3IUQA

Appep_d622n+pp closed state
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
682
structure length
667
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETTPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
molecule keywords Prolyl Endopeptidase
total genus 214
structure length 667
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iuqA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iuqA01
4ARBA 1UOQA 5I8PA 1CV2A 1MJ5A 2ZJ6A 5AOCA 5AK4A 1X2EA 2BFNA 2WUEA 4J03A 3WWPA 1A8UA 5KBYA 1XRNA 5CRIA 3V1NA 1XZMA 1TK3A 3B12A 1XQVA 4QWMA 3V9AA 1Y37A 2I3ZA 3FSGA 3LS2A 2WJ6A 3ESBA 3O4HA 2W22A 4WFJA 3LLCA 5CH8A 1QJ4A 1XRMA 3WJ2A 4Q1VA 2C0PA 3WK5A 1MAAA 5AI4A 1H23A 3I28A 4F21A 3I2HA 1BU8A 3B5EA 4ETWA 1AGYA 4AX4A 1THTA 2ZVDA 2VA9A 1EDBA 5AP9A 2OGTA 3C8HA 2ZYRA 3GFFA 1CEXA 3QZUA 3STTA 4JEIA 3D2CA 4OB8A 1DINA 1LLFA 1FSSA 2CUTA 5AKKA 2JGKA 5CH5A 1E3QA 4MYDA 4BB0A 2ONCA 3LP5A 2XUFA 3WKBA 3PFCA 1SCQA 3GROA 3RKSA 3WL7A 2G5TA 2CKMA 3D2AA 1QZ3A 4PSCA 4BC0A 1WB5A 2HA7A 3ZLUA 1EA5A 1A88A 4WCVA 2WIKA 4DYHA 5JD5A 4H0CA 5DNUA 4Y9SA 1P0MA 3RK4A 2CJPA 4QDOA 1QFSA 3QYJA 3DL4A 2I03A 5EHNA 3W2TA 2PSDA 5EI5A 1E8DA 2H7YA 3BWXA 3SX4A 4CIAA 5E4TA 5SYNA 5AKHA 3FNBA 1GPKA 4B85A 2Y6UA 3O4JA 4AO6A 4B7ZA 5JAPA 2ORYA 2QXTA 5AKEA 3DDUA 3HABA 4X92A 4Y2JA 4A23A 3O9VA 4X6YA 3D7RA 4AO7A 4E14A 4GW3A 2EDCA 2Y2UA 2PU5A 4J0KA 3X3HA 2PSEA 1P0IA 3PDCA 3H2GA 3A6ZA 3QM1A 4I19A 3IDAA 4H7HA 4N8DA 4BE9A 2XMBA 4U2FA 2XMCA 4Y2XA 1CUVA 4G8BA 2XMRA 3FCYA 4LXGA 5CT4A 1E89A 2XUHA 1ZJ5A 3G8YA 4P93A 5T4FA 5FV4A 3IB3A 2R8BA 5AKZA 3R41A 5CT9A 1CUBA 4UBJA 1J1IA 3EF3A 5J3JA 2WKWA 1CUAA 1DTEA 3DLTA 5JALA 1USWA 4MWTA 3D0KA 2YASA 1S8OA 1A8QA 5LZ4A 1NU6A 5DTJA 2WHQA 3FBWA 3WLAA 4EZIA 4FLMA 4S0XA 3OURA 1AC5A 2V96A 4Y2YA 1VXRA 4AZ3A 3WWEA 3HSSA 5LYYA 4FKBA 2JGLA 1QIJA 2UZ0A 5A62A 2BJHA 4K2AA 4GBGA 2E3JA 5SYMA 3C87A 4QDUA 4PQEA 4J0IA 4RPCA 3C6YA 3HZOA 4W63A 1QO9A 1CUWA 1UT6A 5FRDA 5CTAA 3I2GA 5AK6A 5T4HA 4NMWA 1MNAA 3ICWA 4WFKA 3W05A 3BDIA 2O2IA 1XZEA 1TCAA 3V48A 4BAUA 3WI7A 2I78A 4AN1A 3FLAA 1UK9A 2VJCA 2Z3WA 1U4NA 4E11A 1OXMA 3JWEA 4WDRA 4C89A 3B3QA 3MUNA 1YAJA 2WHRA 3R0VA 5ALGA 4F0JA 3AJAA 1W1IA 3I1IA 5DTIA 4KAFA 5CXXA 2WFZA 3HACA 5A7FA 3O9MA 5ALHA 4H7EA 1THGA 3IUNA 4HXGA 5JZBA 3V1KA 5ALYA 1A7UA 1EI9A 1CFJA 2XT0A 1IMJA 2HA4A 3CCCA 1GPLA 5EIAA 5JYCA 2WUGA 5CH3A 2Z3ZA 2VT7A 4Y2TA 1PJAA 2XUPA 1GKKA 5ALLA 5AKGA 7YASA 4PF1A 4X00A 5AH0A 4RE5A 2XDWA 1N5MA 4MXDA 3STVA 1LPBB 4XVCA 4BAZA 2QJRA 1WHSA 1E8NA 2Z5GA 1L7AA 1W6RA 3FSGD 4INZA 1LBSA 1AMNA 4BP8A 1WHTA 2OAEA 4DMFA 4X93A 4ZGBA 1R1DA 1LBTA 3HEAA 1H2WA 5AM4A 6YASA 1WM1A 5AKYA 4JNCA 3F9CA 5AI6A 1XZKA 1BN6A 1F8UA 