAA 3TZLA 1BW9A 3V1TC 4IOMA 2WTXA 4L08A 2A30A 2CXUA 2Q21A 4J9UE 1BCRA 1HLPA 2VPXA 3B8EA 4O3MA 1JHPA 1VECA 2HHHB 3DOEA 4MJXA 6YASA 1HQKA 1NSYA 2V6JA 3FTEA 5AHKA 3U9SA 4US1R 1SUSA 4PZ9A 5AW7A 4MYDA 1YZQA 5CYFA 3BD9A 5A05A 1EFPB 3FMPB 4AO7A 4BO0A 1ZD4A 3UK7A 4QTZA 2X2FA 3F2IA 3PQ3A 4L0CA 3UK1A 4ALLA 1MAHA 4LOIA 5I5JA 2PLNA 2RIPA 3DP7A 4LZAA 5AI4A 3WISA 5AKXA 4YC7A 5KTTA 1RWMA 1YF3A 4HZUA 4NS4A 2JFPA 3LTEA 1JDBC 1Z6ZA 2MU1A 1UC8A 3BWVA 3DT6A 3H9QA 3KM0A 2INGX 3OZXA 4G8BA 1T9HA 3JQ7A 3LWDA 4ND2A 3T4UA 1VHTA 4B74A 1KEEA 2CXNA 2VAVA 4YH1A 1E7QA 2Z9BA 1VHJA 3IS3A 3MGCA 3AC0A 4J2HA 1R88A 3WR5A 4R40A 1TJ5A 3U3JA 4BVKA 2P3QA 1ES9A 4MQBA 5JPCA 3O4FA 2FRVA 5AXAA 4LXXA 4DMHA 3JZGA 2FK8A 1T0PA 4CDNA 1W4RA 1Z2EA 1T8YA 3B7GA 3CMCO 1BGVA 2WG2A 2WU1A 4M37A 3TXXA 2P4HX 2ZR0A 5C1BA 3MLBA 1MAAA 1ZQ9A 3U3DA 3WYNA 2QSJA 2VDPB 2ZIXA 3W2TA 4CHTA 2VNSA 3TUZC 3KWJA 2YV3A 1LS6A 1KKMA 4M1EA 4O3UB 5EP3A 4P8RA 3TKAA 4BVAA 5A06A 4EP1A 4O25A 2BFCA 1NVWQ 4G2NA 1DDIA 1SD2A 1E6MA 5B7NA 1PJZA 2GR9A 4QDTA 2Z5LA 1QHSA 4WBNB 2CWWA 5KNCH 2CHUA 4CLRB 4MJ7A 4PSCA 5JWHA 2YV5A 4ZCMA 1T5OA 1XCMA 1ADFA 4J4BA 1NFQA 1GSOA 2PKXA 1CJTC 2VN8A 3NB0A 2J3JA 3I4FA 4HB0A 5FTJA 3GBPA 4EEXA 3SVZA 1FZQA 5J47A 2DE0X 2XIJA 2CE8A 5KNBA 4ERQA 4LGVA 1YL6A 5EPOA 1RTKA 2Q4BA 2Y2UA 1MH1A 1GVHA 2VBIA 4U4AA 3VU3A 3UA4A 1M3SA 1HGXA 3KOUA 4DJ5X 3KFXA 4CM3A 3B78A 5K1CC 4W1RA 1SKAA 1VL0A 3QOFA 5CX4A 5DO9A 1W5BA 1Z4NA 2C2YA 2G80A 2BMFA 3GWGA 3LRPA 1ORDA 1QAMA 2GEBA 3PE3A 1D0IA 3UIEA 4QUKA 4KDCA 3EQZA 3A58B 3GUZA 3QP9A 4DC1A 1F06A 4NG4A 4CEHA 1J49A 5AMSA 4GP7A 1BYUA 3HE3A 4QICA 2Y0EA 3C85A 2HFKA 5CW1A 5JYCA 2VDMA 2VYND 3VUFA 1I1QB 2JB9A 4EY5A 1P4AA 2VA8A 3FDFA 1OBCA 3N5KA 4FFRA 4QULA 3D5QA 3Q0EA 1BGXT 4XIYA 3VR4H 4ABTA 3KL2A 4RFVA 3WMXA 1GUYA 3ESXA 5JWZA 3LUBA 1GVNB 1CR1A 3E03A 3GGSA 1I32A 1ZA2A 3O84A 4GWGA 4MITA 3ZX5A 2QGFA 2ZVPX 4YRPA 5IZ4A 2V5VA 1TM2A 1D2RA 1RYBA 2FPPA 1A8SA 2FN9A 2JFBA 2XIQA 3NRCA 3PWKA 3PJDA 3C87A 2WHEA 3C6XA 4EW3A 1RWQA 1EAYA 3P9ZA 2TS1A 5EEGA 4MK0B 1IIRA 1RI4A 1Z6PA 2JANA 3DL4A 4BDTA 3N2NA 5FUQA 1D8AA 2MINB 2XUZA 4MRRA 4PONA 5KYNA 2X9NA 4JDPA 3P71T 4RTMA 2PKEA 3HV0A 3IP3A 2PM7B 1PO7A 2B37A 4ZU1X 3MA0A 2WNHA 3RRNA 2E4XA 3H6HA 3KVYA 5FXMA 4CQMD 4C0HA 5FKSA 2HQRA 3P0FA 5HIIA 2AHOA 1TW2A 1TYBE 3L0CA 3QVLA 4J0KA 4W6ZA 4ZAYA 3AYZB 3QY0A 3SS9X 1EZZA 4HEHA 5GOZA 1B14A 4OG2A 2FHSA 1E6CA 4NI5A 5EFZA 2J3QA 3A9WA 1VMAA 4HAUA 4IS3A 2FW8A 2JIBA 2FKNA 2ZTVA 3FPFA 1A2BA 3IDSA 4DQKA 1I8TA 5DK6A 5K8JB 1JKJB 2WB2A 2A4MA 3K70C 3LQ4A 5IJXA 1T5BA 4H7FA 4YALA 3JZHA 3S8YA 1VCOA 4CKZA 4AI6A 3E81A 3LD9A 2X0IA 3BFXA 2Z4RA 1QUFA 4N3GA 4QD3A 5C46F 2ZIZA 3RNLA 2P90A 3T6KA 1GLNA 5F1YA 3RG2A 5DTQA 1OBHA 1ZW6A 