3IUNA

Appep_d622n opened state
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
682
structure length
672
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETNPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 207
structure length 672
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iunA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iunA01
3T4UA 1QIIA 4JEIA 4KJXA 4L9AA 2I3DA 2DHDA 5ALIA 4F60A 1VE6A 1CUIA 2PM8A 1F0NA 2VT6A 2WJ6A 1CQZA 4QDUA 2XE4A 1EX9A 5AK5A 2OCKA 4RE5A 2VJDA 3G0DA 5FUMA 4J0GA 5ALVA 2XI4A 4B82A 4BCCA 2H7XA 4HZGA 2XT0A 4G8DA 1UOOA 1K4YA 2Q0XA 3V9AA 1MAAA 1OXMA 2UZ0A 2O2HA 4J3JA 4WY8A 1ODSA 5ISMA 3E0XA 3W2TA 4K6KA 4K5QA 3VISA 1QIDA 3O9MA 3RARA 3G9UA 4C4ZA 3V1LA 1BCSA 2VT7A 1YAHA 3NUZA 3QITA 1LBTA 2XLCA 1E8DA 4PF1A 3I1IA 1XZLA 2ZSIA 3BIWA 1XRPA 3AFIA 3G02A 3O0DA 3IIIA 1GZ7A 1XRLA 3PUHA 4BZZA 4JNCA 3R3XA 1LPMA 1YR2A 4DMFA 3DYIA 4U2GA 1W52X 1U2EA 3FSGA 4N5HX 1QIJA 2GYUA 4B85A 2HA2A 3I2KA 5FPPA 4B9EA 2WIJA 1XQXA 4E15A 1ODTC 3F9CA 3K6KA 5IVIA 1EDBA 4C4XA 4FBLA 5AKJA 1XRQA 2ORYA 1LPOA 3V1KA 3G9ZA 1YB6A 3PICA 5DWDA 4CFSA 1JKMA 1CEXA 1VA5A 3FNBA 5EHZA 4OCZA 4FDMA 3D7RA 1R9NA 3QPAA 1A88A 3DJYA 4JH0A 1SC9A 4AN0A 3FSGD 4CG3A 3HRHA 1U8EA 5J3JA 4XWGA 3F67A 4QA9A 2DHCA 4GW3A 1ORWA 4Y2SA 2C7BA 1N8SA 3KWJA 1XZCA 3S8YA 3KD2A 3H2JA 3GFFA 1FFCA 4W63A 2PUHA 5AI8A 3WL6A 3H04A 4ROTA 4EUSA 2XQKA 1SOMA 3L1IA 1EA5A 4O08A 2VAVA 1AMNA 3QZUA 4P08A 1X70A 2WG2A 4WFJA 5AK3A 2PPLA 4BTVA 4H18A 1TCAA 5CH5A 4BBZA 3DQZA 3HI4A 1HDEA 1CUEA 1DQZA 1XFDA 4DLNA 2QJWA 4CCYB 1H2XA 4EY8A 1DT5A 1ACJA 1QTIA 4P93A 4X92A 3TGLA 4BAZA 3QBJA 5I7UA 2PSFA 5AOBA 1CR6A 5JZBA 3OTQA 4BVLA 4AO8A 2WIKA 1XZBA 1EINA 3KWFA 1A8SA 5T4FA 5AKEA 2JBWA 1QO7A 3W06A 3BWXA 1LPBB 2AJCA 2C58A 4AO7A 2HFJA 5FV4A 4G4IA 3MVEA 4G9GA 2PL5A 5ALHA 4IO0A 3IURA 1XLWA 1QIKA 2HU7A 5DYWA 1A7UA 2XUPA 2WU4A 3DCNA 5ESRA 2VA9A 1CUZA 5HFAA 5T4BA 3JW8A 1MU0A 3OURA 5ALRA 5LZ4A 1YS2X 1YASA 2D5LA 4QLOA 3QYJA 3IUQA 3WK9A 2WUGA 4Y2JA 2HRRA 4FFWA 4L3WA 1QO9A 3E3AA 3W04A 3HACA 4BCDA 1G4HA 1E8NA 1O6GA 1ETHA 3ESAA 1VLQA 4UFOA 3OM8A 5DYTA 4WY5A 4QZVA 2W6CX 1DX6A 3ZPXA 5ALDA 2VQ6A 1XLUA 3DYVA 4C89A 3EQ9A 3FCXA 4ZWNA 4LYDA 4QDOA 2VSQA 4H7DA 4AXBA 3PF8A 2Y6VA 3DL7A 2BFNA 4RGYA 5AKIA 1AGYA 3WL7A 3AIMA 2ZJ7A 5ALSA 1JMYA 5E4TA 1TCBA 2BUAA 2G5PA 4K2AA 3VVMA 3VVLA 4QWMA 4UHDA 4D9JA 2EEPA 4UHHA 5DLPA 2XLBA 5EGNA 1XZGA 1H2WA 2WUDA 3WLAA 1JJBA 5HCUA 2FUKA 1YA4A 2AJBA 2Z3WA 4G5XA 2OCLA 3ZLTA 4P9NA 5K3AA 1CLEA 2WIDA 1C7IA 4J7AA 1ZJ4A 5JATA 4OB8A 3AZPA 4AB1A 4BP8A 2ROQA 5JD5A 2K2QB 2AJDA 1JT2A 4MXDA 3WA7A 4GEGA 1MAHA 3DKRA 4AQDA 2B61A 1MT3A 2O7RA 2XMQA 4OB6A 4N8DA 2OAGA 4AMZA 3S2ZA 5JAPA 1UOQA 2QTBA 3CCBA 4LHEA 2DR0A 1ZD4A 3AUKA 2GBFA 5AO9A 4G4GA 4JYPA 1CQWA 5FP0A 3G8YA 1TIBA 3IDAA 2J4FA 4X6XA 2ZYIA 5KBYA 5AM1A 1IUNA 4JUIA 1XROA 4YK7A 2C4HA 1QIMA 3I2GA 5LZ2A 5AM5A 2WKWA 1TQHA 2RHTA 5A62A 4FLFA 4I19A 4UFNA 1X2BA 1H2YA 4CIBA 1TKRA 3FYTA 4XIIA 3ZV7A 3V1MA 2XMCA 3C6BA 1DU4A 3N2ZB 3I2JA 1GPNA 1LNSA 4FMPA 1FFDA 5AM2A 2X76A 1ISPA 1TK3A 4OU4A 1THGA 2B20A 1ZI6A 5ALPA 5CT9A 3C6XA 3Q8WA 2QS9A 2XQGA 1WCYA 5HF5A 3BF8A 2WTMA 5JAUA 1K5PA 4FOLA 2WIGA 3H2KA 5CT8A 5ALXA 3I2HA 1WM1A 3IUNA 4LXIA 5JZ9A 5CH8A 4C88A 3R40A 1A8UA 4F5ZA 5AOCA 3UUFA 2NW6A 3BJRA 3WK5A 1NU6A 1XQVA 3ZLVA 5CT5A 5A7FA 1MPXA 3WZMA 4YASA 2WFLA 3ED1A 4Y2UA 4UBJA 3R3YA 5D3ZA 1VXRA 2Z3ZA 3ESDA 5AM4A 4KEAA 5C81A 4X93A 1EB8A 3FOBA 4EA6A 5HF8A 4DMHA 3WWCA 4BC0A 1R9MA 1EDEA 1WHSA 1MNAA 3WKDA 1IZ8A 1EK2A 4OSEA 1K63A 1DWOA 3JYHA 2HA5A 2VEOA 1SCIA 5FXMA 4H0CA 1BN7A 1QJ4A 2I3ZA 2RI6A 1AC5A 1H22A 1CFJA 5LLSA 4BTLA 3AJAA 1AQLA 4XJVA 1E3QA 1R88A 1AX9A 5BWCA 3C6YA 5ALOA 3DKKA 6YASA 2J4CA 3H0CA 4DIUA 3K9BA 4MYSA 2ZJFA 1CUSA 5F4ZA 2XMZA 5JAOA 5CURA 1UT6A 1UK7A 5CXUA 1Q84A 1VXOA 2BUBA 4KRYA 2Y1KA 2DQZA 5YASA 3FLEA 3V48A 4BZWA 2QMQA 1XKLA 2WHQA 4X90A 4UUQA 1A8QA 3H19A 3STWA 4P92A 3DD5A 3ANSA 3B3QA 3TJMA 3WZLA 4PSUA 1YAJA 3TRDA 4QDZA 2XMSA 1XRNA 3C70A 2XMDA 1WOMA 3RM3A 4W1SA 1FFBA 3UUEA 5KWJA 1GQRA 1BROA 1TCCA 2J3QA 5D7BA 1W4LA 5DNVA 1QTRA 4A16A 3D4LA 3FVRA 3FAKA 4ZV7A 3D0KA 5LZ9A 1MNQA 5D3KA 1XLVA 4ZREA 4FKBA 2DFPA 1MN6A 4U2FA 1EHYA 1XZFA 3BIXA 3CN9A 4TGLA 3ESCA 1U4NA 3OC0A 3IB3A 4MJ3A 5C8ZA 2IX9A 2OLEA 2V98A 4HRXA 3WJ1A 1G66A 2PBLA 2C5FA 2G63A 1DWPA 4DSAA 2JGFA 3IBTA 2ZJ6A 2AXEA 5K3EA 4MEBA 2W22A 2ZYRA 4M0MA 4C87A 5A2GA 1PJAA 2OGZA 1VZ2A 3A2LA 2HU8A 3NOXA 2QXTA 1DX4A 5AIAA 5CTAA 5DNWA 1H2ZA 1JU4A 2OCIA 3STUA 2QJRA 2V96A 1LBSA 2DSNA 1GT6A 2G5TA 4EY6A 3N0TA 3WWEA 5AJHA 1AUOA 3VJLA 4B0PA 4K6GA 1N1MA 2CKMA 4Y2VA 4I3FA 3SC2A 4IQ4A 4H7IA 3PE6A 4ZXFA 4PO3X 1W75A 1IVYA 1WB4A 4FLEA 1CUHA 3U0VA 4CIAA 3BDIA 2ZVDA 1J06A 5E4YA 2V97A 4GECA 1Q0ZA 1UK8A 2DHEA 4M0EA 3AIOA 3EQ7A 3HABA 4NZZA 4QE3A 1ZJ5A 5ALFA 3WKCA 5FPQA 5C8VA 5A7GA 4Q82A 1DT3A 5EHQA 3EF3A 2PX6A 3LP5A 5AK4A 3ZWQA 2WG0A 1PFQA 1CUDA 5CT4A 1U65A 5IH7A 1XQYA 1UOPA 1UFOA 2XMGA 1UK6A 4X95A 2R8BA 3WKBA 4KRXA 4DM7A 5T4EA 2WM2A 5A6VA 2H7CA 4Q3LA 2H7YA 1F0PA 3IULA 5EHXA 1LGYA 3F8SA 5DYYA 1QIEA 1CUAA 3FWHA 5ALJA 1VKHA 5HFNA 