1ZI9A 5AJHA 3CN7A 2JGMA 4H77A 4X97A 2WG0A 1QFMA 1ZJ4A 2XI4A 4B9AA 3VISA 2QT9A 3FYUB 3I6YA 4FBLA 2PUHA 1DX4A 5C81A 4JYMA 1KU6A 1RP1A 3W9UA 4H7IA 1JFRA 4M0EA 2HU7A 1UXOA 2DQZA 1ZIXA 2JIDA 1G42A 4U2DA 3R3XA 5ALKA 4CG1A 1ODTC 1AUOA 4H7FA 3FVRA 3LIPA 3PE6A 4Q3LA 5ALXA 1IUNA 2XUIA 3NUZA 1DWOA 4DMHA 2GYUA 5I9IA 1AKNA 4D9JA 4WFIA 1CUUA 2RAUA 3KWJA 1U2EA 2GZSA 4RNCA 4XIIA 4DM7A 2G4LA 4WY8A 1BEEA 1L7QA 1CUCA 2AJCA 3I1YA 2GBFA 2OLEA 4OYLA 4QA9A 5ALDA 2WG2A 4KE6A 5HFNA 4AQDA 5JADA 3R40A 5JD4A 5A6VA 3G0DA 2ZSIA 5HKAA 2H7CA 1D07A 3DD5A 1JJIA 2B4KA 5KWIA 2WUDA 1OCEA 2JF0A 5DJ5A 2OCIA 2B61A 1CUJA 4DTCA 4FMPA 5AOBA 1JKMA 4GWLA 2XUJA 2QVBA 4U2EA 4DNPA 4C01A 5HZGA 3WL6A 1JJFA 4J7AA 4DMCA 4P08A 2RGUA 2BAGA 1E66A 4G5XA 5AM1A 1LNSA 4WJLA 2OCKA 4FNGA 3FLEA 4HRYA 1EINA 3BIXA 5K3EA 3ICVA 3OPMA 4FDMA 1EDEA 2OGSA 2WIFA 1QE3A 4ITVA 2XMDA 2QZPA 1LPOA 2QJWA 1TQHA 3OG9A 2DHEA 4NZZA 4UBOA 4UBMA 2NW6A 1VE6A 2PU7A 3G9XA 4Y2SA 4B83A 1K8QA 1YSCA 2PSHA 3I6MA 4G9EA 4DNQA 1L7RA 2XE4A 1CUSA 5C8VA 2VJAA 4X90A 3C6ZA 1DQZA 1CUGA 1XLVA 1XROA 5FPPA 1FFDA 4C4ZA 2JGIA 1JT2A 4TPKA 5D6OA 2WIGA 1K6EA 2GBIA 3WA6A 5AIAA 3ZI7A 1PV1A 3D3NA 1DT3A 5K3BA 3RM3A 4FNMA 1YA8A 5K3DA 4FTWA 3FOBA 5HF8A 4V2IA 1N5RA 4W9RA 1R9MA 2AJBA 3V1LA 4BVKA 3BF7A 5A7GA 3WK4A 4BCCA 2OAGA 4ZV9A 1R3DA 1FJ2A 1MN6A 2HDWA 3WA7A 1CIJA 2J3DA 4Y2UA 3ZLVA 2HL6A 3VXKA 5BWBA 3IIIA 5DYYA 3K9BA 3BL8A 4G4JA 4EY5A 4DSZA 4IQ4A 1MO2A 2EDAA 5CT5A 4C6HA 4QZVA 1Y7HA 2HA3A 5ALVA 5IH7A 2C0QA 4CI9A 2RI6A 1DT5A 5CMLA 2H7XA 3I6ZA 4L72A 3A2NA 2XQIA 4Z49A 2V9ZA 2OG1A 5LKAA 3GZJA 5LZ2A 4UFPA 4G8DA 3QMVA 1LGYA 1JU3A 5BV7A 2WHPA 3ANTA 4RE6A 1QIHA 4UUQA 5K3CA 4J0GA 5LZ8A 5AI5A 4BC1A 5EHQA 5K5EA 4LXIA 1BCRA 5AK3A 3WJ1A 3ZLTA 1TCCA 4UHDA 1RWQA 1XZGA 4B81A 3SWWA 4QWWA 3GELA 3WKCA 2BUBA 4DNOA 3ILSA 4NS4A 2WILA 3H17A 2BKLA 4HTAA 5IVKA 1HQDA 5AM3A 1QIEA 3PI6A 3DS8A 3DJYA 3DKRA 1UOOA 4X6UA 3O0DA 4MWSA 2J4FA 3STUA 4C4XA 1XRQA 5HF5A 4OD0A 2CB9A 4B0OA 2CZQA 3AIOA 4KEAA 2VAXA 4GHWA 3FCXA 5ISMA 2YXPX 4OU5A 3NGMA 5DNWA 2XUDA 3HC7A 1R4ZA 4OSEA 2I3DA 3H18A 3S8YA 1I6WA 5HK8A 1NU8A 3HJUA 1WPXA 2XMGA 2AXEA 3U1TA 4Q34A 4JUIA 1H2YA 4Q3KA 2WIJA 4H7DA 1CLEA 1CUZA 5H3HA 2WTNA 1EXWA 1BROA 1EHYA 1LPMA 4H7JA 2ZYSA 1XRLA 4X94A 2CBGA 2OQVA 4PV7A 4HVTA 1W75A 2PPLA 3QH4A 3E3AA 4QEKA 5DWDA 5EIHA 1UWCA 1EVQA 4LYDA 5E2IA 1P0QA 1SOMA 3ZWQA 1UZAA 3C5VA 3VJKA 1QIMA 5ALOA 2PVSA 3S2ZA 4I3FA 5IVHA 1N8SA 3A2LA 4WY5A 1G5FA 4W1PA 4Y2RA 5LLSA 4J0DA 2PBLA 5E4YA 4QLOA 1QTIA 4C88A 5K3FB 1F0NA 2VT6A 5CBKA 5AM2A 2J3QA 3VDXA 2D0DA 2HM7A 1H2XA 4UBKA 1X2BA 3OM8A 1FFEA 3AZOA 3W06A 5JZ9A 4IH9A 1BE0A 3QPAA 4FFVA 2LIPA 2XMSA 2XQFA 2XUKA 3NOXA 4G1FA 4UFNA 4M0MA 