1H2HA 1T4CB 2BONA 2MR5A 2R7AA 3ABQB 3IEUA 3QNMA 3NHLA 1G8YA 1GCGA 1VJDA 3KJFA 3N3AC 5SICE 4GGDA 2B8EA 2J9ZB 1BC5A 2ZJ4A 3WSWA 1U7DA 5EZSA 1E62A 4IHAA 2ANBA 2QRZA 3ZXYA 3BXPA 1GAEO 5B1EA 4BKMA 4IHJB 2GWRA 4YP6A 2X0NA 1N9ZA 3JASB 3ZZ1A 4UM7A 4R69A 2PQ6A 3NYQA 1RBYA 1J09A 4GOLD 2ID7A 2IOFA 5FBRB 2GF9A 4CFYA 4YMGA 3AFCA 3K0SA 1JHZA 4FYWA 5BPFA 3AY6A 3T3DA 2MSKA 2K6GA 5JSYA 2RHBA 3WL4A 2WPDD 2CNLA 4GZLA 1NU6A 1HEYA 4YV2A 1K68A 3H1FA 1L8OA 4JX8A 4MUNA 2WD7B 4NBTA 4PO3X 1RMQA 1DAPA 1XQ6A 2PPVA 1TVKB 1FYVA 4DRZA 4L9AA 5A9RA 1N34B 1ZK3A 2R1VB 4JMLA 3OF5A 4XUEA 4XWYA 1XEAA 4DLKA 3VA6A 3H04A 1S1CA 2H4XA 4U2FA 2EP8A 3AJDA 2W43A 2XB4A 2ZRMA 1AA6A 4KO8A 3DJYA 1MX9A 2CE9A 2WZBA 3TXYA 5F98A 2W8ZA 1LFDB 3SICE 4DAEA 2R4TA 3LP8A 4LZNA 3P20A 1YSCA 2PV0A 3KLMX 4W5QA 1HLDA 5C7OO 4NV0A 3JARB 1II9A 4AWBA 1V25A 5LQDA 4FHLA 1E94E 2ONCA 4AKEA 2RBGA 4X6LA 4BNJA 3QWFA 4LYGA 1R4ZA 3GPLA 4KN8A 5AW6A 2HMWA 2XU7A 3LMKA 4OYRA 4ZYLA 1VYHA 3EOAI 1HO3A 4FFMA 1VE7A 1SQSA 4MW4A 4MQ5A 3B2EA 4KFSA 2RHMA 5G4KB 4YJKA 3RADC 4HWOA 5JO9A 1HEUA 4NNJA 2ZM6B 4LJ6A 3LUHA 5AQEA 3ZWPA 4PYOA 2AEEA 3G8YA 4QATA 5DK4A 1RWWA 3A2LA 2B8JA 3ENKA 1D09A 3LFTA 4I3HA 3EDMA 4OFWA 4BO4A 4FP9A 1E1MA 1PK8A 4MDYA 5ESXA 2IELA 2BI8A 1SKQA 4R01A 1N6EA 1PTKA 2H5EA 1J06A 5DEOA 1P9WA 4P4LA 2RGAA 3LYHA 2CNWD 4RE6A 1ZD5A 3V4PB 3L7OA 4BZWA 3HDTA 3CGGA 2BTEA 4OD0A 2DGDA 3P9RA 1XZQA 4LWOA 1JGTA 4BQOA 4ZJUA 5K7SA 2UUOA 3GNTA 1N3LA 2G07A 2OENG 3BE6A 1HETA 3DBLA 5CVCA 1Z9BA 1YT5A 2XKAA 3AKCA 4TLMB 1M1NA 1TQ8A 2DPYA 1Z88A 2LKCA 2HLNA 3F3YA 4MCIA 1WP9A 3NMUF 4QRJA 4OUDB 4D25A 1D6MA 1P4SA 3R3VA 5ALOA 3D4LA 4LXGA 4ZOQI 1VXRA 1R74A 3L93A 4RSGA 1PWEA 1XZKA 2WJ6A 5EP4A 2X5JO 1MEEA 3ZVMA 4DEXA 1H2EA 5FOWA 4MS3A 1JIVA 5KTKA 1YFKA 4DLBA 5C37A 1SXJD 4OL9A 3NIFA 2GNPA 4HDSA 5LZ2A 3L6DA 1OIXA 4J8PA 5KKNB 2ZUFA 2EVWX 3ESZA 4X54A 3RFUA 4LZLA 2IITA 1S4MA 2H1OA 4MWZA 2WIAA 3PQEA 4G09A 4JT4A 4F5DA 3TN7A 2Z6QA 5CHYA 4ZOXA 1C1XA 5KSPA 3R7NA 2C96A 1TLLA 1YDWA 1ECPA 3CURA 3W8EA 1PSWA 4L9OA 3E05A 3D4BA 3BCSA 5P21A 1YZVA 4AJPA 1X86B 2ZK7A 1IJKA 5H9WA 1FCJA 1W9MA 2JLCA 2HESX 2Z1MA 1NTOA 3LVRE 3P9IA 4MP6A 5LBIA 1TNDA 1T43A 5LUBA 3AY7A 3U9LA 2PKWA 5LQCA 5KO2A 4CEHB 1CRLA 4YYZA 1T2NA 4C3OB 4Z4CA 5G0UA 2UZ4A 3EUFA 5BUZA 3BMQB 2JFOA 3KQWA 4DSUA 1VZ3A 1V9CA 3C3YA 2RJOA 4OHPA 5DLQC 1MT3A 2JD2A 1SZCA 1Q1GA 3TNLA 5M3BA 4DVJA 1NJ5A 3AF2A 3ZQKA 3ZZUA 3BFJA 2YOHA 3IILA 2JZOA 2B9EA 3EGCA 1JYSA 2WHQA 4Q9DA 1N3BA 4IMPA 3L7BA 4X7BA 3CT6A 4IQ0A 4GLLA 3CH5A 4CI3A 4DT1B 2M6LA 1I0IA 4PWYA 1YS1X 3DYVA 2IIPA 1I7PA 3M3PA 3FB4A 3TM4A 3CF0A 3PNPA 4WEOA 3VKWA 2IBTA 4GVXA 4S3MA 4ZT4A 1TKBA 3GRCA 4DGQA 2H48A 5C81A 2XNHA 4MS1B 3TO5A 3TYXA 4AG6A 4D42A 1FFXA 