2LIPA 1JU3A 1ZD5A 2GBCA 2Z8XA 3A6ZA 5AP9A 4UBOA 3GROA 5H3HA 5K3DA 2WILA 2RGUA 4PV7A 3SWWA 3VJMA 4UFPA 4NVRA 4BVKA 1IUOA 1R3DA 2BJHA 4LKOA 3UMJA 4GXNA 1GKLA 3KSRA 4Y9SA 3U1TA 5ALYA 1HQDA 2J3DA 3RK4A 4BDSA 5AHXA 2YASA 3GELA 3E1GA 1F6WA 2WHRA 1XZAA 1HL7A 1FFEA 2RHWA 3KXPA 2FJ0A 3A70A 4X91A 1S8OA 1M33A 4FHZA 2XUHA 4RPCA 1QIFA 1ZIYA 2BKLA 4HAIA 4KR0A 1ACLA 4OYLA 2WHPA 1L7AA 1XZJA 1DQYA 1E66A 4B80A 4GLBA 1XZKA 3BJMA 2Y6UA 1UXOA 3WQHA 4BCBA 5JAHA 5AKYA 5HKAA 2CMFA 2PVSA 4F0JA 2XMBA 5ALUA 3QH4A 3H18A 1ZI9A 4H7HA 2BAGA 2Y2VA 4EY7A 3VXKA 2HADA 1CUBA 1CUGA 4G1FA 2ZYSA 1XZIA 2ACKA 1QFSA 1EVQA 1XRRA 3ZLUA 3FYUB 4KE7A 3D3NA 2GBGA 2XMRA 1IMJA 2WFZA 4OPMA 3A2NA 1CUXA 5FLKA 1OCEA 3FCYA 3F98A 3STVA 4Y2XA 2X8BA 1XZMA 2XUKA 4G4JA 2C0PA 1LPSA 1R50A 2Z5GA 3C8HA 1P0MA 2Y2UA 4MWSA 2P8SA 2IITA 3NWOA 3R3WA 3LCRA 2OPHA 3QMMA 4ZRDA 4H7FA 4X85A 4PSCA 4H7KA 4K6HA 1IUPA 2QOEA 3G0CA 3ESBA 4DYHA 1B41A 4DNOA 4B7ZA 4XVCA 2G4LA 1T4MA 3WKEA 5CW2A 1Q0RA 2XUDA 4FBMA 3GA7A 2PSDA 4Y2RA 2H9YA 4EY4A 1E5TA 2WLSA 1BN6A 3D2AA 4N8SA 2I03A 1O6FA 3G9XA 3I6YA 1DTEA 4QLAA 3H2IA 2XUOA 5KREA 3D59A 1CRLA 1EB9A 3D5EA 1NX9A 3G0BA 5EIEA 4Q3OA 2R11A 2E3JA 4X97A 5AI6A 4DNPA 3WI7A 1DINA 3AINA 3WK7A 3WYNA 4AX4A 4BYMA 3Q0TA 2WFLB 4BRZA 2XQIA 1EH5A 5AOAA 3AIKA 3DOHA 5JD6A 1N5MA 4L0CA 4CI9A 3H1BA 1KEZA 1JFRA 2O2IA 4U2CA 4W1QA 3P2MA 4F21A 3O4HA 1UKAA 3C87A 4BE9A 2HA7A 4HXFB 1MJ5A 3EQ8A 1CPYA 3BL8A 4EZIA 4DTCA 1HPLA 1MX5A 1IZ7A 5DTJA 1EI9A 2HM7A 4OUKX 4AZ0A 5LZ5A 2QM0A 2XQJA 3ICWA 3KOOA 5E4JA 1CIJA 5SYNA 4BC1A 5AIBA 5ALLA 2YYSA 1MO2A 4ETWA 2WJ4A 2CUTA 3E4DA 3H2GA 1C7JA 4J0CA 3MUOA 1HBJA 1MTZA 4OYYA 1X2EA 4DMCA 5ALWA 1BCRA 3IUJA 1L7RA 2OGSA 4X00A 2XB6A 4DNQA 7YASA 4J0JA 4Q1VA 3NGMA 3WL5A 2VATA 4E14A 1THTA 2WJ3A 1LPAB 1XKTA 4YX9A 2ACEA 4UBKA 4Y2QA 4J03A 4X94A 3CCCA 3HEAA 2XQFA 2JGIA 3FLBA 2CJPA 4LXHA 5A71A 4N5IX 4HS9A 1USWA 1MX1A 5JYCA 2HL6A 5CXXA 4U2EA 2QZPA 1LLFA 4U2DA 4X6UA 2AJ8A 5AKXA 3GUUA 1QFMA 4J0DA 2OG1A 2JEYA 5DTIA 1TAHA 3G0IA 4XX1A 1RWQA 3HSSA 5FOQA 1DWQA 5LP1A 3C5WP 4GDMA 5CH3A 4BP9A 5ALKA 3LS2A 1RYYA 5AKGA 2OCGA 2BGNA 2RIPA 5IKXA 4KAFA 2QT9A 2QVBA 3D2BA 3DS8A 4TVKA 1NU8A 3M81A 5LKRA 1F8UA 3W05A 3JWEA 4GI1A 2ZSHA 2QUBA 5EIHA 4ITVA 4KACA 3KDAA 5LIPA 1UKCA 5CRIA 1VA4A 2JGLA 4UHCA 3QPDA 4S0XA 3IUMA 3LIIA 3WK8A 4HXEB 3MUNA 4C6HA 4FWBA 3QMVA 4CCWA 2GYWA 1I6WA 3FLAA 3AZQA 2EDCA 4IH4A 4HXGA 2HHAA 2BCEA 1K6EA 5AM3A 3ILSA 5AI9A 4UPDA 4BDTA 4U2BA 1C4XA 4GBGA 2PKYX 1KU6A 1SCKA 5HF6A 2VJCA 4Q05A 5DNUA 5FKJA 3I28A 4QWWA 4WDQA 1VE7A 3PFCA 4V2IA 2JGJA 5AH0A 1QIGA 3ZI7A 2CBGA 1TRHA 3WIBA 5C8XA 1CUYA 2GBIA 2XUFA 4KAJA 3WYDA 1GGVA 1R4ZA 4HTAA 2WUFA 2PUJA 3O4JA 1Q83A 2CZQA 2HIHA 4HRYA 2PSEA 5ALTA 2YXPX 4B9AA 3YASA 3FYUC 4LXGA 2OQIA 4X3CA 1GXSA 1BE0A 4KAAA 3RLIA 4BATA 3PFBA 5HQ3A 4M0FA 5JIBA 4I4CA 5SYMA 3RKSA 3WWPA 1P0IA 3CXUA 3DNMA 1XQWA 3R41A 5I9IA 5K3FA 5DJ5A 2EDAA 5EFZA 3IVMA 1P0PA 5HF9A 3HXKA 1CUFA 1WPRA 3M83A 1UKBA 3R0VA 2ZYHA 2XUQA 1G42A 4J0IA 3W9BA 4EB0A 4N8EA 1P0QA 4EY5A 1GQSA 4UHFA 2C5GA 2QXUA 5AI0A 2GYVA 1BEZA 1FFAA 4TPKA 5IVHA 1RP1A 1SCQA 3QVMA 1QONA 5CBKA 3AILA 1HKHA 4OU5A 4X7BA 2IIVA 1MX9A 3WKAA 5HKBA 1GKKA 2D0DA 2ES4A 1EDDA 1W76A 2WFMA 5BV7A 3I2IA 3H17A 3R3VA 3O95A 2GZSA 1H23A 3VDXA 5ALGA 4Z49A 1JJIA 1FJ2A 5JARA 3VKFA 5HK9A 1J2EA 4J0HA 4PQEA 4QNNA 3L1JA 1BU8A 1XZEA 5EIAA 3H2HA 3OG9A 3SK0A 1VOTA 1JMKC 3WWDA 3GBSA 2WHPB 2PSHA 3BF7A 3G7NA 5ALQA 1T2NA 1WHTA 2C0QA 1Y7IA 5HZGA 1AZWA 2JEZA 4LYEA 4MWTA 1W6RA 4FTWA 5KWIA 5JASA 2WQZA 1UK9A 3WL8A 5C7YA 4Q34A 1ZIXA 2WSLA 3WK4A 5FDFA 2B4KA 3WA6A 1N5RA 5JD4A 2O7VA 4FNGA 4E46A 4WCVA 3B12A 4JYMA 5AI5A 2OAEA 4G9EA 4H77A 4GHWA 1K8QA 3C6ZA 3WMRA 1J1IA 4RNCA 4BAUA 3PF9A 4ARBA 2B9VA 2HA6A 1YS1X 1CUJA 5IVDA 4DMKA 4A5SA 1ZGCA 2ECFA 1W1IA 3VJKA 1ZGBA 3O4GA 1PV1A 5JANA 3I1YA 5AKHA 5I8PA 3BXPA 2HDWA 3HZOA 5ALEA 1FSSA 2YH2A 3C45A 5T4HA 4PNZA 4UBIA 4LIPD 2BGRA 2I78A 2VAXA 5BOVA 3DLTA 2VF2A 4FLMA 4UHBA 3W9UA 2VJBA 4H35A 1EK1A 3QM1A 4W9RA 1ZD2P 1LPPA 5ALMA 4NS4A 2WUEA 1AURA 2ONCA 1CUWA 4H7EA 3H1AA 2O2GA 4IHAA 4EHBA 2OXEA 4ZI5A 3D2CA 2H1IA 2WTNA 2HA4A 3L1HA 4DNFA 4L72A 4C01A 3DL4A 3F97A 4B81A 3QPCA 4PW0A 4RE6A 4G8BA 3WWOA 1ORVA 4KYVA 1VJ5A 2VTVA 4MQMA 2PSJA 3FBWA 4ZV9A 4CCYA 2X5XA 4WJLA 4NMWA 1KU0A 3C5VA 3X3HA 4AO6A 3EBLA 3DDUA 4W1RA 4KE8A 1YCDA 2OQVA 1ZOIA 1D07A 5A7HA 4G8CA 3OPMA 1G5FA 3I6MA 3I2FA 4BRSA 2WIFA 1CV2A 4Y7DA 3WJ2A 5LKAA 1XZHA 2JGKA 4KE6A 3QMWA 3IA2A 3HJUA 1BRTA 3STXA 1L7QA 4BE4A 4CG1A 1BEEA 1XZDA 3STYA 1UWCA 1E8MA 1XRMA 5JADA 1CUCA 2PU5A 3I6ZA 1Z68A 5LZ7A 3STTA 3BDVA 3LIPA 1LZKA 4BAGA 4B83A 2QR5A 4UBLA 4INZA 1WB5A 4B6GA 4B84A 5IVKA 4DGQA 3C8DA 5LZ8A 3C43A 4UBMA 1YB7A 4ZGBA 3O4IA 4WDRA 4IH1A 4DSZA 5EI5A 1QE3A 5FRDA 1AKNA 3R3ZA 2JF0A 1ZICA 5K3BA 4UHEA 2XUJA 3B5EA 4X71A 1ZD3A 5LYYA 4CG2A 2RONA 4AZ3A 5AM0A 4WFKA 3ANTA 4YPVA 2OGTA 1BS9A 1WB6A 1EXWA 4A23A 4Y2PA 3M82A 4ARAA 4J0KA 3FYUA 4C4YA 4MEAA 4AN1A 3GZJA 5HK8A 4AMYA 2QRUA 1E89A 5K3CA 1QZ3A 4UBNA 1QIHA 4Y2YA 5EHNA 1B6GA 5K5EA 1CUVA 3SX4A 5AKKA 2XUIA 3OOSA 4QEKA 3O9VA 2GZRA 4H7JA 2CB9A 1CVLA 2WU3A 5JZSA 5E2IA 1VZ3A 2HA0A 4OB7A 4HVTA 2PU7A 4BVJA 4WFIA 4FFVA 4E11A 4EBBA 4PSDA 3TEJA 1HLGA 1JJFA 2XUGA 4MYDA 4Y2TA 4BB0A 1ODCA 2V9ZA 1UZAA 1GPLA 4QDTA 1OILA 3DOIA 5AKLA 2HRQA 3FVTA 1Y37A 2RAUA 3WIOA 2Z8ZA 1GPKA 5AK6A 2JGMA 2BUCA 3PUIA 5CT6A 4IH9A 3MGAA 2FJPA 3WK6A 3LLCA 1JI3A 5AKZA 3BE8A 4B0OA 1SFRA 3R3UA 3M3DA 4GWLA 3PDCA 1QGED 2DQYA 2JIDA 2WG1A 4FNMA 3F96A 3A2MA 1EVEA 1ZI8A 3K2IA 3G0GA 4QDXA 2AJLI 4W1PA 1YA8A 2HFKA 5HQ3B 3ICVA 1WPXA 3AZOA 4X6YA 5ALNA 5JALA 5D6OA 2DCMA 3HC7A 3HLKA 1YSCA 1QLWA 5K3FB 1J07A 3T52A 3EIOA 4Q3KA 5BWBA 2XDWA 2XUAA 2VJAA 5CMLA 5ALZA 2FX5A 3HYSA 2QUAA 1QOZA 2QKYA 4OD0A 1R1DA 2HU5A 5AICA 3V1NA 2CEKA 2HA3A 1Y7HA 2JGEA 1CUUA 5AI4A 1LZLA 3G9TA 3DEAA 4KE9A 3PI6A 4MQLA 3CN7A 1LPNA