3D59A 2QRUA 4X85A 1SCKA 1C7IA 1JMYA 4N8SA 4BZZA 3U0VA 2ECFA 4W1RA 1CUXA 1MT3A 4BYMA 4GI1A 2DHCA 3UMJA 5IKXA 3FYTA 1LZLA 3ED1A 1CUIA 1BEZA 5CT8A 4BATA 4G4IA 5K3FA 4J3JA 2Y2VA 3H2HA 2CMFA 3QMWA 2WFLB 3H2KA 4F5ZA 2YH2A 2O2HA 3A70A 4X3CA 2BGNA 2C5GA 3L1JA 1QLWA 4Q05A 1FFCA 1K63A 2V98A 2HU8A 1EDDA 5AHXA 4IHAA 2BCEA 3WWCA 5JD6A 2C58A 3SK0A 3L1IA 3QPCA 2HA5A 3WWDA 3NWOA 5HK9A 5AKLA 1ODSA 3O4IA 3M83A 2DFPA 4Y2VA 4U2BA 1YCDA 2HHAA 1XZAA 3YASA 4AZ0A 1UOPA 4HXEB 1VXOA 2QUAA 4ZV7A 1Q0RA 2XQJA 1X70A 4W1SA 1TIBA 2ZJ7A 4F60A 1HKHA 3E0XA 1BRTA 3R3WA 4BE4A 1YB7A 2ACEA 3K2IA 4HXFB 4KE7A 1AX9A 2JGJA 3WIBA 2OCLA 3W9BA 1XZFA 3DEAA 3G9ZA 4ZWNA 3IURA 3PUIA 3V1MA 4UFOA 3ESDA 3HI4A 2XLCA 1CR6A 2C5FA 3D4LA 5DYTA 5HQ3A 2WFLA 3F67A 5AM5A 2B9VA 1O6GA 3PICA 4B9EA 4EUSA 3R3VA 4OB6A 3D5EA 1ZD2P 3R3UA 4QLAA 3E1GA 5JATA 2HADA 4BTVA 5AKIA 2HA6A 4PSUA 3VJLA 3KWFA 1VA5A 3I2KA 1QIIA 4JH0A 3H04A 4ARAA 3CCBA 5I7UA 3P2MA 3G9TA 3M3DA 4EBBA 2ZYIA 5ALJA 4M0FA 4EY4A 4MJ3A 5JARA 2C4HA 2OXEA 1EB9A 1QOZA 3OC0A 3WZMA 4DIUA 3IA2A 1ZICA 1MTZA 5HCUA 3L1HA 2VJBA 4AXBA 3MVEA 4C87A 1P0PA 1B6GA 1TRHA 1ODCA 1OILA 1K5PA 4H35A 2WU4A 3PF9A 4HRXA 1B41A 1AQLA 4CCYB 4KRXA 4LXHA 4QNNA 3QITA 2OPHA 3K6KA 4BDSA 3GBSA 5ALIA 3G0GA 3TGLA 2GYWA 1CUFA 5ALSA 5JIBA 1FFBA 4QDZA 5C7YA 3G7NA 2BUAA 5E4JA 4EY7A 1ZIYA 2XQGA 3STWA 2OGZA 4AMZA 5CT6A 2VATA 5ALUA 2PL5A 5AO9A 2H9YA 2ACKA 3G0BA 2HFKA 3Q0TA 3FLBA 1H22A 5CXUA 3EBLA 3H19A 3IUMA 1XQWA 1LPSA 3SC2A 1WCYA 1E8MA 2Q0XA 3AFIA 2G5PA 1CVLA 1LPAB 2X8BA 4ROTA 4KAAA 2J4CA 1XZJA 5AIBA 3LCRA 1YR2A 5A7HA 3VVLA 1T4MA 2AJDA 4DLNA 2VEOA 3FWHA 2JEZA 1AZWA 1DWPA 1QIGA 5ALRA 1J07A 1QONA 1N1MA 3D2BA 1LPPA 2QUBA 3DQZA 1XRPA 4CCYA 4UHBA 3C6XA 4HS9A 1ISPA 2HA2A 3DCNA 5AK5A 2DCMA 4BRZA 4QDXA 3I2JA 1MAHA 5JAOA 2ROQA 1GT6A 3ZPXA 3FYUA 4TGLA 1HL7A 3CN9A 1WPRA 2VSQA 1UK8A 1CUYA 1G4HA 3HYSA 1JJBA 3M81A 2GBCA 3BIWA 2PSFA 3H0CA 1G66A 1ZI6A 1W4LA 4EY6A 4A5SA 1QIFA 1XFDA 3FAKA 2FUKA 3WKEA 2XUQA 3H2IA 1DQYA 1KU0A 2PUJA 1YASA 4B6GA 4YX9A 1J06A 5HF9A 2AJ8A 4AMYA 5JZSA 1ETHA 4K6HA 3WK9A 3O95A 3UUEA 1ZGCA 5A2GA 5HFAA 4BBZA 5FXMA 2O7RA 1UK6A 1DU4A 1U65A 2VQ6A 1DX6A 2WIDA 5T4BA 4EHBA 1YA4A 1F0PA 1NX9A 4IO0A 1Q83A 2JGEA 4YASA 3MGAA 2DSNA 4BTLA 4MEAA 5EFZA 3EIOA 5AKXA 3WK6A 4KE9A 1EX9A 4X91A 3WYNA 3IULA 2OCGA 4N5HX 1J2EA 4BCBA 3AILA 5ESRA 3AZPA 5ALMA 3O4GA 4L0CA 1XZLA 4MYSA 5F4ZA 1UK7A 4MQMA 3HXKA 1CPYA 1Z68A 2EEPA 5AKJA 1BS9A 4FOLA 2IIVA 3RLIA 4LHEA 3G0IA 4G4GA 1HBJA 2QS9A 5ALPA 3STXA 5D3KA 1MX5A 2PX6A 4K6KA 4N5IX 4CIBA 2DR0A 1RYYA 4X7BA 1U8EA 3IUJA 1A8SA 2WHPB 2WG1A 1VLQA 4OU4A 2RONA 3I2IA 1XZBA 3I2FA 5IVIA 1QTRA 3GUUA 5AI8A 2P8SA 3DNMA 1QO7A 3G0CA 4Y2PA 2QM0A 