2YZMA 4G56A 1A1VA 5JI3E 2BFFA 4NNPA 1VP3A 2C78A 2JKYA 3LHFA 4OXRA 5GQSA 4OHXA 4E5ZA 5K3AA 2ZYAA 3EXEA 1Y4SA 2XUAA 1A76A 2AYZA 1TTHA 4GM4A 4M1ZA 1Z5WA 3GOHA 3LPAA 5FR1A 1AKYA 3JZMA 2RKBA 2GVZC 2E21A 4F72A 3PHHA 2D5LA 5KMGA 3UW3A 5KTOA 2XTMA 2O3JA 2EYUA 3HLTA 2HA0A 2OV6A 3B12A 1OH7A 2D5AA 3K4QA 5F1OA 1CZKA 3ANYB 1NVVR 4XJSA 1DAGA 4M7OA 3H18A 1RYNA 5A4KA 3B36A 4J79A 1KRHA 2QL6A 3RVSA 5IP5A 2XZPA 1I10A 4RY8A 5EMJB 1YRHA 4QHTA 4Y3UA 2FR0A 1WW3A 3EBOA 2DZDA 1MG0A 1TCAA 1N5RA 2B69A 2GPWA 2XKBA 4IPTA 3REQB 4ESVA 1X19A 3DKRA 4H3VA 2IUFA 3U6BA 2VSNA 4R1LA 1XEWX 2Y1FA 2GTHA 3K1JA 1Y8QA 4FD3A 1C9KA 1RIIA 2FR8C 3M4XA 4FLMA 1G3MA 1EJ6A 1P17A 3D0QA 5DTJA 3UMGA 4DNQA 3ZLUA 2X22A 4YXWA 1GQRA 3A9VA 4M8NE 4N3BA 4UPDA 1T25A 3BWMA 1K4KA 2PGIA 5TEFA 1N8SA 5IARA 4EI9A 3GDFA 5BNZA 4E13A 3QIVA 4IVQA 3BJMA 1IMJA 3L07A 3NWBA 1WZCA 4OBWA 4S2EA 4NU6A 5BSKA 5JS1A 1K7XB 4XD7D 4DNOA 1PDWA 2FPXA 2YJ5A 1G2IA 1M8FA 3EH2A 2VJDA 1HWYA 3IOMA 4KE7A 4B45A 1OTYA 3I01A 5AWFC 4BN4A 4YR9A 1UT5A 2WINI 3IUBA 3PPWA 5LQMA 1H3EA 4O4JB 1BDBA 1RHJA 3V32A 2OY0A 5CXCA 2DFLA 4R1PA 4JBXA 1N3IA 4RMHA 2H9LA 3V00A 4B3TB 3I6YA 5DCUA 3GFTA 2AX3A 2JEYA 3NAMA 1AA9A 3LT0A 3U17A 1VJCA 1LDBA 3A9UA 3BJZA 4CL8A 4M1YA 5LU8A 2F8SA 3R5JA 3O83A 2ZVQX 1KDTA 2F1HA 3C7DB 2QDKA 2VT7A 3G5AA 4TV8A 3WNCA 3X44A 3CRRA 2RCNA 3TE6A 4DJTA 1U8UA 3PFHA 4JC0A 2WUGA 1PFGA 1FDOA 3FCUB 4O9DA 1RHQA 3DC7A 2V6BA 3TEFA 4DCCA 5K8VA 3I5YA 4DG8A 1Z12A 3CUWA 3AKZA 1GGNA 2D7DA 2V3CC 4PTZA 2Y66A 1RPAA 4X1OA 4NBNA 1EFAA 1UKAA 1GPJA 3OZEA 3FYDA 1P9LA 3FXAA 4MKHA 5ICFA 4FB4A 3E4DA 3ITKA 1RRKA 4PZ0A 5CMLA 4KYVA 2P1DA 4A6XA 2BCJQ 3HYTA 1SHUX 1U3FA 4U2DA 5IU6A 2WSSA 4JELA 4QHSA 3RTAA 3QKWA 5HK9A 4BYMA 1A5SB 1GU7A 1NT2A 3N0DA 1AKQA 1G8MA 1P9NA 1OXBB 1W29A 2AFHB 2HZBA 2XVAA 3FOCA 4C4ZA 2JCSA 3AM5A 1GDDA 2CN2A 1GPDG 2XSZD 2ZRCA 3FLAA 3NTLA 3R6TA 4PGHA 4URHA 4DJEC 2DQKA 4RVFA 1RCFA 2GETA 1GV0A 3OTTA 3WYEA 2XUPA 4TMKA 4BPBA 1UM9B 4ZTBA 4JSXC 4N0EA 3FTCA 4L78A 2H1LA 4F6RA 4YJFA 4MZXA 4EG7A 4HF7A 4MB6A 2DVMA 3N2ZB 1XQYA 3QYJA 4Y6LA 5JAUA 5SYMA 4QU9A 4AXBA 5LXTB 1BWSA 1HK7A 5C2VB 5E1BA 1VIVA 2QRNA 5BURA 3DB1A 2C4KA 3B60A 1S0UA 3AY0A 5AJVB 2IU3A 3SN6B 2I33A 3WNQA 1N9GA 2FSHA 2QTLA 4IDQA 1V5GA 4P22A 3KT6A 4O4LA 5SV2A 3U4QA 1THGA 4RY2A 3KUKA 1QHNA 4AZVA 5K0ZA 2F48A 3BVPA 1E6UA 1YMVA 3C1TA 3GLVA 4P7FA 3THXB 4MYRA 4F4IA 1SG6A 2DX7A 3PQ6A 4HLCA 3RSQA 4BGEA 5AIBA 1GEGA 3R41A 2I3AA 1ADBA 3GROA 2AQIA 2I2DA 4B5LA 3D2LA 1QK4A 1NKVA 2IF2A 4ZCLA 4ZK2A 1JI3A 2ATCA 2V03A 5FIUA 3W5VA 5HVNA 2JHFA 1D8TA 3F7MA 4ZKEA 1BW9B 3KLPX 1KZYC 2PK3A 2Q4RA 3N8IA 1JPJA 1CUUA 3FNGA 3TOVA 1C9MA 3ETCA 5JEDA 2QLFA 1Q22A 1KXZA 4J73A 5EMHA 1NVEA 3EDQA 2FMXA 4RXTA 3QX3A 