chains in the Genus database with same CATH superfamily
3OF7A 4JEIA 4KJXA 2FSVA 3KB8A 1HDRA 1V16B 1W5BA 3MTEA 4J0EA 2VNJA 2ZBDA 4NTZA 2PMKA 4RMHA 1XXHB 1P62B 3UCEA 4RKQA 5DCUA 2OCKA 3GRUA 2F9FA 3HBAA 5IDXA 1W581 4N14A 1EJ0A 1J8DA 2H7XA 3BB1A 1G18A 4RK0A 2IXGA 3EMKA 3WJAA 1SUSA 3CVWA 4QGAA 2C2XA 3OF2A 3VISA 1ZJYA 1U1DA 1TM5E 3KOUA 5LFAA 1L7VC 3FJYA 4JD2C 1LBTA 4BO3A 2ZSIA 3AFIA 1MG0A 1VECA 3JWIA 4ZEXA 1E1MA 2XE7A 1JB1A 1UBJS 3QX9A 3GVIA 5IT0A 4E1VA 1L8LA 3L41A 2QSYA 3KFXA 1NBWB 4ZKDA 3A1FA 5LXTA 3CUTA 5DLDA 1ODKA 4DIEA 1LSUA 1P9WA 1PE0A 4ZI7F 5TE9A 1Y8CA 1WF6A 1E9DA 3TVYA 1MG3A 4PZAA 5G0WA 3W3AD 4V0NA 3DJYA 1J8YF 3TTYA 4UEOA 5L3VA 1OX4B 1A8PA 3WV4A 2DYKA 3B1JA 3ND8A 4LY9A 3OH8A 2HDOA 1XT6A 5EIBC 1NATA 1AMNA 1OZGA 1WCIB 2P27A 3QZUA 1YTUA 3KJNA 4AG5A 3ZDYA 1AKMA 3BWEA 4FFRA 1Y6RA 4PYKA 5H83A 4J94A 3LC0A 3Q7TA 3INTA 3DXKC 1U8ZA 3TLBA 3MHTA 2G71A 3PZRA 1Q0PA 2L0XA 3X1MA 3RTGA 1L1EA 2V6FA 4LCBA 4CTNA 1JSZA 2AGZA 4AXXA 5AW4A 3VHXB 2FWMX 4OO3A 2HW8A 1BGXT 5BYJA 3M3HA 1FXWA 1ZH8A 2C5LA 4PTLA 3W06A 5GJWC 4DR4B 3PSLA 1KYYA 4YJ2B 5F21A 1UDAA 1FJHA 5ANRB 1P7YA 4E12A 4IO0A 3PXGA 1NRXA 3DDNA 2NTJA 5EINA 4HH0A 3ORSA 4D8XA 4XYHA 2C9OA 4QQ8A 4DC0A 2OSVA 3AONB 4ZTBA 3V7FA 1U8AA 1E6EA 2IDJA 1RYZA 1MU0A 4O02A 1ZM9A 3JYQA 1YASA 3CEAA 3TIIA 2I80A 3JZIA 1WZ2A 2HRRA 3REQB 2CLLB 3U56A 4C9BA 2MWMA 1U8TA 2AG5A 3FPBA 3G2HA 1TFRA 2YX1A 1T25A 3C3DA 3SHTA 1YL6A 2BFBB 3IE0A 5DI3B 2CNXA 1ZLYA 3S5JA 1YL7A 1ZVJA 4CE6A 2JDIA 5KS2A 4JFRA 1P4JA 5TNXA 4QYIB 5HIKA 3VI4B 5D3MA 4JIMA 5KDDA 3W6PA 5C7IO 3D1LA 1KIAA 3JQFC 2BUAA 2ZPUA 3E7WA 4N0QA 3TPZA 3D54D 1O6BA 3ZEAA 5DLPA 2PV7A 2GASA 4KXNA 1Y1RA 4MZXA 4AKIA 2PM9B 4IP0A 2GZDA 2QR3A 3EGDA 2HY7A 3CGWA 4PZPA 4P7BA 1NUAA 4LOAA 2F59A 2FPKA 5JMWA 1N2ZA 4B45A 4AP9A 1VYHC 4IGKA 2K2QB 3ZY4A 5B6PA 4M7RA 3F71A 4YJGA 5GVSA 1O6CA 1TECE 2X5KO 3NHYA 1SHJA 1U7ZA 3I92A 5L6LB 3IOYA 4JLOA 2OAGA 4AMZA 3HYTA 3J7AC 4N12A 5CEFA 1ZA2A 5A9TA 1KFBB 4EECA 1DXOA 8OHMA 3EI2A 1RAEA 3TQSA 3GGDA 4QOSA 2XDQA 3IDAA 3WNVA 1P73A 3HADA 3HP4A 1BFKA 1KQ3A 3AVWA 4A82A 3BN3A 2ZKLA 2XMCA 1KR5A 1YL5A 4G1BA 4FMPA 2ZBGA 2P9ZA 1EZZA 4DDVA 4DUYB 1R12A 2EX1A 4E22A 5T7BA 2X1VA 2JLSA 1TK2A 1QV6A 3QWIA 1PL8A 3CTPA 2F8TA 1GG2B 5CH8A 3X43A 2GN4A 3KEQA 3NAZA 3H8SA 4WT7A 4ZKEA 3CS3A 2H13A 4A8TA 1PNTA 5KDOB 4IEEA 1DJOA 2PLWA 4OK5A 2W71A 1WY5A 1ZK1A 3DBHA 4LMRA 1NQ5A 3AJAA 1AQLA 3E22B 2E85A 5GINE 1Q21A 1F17A 3ICPA 2V45A 2JFPA 3K9BA 4TS9A 3TD6A 2W6MA 2FK8A 1I32A 3EDRA 1PO7A 3RS4A 3UCXA 2Q1XA 2W9XA 1GGHA 3PDIA 4RZXA 1PLLA 5J9FA 4D74A 5C0OE 1ECFA 5EXSA 4Z7OA 3IXQA 1XJWA 4U8GA 5GPBA 3NH6A 1H0RA 1J0AA 4I3GA 3B13B 3ODGA 3ROQA 1RNLA 2ECPA 5TDHA 4DV3B 4M9ZA 2HJ4A 4ZOBA 3F6YA 2CD9A 3HJAA 2IH4A 1BXRA 1NQOA 1CE8A 4FKBA 3EXHA 2ISSD 3PJFA 3Q5GA 2VPIA 4COOA 2QMZA 4WA7A 4D9IA 1AV7A 3G85A 4XIYA 3BL5A 3G2LA 2OLEA 2EICA 2CFTA 3HBJA 3KHUA 2PBLA 1UJ2A 4BZPA 4EVQA 3UN1A 5EUCA 3PJRA 4BX9A 2ZYRA 2NMVA 4D92A 2ZYGA 1OV6A 2CYBA 1DJPA 2P2LA 1M1NB 4W4TA 3VSDA 5JNTA 2EKPA 4EY6A 3TWOA 1QFXA 5DN6A 3ETJA 4I3FA 3ITKA 3GIDA 2JGAA 4RLHA 3VO9A 4XUGB 4ZXFA 2HT6A 1RAHA 5AW8A 2WE7A 3HCEA 4ER6A 1F2DA 2X40A 2FW7A 4BVBA 2X4DA 1UK8A 5BQ5A 7REQB 3CINA 4M55A 2O2SA 1GCIA 5C8VA 4L8GA 5IJ0B 3OLWA 2N1MA 2D1SA 1DMRA 3N0RA 3T41A 1QH1A 5FEUA 4RMNA 3U7GA 2EZ8A 3OCCA 2JATA 4P33A 5IH7A 4UUPA 4N3GA 4US2R 2GHRA 5EQFA 2O6HA 2QB5A 4WGGA 5JLAA 4E5ZB 3CLRC 4AG3A 3UF0A 5C52B 2A7XA 1RIFA 1XTPA 2AEMA 4Y9RA 3ZHYA 4ZYXA 1GFWA 4ZZ3A 4JT2A 5AP9A 5BW8A 1LI5A 2UU9B 3UT5B 2PL3A 3JQAD 5FI3A 4PQRA 1N32B 2FI1A 3NTVA 2RJ3A 3BMQB 1I5EA 4EJSC 5BT8A 3DULA 2OVQB 1A9SA 1OXBB 3DF7A 3OU6A 5KU7A 1G59A 2IBTA 1HL7A 2NU7B 2F2TA 1KZGB 2G4VA 3FKSA 2FW6A 2QAGC 4FCCA 3IP5A 1TAUA 5KNLA 3LOUA 3NEYA 4I6GA 1ACLA 5CLHA 5A02A 4MQEA 4NDZA 1L7AA 2GJ8A 1DQYA 3WMFA 4MPDA 4G0QA 2QK4A 3BGVA 1G5QA 3JD4A 3T1VA 4ER7A 3SEFA 5JAHA 3IAUA 1M66A 2CMFA 3Q3CA 2C03A 3VNRA 2X0DA 1WXQA 4FE4A 1YGPA 5CW1A 3BUSA 3X0DA 3DFMA 1E3IA 2WWWA 3O8OA 3V42A 2GBGA 2A9FA 1LVUA 2JKZA 2C84A 3E9EA 2Q3EA 2IE8A 1DIRA 2YWBA 4FOSA 2I6GA 3GPBA 4PSCA 3QOXA 2BH9A 3K72B 3BHIA 1B41A 2CV0A 4CV3A 3CF4A 3V5NA 1DC7A 1HY3A 3SBDA 4TQ9A 2Q45A 2I03A 3G9XA 3I6YA 1YJQA 3D5EA 1GCGA 3H5LA 4HQ0A 4QXMA 2QLTA 1ZN2A 5JO9A 5B6IA 4TZ0A 3F6BX 2RBEA 4Z9AA 3LCVB 1OGYA 3UPDA 1JFRA 4U2CA 3P2MA 5ES3A 1P7WA 1SQFA 2IDMA 4YLGA 