4XX1A 3M82A 2QMQA 4YK7A 1XZHA 4U2GA 1H2ZA 4DGQA 4ZREA 1CUDA 3QVMA 2B20A 1XKTA 2HA0A 3WKDA 4KR0A 1C4XA 5LZ5A 2WQZA 3C43A 4U2CA 1EK2A 2XUAA 3T52A 3EQ7A 3OOSA 3F96A 2V97A 2HIHA 2Z8XA 3PFBA 3TJMA 1MNQA 3F98A 2PKYX 3KOOA 2C7BA 4C4YA 1VKHA 4GLBA 3N0TA 2X76A 1HDEA 2D5LA 2R11A 1GPNA 5EIEA 3WWOA 4N8EA 1MU0A 2G63A 2WTMA 3UUFA 5HKBA 3VJMA 4UBNA 1K4YA 3IBTA 2O2GA 1GKLA 1WB6A 4UBIA 4TVKA 1FFAA 1UKAA 4EY8A 4J0JA 1VA4A 4AB1A 2DQYA 1ZOIA 1KEZA 4IH1A 4FFWA 3JYHA 1CUEA 3VVMA 1MX9A 3GA7A 2VJDA 3HRHA 3OTQA 2DHDA 2W6CX 4J0CA 4EA6A 3STYA 4PSDA 4HAIA 1ZD4A 4DSAA 5D7BA 4GXNA 4OUKX 1ZGBA 4B0PA 3C5WP 5LP1A 4DNFA 4JYPA 2VTVA 2VF2A 4Q3OA 1Y7IA 2WU3A 3WL5A 2WM2A 1F6WA 4Y2QA 1CQZA 4O08A 1ACJA 2QXUA 1QIDA 3C70A 1IUOA 4BVLA 3QMMA 5FKJA 1VZ2A 4BZWA 5FP0A 1MX1A 4LYEA 1E5TA 4FHZA 2XUOA 4L9AA 1IVYA 3DYIA 2WSLA 2RIPA 1TKRA 3BJRA 4ZXFA 3WK7A 4L3WA 2K2QB 4G9GA 3F8SA 4GECA 1PFQA 4Y7DA 2Y6VA 2HRQA 4OB7A 2XMQA 1EVEA 1HPLA 1TAHA 1XZDA 2ES4A 3G9UA 2IITA 1Q84A 1EK1A 1CRLA 5LIPA 1XZIA 3DYVA 2PM8A 2VAVA 3BJMA 3N2ZB 3JW8A 2XQKA 5YASA 1XLUA 1XRRA 3R3YA 1LPNA 3AZQA 4KRYA 3MUOA 1EB8A 4W1QA 1XKLA 4FWBA 2QTBA 3FVTA 4K5QA 1AURA 3VKFA 3LIIA 1TCBA 3ESAA 5DYWA 5K3AA 1HLGA 4CCWA 4CFSA 3QBJA 5AI0A 1M33A 3FYUC 3BF8A 5AI9A 3BE8A 2QR5A 3RARA 4XJVA 1XLWA 2HRRA 3BDVA 1DWQA 4E46A 1IZ7A 3KSRA 3T4UA 3AINA 3DKKA 4KE8A 4K6GA 2OQIA 2GYVA 4UHCA 4EB0A 2XB6A 4UBLA 3WKAA 1ORWA 1SFRA 5FLKA 2HU5A 1QGED 4IH4A 4MEBA 1W52X 4X71A 1ZI8A 4DMKA 4RGYA 2RHWA 5A71A 5HF6A 2QKYA 4CG2A 4P92A 5BWCA 2Z8ZA 1EH5A 4KAJA 4ZI5A 3TRDA 3DOHA 1BCSA 1ZD5A 2ZJFA 3EQ8A 2XUGA 5ALWA 4B84A 4P9NA 2XMZA 2CEKA 1IZ8A 3ESCA 3WIOA 3WYDA 3AIMA 5FDFA 4LIPD 4WDQA 1R88A 5EHXA 4FLEA 5KREA 4PNZA 2YYSA 2X5XA 1CQWA 3E4DA 2BGRA 4UHFA 5T4EA 1GZ7A 5HQ3B 2XLBA 3BXPA 5AICA 1YB6A 4CG3A 3F97A 3H1AA 4A16A 3EQ9A 2AJLI 1XQXA 5DNVA 3C8DA 4NVRA 2Y1KA 3WL8A 1GQRA 2JEYA 5C8ZA 1C7JA 2IX9A 4BCDA 4X6XA 2H1IA 5C8XA 1BN7A 3IUQA 3PUHA 2WUFA 2WFMA 3DOIA 4B82A 3PF8A 1WOMA 1UKBA 3WZLA 1VZ3A 3HLKA 5ALTA 4E15A 5ALQA 3KXPA 4XWGA 5FPQA 4BRSA 5D3ZA 5FUMA 5JASA 5FOQA 2FJ0A 1ACLA 2WLSA 4OCZA 2PSJA 1IUPA 1MPXA 1W76A 5CW2A 4MQLA 3TEJA 5EHZA 1XQYA 4X95A 1JMKC 1YS2X 2JBWA 5AOAA 4OPMA 3KDAA 3WK8A 4PO3X 5AM0A 4FLFA 4KACA 5JAHA 4AN0A 3A2MA 1YS1X 4OYYA 3CXUA 5JAUA 3QPDA 3W04A 1QIKA 1XZCA 3KD2A 1JU4A 3Q8WA 4ZRDA 4HZGA 1VOTA 1R9NA 3C45A 1GGVA 4GEGA 2BUCA 4BAGA 1ORVA 3G02A 4BP9A 4I4CA 2RHTA 1VJ5A 2GBGA 1T2NA 5LZ9A 5BOVA 4G8CA 1UFOA 2HFJA 3DL7A 5DLPA 5IVDA 1LZKA 1ZD3A 2FJPA 5EGNA 1Q0ZA 1GXSA 2WJ3A 1O6FA 4LKOA 2WJ4A 4Q82A 4BVJA 4GDMA 4UPDA 5ALNA 1YAHA 3WQHA 5LKRA 4QE3A 3ZV7A 4BDTA 1SCIA 1R50A 3AUKA 4J0HA 3ANSA 1VE7A 4UHHA 5ALZA 3C6BA 1SC9A 1UKCA 5LZ7A 2QOEA 4PW0A 3R3ZA 4KJXA 4KYVA 4H7KA 3WMRA 4B80A 2GZRA 4UHEA 5KWJA 3IVMA 2O7VA 5ALFA 3AIKA 2FX5A 4YPVA 2ZSHA 4FBMA 4AO8A 5JANA 2ZYHA 3H1BA 1GQSA 5CURA 5ALEA 1CUHA 4H18A 1JI3A 3H2JA 2JGFA 4QDTA 1WB4A