4IKOA 4X44A 3OHSX 3CZAA 2E9SA 3IEKA 1U0NA 1KJQA 3A37A 3UKOA 3I28A 3D2CA 4UVHA 3J7TA 1OMWB 1RHRA 3JYLA 3DO5A 3O03A 5FBWB 1TRHA 2J0EA 5J2UB 4PVDA 1BWPA 2QRVB 3TNJA 4J0DA 1DAIA 3KPVA 3PD7A 1OZHA 2ZS9A 4KQWA 1BCSB 1EK6A 2WABA 3IQDB 1INLA 4KACA 1JHUA 1M73E 3IALA 4TN5A 4TVOA 1DDGA 5DGXA 4WERA 1GG8A 4DLYA 1J9ZA 4LF9B 1XXHB 3DEAA 4B34A 1WNFA 4DZZA 1K4YA 3WLEA 3LQ2A 5BSFA 5EE0A 2H47A 3CRQA 5ABPA 3E7DA 3ZE2A 4C7OA 2K5UA 3I42A 2QTMA 4PXYA 1MRZA 4M9XA 5IW8A 1QV6A 2UZ3A 1NURA 3C5EA 2Q9UA 1QZ3A 2AF3C 4WLUA 5IBQA 4FWTA 3D5EA 1UFRA 1XP5A 4POAA 2Z95A 3OSUA 1J0AA 1HE2A 1LNSA 5AI9A 3T06B 1QP7A 2XJ4A 2PX5A 3DHYA 2CMGA 3R0JA 4IJWA 2ZXUA 3K35A 1MQ8B 3K9GA 5CGZA 4OJMX 3WZ2A 2R8EA 3ILVA 3ORFA 4M8IA 4NS1A 1D07A 4QXPA 4TT3A 4BKQA 2BFDA 1DBVO 2MHCA 5K01A 4MV9A 1K7EB 4H6WA 4NOLA 1KQGA 1SJ9A 5DISB 4YMHA 3U60B 4TXMA 1L9KA 4X97A 3RTGA 4DLSA 1YDHA 2CXOA 3GJ7A 3JY6A 5C7LO 3H1BA 1J1ZA 4IIYA 1XLTC 4WA7A 3RVNA 4LJLA 3UJAA 4BEJA 1S2NA 1JIUA 3OQNA 4UTZA 2UVQA 1ZEJA 5IBRA 2QGZA 3PR3A 1X7WB 1O96B 2XEDA 1ZICA 2VSQA 3FZNA 5BN3B 2E87A 2RK4A 1PW5A 3CLRC 3H3FA 3KG2A 1ZR4A 1ZRSA 3SLKA 2BUCA 4IRZA 1NJSA 1L8AA 3HM2A 4FDTA 3RRJA 5DM2A 1RVDA 4AS3A 4ARCA 4OBBA 3W6NA 2R96A 5BW5A 2OR3A 3Q6NA 1UFOA 1KYQA 3PT9A 1CFZA 3HKCB 3OPYA 2IS2A 3GG2A 2DQZA 3EQ2A 4FOOA 1G6Q1 2AJTA 2ZRAA 1XG5A 2GXUA 2VJYA 2H8GA 3RIMA 4U2EA 3L1VA 4EMTA 3IQGX 2FRXA 1V35A 1TK2A 2W6CX 4FYIA 5JCJD 4HGRA 3PCTA 4DBZA 3TD9A 1T9BA 5J4HA 1LJ8A 2GXAA 2POQX 4IKEA 1IWPB 2AQ8A 4P33A 3SBEA 3LKVA 1Z36A 3DAGA 3CEAA 2GBCA 1LDEA 2HWKA 2X2PA 2XMRA 2IYFA 3DQPA 4GZ3A 4GZ8A 1VCIA 2BMDA 3DZFA 3SSNA 3RWMB 2IIVA 1PN3A 4JVOA 3KB6A 3REQA 2FZ5A 5HDQA 5G4LA 4H7DA 3ZZ0A 2Q2QA 2CMHA 3L84A 2VAPA 4TV8B 1QOZA 3CPSA 4CM1A 2PSJA 3FX2A 3PU6A 4QOIA 4H4DA 4EGCB 4ZFNA 5G02A 3VNRA 2J46A 3AI2A 1CNEA 1WCV1 2R9VA 4WA8A 2GKGA 1RP1A 5EKTA 2JVKA 4A08A 4Y7CA 4E11A 5JAIA 4B4KA 4JVLA 4B40A 1U5BB 3PQDA 3KSBC 4G81A 1GYQA 4TLDA 5JE8A 2XCTB 3D8NA 3RH0A 4QL1A 4R0MA 2X15A 2JCYA 2QVGA 1SCKA 3AYXB 4KWEA 4RD2A 3T41A 3MF4A 4B2LA 3W1VA 4AUMA 2FGJA 3N0TA 1JXMA 5IT9g 2DUUA 4MCAA 3B20A 5CAEB 5G0WA 1XTBA 2YJGA 4EFMA 4X90A 5KHOC 2BYTA 1NLYA 4XQ0A 4IS2A 3CZQA 4A0FA 2C2KA 4IZ6A 4DCOA 3KKOA 4ESEA 1ZAYA 1Y6FA 2ZBGA 1FLDA 5IFKA 2Q9AA 1N6RA 1A9SA 1GRQA 1WZIA 1ZVJA 4A2PA 2W6OA 1XK6A 1IY8A 5IJZA 4G5OA 5NULA 4EYQA 1KSJA 4IMIB 3SEFA 4J07A 1YTUA 2WUDA 2WQ7A 4LSZA 5EINA 2BDEA 3HMKA 3LGXA 2UYGA 3FUTA 4MQEA 5E6RB 1OY1A 4OKIA 1IN7A 4QGGA 3I37X 1QANA 3LC1O 3FYTA 2IY7A 2GLXA 4NHEA 5EJFA 1RRVA 3B6KA 4JK3A 2ACKA 2W2MA 3B3GA 4M0EA 4ZAFA 3V1LA 1Y5LA 3SBOA 1I4LD 2GX6A 3GIDA 1E2JA 3EQ7A 1W0JA 3PQ5A 3O74A 2CXSA 3BSSA 1HL7A 3MB5A 3E53A 3NBFA 4GHWA 4L76A 2NWQA 4M87A 1HOXA 3A9CA 4IHQA 1JDTA 5CVEA 1OIVA 