1PQPA 3MUFA 3VOAA 1RI3A 1LSJA 1IZ7A 1AN0A 4FCTA 4L6IA 2OV8A 3A1SA 1V7PC 1PGPA 1TB4A 3UJPA 2BEUA 3T9EA 1VSVA 1IBLB 2J0QA 3WBKA 4OAOA 1TE2A 1EUDA 2XB2A 2W2KB 3OIFA 1ZJWA 2B5NA 4DMCA 2ORWA 2OGSA 5EEGA 4F7DA 3NKFA 1RXSA 3J7TA 5DWVA 3MRXA 3VH2A 3N28A 3FYDA 4OP2A 1Z16A 3X1XA 3A7EA 1TTQB 5DEOA 3TFQA 1YFLA 1XMOB 4YT8A 5B1IA 2FPMA 4NR0A 3N2IA 4URWR 3R5KA 5JLJA 1MFPA 4W99A 2EBSA 2JGIA 1I4TD 1ORHA 1RM4A 1VIYA 3TLXA 3GNTA 4Z9FA 2X0EA 4IKEA 4X6UA 4B6OA 5FULA 3QFCA 3HB7A 3L06A 4DLTA 2BWJA 1Q17A 5JJLA 4MI3A 1CQXA 4BP9A 3EOZA 3PHJA 5ALKA 3WFZA 3FMPB 3ASVA 1D2GA 1SKUA 1RT9A 2IZ5A 5IKXA 3OWOA 1N2SA 2AZMA 2FSSA 2JK1A 2VJYA 4TKUA 4AJLA 1SCUA 5CVUA 3SJLD 2Y4NA 2AYXA 2VWGA 1K7SN 4IFEA 2Y68A 2AX3A 4L57A 4XARA 5LIPA 4XWAA 3K71A 3IUPA 5C51B 1JALA 2YIDA 1DFIA 2P4EA 3LF1A 4CFYA 2JW5A 3C4VA 3I2YX 5G40A 3REGA 2WEKA 1U28A 4XR4A 1OBHA 5J47A 3LGXA 1BS2A 3DE5X 5DNUA 4HH4A 4E6EA 4M49A 1UMBB 1B43A 3S6JA 2OHVA 3Q9LA 2OJYA 1U02A 2Z0MA 3HMQA 3UXMA 3AOGA 2W42A 1F51E 2VH2A 2BCJB 4YECA 2CYAA 1H1LA 1DRWA 3VGPA 3DZFA 4CMCA 1UQUA 4P36A 2PSEA 2GTIA 2G09A 3CH7A 2I4TA 5SYMA 4PZEA 3ASUA 3DV0B 5K8LA 2IYFA 1SOVA 3T12A 5HF9A 3VKVA 2C7VA 4RXTA 1YNOA 3TFWA 2PPVA 4ME6A 1QC5B 3HB1A 1FS4A 3NHBA 3WQBA 4XDGA 3REFA 3K0FB 3VR0A 4EY5A 4B3IA 4G67A 5AI0A 5FT9A 3D6FA 1WEKA 3AJEA 4EO4A 3HXLA 4EDFA 4X7BA 1BFUA 3RVMA 2NSHA 4DT1A 2OKCA 3OKWA 1QDLB 3OTWA 1EE2A 2ZRFA 5EIFA 1ML3A 2O3TA 2VRNA 4XPZA 3UPUA 2C4WA 5GSAA 3ZDFA 3A4LA 3GZNA 4YR9A 1VOTA 3W5HA 5EMJB 1JZTA 4I1SA 5K0EA 4JP2A 1A95A 1L8OA 3KTAB 3G7NA 4LTDA 1OXSC 3JRWA 3C15C 2FDRA 4FTWA 5LLTA 4ZC8A 1EGQA 1RWVA 3AUXA 1B00A 3KJHA 4CLRB 1DL5A 4Q34A 4X62B 3HGTA 1R16A 4KJZA 1KE2A 1A5SB 3WA6A 4YIKA 2Q6LA 1GG9A 3GEGA 2XW6A 4RQTA 4YRCA 3T95A 4ID9A 4IZIA 2QN9A 3D4PA 3ZWVA 2GN1A 4XM2A 3MBOA 3WHKA 3F3GA 4H2DA 1F4PA 3B9RA 1IY9A 1S89A 2IEYA 5IANA 4DA8A 3AMVA 3ZZ0A 3HB0A 1PIWA 4TTPA 4UXIA 3CF0A 2XTMA 2VDJA 4XDZA 1A9PA 1K3IA 2KSQA 4FW8A 1QHXA 3A06A 3L5OA 1PZNA 1XUOA 1DELA 2H1IA 3CLHA 4L9RA 4URHA 4C01A 5SY6A 2P4SA 3BBLA 2JZOA 2GHIA 5I3ZA 2OTCA 2OCBA 2GETA 4G8BA 2GVNA 3KR0A 2VS1A 1XMPA 1AQNA 3M6AA 1TJNA 1E6LA 3JAKB 1SG0A 3JASA 3F4KA 4XFKA 5K0LA 2ZB2A 1EP1B 3MMSA 3OPMA 1WULS 2R1TB 3VMFA 2R60A 1W1UA 3EAGA 5HXAA 5H82A 4YEDA 1QE5A 4G0MA 4DAOA 3FHCB 4YAJA 2BLNA 4WGFA 1NWHA 3STXA 1L7QA 3UA3A 4FI3C 1Q57A 5I7AA 1W2HA 3N8GA 1B2RA 2BJWA 2J5RA 2W4QA 4OJYA 4UU7A 2V1XA 2QRQA 3TAHA 4W5HA 1GN8A 4L8VA 1X7XA 3H4MA 2IYNA 2QR5A 3TFOA 4C4OA 2CLFB 5EE1A 4DGQA 2N9UA 3TNDA 2V74B 3DUWA 3MUEA 2WW8A 1U5BA 1I2MA 4AY6A 3K70D 4FJ2A 4D6YA 1PQYA 3DQQA 1ZD3A 4K3ID 3MK31 2OMEA 2RONA 1NQTA 7AT1A 2I67A 5HNKA 3UK1A 2C2WA 4D0KA 1YUMA 4Q4JB 1JZQA 5DK6A 2QRUA 4HEJA 1Z33A 1J09A 1I3CA 3RRMA 4YRSA 5C5DA 2PO7A 4EX7A 4CM5A 4CLDA 3WRXC 1PR5A 4X3EA 3G7SA 1SBHA 4RXMA 5EJFA 1LJ8A 5AK0A 4BASA 3R5HA 4LWOA 5E6SA 2H5IA 1GGEA 3ZLJA 3OQOA 2HRDA 4F2GA 4LHVA 1QANA 3R0XA 4L9SA 4MW9A 1KEVA 1H9CA 2R87A 1V1RB 1W36C 4FGKA 3VC1A 1GUFA 2O23A 1KP9A 4J3FA 5IC5A 2O20A 6ABPA 1GPKA 3DCYA 2JAOA 1B15A 1D9ZA 2YMUA 4HGQA 2HIGA 2IE0A 4YQEA 1UJ5A 1BMTA 1EQ2A 2EX4A 3IAAA 5HQ3B 3ZNNA 2XNKA 4GI2A 5LUBA 2P3SA 3A8TA 1Z5UA 5TC4A 3NATA 4UTNA 1X7WA 1OZ0A 2BFMA 4GKBA 2ADFA 2RHDA 4GZ5A 2NLOA 3DM0A 1YCHA 5ALZA 2PQ6A 2QUAA 3HNOA 3TO5A 4AYWA 3AUSA 1Y9AA 4BUCA 3QA9A 4BYGA 2VPQA 3L7AA 4G65A 4NEQA 3MB5A 1D2RA 3TL2A 5IVPA 3DMFA 2PGAA 2O8EA 4TL6A 2H4YA 2E89A 1CUIA 5GWXA 1X86B 2XE4A 5AK5A 4LDRA 5DIFA 4HVLA 4Q4CA 4Q5IA 1N78A 3IAEA 3Q5EA 3CWZA 2BMJA 1UOOA 2HMWA 1FK8A 5ELXA 4LRUA 3OZTA 2UZ0A 4PWZA 4D8VA 4J3JA 1J70A 2PBIB 1X7ZB 1LV8A 4K28A 4NENA 4K6KA 3W6OA 3TEFA 1K0UA 3ZOKA 4I4LA 3C24A 4Q39A 3T7AA 4PF1A 1U7WA 4GXQA 3P0IA 2PX8A 2XWSA 4NNJA 2IELA 2Q5CA 3HP7A 1PFYA 3L7NA 3KSDO 3ZDCA 2JLCA 1KDOA 1XMXA 1AMOA 4IV0A 2WIJA 5E6RB 4E15A 3P52A 2CJYA 4PIVA 4FBLA 3NEAA 3L7CA 1D0SA 2XVYA 4A0GA 3VC7A 4U7JA 2AA3A 1TEZA 1Z5OA 1J9GA 3PVSA 4UDNA 2IBSA 3AB7A 1DQRA 1AHIA 3QPAA 4BX2A 3KT8A 3F6SA 3F67A 1IY8A 4TTVA 1XPOA 4R40A 1JFTA 3DZBA 2BD0A 5KQMA 4MGYR 3NBQA 1ZMOA 4IIJB 4BEVA 4EUSA 2JLBA 4IX1A 1A71A 4O08A 1SA0B 2JVKA 4JJIA 1G8HA 3K6JA 4GMBA 3V1TC 5FX2A 3N6RA 2ATXA 3LQ4A 4NI5A 1PCXA 2GBLA 2R4TA 1F8FA 4GZMA 1QGZA 5FB3A 1XNJA 5IEBA 3SMVA 2EQ5A 4UVHA 2PUVA 4ABYA 5T67A 3TGLA 1B2LA 1OAKA 3N2KA 3QBJA 1I7QB 1BDIA 2P9LC 5GP1A 2OBYA 2ZB3A 3CXRA 2DGDA 1IEQA 1T26A 2CE8A 4LSMA 3ZWWA 4RWZA 1ESNA 4QJBA 5FV4A 4F93B 3OX4A 3JATB 4XRGA 1HDYA 4X1KA 4Z7QA 2HU7A 3ZIDA 1BMFD 1XYYA 4WKPA 2H29A 1DDIA 1FRQA 4M1TA 4CMJA 3W90A 2WM8A 5IJ7E 2E5FA 2HYDA 1NMQA 3Q40A 1Z36A 4K2HA 1E6UA 4XB2A 5LQSA 2FUEA 4GP9A 2HEIA 3WK9A 5I5IA 1D4AA 4YCAA 2ZUEA 1GLGA 4H4EA 4H0FA 2O8FA 5COQA 3IRUA 1Q14A 1PK7A 3Q8XB 2Q1UA 1A9OA 4L76A 3GG2A 2VJMB 1A2OA 1KZ1A 1Z07A 2H2DA 5EMMB 4KIFA 1NUPA 1AD2A 2P5SA 2VQ6A 2IP2A 1KMIY 3FCXA 1Z08A 1NJSA 4WN3A 2C9YA 1R64A 2V9PA 1JIKA 2WSSD 4LF7B 2F7SA 5GONA 3MEQA 4B3RB 4K2AA 3VVMA 3VVLA 1TTHA 1KERA 2J9RA 4FHLA 1ZNYA 3TXXA 1TAGA 1WUYA 1NI3A 3LBYA 2VXOA 3HPRA 1GP2A 4ZAXA 5DHFA 5AWFC 1PBYB 1KEKA 2OCLA 1JEJA 1OFGA 5H5JA 2P30A 4JJ4A 5F5XA 2ROQA 1TD1A 1NR7A 1OKKD 4C04A 2C20A 4WOPA 1WAMA 4NCHA 