chains in the Genus database with same CATH superfamily
5JQGA 5I45A 2VJPA 4CR8A 4OL9A 4ZCTA 1NMZA 4ZAVA 3TSYA 2IEAA 4C08A 1U0HC 1XL1A 1M0SA 2ZJ6A 3ESYA 4PQGA 1EZ4A 1KMHB 1CQJA 1U7TA 2RI0A 3WB2A 4CYMA 1JLSA 1MVOA 3BRWA 4LVNA 3ZEIA 2JKZA 4UNRA 3GZNB 4ZO9A 3T7CA 4XGQA 1ZRMA 4L3OA 3KJZA 4DR6B 2IZZA 2QYOA 1O2DA 5KBYA 1JXQA 4D9CA 4Q12A 3V1NA 1PZFA 3OLWA 1XZMA 5JMOA 2FPMA 2BMFA 1TK3A 2VO1A 1FUIA 4FSXA 5EEHA 1NFQA 1WLSA 1XQVA 4CN8A 1MZPA 1RZVA 1Y37A 4WKOA 3I09A 5U4QA 3AEQB 1MW9X 3HCFA 2J5XA 2HJBA 2W0MA 3N7TA 4QSHA 3S2SA 4BUCA 1GIAA 3LS2A 4B2YA 1VL0A 3A7EA 3DFZA 4V03A 2JZCA 5FTJA 4CCWA 5LMZA 5LYJB 2WJ6A 4YECA 2H54A 2JNWA 4CMGA 5IMBA 4RV5A 5F52A 1NNLA 2FOLA 3R6GA 2W22A 3EW7A 4JC5A 1L5MA 3M4JA 2W4IA 3QUBA 1XKSA 3LLCA 4P22A 1HNXB 3KT3A 4PXSA 4PVCA 3JQPA 2WM9B 3BE4A 3OOHA 3TOZA 3UT0A 1GZ3A 4XYMA 2R00C 4D81A 3WJ2A 4KLNA 4QUAA 4KDEA 2C0PA 4Q1VA 1T8PA 3WK5A 4OLFA 5E8JA 1MAAA 1VTKA 3RFGA 4XJSA 3DWFA 2GD1O 4BVFA 3SE7A 3EEOA 1GQFA 3NCTA 1U2GA 1O89A 2VR1A 1BU8A 1XLTA 2VDMB 2ZTHA 2Z4TA 3PXBA 5A2QA 5ESXA 2QRMA 2RCYA 1BO6A 3NIDB 4PZCA 4LF6B 3UHAA 2MSCB 4IDNA 5GINE 1JIXA 3IDQA 4AX4A 1KQOA 3O8NA 1EUCB 3DZBA 3CNHA 3HB9A 1NNUA 1T9GS 2VUTA 2XA9A 2Z1MA 2ZVDA 1YQXA 4OI4A 1E62A 2A78A 4ZT7A 5IBQA 4AG5A 5CBPA 2VA9A 2GEFA 3FTQA 4N3BA 2ZIGA 3DE1X 1S7CA 1L8AA 1JKXA 1V45E 3LUFA 2OGTA 3PC6A 4RVFA 4F6CA 2HXYA 2XEXA 1JIVA 2G1PA 1N1GA 1O95A 2C2MA 3HWRA 1K7XB 4ED9A 4FEYA 7AT1A 3L1VA 5LB4A 1U7HA 3M4YA 1HLPA 1KJJA 4HUJA 4GI5A 4KI7A 4PQRA 5DM60 5CEFA 1ATZA 3WLKX 3ZE1B 2H9MA 1V16B 4OY3A 4F8EA 2A30A 4AP9A 2FOXA 3A4VA 4JEIA 3MTBA 1G8SA 3D2CA 1LLFA 2IELA 1AV6A 5M5TA 1PYGA 1FSSA 2QRPA 4KIJA 4LGCA 4LJ4A 3TDMA 1TO1E 4CM7A 2G1KA 5JMWA 3NONA 1HE4A 1VI5A 4TZ0A 2JGKA 3G5MA 2CT8A 1CS0A 1NTRA 1E3QA 1XDBA 2J33A 3NTRA 1Y1KE 2ZYAA 4CMEA 4AY6A 1PVOA 1H6BA 5DNDA 2P77A 4BEVA 4NS1A 5H3CA 1L6IA 2CWDA 1SCQA 3VPCA 3P9RA 4G0YA 1Q14A 4HADA 5CVCA 3IERA 2F00A 2IUSA 3BGOS 1ZUWA 4QRHA 3CKKA 5IFKA 1YRWA 2IPAB 4EMSA 2J30A 2ZBUA 1QG6A 1QF7A 4OHMA 3ZLUA 3MINA 5I9NA 4HEQA 3WDSA 1H4QA 1IG0A 3TXXA 4JIGA 1A88A 4WCVA 1PQWA 3FMIA 2Q8QA 5EINA 4GI3A 1PDVA 4OHUA 4C22A 5JD5A 3CSSA 4M8NE 1JHRA 1P0MA 3DMGA 1E9SA 3OC6A 2P6NA 2IEZA 2UZ3A 1C8BA 1LW6E 2ZUVA 3RK4A 4JT6C 3K0KA 3VR3D 4IIGA 3D0QA 2GC4A 4GGAA 2ZATA 1R8QA 3IR7A 3JWJA 4ISCA 2X3FA 1QFSA 2H13A 3MWEB 5L51A 4MQBA 2J9YB 3W2TA 5FBKA 1GYRA 3MYRA 1I1OA 3HY6A 1JHMA 2JI7A 2SBTA 4HNTA 3Q8KA 4BN4A 3QQ5A 4D9BA 1E8DA 2H7YA 3RSGA 1SUWA 3HCEA 1JPJA 4W4TA 2RGXA 4WCDA 