3KR2A 4DUGD 1QPGA 3J81g 3FHLA 3UT5B 4B87A 3JD0A 1W93A 4EBBA 3QSGA 4EGJA 2K2WA 4ZI3A 5LD2B 4YV0A 3UJ6A 1YBFA 2IYXA 4U5QA 2XADA 3WK9A 4GICA 4TKLA 3RTDA 2J59A 1FMCA 1NBMD 4E5ZB 4BVLA 3OETA 2BBTA 1OILA 2DH5A 4KIJA 4AJKA 5JH7F 2ZYDA 3K9WA 2Q62A 3ONDA 5JALA 4EMBA 3SQNA 1J21A 1J9GA 3O2QB 3ZV5A 4F3YA 1WXXA 2QYSA 1SKMA 3UR4A 2CDCA 1UPXA 3CWCA 5AW3A 4BAGA 2AOTB 2WJAA 2E49A 4QC2A 2CXTA 2PCJA 3O4IA 3M6XA 3DM0A 5CW2A 1TO6A 1YVDA 4WOPA 3W6ZA 3EEIA 3KXPA 3CG4A 2ZB2A 3E9RA 4N6GA 2W4MA 4TTPA 1IM5A 3SQWA 1EX9A 1QR6A 3BK2A 5I8ZA 4CMJA 3T5AA 1SUCA 1NQXA 1T3GA 3QMVA 5KYYA 4X3EA 1D6SA 4LRTB 1BKDR 1PZFA 3K1YA 4I8DA 4LMAA 4UHKA 5L45A 3JQBC 1FE8A 3NLLA 3JCZA 3K31A 2Q3BA 5CLQA 5LQUA 2VHTA 4LAFA 4JIGA 2PM6B 3ER8A 3PR2B 3FTNA 4BNNA 4IZHA 5EEHA 5KHAA 2QK4A 4NCAA 4XYHA 2IX9A 2WUEA 3AJ9A 1GTJ1 3U13A 4I4NA 4QYSA 1P60A 3F74A 2ZDQA 5K0TA 3F90A 5ADVA 2FJUA 1C3EA 2I80A 4N6NA 2KW5A 3BWXA 2YHBA 2B20A 2VLIA 4JUCA 4MIOA 1JQJC 2XTAA 2MSCB 4JKIA 1E69A 2P9KC 1P5HA 2R8ZA 1HTTA 3F71A 3ZWQA 4AMBA 4B9AA 5C7IO 2IXTA 2R8YA 4ZHQF 1S8OA 5A0TA 3WK6A 1SHKA 1CPYA 2YMLA 1NE2A 4MUIA 4C6SA 4D98A 3SJLD 3KTFA 4GYKA 5CP8A 1N2ZA 3CRW1 3E18A 3IPXA 3DH0A 3SKVA 5K8CA 3GXBA 3QJ5A 1P19A 1F1BA 2C07A 3GLRA 3EGEA 3F2VA 4P53A 4U8HA 1OFTA 2I0FA 4JNCA 4GX0A 3T54A 1CQPA 3R40A 3ZI7A 3JZNA 4HDSB 1FUKA 3HWWA 4HRAA 4KAXA 1B41A 3A0FA 3JAMg 2BFBA 4CQMA 3I04A 2AW3A 2ZSBA 3C1AA 3EXG1 4XWKA 2G1AA 1BMFD 2F90A 2I1VB 5B58T 1R0ZA 1GNVA 2HQ1A 4DV4B 1NOIA 2RGUA 5IT4A 2REXB 1K75A 5CNKA 1E5XA 2WSIA 1VKHA 4IFIA 5AXDA 3WHIA 1PV4A 2ZJOA 2HWYA 3BYZA 3N75A 3B2NA 3UG7A 3LO8A 4L72A 4WZBE 1A5ZA 3LY7A 5TNXA 4LXYA 4Q9IA 2FCAA 3BHJA 3KPYA 1HDCA 3L4SO 4FZJA 4NH0A 4P4SB 4LYFA 3VOSA 5ITZA 5JZ9A 1FTGA 3A1CA 1C7JA 2NSHA 4E09A 2UAGA 2YBAA 3EZNA 2VK1A 4RHUA 5IDWA 4TXJA 3HBFA 1S2OA 1OAAA 1YIDA 2GZ3A 4BLUA 2DLCX 1YTLA 3HZRA 1UDWA 1FNBA 5AO9A 1E2DA 2HA6A 3V4SA 4DADA 1PR1A 2N47A 4JLPA 4PGGA 1G4AE 5DNYB 5TF0A 1RC0A 2Y68A 3KJNA 4BVBA 4E1VA 4EWRA 1VYTA 2ZIFA 3K0CC 4HPWA 2HI0A 3W2HA 2PT5A 1LQTA 1FNNA 2M32A 4XQ9A 4MPJA 1D1TA 5CA1B 1T9GR 3FCXA 1JWLA 1GP2A 1E1DA 4KUEA 3L4KA 1RLTA 2X8AA 4HDKB 4IVRA 4EG0A 4PAGA 4JJ4A 1I0LA 1E9VA 1GZ4A 2RI6A 3NPMA 1QTQA 2YNMD 3LWZA 4RQUA 4OHFA 1DAOA 4ZCSA 3JQQA 1P5RA 2Y05A 2IYEA 1O1YA 1VGRA 3C5WP 1KF0A 1NPTO 2P9BA 3DMFA 4P3PA 4MVJA 3RVMA 3DXMC 5IANA 3AO0B 5FUWA 4R8MA 1RDFA 3R7DA 1GPYA 4I50B 1IDN1 1YBVA 1Z73A 3DL7A 4P0PB 2ECOA 1EP9A 5JAOA 1A2QA 1WPQA 2OLKA 1YACA 1RYEA 2FEXA 3NGMA 3M6FA 4JLVA 4N5NA 5FL7A 3OW8A 2FR1A 5J3JA 1K97A 2H31A 1VHLA 4JYZA 3SWWA 2OCKA 4JT5C 2WMDA 4GKBA 1E8DA 1KEUA 4G8CA 4HXYA 1R00A 1JEYB 4H27A 1BQEA 3NBMA 5E2IA 2C4UA 1RKBA 2B4AA 1KPGA 1I2DA 2QTAA 2C0CA 1LZLA 2IFTA 3T34A 5K4GA 3FRXA 5AKJA 