2J3JA 1GRVA 4GEGA 1JG7A 2IBMA 2O7RA 1YHNA 2XMQA 4PYQA 1QZZA 3CVJA 4YUXA 4E1AA 3IMGA 1K8YB 1ZNXA 1N7GA 3ISJA 4DSUA 3V4OA 3C97A 1VJRA 5F77A 3GUYA 4X6XA 2ZYIA 4A2QA 4BNXA 1I1HA 1W4ZA 4FIDA 4GZ6A 3RVRA 3V2GA 3LHSA 4N40A 4HOYA 2WJVA 4F8EA 1YC2A 4MA5A 1WABA 4WW0A 3FN4A 4D9MA 4I1RA 2Q21A 4MQ4A 5DYIA 3Q15C 5M61A 2WTEA 2CHGA 1TLFA 5ALPA 3TOVA 4ZZIA 3PG5A 3UIEA 2WWVD 3WB1A 2I91A 2WTMA 1ZBDA 3FOWA 5CT8A 4RQBA 4C88A 3R40A 3DMNA 1OYYA 4ZT3A 1SBQA 1VIMA 2VP5A 5CT5A 1W30A 4OLHA 1Z8DA 3I3OA 2QTCA 3O3MB 5D3ZA 1SJ9A 5ARCA 2ZR8A 2ZS7A 2JLQA 4FGSA 1WHSA 1MR3F 1YQQA 4BQSA 3IQDB 4OSEA 2GILA 1XEWY 1Z4OA 3U60B 3W5IA 3IP3A 2OBLA 1E3QA 4JOSA 2DHQA 4DIUA 4YUYA 4UASA 4ZT7A 2JCGA 1U7HA 4KYIB 3VUFA 1PSZA 3FZGA 1EXVA 1RWXA 1G2PA 2IOQA 1KMQA 1HE4A 5YASA 5TPZD 3FLEA 4K86A 5FA5A 4N1AA 1A8QA 2BZGA 1VLMA 3IYLW 1V43A 1ENYA 4R83A 2VJKA 1XSEA 3E2MA 3QBDA 1SU8A 2QRVB 4AJPA 2GPAA 3K92A 1V9CA 5KWJA 3AM5A 3QPUA 3AL0C 4FYKA 2J3QA 3LKZA 3U49A 4YQZA 3MAAC 1IONA 2XCQA 3I9KA 1V48A 3R24A 3FVRA 1FUUA 3KIPA 4J79A 5ILGA 2V0CA 4DHWA 3GLKA 4GDFA 3C3YA 2VWHA 1U31A 2HOQA 4NJMA 1R5OA 1V8DA 4F5DA 5EAIA 1Z5GA 1BW9A 3BAZA 3G2MA 1R6BX 4QUJA 3PT5A 3ESCA 3KJXA 5L4SA 4WE3A 1RXCA 2X6TA 4HB4A 4LDPA 4F72A 2LCIA 2X42A 2QV0A 4DLUA 2HF7A 3EVBA 4YRNA 1X38A 2W22A 1OU4A 3K0AA 5JS7A 2WM3A 3B78A 4LJYA 4C0LA 3DE0X 2GZMA 4QTUB 5KX5B 5AJHA 1K97A 1SHUX 4I55A 4F84A 2DPGA 3LYHA 3K5HA 1ML4A 2XTAA 4IDFA 2ZVDA 3QEKA 1RMYA 1K66A 1E9AA 3WGMA 2PXCA 1UBHS 2FK7A 3HABA 4PRKA 2X0JA 3RSHA 3CEMA 5FPQA 5CIQA 3ZE0A 2WNSA 5BNFA 3EF3A 1U94A 3ZWQA 5J4KA 3O8LA 1QH8B 1T6NA 1T5SA 1XQYA 4QPZA 2WTBA 2AC2A 3CE9A 4FR0A 2ABWA 3SYNA 2YFYA 5JHGB 3SZLA 1K7XB 4BFSA 3ASYA 4RDCA 2R0QC 1QK3A 4PRLA 3B8HA 1U7XA 1C4KA 4TMFA 2M32A 1KO5A 3HK2A 3CFYA 4GX0A 4R2MA 2OWEA 3RGGA 3ELBA 1D4FA 3ZHCA 4Q1EA 2A1TR 4B74A 5DBIA 2PUBA 4JNKA 2G1JA 3FTNA 2EFYA 2NZJA 5DGXA 4KWEA 3QU7A 4XPIB 3SIPA 1TW3A 2WJPA 4D3ZA 4ABTA 3SDSA 3BSYA 1HQDA 1X8LA 1FB5A 4N41A 1IBCA 5LMZA 1JG3A 2J3KA 3D4NA 4KQ1A 4EUNA 2KBFA 1AS0A 4PICA 1D7AA 3A37A 3UNXA 2AH5A 4BJ6A 1ZSVA 5IJZA 1PFVA 4WK6A 1N2CE 5DO9A 3WLQA 1M33A 2A2ZA 4MR9A 3GLVA 3I30X 2OFPA 4Y6RA 1KSGA 3M5CA 4HDCA 1FSFA 3X1DA 1I7SB 2W11A 1COWA 3GN1A 4GMGA 2F3RA 1Y9ZA 3LBNA 2PHZA 4GS5A 3WJ7A 1KH2A 4UMFA 1Z75A 2GD6A 2OZLB 2QN1A 1CIVA 2Y2VA 1U0JA 3U4HA 3COZA 1UP7A 2XCUA 4HUJA 1RWPA 3F49S 3FYUB 1P7PA 1S9HA 5ILQA 1P2FA 2O8DB 2OPBA 3LC1O 4RJKA 3FCYA 1C8BA 3AU8A 3RTBA 2P11A 3UK0A 3CNNA 4WY2A 1P0MA 1GQYA 1ODFA 3R3WA 2VLBA 1DKNA 1D9XA 4JQYA 1OD6A 4Y0AA 1Y1SA 3WGIA 4O2AA 4F06A 1FPMA 1T4MA 5IUJC 4IIEA 2Y27A 3SE0A 2OAP1 4FI3F 1ABBA 1XWWA 5CLQA 2J3EA 4Q3OA 4I7EA 1UPXA 1SGWA 5AI6A 2FP4B 4CZXA 3VR2A 1AU9A 4MAAA 3IV7A 3E35A 1RKBA 1DQPA 3AIKA 3OQJA 2J32A 2HBYA 4D0RA 3EI1A 2PH1A 2O2IA 3MTJA 3S2SA 5LOVA 1JKXA 2NV0A 1H0HA 4JSYA 4TTSA 2QGZA 3R0IA 4KQIA 4Q3CA 4DTCA 2PUAA 2GRJA 3MJFA 1PI6A 4GXRA 3A9RA 2O2XA 3ETLA 3ICWA 2A8YA 1HQKA 5SYNA 5KNBA 2R751 5ALLA 3H6GA 4ZAVA 5IC7A 2NV2B 2VK2A 3LUDA 5LYJF 2WE8A 1HBJA 2XGMA 1D2EA 4XVQA 4ML3A 3W5DA 3WSWA 3KLMX 2Y93A 2YIVX 3K3PA 2IPNA 3GAAA 1DPFA 2VHUA 3INNA 1O5TA 1G38A 1J7KA 1WZNA 4Q9IA 3D8RA 4UAVA 1E3DA 2GSWA 2DOKA 3JQDA 1N57A 4C5AA 3OLZA 1Z38A 2XKAA 4TM7A 3L4BA 1G2IA 3U19A 5GXIA 2AOWA 1S2LA 1V5EA 2FPIB 1LW7A 1SXJD 1T3ZA 4DMLA 1YOVA 4CLEA 1SQSA 4Q6BA 5BOSB 4EG0A 4RTMA 2H2FA 4ERYA 2AUNA 5C5EA 3CONA 1L4UA 3DS8A 5J4VA 1MV8A 1O08A 1EX1A 3PC8C 3JWEA 3OT5A 4XEUA 3U0BA 4J07A 2IYEA 2QUBA 5EIHA 4HDKB 2DPMA 4XWTA 1XHMA 4JELA 3KWMA 3QPDA 4JT9A 1IM5A 1OPXA 3GD5A 2FZLA 1V6CA 1NVKA 1RXWA 5C5IA 2EJCA 1I6WA 3NYQA 5EOVA 1J5PA 1S2IA 1GZDA 1ILEA 1U4SA 1K6EA 3GPCA 1TZMA 5L7YA 4GBGA 4Q05A 3WLIA 4XR9A 5EVCA 2CBGA 1XJ0A 3PGLA 3WIBA 1C3OB 4HVAA 1LS1A 1OH8A 5T8KA 1UBEA 1W4BA 3WYDA 1R4ZA 1Y4SA 1DXYA 4AJKA 1Z2EA 2NVWA 3YASA 5LC1A 3UJDA 1ID8A 3NFRA 3DTVD 4A6EA 4MKGA 4X3CA 2QTHA 3CX4A 4KAAA 4JB2A 4PFKA 3OHMA 4IICA 2H8KA 3OUTA 4YP7A 5EFZA 2FMXA 2ZJ1A 3EOAI 1GGNA 4DA4A 2NP7A 1KI3A 1WPRA 1Y81A 3GQVA 5F64A 4X61A 2RH8A 4BVEA 2OO3A 4J0IA 1GN9A 3OCUA 1GQSA 1R4MB 2D2VA 2GD0A 2ZCJA 1H8ED 4WZBB 4EKNB 1SCQA 1CF9A 4WL0A 3M6WA 4HUTA 1J22A 2ES4A 2PS3A 4XLZA 4C43A 3CC8A 2GZSA 5CLLA 2F3QA 2UYQA 3EWEA 1H23A 2YJ6A 4C7JA 5HZMA 3JTMA 4LC1A 2XDYA 2KQUA 2YS7A 3CA8A 1FRZA 4QEDA 2EF1A 2A9VA 2JCBA 5EIAA 3OG9A 1G8GA 1JMKC 4AWAA 1XLTA 1P80A 4Z1MD 3HKEB 1U3WA 3TAXA 1RVDA 3CG4A 4IVNA 2CNWD 1WHTA 2CHFA 3CZMA 2IXAA 3DV2A 1U6IA 3SSNA 2OORA 4CEJB 3T5DA 5FDFA 1UMCA 2WM9B 1SKAA 5HJ5A 5JDIA 1N2CA 1HGXA 1UBNA 5AI5A 2OAEA 4G9EA 2FWRA 4JJAA 4HAOA 3PTLA 4WLNA 1JSCA 3WMRA 4DCCA 1NYTA 3RV3A 3LLSA 5BR8B 2HA6A 3E9ZA 4DNXA 2NPFA 4DMKA 1J2RA 2C3YA 1KO8A 1YFQA 3HJTA 5BR1A 3GHHA 3VKUA 4WBNA 4EFMA 3EGIA 3FB1A 4F45A 5AJWA 4X9XA 4DE5A 2PFSA 3V6MA 5L7TA 3IMEA 3LG2A 2P9NC 4A2LA 4W9RA 4YIHA 2QD3A 3PCTA 1LPPA 2QRJA 4MLDA 1DBPA 4GGDA 5HUHA 3ZEIA 5B3JC 2R97A 3VPSA 2P67A 2VHYA 3D0RA 4I50F 1R4NB 3M5WA 5KB3A 3CRNA 3BSWA 4C21A 1E59A 3EVDA 1DKOA 2JNWA 3U7IA 4I1IA 3NJ4A 3FPLA 1ORVA 4EENA 3FNHA 1TTPB 4X1IA 4RJLA 3FI9A 5HDBB 1N3YA 4KN8A 4QQNA 3ZE8A 1Z82A 2QD4A 3SLKA 2CDAA 2X13A 1XA4A 2CHEA 