1RIFA 2LR0A 1H3FA 4CLDA 3AGPA 4JBWA 2FV8A 4EF6A 5CBPB 2CXSA 2WIAA 3F6SA 3BB3A 3EXFA 3HCDA 3A6LA 1EAMA 1L4NA 1RFLA 2M6SA 1MEOA 3HKEA 3QOFA 3KHSA 4HX5A 2PM6B 3L4MD 1SB9A 2WV9A 2Y6UA 2BTOA 2QXTA 3CF4G 4LMAA 6REQB 2ETXA 3DDUA 1DJPA 2KYRA 4RIEA 2GK7A 4ETMA 1RHQA 4A23A 2Z09A 5JQWA 2P90A 2DH5A 1GITA 2FZEA 1WW3A 2XTMA 2XWSA 2XGGA 4QHTA 1OLUB 2QX4A 1OXBB 1U4SA 3KT0A 3A1FA 3BUSA 3R3JA 2W11A 3WXMA 1WU8A 2G7ZA 3K0SA 5FKQA 4DC9A 2HBRA 3TCNA 1HA3A 1CIPA 1P4SA 1UM9A 2CXOA 2I2AA 1FQOA 2QSYA 3OZBA 3EUFA 4I5DA 1Q0QA 2VYVA 3ZNPA 3KAJA 4JDPA 3TPCA 3X3HA 4J86A 3KOMA 2VPPA 1Y63A 5DTQA 1ZMXA 3WV4A 4MRVA 1SXJB 1RJEA 3A6ZA 4TXNA 4E03A 2I8CA 2NU9B 3K26A 2XGOA 4I19A 2EIHA 4D4LA 4ZTUB 3KRXB 4IJWA 4XFJA 3N0VA 4U2FA 1R64A 1UBUS 5DRYA 2G80A 3Q7RA 4HC4A 4WZAE 1CUVA 1QHHB 3AC0A 1YRBA 1RKXA 1OAKA 2XMRA 2ZWOA 4WK4A 3DMNA 2G82A 3EVDA 1V8FA 2GUWA 2DY0A 2QRZA 2QTNA 1C9DB 4LOHA 3OU6A 4LZOA 2B4RO 3IFSA 4KNWA 3G8YA 2WJHA 1JQLB 4P3NA 4R3UC 5DBFA 2FPOA 2R8BA 1SQ0A 4QNRA 2EBHX 3MWKA 4TXMA 3RT7A 5C8DA 1GG2B 3RG2A 4UMDA 2ZW9A 1Y6RA 3R0JA 1Y4SA 4PC1A 3FSRA 5IZCC 3H5VA 1RYNA 3PC2A 3DDHA 3GLRA 1OROA 1U3TA 4MI3A 3SR3A 1KYIA 5I7OA 1RRMA 1FQWA 3KTOA 3PPYA 1UPUA 1RZRD 1DTEA 1HX7A 1O9HA 2A0YA 5JALA 3W8RA 3SHFA 2ILTA 3E3MA 3UG6A 5BNZA 2XH8A 1DEKA 2BCJQ 3K4HA 3BKXA 3T5GA 3ZDEA 3DDOA 3MCZA 4O3MA 7ABPA 5AVVA 1NXPA 1S8OA 1YR8A 5LUBA 2R1VA 3C8MA 2IYQA 3QXXA 1K7FB 2WHQA 2B8NA 4MQEA 2VOJA 2WYWA 4DC1A 5KAPA 3FBWA 3QKWA 3M3PA 1B7GO 5HCIA 4EZIA 1R6UA 4FLMA 3WL6A 1DFIA 3EMDA 4GEKA 1AC5A 4UM7A 3TNDA 4YMWA 1UJMA 1W4BA 1FMJA 3BYZA 5FWDA 2BLLA 2QL7A 4A6EA 1EFRA 1FSFA 3CLSD 3L6EA 2PZBA 3JX9A 4HN4B 3O26A 2JRCA 4P32A 3EXAA 2IZOA 2YHAA 3HEMA 2P79A 1QV9A 4RFVA 2CFSA 1Y9DA 2A2ZA 5LYYA 1BSVA 2P5SA 5CLJA 3AEUA 3MWJA 3WLPA 3AK4A 1HTTA 5AW0A 1IWOA 1VG8A 2P9QA 1R0ZA 1B6TA 3EF0A 1YRYE 3QF4A 2E3JA 1I7DA 3MIIA 1ZL2A 1OLUA 4BJ3A 2O8BB 4FP9A 4DAOA 4QDUA 4PQEA 1PDOA 2CMDA 2I3BA 3TIIA 4RPCA 3ML1A 3D8BA 2D2IA 4J91A 1EMDA 5JANA 4JP3A 5DNAA 3MHTA 5K7SA 3DZDA 4JHXA 4D0GA 3O90A 1BD3A 4B6RA 4KIFA 4M1KA 4H60A 4J2TA 1CUWA 1SXJA 2NX2A 3VH3A 4MDHA 2IUQA 2XTNA 2ZJZA 5AK6A 4JSRA 5EE1A 1YZUA 4UASA 2QC5A 3W05A 2QA5A 3G85A 4R3WA 4A03A 3BDIA 4BGEA 5JU6A 4NYMQ 1NUAA 2O2IA 4O2BA 2QV7A 3UXHA 4ZOQI 1U0SY 3C39A 5DLEA 3EB9A 2QUHA 4F8JA 4PX9A 4J81A 3K72A 3HGQA 4NYMR 3ROXA 2F8LA 5C9ZA 3B3FA 4L5YA 4BAUA 4UKDA 2Z4SA 4WPGA 3CIOA 2QBYA 4PSVA 4CZVA 2QGFA 1MC4A 3DLBA 3Q9UA 1WMFA 1UBCA 4PZLA 4PSXB 3MBOA 1I4WA 3C3KA 1W35A 4B71A 1U4NA 1W30A 5ED4A 4B35A 4MR8A 4QX6A 3ZDZB 1Z33A 4JU8A 2IAAA 1UJNA 3JWEA 4IQGA 4LN1A 2DSTA 2VA8A 3OF2A 3OE7A 5I51A 3I64A 1J2YA 5K45A 4C89A 2XE7A 3GLIB 5AVTA 2WHRA 1Y5IA 5GJWC 4F0JA 3N0DA 3AJAA 