1ZIOA 1HMPA 2IPMA 2UVDA 1KBQA 5K0JA 2BBKH 1SUIA 1TYZA 1TZJA 3RV3A 1TCUA 3QHPA 4PC2A 4A6PA 2VF2A 5FYQA 3H8JA 3EPRA 1UPFA 1W96A 1TA0A 3RS9A 1Q1BA 4QJBA 4A0AB 1I13A 4X92A 4A16A 1TMYA 5HIJA 3IP6A 1X8JA 2M6SA 1MDAH 4BNWA 4MSUA 4KAJA 4HDAA 5ELXA 3OP1A 3SJBA 2V5UA 4WY5A 1FXUA 2RI0A 1IDOA 1R37A 3E15A 3E6AA 2D0OB 3OOHA 4ND1A 1OWPA 2OVQB 5AXBA 5K8IA 5J2TB 1ZLYA 4DMRA 4GMBA 3PDUA 5C4MA 1KPHA 1A7UA 1WBDA 5JJIA 5DYGA 1W30A 4FDLA 2PT6A 3QI7A 3IAEA 4GECA 9ATCA 4NBSA 1EM6A 2QX6A 4RK1A 2DTDA 1SQGA 2QJWA 2NO7A 1M1XA 1GQQA 2Y76A 3IUPA 3AI1A 1NIPA 3NHWA 2HYIC 3OQJA 1X8LA 4LRXA 1OF1A 5EI5A 1CQIA 3OKPA 3G0CA 1W4BA 4P38A 2PMCA 1RJ9B 5HUHA 3ONNA 4NR0A 5LJIA 4KXWA 3TG2A 2ZJBA 5DKFA 4YASA 1C9JA 1JWBB 2KQUA 1GA6A 1T2XA 5LC1A 2FPSA 3OP4A 5F7OA 5CPFA 4DMUB 4CMHA 3I7NA 5J1TB 4EUNA 3AVWA 4KR9A 1NMSA 2HSGA 3ENVA 3JQDA 3DUFA 2B61A 3OA0A 2ZWVA 4Q7EA 1AGXA 3C6QA 4GWKA 4TUYA 1EPUA 2DBVO 1XLVA 4LE2A 5FUMA 2HMSA 2O3RA 4OJQA 2EICA 3A9SA 4JZYA 4ZZ0A 1II0A 3DUWA 4S12A 4PICA 4XD2A 2VI5A 2HXCA 1BPOA 1JEDA 1EX6A 1WCWA 5JS7A 2APJA 3JWHA 3WL8A 4CUZA 2VDWA 4U7GA 4COOA 4Y67A 5BR7A 3E5MA 3SQLA 4MRMA 5JS8A 1RBZA 4YHHB 3RJZA 3BG5A 1KO8A 2AJCA 2JVJA 3DWEX 4QGHA 3HRIA 1H2FA 1F2VA 1ODLA 5A5VA 3WYGA 3MJDA 3AG6A 1K5PA 5J40A 5JBQA 1UK6A 1I4TD 1XO1A 1ZN2A 1X7XA 2ZI9A 2FWNA 2J5KA 3NP7A 4NVRA 2H2AA 3I23A 4G0XA 4QUJA 4EZEA 5E9AA 3L40A 3ODPA 4K9SA 3WDLA 3EIQA 3F8WA 2UUPA 3OT1B 1DJQA 1V8OA 3B53X 1LZKA 5CTJA 1EXDA 6GPBA 4QT4A 1F2DA 3WHLA 1V3UA 4AG3A 2BRUA 4G26A 3CPEA 1N2SA 1K8QA 4YP1A 4OLFA 3RIXA 5GV7A 5B7QA 1ZUNA 1Z0ZA 3E3AA 4XD7A 2X76A 2VXOA 3AXTA 3UCFA 1J2TA 5IAAA 4AOWA 2C82A 1WABA 4Y2TA 5C86A 3EGIA 2HDWA 2OWDA 4MPDA 4FR2A 1TYDE 5EGNA 4OQNA 3VR5D 4CIXA 3I12A 4BMZA 3KVNA 1MU0A 2WM2A 1Q6ZA 2O2HA 3LSTA 4OHKA 4ZV9A 4PLGA 2ZITA 3V4OA 1NWHA 3ZDFA 5GAJA 1G38A 2Y67A 3ORYA 1GGHA 1KSGA 1ISRA 2QUKA 4JITA 2H68A 3C7AA 2NZWA 4BLWA 4UTNA 1WTAA 2GF0A 5I5EA 2KS6A 221PA 5BQOA 3IQWA 2JNWA 5FA5B 3PTAA 3UENA 3CONA 3MJVA 4C4TA 1GFSA 1K7SN 3ZHSA 1YBHA 5DE3A 1O3YA 4CY2A 1MZVA 2ZETA 3TZKA 3T95A 1XOIA 2CVFA 1Z3IX 3T5BA 4J3NA 1HYGA 1Q21A 3PVUB 2DLNA 1B6SA 3U7QB 3ZBQA 4DREA 4EAQA 3WLIA 4EQ6B 4Q48A 2P7HA 4XYLA 3PC7A 1GARA 2L19A 4F2WA 1LPOA 1QORA 4S1TA 4P34A 1O95A 3TZEA 5AHRA 3NYIA 4E3WA 4EO7A 1BD4A 5B36A 3RFCA 3GAZA 4KI0A 4L5IA 1V1JA 1M0TA 1AXRA 2IEDA 2C61A 2YRFA 4JGIA 4ALKA 4FMCB 3DF7A 1ZH8A 4TLCA 4YGYA 3U7IA 5L51A 1UQTA 2H5IA 3FD8A 1ZI8A 4Z6KA 1COWD 5JBNA 2W6PA 3DMTC 3MXTA 4JJEA 3O8RA 1SXQA 2VJKA 3FCSA 4D9IA 3IAXA 4XVHA 2OCLA 4PEVA 4QYMA 5D3MA 3ZDDA 2OQIA 3I52A 4UVIA 1JHYA 3DV9A 4F60A 1KH3A 4Q1DA 4HSGA 5LIPA 4UDXX 2FZLA 3QV2A 3O9ZA 1CJBA 4JB3A 4HH4A 4JQOA 2PKCA 3MUFA 3I9OA 3FWKA 2EX4A 3VI4A 1ZIYA 4I1SA 2V7BA 