2WIFA 4ER3A 5HJ7A 3MJ4A 2A3RA 1ZQ1A 1GOGA 1WDMA 5EARA 2D5AA 2JGKA 5I4CA 2HBQA 2HQRA 3SIWA 1O96A 1TM4E 1KGSA 1E7WA 2FMTA 2PTGA 1E8MA 1E0KA 2BC9A 1EESA 4JT8A 1NXVA 5ENZA 3SVZA 1D6MA 1TAQA 3NZEA 1REQA 1K2WA 3Q3EA 1PS8A 4JI0B 1KYXA 3DOFA 5H80A 3M6VA 4W5NA 2QR2A 4ARZB 3LLMA 4RK1A 2GJ9A 1N9GA 4KR9A 1TU4A 5D6NA 4HJRA 2QUJA 1XJCA 3FTDA 4OKSA 2XXAB 4V3CA 3FOFC 1I1NA 3OLXA 1ZR4A 1QDEA 1F4LA 3VUEA 2OVPB 3JXEA 1NC1A 3UWOA 3AF3A 4D4KA 2IUTA 3ONVA 5C31A 1V41E 1E89A 3B38A 1XCPA 4QHSA 1UFVA 5EHNA 4DXHA 4TLBA 3RUIA 4RKWA 2R5WA 5JC1A 3NOOA 1NW4A 3F78A 3V7WA 4E11A 2J7KA 1UAAA 4I46A 1JJFA 3HUDA 3OFJA 2XYPA 4DREA 4MMZB 1DIHA 3S2EA 3PRHA 3PPYA 1SVNA 4ZO8A 5AKLA 1M6YA 3MTDA 3FMGA 5C37A 2YN4A 5CBPB 2VAMA 1WP4A 2N1BA 4ZV4A 2UKDA 3QU4A 2ODAA 4WTOA 2KLBA 1Z2NX 2REOA 1EVEA 3N7UA 4RVGA 2RGDA 3QYFA 1K3TA 3BULA 5JALA 4A11B 1VDMA 3ZNPA 3OT1B 4RDXA 1T6ZA 1Q0QA 5EKUA 2VTDA 4GQAA 3QJYA 4Q3KA 4L8YA 4KDRA 3TDMA 4OFWA 4U7GA 3AEKA 3TIFA 5MN4A 3OZGA 1AGNA 2P6PA 4WNAB 1YJCA 3AEUB 1JG2A 2HA3A 2YV2A 4PHHA 1CUUA 3P45A 1L5OA 4ES0A 1GL6A 2TMKA 4WCFA 1YRLA 3BYZA 3NVDA 4F60A 4ZJPA 2HMVA 2WD9A 4LZZA 5GOTA 4BZQA 4FA9D 4RX1A 3MGKA 4KLAA 4Y1RA 1UJNA 1RAAA 3NHRA 3L4OD 1DKRA 2P2NA 4A0AA 2PKRA 1MV5A 3UJ6A 1I6KA 2P69A 2I62A 3VJRA 4WCDA 3THXA 4FPXA 4IRMA 4MI6A 1C9LA 2VUTA 4B44A 2DX7A 1OXTA 3W2TA 3GLHE 3B1XA 2XKBA 4CMEA 2L2QA 4GR9A 2O5EA 1R0WA 3ZCTA 2MU1A 1AJEA 1USUA 3PPWA 2VT7A 4U7PB 3QITA 1V47A 1XHEA 1E8DA 5GJVC 1OI3A 1VG1A 1GZ7A 1O94D 1EX6A 5K0NA 5LA6A 1ZRMA 2ZIAA 2JJMA 4CDGA 2R00C 4NAUA 5EZ5A 2ZRGA 3TRIA 4MK4A 1UXIA 1EXDA 1C7RA 5F7XA 1P9LA 5F5LA 4Q6WA 3COJA 4NYJQ 3EPHA 5I9LA 2G08A 3U09A 3O0TA 1HKUA 4V0SA 3SF0A 1YE8A 2EGUA 1PDWA 2IOFA 4OXXA 2FX3A 4JH0A 1UMDA 4RCZA 1Y5LA 4R3UC 3KM0A 2Z1NA 5IJAA 3QU2A 1G8KA 1M6EX 3BJIC 2PUHA 1T5BA 3OIWA 3W5UA 5FBKA 5KC9A 4FFNA 5DNYB 2G9ZA 1DEAA 4ZP1A 1DKMA 1P1JA 1OBOA 2QJOA 2YXLA 4F9GA 1XTJA 4WFJA 4P3OA 2VKTA 3L4JA 3TIXB 1ZCJA 3THWB 2C3MA 3DQZA 4G97A 1ISRA 1HDEA 4RK5A 1CUEA 4Z3OA 4BN0A 1NFQA 4UNRA 1H9AA 1KO4A 4QLBA 4GI5A 5KKNB 5TQ0A 5I7UA 2X8JA 4YV1A 3RWBA 3LDUA 1G6HA 1EFRA 2AZ4A 5LR6A 2A5FA 3AV3A 4N18A 3RU7A 4URYR 3UUGA 2WRZA 3BWXA 4EHLA 3U4GA 3UMRA 4F4JA 4ASUD 3M4XA 5F78A 4F9TA 4MUIA 4FHEA 3ETNA 5SZHB 1VP9A 3BRWA 5T4BA 2PGOA 2O0LA 4NAVA 1DIGA 2QTNA 2Z57A 1DEOA 3OURA 3AO0B 1YS2X 4NSXA 1V7QA 5KNDA 3KRTA 3RU3A 3ZHSA 2WYIA 1H3EA 4L3WA 1T5IA 3FXAA 3I42A 1DX6A 3ZPXA 3ZX4A 5EWLB 3SHFA 1L3IA 2G6BA 4KXMA 4ZU1X 3PF8A 1D09A 2DQ4A 1GRNA 2E7ZA 4AUMA 1X1EA 2W5UA 5E4TA 1G0OA 3EEQA 3FPAA 3AR5A 3EXAA 3D3QA 2IHBA 1LC0A 2FWAA 5EGNA 1JMVA 3RSGA 3OEWA 2IU6A 3TUZC 4G1VA 5BVGB 5G02A 2CSUA 4N7BA 4QUAA 4Q9DA 1GTZA 3OCYA 3QBTA 3AFHA 1SC6A 4TT3D 3QEMB 4OB8A 1FJXA 2D1FA 3DLCA 1IOLA 3R8FA 1PG2A 3E3NA 4KWHA 4BIIA 4CJXA 1J5EB 1MAHA 1S0UA 2EL7A 4N8DA 4F6RB 5BN3B 1CBUA 3HU1A 4FGLA 4HC4A 3H5OA 3ZE9A 4DLLA 1E5LA 1H6AA 1JUDA 4KQXA 1ZISA 5J2TA 2Q9BA 5AM1A 4GR5A 1BFDA 4OHKA 5CVEA 2BI7A 5FUXA 4U8HA 3TZBA 1SXHA 1A4IA 2XNDA 2E48A 3SKXA 1KZ7B 1TM2A 1XPUA 4NBRA 3TSZA 1L1FA 3N2ZB 4I36A 1E3JA 3QYAA 5CX4A 4WJKB 1WDTA 2YV5A 1E96A 2I2WA 1ISPA 3CF6R 2HHHB 3WS7A 1LEHA 5KYXB 3IAM1 3C6XA 2XQGA 1LLUA 4PG7A 4PXSA 1PJZA 4I2NA 4FOLA 3C1TA 5L3SB 4EJSB 2IUFA 3LY8A 5EZ6B 1IEVA 1SCJA 4YRRA 3KOXA 3W5CA 2EFJA 1W4CA 3ZLVA 2IUVA 4J9VA 3HKDB 5HRCA 5DOVA 2G36A 2O57A 1VXRA 3LP6A 3ESDA 4ATNA 1KEPA 1EB8A 3OZDA 4QPNA 1TF5A 2QAGB 1EEHA 3WWCA 1R9MA 2VSOA 5KHLB 5IHPA 1K63A 5CXSA 4PO8A 5IN5A 2PJDA 4MUEA 5D84A 2FPGA 4KPGA 1ZD9A 3ZE2A 2DUUA 3MWYW 3P9YA 2V6MA 5DTMA 3EG6A 1OHHA 4Z3DA 4DIDA 2DB3A 2WPNA 4NCKA 5HUQA 1GZVA 3B20A 4YRPA 1L7MA 5AW3A 1PR4A 2ZRMA 1TEXA 2GPJA 2B35A 4PEVA 4IIBA 4ZI2A 3GLHA 5THKA 1E6KA 3NYWA 3GA5A 2FPLA 4PLTA 5HE3B 1X9HA 4R51A 5CCBA 3OJOA 3M5DA 1N6RA 1M67A 2IU4A 3N0EA 1EFPB 1B8UA 2XITA 3ZWKA 4ZQHA 1VKZA 4LYYA 1FMTA 4TMYA 2EGGA 5K8CA 4EBFA 3D0KA 2ZBUA 3L6CA 1E0JA 1HNZB 3QI2A 1TC2A 4M1WA 3B89A 1WB9A 2PZGA 3B53X 3DZIA 1NDHA 4LTNA 3AW9A 3CX7A 3IJPA 1NN1A 3P9XA 4HRXA 4BXOB 4GPTA 3AWIA 4IWNA 4W82A 4JBGA 1NHWA 3IXMA 5KTTA 1T2FA 3ZQKA 3TCKA 1E2GA 1VZ2A 2LKCA 3NOXA 1J24A 1WDKA 3CFSB 2XZTA 2GPTA 2ATVA 5DNWA 3U4IA 2V96A 4Q12A 4EW1A 4MUKA 2GKSA 3N0TA 4MR7B 5F2EA 2R6R1 1FLDA 4M6WB 5HE0B 1IATA 3PD1A 1C50A 3ICCA 3PRJA 3HFQA 4CMIA 4CZYA 3I61A 4DJEC 1D1TA 1NXOA 2FETA 3ECSA 1N92A 2NTNA 1QHEA 1NRIA 2R44A 4P2BA 3EF1A 4ZQBA 4D6PA 1HE1C 2QW0X 1NM5A 1NY5A 1ZY2A 4CKCA 3EEYA 1ULSA 1GGJA 4GPEA 2AVDA 2B37A 3SN6A 4Z0NA 4HQFA 4UMVA 5F5NA 2V0GA 3DHVA 3GJZA 4BB6A 3I58A 1O54A 3FM9A 3ZBTA 1WE2A 1A7AA 1RQ7A 4KDFA 2YHIA 4WBSA 2FW9A 3C75H 1Z47A 2YYYA 3F4LA 3VJMA 1KAOA 2RGWA 2DETA 3GU3A 1GUAA 1SIBE 1LK5A 1VGVA 2VNAA 4Z1OA 5JECA 1JYFA 4URXR 3T54A 2CC2A 5C80A 2RHWA 3IQIX 1U11A 1XTSA 4OK3A 4X91A 3T1TA 3G2KA 5EE9A 2ZT5A 4HAIA 3AB8A 2DH6A 1M0TA 1X1SA 1E66A 4PLYA 1PW7A 1GY8A 3KQNA 3G82C 2V55B 3ZU3A 1OGIA 3QG1A 4NFHA 1UXOA 1NVAA 3RK0A 2DECA 2I6SA 4ENRA 4M60A 5F1KA 1DRJA 3W79A 1U3FA 1SUAA 4KSYA 5JXIA 4BJ5A 2ACKA 2QRNA 1TZCA 4IIVA 4K05A 1IMJA 4UTRA 1BJRE 1ZNQO 4CI0B 3C3MA 3DVSX 4X7PA 4CL3A 3D8BA 2QX6A 1R50A 4A8JA 3RSEC 5JWRA 3ROGA 2IITA 