2IOHA 2AUTA 5G02A 1WR8A 1FS5A 5I7RA 2ZJ1A 5K01A 2AHOA 2PMDA 4KAFA 1NULA 2FNAA 4MGZR 3K9LA 2R6FA 1E6KA 1ECPA 2QU7A 1Z4IA 2CHUA 3TOXA 3W6ZA 4CMAA 4E30A 4UAJA 3EQ2A 2EKPA 4HNGA 4PLVA 2FF7A 4RD2A 5A7FA 1CJUC 1GD1O 2UYGA 4YTEA 3IEIA 4GX2A 1ZM2A 4OIFA 4HB2A 1L5GB 4CLHA 3THYB 2IHTA 1Z56C 4IOLA 4DUYB 1DCTA 1B0AA 4QO8A 1I10A 3QLVC 3UMVA 1CF9A 2BVNA 5BMVF 3DW1X 2AUMA 4JHLA 2QTHA 1B2LA 2AYZA 3FPFA 3ON5A 4MVWA 4ZQIA 3RT1A 4AJNA 5JAIA 4UE3S 1IMJA 1YUNA 5HTOA 3T94A 2HA4A 4Z3DA 3CLTD 4CI8A 1GPLA 3OD1A 4QG7A 1B23P 3DDZX 1G4AE 4BWYA 4DDHA 3RTDA 1XL0A 3I9KA 3QQPA 3UW3A 4AJ1A 2WJYA 5JS1A 3GBVA 3VH4A 3IQWA 2WUGA 3KV3O 4MW1A 2HESX 1Q74A 3GJYA 4NBUA 1FJGB 3U4DA 4ZU1X 2D00A 2OPBA 3NHYA 4CRWB 1N2SA 2OHGA 1A9RA 4IVPA 4NTZA 2VT7A 4Y2TA 4HWSA 1SC1A 2A4MA 4ZCPA 4EB6B 2XUPA 3D31A 5ALLA 5KTOA 3LSYA 3CLRC 2WKSA 2EFJA 1HGXA 1JHAA 1WNFA 4G0NA 2YOHA 1JIIA 2PGAA 1OBVA 3IP5A 3OF5A 4PLWA 4TTVA 4UUOA 3SDSA 2F3RA 3VNQA 3K5HA 3RJTA 4JXZA 1KTVA 3CSUA 3PPVA 3LBNA 2YW2A 1CE8A 4F2PA 1N5MA 4MXDA 5DX0A 3LPDA 2NV2B 4BUJC 1ZMTA 2PVPA 1G16A 4AURA 3T9AA 3NC4A 5IC5A 2JLYA 3STVA 1ISSA 4ZQHA 1I0LA 4WXEA 4JSXC 2FX2A 1Q20A 1RM3A 3NNSA 2A9OA 2O50A 3OTGA 5K0NA 4A7JA 1M1ZA 3B1KA 3ORFA 3KR2A 1IM2A 3I8EA 1W6RA 2H11A 3H5WA 3IMEA 4X60A 1EHCA 2WT4A 1U9JA 2BHLA 5LXTF 4DRXA 5CDSA 3LC0A 1E3EA 5M7EA 1Q5PA 4MSUA 3UVEA 4A2CA 2M1ZA 1YL7A 1G1AA 1YK1A 2OZKA 2R44A 2R8RA 3I37X 3FYDA 3CLTC 4Y1EA 1NHGA 3EFBA 3IBGA 3MJRA 3TNFA 3PNKA 3URKA 4X93A 5FTWA 3SYKA 1LU9A 4MKFA 1KP2A 1A4RA 1S4MA 1A5AB 2IYPA 3L4BC 1PK8A 1E4OA 2AK3A 2H6QA 2FUEA 2OBXA 4CL0A 2P8JA 3AP1A 1P77A 3G9QA 4MW9A 4G1MB 1COZA 3CT6A 3WXBA 3ZOKA 1B8PA 1WM1A 3PUJA 4UUAA 5AKYA 5ADWA 5IUJC 4YQEA 3I04A 1U1EA 4JJAA 3F9CA 4IIUA 5AI6A 4BN0A 4E5ZA 3QXSA 1WCXA 1XZKA 2F9LA 2ZULA 3DP7A 1ZI9A 1I5OA 3CN7A 2JGMA 4Q9HA 5CB4A 4X97A 3IPCA 4GI7A 5KVSA 4A11B 3CLSC 3N53A 2BRUC 3QUTA 5FBHA 5TPZD 3AF1A 5EKTA 3GFCA 2HD4A 2O48X 2QMOA 1KR5A 1UJ6A 1QGUB 4KVFA 1OGYA 2P65A 4ZZ1A 3FI0A 4JBNA 3VISA 4ID3A 4DG8A 2GXUA 2JCVA 3MTJA 1WP4A 3V4PA 2J9FA 4XYEA 3G6WA 4WK2B 5ES4B 2IHVA 3HR8A 5ICFA 5C81A 4JYMA 4H31A 1GPH1 4MPPA 1E7WA 2WUVA 2IXEA 3H7IA 3PIIA 4M7RA 4O2AA 4GYKA 4QUIA 4U7WA 3X1JA 4R2JA 1JFRA 4WVLA 2OK6A 1OW3B 4BBJA 3H42B 3K71A 2DQZA 3A4MA 2FDXA 3R9KA 2OCAA 1AF7A 2W71A 3EA0A 3INTA 3QKUA 4FZRA 3IHTA 1EFAA 1OAOA 1TIKA 2YV3A 1USGA 3O5AA 3GFVA 3PZRA 4OQPA 3B53X 1UJBA 3KXIA 4PRZA 5A4FS 2JFBA 1J1UA 4CG1A 1SD2A 1U02A 1EG7A 4KXMA 1ODTC 2AMFA 4RF3A 1Y42X 4M8IA 3SHWA 4HJXA 2HEIA 4CR7A 2HHHB 4A27A 1MG5A 2OD7A 1MBZA 4AWAA 3LUCA 3DJFA 3TWOA 1CE8B 4D98A 5I48A 3RVJA 3OCWA 2ODWA 4RTOA 1NQ5A 4HJRA 4QM7A 4J82A 2I4NA 1PT9A 1YC5A 1QE0A 2N1BA 4NCJA 3E27A 1UXGA 2PKQP 