2OQRA 3AUXA 3CO0S 2V45A 3CN9A 4MNTA 2A4KA 3G59A 2VATA 4IO0A 5ITVA 2CHQA 4GWLA 4IQGA 3DTYA 3IPCA 3LCVB 2EW2A 2WF8A 3SC3A 4QQ8A 2I6SA 5DSTA 5EKUA 1CFJA 4WNAB 4CTNA 3WNBA 1E92A 1ZD1A 2O8DB 1DJPA 3R3JA 2ZYIA 4BNUA 2OJYA 1YOBA 5FJIA 4H0CA 2AJDA 3A04A 3QKSB 5BN4B 2A58A 3GF4A 4IDCA 2VQEB 3M9XA 4V3BA 3PJRA 2GCOB 4KSYA 4NFYA 1NXVA 2X4LA 3JZDA 5CCEA 3F4BA 4J1NA 3MJSA 4BJHB 3EY4A 3D9QX 2IGTA 5TRTA 3L01A 1AXEA 3YASA 3WK4A 3B9RA 4EPYA 3V7FA 3THYA 3K5WA 2PUVA 4BE9A 5JLJA 3PJGA 5D86A 1LQUA 1XKXA 3VYTB 2IW3A 2PGNA 4OKNA 4CMIA 1MB0A 2GC7A 1E4YA 2HOQA 1YA8A 4DCGA 3AF1A 3F67A 4FN5A 3RS5A 1X94A 3QX8A 4QREA 4Z51A 1MNAA 1M2FA 3JPXA 1VOTA 2P2NA 3A8TA 5F7JA 4YUAA 5AVXA 2XGGA 3PYLA 3MWLA 1GQFA 1PK9A 4Q4DA 3UJHA 1ZWLA 3G88A 3LBFA 4UTXA 3ORHA 2MSWA 4A8TA 3IQXA 3UHOA 3T94A 1GKIA 1F3LA 3ZE9A 2WTUA 3VTKA 1RBQA 5ICGA 2UXCB 3GAFA 2VTKA 2QX8A 4EKIA 2WA1A 3RD5A 2P6OA 1L6IA 2O7QA 3LW7A 1G20B 5LP1A 3VSCA 4CLXA 2I1WA 1Q1NA 4TKZA 4MI3A 1BU8A 5DB4A 4TTTS 2DUWA 1WBBA 1P0MA 3E7FA 3QITA 4UXHA 1E1LA 2HF2A 1RKXA 4RQBA 2SCUB 5A62A 4KE8A 4LOHA 4GG1A 3GARA 4D3XA 9LDBA 5JTTA 3JPWA 4Y7DA 2QPOA 1Q1EA 3CUYA 4BBJA 5BSEA 1A4UA 2ZJYA 3A26A 5CD1A 5CFRA 2G09A 1LPBB 2B9VA 4QTTB 2R79A 1H2ZA 1N7JA 3IQZA 3L0YA 4BQQA 4C22A 1GGFA 4CKWB 2GZHA 4TMFA 3PQCA 3BXGA 2SKCA 1G20E 1HDXA 2XDWA 1Y42X 3RUCA 3BGIA 5E7JA 1FEZA 2PKQP 3NQ41 4EA8A 4QJ3A 3VMFA 1ISFA 1ZHFA 2JKVA 4K9RA 2Q07A 3AFGA 1BS1A 1KP9A 1IOZA 1OQAA 2PEYA 1YUMA 4UXJA 2JLUA 1ZCJA 3FBWA 4WY2A 5JAHA 4MW5A 4ITVA 3ZS9A 1PU2A 3F8SA 3O0DA 2KWIA 4Y6RA 1C4WA 1VFNA 2HDHA 3DBVO 5B5SA 3ONFA 2CDRA 4PX5A 4EITA 1TLFA 2QZZA 2JGDB 4PPQA 2CO0C 4I19A 5DW0A 3OD5A 5LDGA 3N6RA 3HDVA 4RM2A 3V8EA 5CFQA 1G21E 3TI7A 3IEXA 2MYNA 4EQZA 1DWUA 3AF4A 3L9XA 4F1JA 4E54B 3UGQA 2ZJAA 3ICVA 5BQFA 1G3IA 3V9AA 3EWAA 1LCIA 1NL3A 3CF4A 5GP1A 3CMMA 2JC3A 4L4YA 4RTPA 3TGWA 1CD5A 1YZKA 3G5TA 3KKKA 3HWX1 3ROTA 1QP0A 3DR3A 3PEYA 4XARA 1C0KA 4QDXA 2OP1A 4QUHA 4EMSA 4J4TA 1XAHA 3H9CA 2FPPB 3CVWA 2QM8A 1WETA 4O2AB 1QRAA 3GREA 3GFVA 4ZQHA 4B4WA 4BX0A 1YI8A 4WVLA 1Y3BE 3AHGA 3DF9A 2YN0A 2YUTA 3H1GA 2OXFA 3TTSA 3KYDB 4AC9A 3I7LA 4BNIA 5F3DA 2ZRFA 4S1WA 4Z0PA 3T61A 1RYMA 4NQZA 4AZSA 1YZLA 5ILGA 2HADA 4QYTA 1HZZC 1MC4A 2HQOA 3QVOA 4IRUB 3GLSA 1KVRA 5AUQA 3UXYA 3UOGA 4BIMA 1NBAA 1LRKA 2AS0A 4P58A 3H9BA 3ZUPA 1PAUA 5TGTA 3O47A 2I22A 4K6KA 3MOIA 2R6DA 4UULA 4IFBA 3EVCA 1IJEA 1ZH2A 1QS0B 2WT9A 3PQ4A 3VX3A 1PT5A 1MG3A 4Z4GA 5F9MA 2G99A 4WOBA 2IIBA 3HWRA 3VU9B 1TK9A 1Z4PX 1JEOA 1HDIA 4RF2A 4TTVA 3HSYA 4IIEA 4TZ0A 2AG6A 5IJ9B 2V7WA 3HKBA 4NYIR 1VE3A 2Z4TA 4J1TC 1G4UR 2ZOSA 4HDRB 4RADA 4PG8A 3I73A 5KSYA 5EAMA 4M83A 3M4ZA 4KL8S 2OMKA 1HDRA 4F8JA 4O0LA 3RSLA 5AW2A 3HMQA 4AUKA 3VMMA 4I7EA 1ZJ5A 2PG3A 