3IVCA 1N4AA 3ZQUA 5A9SB 2NUPB 4X85A 1IUPA 4LJSA 2XR1A 1MABA 2BBSA 2IAAA 1P4RA 3VU9A 3TIVA 3TPCA 5IPFA 2VHTA 1P7VA 2H8GA 1ECGA 4M7WA 3LUJA 4XW2A 1SPXA 3VDMA 1R15A 1G98A 3HCRA 3TSYA 1BHQ1 1P77A 3NONA 3N8DA 4L9OA 1P1FA 4EF5A 1EFLA 2GB4A 2D3TA 3L0BA 5E3IA 4M98A 4NU8X 2I22A 3SC4A 3EARA 3OTHA 1GCOA 3AVVA 3TMYA 2H63A 5FWAA 2VXBA 1XALA 4LXTA 3G0OA 2G1PA 3DDCA 3D31A 3HXQA 4Q47A 1UC8A 4MUGA 1T6BY 2QX9A 3L5KA 3ESXA 2Q2VA 1C7JA 5IAEA 2YMQA 1X2EA 2DPXA 3ZWOA 3LZDA 3MJRA 1WXXA 4UJ5A 4DNQA 7YASA 2TMDA 5AXCA 4D8TA 4ZYYA 2JJ8A 4IM7A 1LDBA 1ZVMA 4NBNA 2EZ4A 4X24A 2QLNA 4TWBA 3KXKA 4XJTA 1E7MA 4J03A 1C4OA 1TF7A 3FLBA 3ROFA 3BQMB 3DQPA 5GMOA 1GZ4A 1YZTA 5A71A 4N5IX 5KWVA 1PBTA 3TLKA 1UDCA 5TQ2A 4U2DA 5T41A 4EVIA 4ALIA 1QFMA 4GO1A 2X1HA 4E31A 3KSMA 4B2LA 1AO0A 1Z3IX 4Z53A 2O19A 1W5TA 5IFLA 1DWQA 2H0QA 2F1JA 3JVIA 1B0UA 5BNWA 4O5OA 4URZR 1NU8A 3RYCA 4NNOA 4CETA 1MAWA 2OK7A 3E05A 3KKEA 2FUG1 2J7PD 4XUEA 4AS3A 1KKUA 3VSCA 1RI1A 4CY3A 3E7FA 1UKCA 4S1OA 2PLNA 4MV6A 3RUCA 3H6HA 1W5AA 3LIIA 5JO0A 3TZLA 3T5GA 4FWBA 2JAHA 3R1IA 2X7XA 1AUXA 1QVWA 3UAYA 2HREA 5FHQA 3Q8MA 1KAEA 3D7SA 1G55A 5EJAA 4MUMA 4FU0A 3ZI7A 4PNEA 4IHJA 4FX5A 1AHHA 2GHQA 5B1SA 1X3SA 3E7PA 3W15A 5IW8A 2ZG6A 4PYMA 5IULC 3H05A 2ZKIA 2C83A 4GX5A 4CM8B 1C3XA 3KKMA 1QAOA 3KG2A 1WSWA 3KZNA 3EZLA 4HRYA 1B9YA 1IAQA 3CKLA 3T4EA 4GICA 4GL4A 1OY1A 4MEJA 4BVFA 2JS7A 4GNKA 3DUFB 1P0IA 2B8WA 1QP4A 4BBAA 7ADHA 4IUDS 2EDAA 3DOEA 3A6KA 4KXQA 3O3OB 1LY1A 3M83A 3QXXA 1SVSA 4ZYWA 4D43A 4DC9A 2QXUA 4ZOCA 2QX4A 3AVUA 1QTNA 5AESA 5CPFA 2V65A 2VF4X 3CPSA 1K89A 4F2PA 1RJDA 3OPNA 4UJ3A 4RENA 2EP8A 4ID3A 1BH2A 3LUCA 1EDDA 1PHPA 4HX9A 2ZXFA 3KE8A 4NWIA 2V7VA 4KCGA 2GNAA 4EWLA 1QHYA 3N8NA 1Q7BA 1O8CA 1MC5A 2J87A 3MTGA 4GMKA 2IYQA 4L4RA 2ZRNA 5MF6A 2PVCA 3SPXA 1KORA 4IAOA 5DN9A 3DOJA 4WLVA 1W36B 3HDVA 2PV0A 2W2QA 5ALQA 1KFKB 2GNPA 3HNPA 4M9SA 3M1YA 4RVFA 2VHZA 3ZN2A 3HHEA 1TU3A 3O8QB 1ZM4A 2PWYA 4PYIA 1NVWQ 5I8WA 1TU0A 4XIGS 3O91A 2CDNA 5GZ3A 2YMPA 5DNDA 3C2QA 4QGSA 4KTTE 2B34A 4MUJA 4TUYA 3B82A 1ZPDA 4MO9A 2Q07A 521PA 4UBIA 2H85A 1OH6A 3JQRA 4Z3KA 2PD3A 5BN4A 1DFHA 3ELDA 4HNGA 1KMHA 2G99A 2VDKB 3H87A 4WH0A 3JALB 4CKXA 4DPMA 2PLFA 4R8VA 1CUWA 1QBGA 1VKOA 4IHAA 1HYQA 1OLOA 3VYVA 4DNFA 1MDAH 4V0OA 4UTOA 2I7CA 4KMSA 3F97A 1Z0ZA 4OA8A 4C3UA 1DJLA 1Z4IA 2W0SA 1BMDA 1SBZA 2IS6A 3IBYA 5H1YA 4IV8A 1GVNB 5T64A 3EBLA 5F9HA 4HAVA 1WXIA 3OZUA 3WAGA 1K7YA 3F74A 1F3LA 1D07A 2ZK7A 4I5GA 1NEXB 2I4OA 2B0CA 2GAOA 3VR5A 4EEKA 2CLEB 4LJ7A 2J55H 5TEEA 2QW1A 1TYAE 1O9GA 2W2TA 5KYTA 4JSVC 8ADHA 2JARA 3P2KA 1E9RA 3T3MA 2OO5A 3ABIA 3BFXA 1Z68A 5LZ7A 4G1MA 1TW2A 3A3NA 4ZI7B 4FVTA 1RJWA 4INZA 3C4JA 1K1EA 3Q0IA 4NPHA 4TX1A 4U7DA 4MS1B 1UT5A 5FNVF 1DMSA 2X23A 5E38A 2EP5A 1TQDA 4TXHA 3VNBA 4HJXA 5G0UA 3AYZB 3L82B 1E1CB 1T9GR 1KK0A 3U1VA 4M9UA 1RQGA 5H16A 4MA4A 4AZ3A 5AJZA 4PTYA 4GI7A 4A23A 3G6WA 4BO0A 4B32A 4J0KA 1VPDA 2COUA 4Y6OA 3GZJA 4KI7A 2P5TB 1HRKA 2O06A 1ETUA 3V1YA 4FGUA 1GL7A 1Y4UA 2ODPA 3M34A 1H2FA 3PFKA 3L7OA 3V97A 1KYWA 2VN8A 4P4TA 2HLDA 4P22A 2B5OA 4A03A 3ODTA 3CLUC 2BTQA 2E6KA 2AFHB 1VDZA 5A2QA 3ZS9A 4HVTA 4CIDA 3B6JA 4GPBA 4NBSA 5CA1A 3VA7A 1TRKA 2XOKD 4EG3A 4BB0A 4N3NA 1PFUA 3SIRA 3GJ7A 5BQXA 3FVTA 1IN7A 3R5FA 1QR2A 1YE3A 4HB0A 2P9GA 1CB0A 1ORTA 4L8WB 2UVPB 5LQUA 2SCUA 3UVKA 1OVGA 1PT7A 2AR0A 5F7OA 1SN7A 2O3JA 4PYRA 4D26A 4I50B 1Z34A 1NVXQ 1JVBA 4D44A 1HTTA 1VLVA 3SYTA 1ODIA 5DM70 1H4TA 2BGIA 3UMBA 5K09A 3SC3A 2J0SA 2SHKA 1PWHA 1MA0A 3S27A 3RYIB 2ZUWA 3K6SB 3HR4A 1M34E 4CKWA 2ZREA 3AJRA 4F2DA 1S2GA 3ECAA 2ODQA 1BHO1 4KV9A 2IWHA 4DCJA 4MR8B 5EJ9A 1FNDA 2LNDA 1AK1A 2ONZA 3LP8A 1KIMA 4FBGA 3BMXA 4M3NA 2ZWPA 1JE0A 1HZJA 3T7IA 2I87A 3FD8A 2NSLA 1L5MA 1OXUA 2IUUA 2FZGA 3WMXA 1MO5A 2VFAA 3T0IA 4MDHA 3GZ4A 1DBIA 1TQ8A 4BCCA 4LA4A 1NSFA 1C0KA 2Q0XA 3H5RA 4AI6A 1AV6A 1Q3KA 1EFUA 4RLFA 1P74A 5ISMA 4Q01A 3B2EA 3PIRA 5ESXA 4XCVA 1Y0BA 4IZOA 3T5CA 1QGYA 1NOJA 2AHOA 5DTRA 1VHLA 4G5FA 1ZC4A 4CKEA 2BH2A 1UC4B 5KJFA 3VR6H 3PUHA 3TVTA 3W5SA 1ZUNA 4MW4A 2GK6A 3JWGA 2NZYA 2YNMC 4L0DA 3N0WA 1YR6A 1ODTC 2I7VA 1G7SA 3CLVA 2I0SA 2BR4A 1YRQA 1KSFX 4QKQA 5CUQA 1L7NA 4N65A 4TV8F 4JC5A 4CFSA 4IBOA 1E2NA 4JC4A 5EHZA 1ORIA 4FDMA 2PNFA 3BGWA 3P0EA 1XU9A 1N6DA 1YVRA 9LDBA 1V4NA 2GPBA 4INAA 3R3HA 1D1SA 4DLVA 2YFQA 3FSGD 2ZIUB 4LWPA 4CT0A 2AN4A 2Y4OA 5F9FA 5FD8A 4OHMA 4JKYA 1BWPA 3NOVA 4KXWA 4WOCA 5AI8A 4WSOA 4M1KA 3I5YA 3ZDQA 3JQ9A 4HPWA 1UWVA 3R5SA 2Q5JA 5LP6F 1EA5A 4Z4GA 3OC6A 2VAVA 5SY4A 2FPOA 3MXOA 2P2DA 5HVNA 1IZZA 3ETEA 3IX7A 4U3JA 4BBZA 1JBKA 4TWAA 5LQAA 2QZZA 2ISCA 4DLNA 4G07A 4LQDA 3TOCA 4XM0A 2OOKA 2NZ8A 1QHFA 2X9NA 1P1CA 4YROA 3EA0A 2A57A 3EXEA 1PWYE 4W5RA 4Q1BA 5J2UA 3IAM6 1RC0A 2OK6A 2WYUA 5IM5A 1QU2A 3RC2A 3T9CA 5IASA 3LQRA 3P4UA 4GGPA 4RXUA 9LDTA 3GRAA 4HAWA 3KYJB 3MVEA 2PD4A 2C9CA 4FWIB 4QO7A 2PGNA 3A11A 1A7UA 3B7FA 4JASB 2N47A 2GEDA 4ZARA 1C1HA 1SG6A 4R5MA 2RCNA 2RHLA 4B3HA 3MTQA 3F2IA 4IJMA 1A12A 2B2XA 3DEIA 1MJGA 5DHRA 2DMRA 2PGIA 3IEKA 1ETHA 1N0IA 4FA5D 3NAMA 2QTFA 4WY5A 4V1CI 1FF9A 5HEKA 1D3AA 5F2OA 3AH8A 1XLUA 1M0EA 4MCJA 3ZDEA 1GPUA 1ZGZA 3OZFA 4ESGA 4FC6A 1GQOA 3OQVA 1BVYF 4LV8B 4G86A 4AF6A 4TVBA 3GRZA 1JMYA 4W5TA 1L4KA 3JQBC 5DM4A 2MOKA 2JBAB 4D8UA 3L8DA 3ROZA 2BT4A 2HLHA 4PLGA 2J57G 1E18A 4B40A 1PJLA 1NASA 4F97A 3BWMA 4J7AA 1ZJ4A 1KWGA 2DFKB 1M76A 4EDHA 1GO2A 2OFWA 3AZPA 2AXNA 4D3SA 4A6PA 1OBCA 4AURA 2NU8A 2AJDA 4FSHA 4BNIA 3R77A 2QPOA 4IG9A 1BSVA 3GG9A 3ZDBA 1TLTA 2WLTA 4I4TA 1SUDA 3FRXA 4QICA 2WZQA 2QTBA 1JHYA 4RPLA 4FE3A 1DO8A 1PQUA 2QDXA 2R86A 4OZUA 2AOXA 4PU0A 3KT6A 2R2AA 3G8YA 3GT7A 5L4LA 1DX9A 1OZAA 2X5JO 1YKGA 3TQHA 1JECA 4NQRA 4K9QA 3RRXA 4QRJA 3T3PB 4MRPA 4YK7A 5J4YA 4UDXX 5AM5A 1HT3A 1B42A 4UFNA 1HG1A 4N03A 3CSDA 4BO2A 2ZUBA 3VR4A 3WE7A 3V1MA 1Y98A 1H8HA 1G6OA 2Y71A 2II6A 4GKVA 1P4AA 3LCCA 4W9NA 4RFLA 3HGMA 4N39A 3UJBA 3PQDA 1CDDA 4FOOA 2VKQA 1JEDA 2HK8A 4CXMA 3H2KA 2BMWA 5K7SA 4KBYA 1F5NA 1X7YB 2H3XA 3DXFA 1Z2OX 3RTAA 4PZ9A 1A9XB 2HGZA 3FFWA 3ZHZA 3NNNA 1E4OA 2CNLA 2PLAA 2B21A 1IJFA 1W2GA 5G4LA 2BGMA 3R3YA 3FVWA 1GU1A 3AFNA 2G4CA 4RIEA 5KNCA 4MLZA 5DHSA 3GJ0A 3TLGB 2X2PA 3JYHA 1E3TA 2ORVA 1D5CA 2MINB 5FXMA 3DWFA 1AC5A 2V7QD 4BTLA 2QE6A 1YIDA 1KNQA 1AM4D 2GFQA 5ALOA 4EQZA 2ZSDA 4NLLA 5ELMA 1O9HA 5BO5A 3BWBA 5F4ZA 1BD3A 2DLDA 3DGFC 3WHIA 2X77A 121PA 1J90A 2QM3A 2Y1KA 1QHSA 4B7UA 2RGXA 2VYNA 4Q48A 1EYZA 3VSAA 1IJBA 4OI2A 2IS4A 1P75A 2AFIE 1RLIA 3OETA 2G8LA 4LHSA 4K0KB 3O47A 4OUDB 5KJEA 1ORRA 5C86A 3TRHA 3ID6C 1XRNA 2OQ2A 3OE1A 3PUWA 2J3MA 2Y99A 3V6LA 4RH3A 3T7CA 2AOUB 4QSMA 3ICOA 3D6MA 1QCZA 2O8CB 1QTRA 2WB4A 2EZUA 1EVJA 2YRXA 4EI2A 4TVOA 2WAYA 3QNUA 1MN6A 2KI5A 1U0LA 1QORA 4QNMA 1Y4AE 5BN1A 4O4LF 2C5FA 5IWCA 2VF7A 3OKTA 1Y9JA 2ZJ6A 4BJ1A 1ESMA 5BXYA 3L79A 3I04M 3WB9A 4BGEA 2XRFA 2BM8A 1RJ9B 1J0BA 5AIAA 4Q1CA 2QJRA 3QE9Y 1RQ2A 3L4KA 4B6JA 1GILA 4HDNA 3GPLA 2FSIA 5CA0A 4ZO6A 3N2GA 2VP6A 3DVAA 3PE6A 2H4XA 1M1YE 2QM8A 3K7EA 2HWXA 1H5QA 3NPMA 2VDMA 3EAQA 2Z4RA 4X8OA 3EQ6A 1MG2A 4GP6A 1U9IA 5F2KA 5EHQA 3MYRA 4PSWB 1EPUA 5MHTA 1JTVA 4UNIA 5IT9g 5E3HA 3UJCA 4NBKA 1ADYA 1IWPB 1C3JA 4X95A 3BMOA 5B6JA 1HDCA 3DSMA 1PUIA 3KUXA 2VJLA 1MO6A 4Q3LA 4ZA2A 1QHIA 2LDBA 1OC4A 3NW9A 3OZWA 1BX1A 4A0RA 1SUCA 4OHXA 5EE5B 1KJ9A 3BTOA 3DONA 4UBOA 2DPHA 2BF4A 5A5DA 4PV7A 3NJRA 1DC8A 3C41J 1PV2A 4WLOA 4AC9A 5KJCA 2H1HA 5A05A 3SYKA 1KMCA 4UXJA 2XODA 1F6WA 5CIWA 1FOEB 2O4CA 1KVRA 4HCJA 4R98A 3ZZNA 4JIGA 4U00A 4ZPJA 5B55A 1EGMB 2G80A 1W88A 2QEQA 4ZMSA 1P2DA 1RJFA 2BKLA 4Z2AA 2GM3A 3GY0A 3ENQA 1YU6A 4B80A 4NF2A 1M5TA 2Q62A 4GLBA 1ESDA 3C7KA 5HKAA 2PVSA 1YDGA 3QH4A 3VO1A 1NG1A 5JCZA 2FMIA 2HSGA 4V0KA 2FUG6 2R48A 4MKIA 3S2YA 1MDBA 1V8PA 1Z56C 4OPMA 3U9TA 3SZGA 4XCXA 2YTZA 2VDLA 4KN6A 2YXBA 3CB4A 3SNHA 4C30A 3KFVA 4Y9TA 2WOJA 2CFOA 2FWJA 5EPEA 1G41A 3ZE1A 3SCZA 4CQMA 3U7QA 4JLUA 1C9JA 2H2AA 4H7KA 4YBZA 4K6HA 5JDCA 3G0CA 3RLMD 4M8KA 2CDBA 3AHHA 3LKVA 2ZI4A 2WLSA 4MPTA 3ND9A 1NBHA 5IKOA 4NU6A 1O6FA 2N42A 2YRFA 1OZHA 3RFCA 2EOAA 4O3FA 1VPWA 3MQ2A 4DNPA 1HDGO 3EFOA 4HH3C 4BYMA 2IU0A 5HMLA 2YDXA 4L0CA 1Z22A 4Y67A 1DAMA 3F5MA 4F21A 4GWKA 1PGNA 3GMIA 2BE7A 4YDHB 4QOIA 4BE9A 1JDSA 5U4XA 1HPLA 5KJ1A 3HR7A 2GAFA 2GJ4A 1X7HA 1OOEA 4M8IA 4BC1A 2H2HA 1FDRA 1XP8A 2WUWE 1GPH1 2C5HA 3MUOA 1KZ4A 1BQ3A 3FVQA 2JEOA 3U4DA 4N6GA 3EXIA 1L7RA 1X9IA 1ULUA 4X00A 4R7TA 3V4VA 2ZEJA 4AFNA 3SF8A 2RKOA 3NGMA 1GV1A 1HOTA 4EL0A 5BYAA 3AUJB 4RF4A 3WYBA 1U63A 1HE3A 2P9JA 2P9IC 1MB2A 1XL1A 3T7SA 3HL4A 4PS0A 2XCIA 3R3SA 5JR3A 4JLWA 2HK6A 1MX1A 3O2SB 5JYCA 1SUFA 3QXGA 2HCJB 2XBLA 1O9BA 1A4RA 2DP4E 4MDFA 2AFIA 1JQDA 2JGDA 4DJ5X 4FX2A 2FNAA 2WWFA 5CH3A 3EZFA 2ORIA 1WOYA 1FLVA 3T9DA 1TM3E 1OT3A 3WRYA 1KJQA 3GJ8A 4IILA 4JT4A 3VDNB 3HKBA 4JOBA 3EVFA 5SZIA 2QL7A 1DIBA 1HLPA 4DDKA 3Q72A 2ZRKA 1PG5A 2LP4Y 3OSZA 4RY2A 1B0ZA 4MGIR 2QORA 4J4TA 5CFRA 2Q6VA 1NG9A 3KFLA 2ID9A 1KU6A 1L4HA 4CLXA 3PFCA 3A32A 3LQKA 4HFMA 5EESA 1W94A 2ETVA 3EGXA 1CUYA 3AFMA 5C34B 3V8BA 2DFNA 2ZUVA 2R6JA 1WO8A 3E15A 3MCWA 5ER9A 2FWIA 3KSZO 1PYOA 1Y3HA 2OC9A 2Q4DA 1GEEA 4RZ3A 4GOOD 1HFEL 3P5SA 2G25A 4ZDJA 1M1YA 1XQWA 4QPDA 1H42A 4DCGA 4AMUA 2OBFA 1UXHA 4LRYA 1E1RD 3AKDA 5FPKA 1I4DD 4RVHA 5AVYA 4JGGA 2IX3A 2Q4RA 3R0VA 3PGMA 4QC2A 3AY6A 1RXEA 1HDXA 4EB0A 3IPLA 1RM5A 1GIAA 4HDSB 3VNAA 2FF5A 2W4MA 2G5GX 3EISA 5IVHA 1JLRA 1A04A 1EGVB 4OU5A 1FRNA 4GM4A 5CB4F 1ZAYA 4V02A 3ZU6A 5E7MA 5I4IA 2WT4A 2Y77A 3O95A 1O1YA 1S2OA 2BFCA 1Q22A 4ZCPA 1Z26A 2AH1A 4J0HA 4JMLA 1SKQA 1RYFA 3BSSA 2CL6X 3DLHA 1EAMA 8MHTA 4LJ9A 3ZU2A 4BNZA 3QVWA 4IXDA 1GOTB 2LE0A 1B4DA 3LBAA 1JWBB 1AZWA 4RM3A 4OIMA 4NBVA 4LRTB 2JANA 5BR7A 4AUEA 2YUTA 5M04A 4FC7A 4H3SA 3LNTA 5TGTA 16PKA 4HYYA 4RZ2A 3OPYB 1JSRA 2ZB8A 3RQIA 1J1IA 2E82A 2NT3A 5ITZA 1GNRA 1W4RA 5IWAB 3HB5X 2C9MA 1JHRA 4TKMA 3VJKA 1PV1A 5EJ4A 3BXPA 4GQ1A 2NG1A 3T61A 1RYMA 2GEBA 5IBQA 1X15A 4X8HA 2CE2X 2QE7A 4JLDA 1DRKA 4GQBB 3DLTA 2VF2A 1RWKA 4YJHB 3U4QA 1DHTA 4TSFA 2QTVA 3QIVA 4PFQA 3ORRA 4UZFA 4QGHA 4A0HA 2VSNA 4YREA 4FSDA 3A2KA 3WV5A 4Q1DA 4D8WA 2NXCA 1ZJZA 3NU1A 5K3SA 1F2UA 5J43A 3NXKA 4NYMR 4PW0A 1JJVA 2R7LA 3IUYA 2CW5A 2IH5A 2VTVA 2L42A 1BGVA 3I6IA 4WJLA 5AFSA 5HUJA 3FNRA 3PENA 1DTWB 3OOYA 4LHZA 3VZQA 4KE8A 1YCD