4N7JA 4F91B 3NBQA 4RNCA 3FYSA 3TW8A 3WSTA 2WLTA 4V0RA 3NANA 5TEVA 4RDIA 4QOHA 1WY7A 1CW2B 4M9QA 1DAEA 4IOKA 4WV3A 5HZKA 4B17A 2WMOB 3Q6IA 3ZV6A 2AGYA 2FP4B 3DE2X 3I83A 3L7CA 2JFHA 3WGHA 2CMKA 4HTFB 3VR0A 2Q6IA 4F56A 3OCXA 3O9MA 3HO6A 1KU6A 3A10A 3D6JA 2A33A 2E3JA 3R9XA 2VSYA 1CJKC 4L3WA 4OJKA 4AECA 3GNQA 2X0FA 5AP9A 2O0JA 4ARZA 1KDOA 5LVAA 1B76A 1DKRA 1J8DA 1X2BA 3DPSA 4J91A 3Q98A 1HLGA 2A5GA 3CU5A 3GDHA 3IC5A 3QFCA 3V48A 2O9KA 1ZL2A 2PGLA 3HYCA 5FADA 3LCUA 1TZKA 5FWXB 1XN4A 1JFRA 3B8HA 4NENB 2BI4A 2DTEA 2BBOA 5IRCD 1Y1SA 3WMRA 7MHTA 1L1QA 1M6NA 2NZVG 1QWSA 2ZJ7A 1TUIA 5E4FA 2GD1O 5KC8A 4QECA 1FFWA 3DD1A 5DGCA 4ARAA 4G2TA 1GIAA 3AR9A 3LY8A 4R2IA 2VHCA 3L8ZA 3NALA 1BAPA 4YRRA 2GSDA 3KUUA 3E22B 3OIUA 2WKWA 1NJ1A 4ZODA 5KNCA 1J07A 3GLIA 1JA1A 2BH9A 4CN9A 4E03A 3ZGYA 2BE9A 1NG1A 2ASVA 5BRNA 2DFNA 2XE4A 3MCVA 1KY2A 2FG5A 1T2EA 1LK7A 1O57A 1B00A 2MDTA 3QSYA 2GEKA 4ZTUB 3VNUA 2QLLA 3EA5A 4QOEA 2H5LA 1JSRA 5JWOA 1WTCA 1H0HA 4B75A 1JNXX 2C2MA 3PGMA 2B5NA 2IZ6A 3OO0A 3LFHA 4OL0A 4R6WA 5COBA 5HXAA 5ALUA 1M0SA 2XRFA 1YR2A 4HT3B 1SRQA 1OE0A 5CXBA 4WBNA 1GPWB 5ICCA 5ECWA 4D6XA 3SX4A 4MDHA 5HMMA 1ZBDA 1QSGA 2VJNA 2Y9PB 5DMXA 4DSNA 4EJFA 1ESMA 4BLQA 1LX7A 2R7LA 4UFOA 2XDYA 4FFLA 1IBLB 3SS8A 1GGJA 2EJBA 5FV7A 4C87A 4RK6A 1WHSB 3MGAA 2RAPA 3O1HB 1PSZA 3A11A 3R9WA 3AFHA 1CUFA 5G4KA 3GJ3A 2QN3A 2ZI7A 4B84A 1TMOA 5HQTA 1JJAA 1LY1A 4OB6A 5HQ3B 4F3TA 2EBUA 3FH0A 1KQNA 1GWNA 3W7VA 3WP1B 4BUCA 2ZI4A 4YRNA 5LUAA 1L5YA 1KDYA 5DHFA 5E3IA 3U5TA 1GAJA 1QDUA 3LKDA 4RVOA 4CRWB 5C2WB 4BGVA 4UAUA 1SBNE 4M88A 1ZESA 4BO9A 5FQOA 1L8LA 2WE7A 5C9ZB 5I4CA 1OFUA 1AMUA 5T8KC 3WWPA 2C5FA 1WSWA 1T8UA 1V7QA 1XZFA 3AUAA 3A4MA 4H31A 4YIKA 3RKSA 2PMKA 5KNDA 2JLXA 4GL4A 2H7YA 1EYZA 4R7TA 4NNOA 3K2BA 3NFYA 5H70A 4QTXA 3CNNA 3WB9A 2IU4A 2P78A 2QS9A 5ETJA 3PE6A 1M5TA 4AKSA 4DLLA 3IE2A 1QLJA 4FILA 3I89A 2C31A 4WHMA 5CTAA 4XIFA 2FETA 1JFFA 3JXEA 1QJ4A 3S1LA 2C7VA 1T2FA 4V1CB 1XQWA 3GLHB 3NTUA 1SGWA 2O0KA 2PKRA 4KIGA 4M1OA 1XMIA 3NKLA 3FMOB 4ZT5A 4D74A 4DIEA 4X0EA 5D1NA 2Y6UA 4RKQA 3UMCA 5B4TA 2ZRLA 4X9XA 1A69A 1RRCA 2NU8A 5FULA 5TY0A 2J4FA 3TW0A 1R9NA 5JAPA 2I0TA 2VJOA 1MD9A 3CJTA 3NR2A 2OVRB 2RARA 3GEGA 4OOEA 2B6HA 3HVJA 3SP1A 1U94A 3ADPA 4RJ2A 5AW4A 3DW3X 2CXQA 4R4JA 2DFDA 3J80g 5J9FA 3FCUA 3FUVA 3D6AA 1RR6A 3QUBA 4Q3BA 1AHPA 1C1XB 2J3DA 1ZUWA 3CM0A 3VGPA 1Z5VA 2G88A 3W9UA 2NOAA 3GA0A 4GIBA 3RIHA 4F6LA 2BW0A 4C07A 4WK2A 4PC1A 4A3SA 1TJYA 3DV2A 1NDQA 2G0NA 4YMIA 4MH0R 4QPJC 1ZX1A 5AH0A 1YGYA 4IV0A 2H52A 4OHZA 4ZAWA 3SFZA 4GMXA 3KSAC 4YJ3F 4ZVLA 1RACA 1C0EA 2WI8A 5IM5A 5ENVA 3ZE6A 4ZYTA 3VDNB 1RM3A 3H86A 5J58A 1Q0TA 4XFKA 2J3LA 2OHVA 2ZRKA 2J9FA 3B52X 3AH8B 4Q66C 3UCEA 3NC1C