3FVRA 3LIPA 1T2CA 4P4TA 4BGUA 1EWQA 1QBKC 4DB4A 1IUNA 3ITNA 1N5IA 1Z0KA 3ZD7A 1AB6A 4UVEA 1GFZA 2J5RA 2UYYA 2VYND 4CLOB 4DMHA 5I9IA 3O7WA 1H8HA 1X1DA 2FEMA 4MP6A 2AKYA 3M6AA 4B2IA 1CUUA 4EUEA 2OO5C 1IG3A 1V47A 2ZUWA 3Q3HA 4I4TF 4XIGS 2VH5R 2WJAA 2OSBA 3UJBA 1RI4A 4PHFA 4Y1RA 3J81k 1AS2A 4KQMA 2GCNA 3FUCA 1IHXA 3SEQA 4MLDA 4Z8LA 1YQTA 2ZYDA 1GAQA 4KQXA 4ZO4A 4XIIA 3SJLD 4GQAA 4DM7A 4QVKA 5H9WA 4WY8A 2GA9A 5FADA 3T1TA 1GYPA 1V4BA 4PSKA 3GNLA 1WW8A 3HUDA 3V7YA 3KQHA 4MQ6A 3JASA 5F35A 3LZ6A 3PYXA 1T6YA 1RVV1 1XMJA 2BGMA 2QLBA 3SJBA 2E4AA 3CVOA 3PC8C 4G26A 2G6BA 2KBFA 5DEOA 3FCCA 1BS2A 1WY7A 3JD1A 5K19A 2LV8A 1P7PA 3IMCA 1CYDA 1X74A 4KE6A 2RI1A 3R4CA 1GN8A 4JKYA 3SBOA 3FCSB 1QGUA 1RYDA 4TT3D 4BX9A 1JQDA 4DLYA 3EXG2 4YV1A 1IM5A 1JAHA 3MRSA 2NO4A 4Z0TA 1F9EA 3LCVB 3V4PB 4FILA 2H7CA 1GNTA 4FCCA 1JJIA 3TSOA 2C78A 2WUDA 3B8EA 3QEKA 2X9LA 3TFOA 1OCEA 1DIHA 1UINA 2JF0A 2PJUA 4HS4A 2D1SA 2GFHA 3BX1A 5C8YA 2HQRA 3SQXA 3DD1A 5B3KA 1V11A 1HZZC 3AHJA 4UMFA 2YQZA 1PJ2A 1QCCA 3WTCA 4FMPA 2RB4A 1BTOA 2YHIB 3B6ZA 1NRWA 4MWGA 5AOBA 4EW1A 4OZUA 1PZXA 3PZBA 3JAMA 1HG0A 2YYYA 4IRUB 2CMKA 3OFSA 2O05A 4PZ0A 1D1QA 1MX3A 1DIRA 1UKEA 2D06A 2GBLA 3AXTA 5EJGA 4AJ2A 2IPMA 2HWUA 3W5VA 5TQ0A 1JJFA 3T3DA 1GTMA 1Q3HA 3EPPA 2XECA 4P08A 2RGUA 4HFMA 1J97A 3K0FA 5BQOA 1UDAA 4G5XA 4YP6A 4PZPA 2E48A 4G55A 2X22A 3KLOA 2OMEA 4K86A 4HGQA 1TM4E 4MQ4A 1ONOA 1U3UA 3LV8A 3HDVA 4FYJA 1JMVA 4GGCA 4UEKA 2J85A 2JIMA 4BV9A 2O0LA 2ZGVA 1PSDA 2WWXA 2R7NA 4L5IA 4LDPA 4A0AB 1C7RA 1EINA 4QVGA 4U5XA 3FNFA 3OLQA 3OZ7A 4QQFA 3BIXA 1A3CA 3ICVA 2QK4A 3GQBB 2L19A 1OTXA 3C3BA 3OPMA 1M1YA 4CLOA 4M86A 1GGHA 1DLJA 3OQPA 5BUZA 1A2KC 3TF5A 3VR2D 1LTQA 4C4SA 4YHHB 1EG2A 3IVAA 1ZCBA 3GLSA 4UPVA 5BMOA 3H3XA 5BMVB 3PKZA 4WGFA 3EXHB 1WS6A 3ZY4A 4ALMA 1ZKDA 3MTIA 5CFZA 2M6KA 1W59A 5G4LA 4FOPA 1OWLA 5E2AA 3KPUA 4RTQA 2NUTB 1Y3FE 1TD1A 3D5TA 3ZVLA 2R8OA 1ESEA 1AMUA 1L7NA 5C1OA 3IDZA 3ELYA 1TT5B 3HYCA 3X1XA 2OA0A 4D3SA 3ONWA 3R7WB 2RHLA 4Y2SA 4A82A 1K8QA 1ZIPA 4IZIA 3SJ7A 2E87A 4B83A 4F9TA 3I6MA 4O33A 3TR0A 3LBHA 4DNQA 1QDEA 4G5YA 1CUSA 2EJTA 1KO4A 3IXQA 2BMWA 2ZR0A 2YBAA 1G17A 1KVUA 3PU6A 3RF6A 1S89A 4D80A 5DSTA 1DQZA 1M2OA 1XLVA 3JD3A 2UZAA 1XROA 2FE1A 3TTTA 3UJCA 3EY4A 4BYGA 4I55F 2P4EA 2P1DA 3AP2A 3IVRA 3IR6A 2IH4A 4TPKA 3B13B 1Y4UA 1VIMA 3E5MA 3PV0A 3OM0A 5KYWA 1K6EA 1C7FA 3S7ZA 1WMAA 3BRSA 4IIJB 3V4SA 2HF7A 3WA6A 1DAEA 5INTA 5JFOA 1NPYA 3HM9A 1NP3A 3RM3A 4E54A 1NJ8A 3HVHA 4JASB 4AXXA 1BCRB 3EPLA 1U7ZA 3D7KA 5HF8A 2G83A 4V2IA 4M9RA 3DFUA 3QVWA 5AT1A 4AZSA 5MF6A 1R9MA 3FPEA 3GMDA 3MC1A 3DOFA 3L02A 4RO0A 4BCCA 5AJZA 1GTRA 4RKQA 2WF6A 1QRUA 3NBAA 1PS0A 1M1XB 1U1CA 1YVUA 2CVHA 1MN6A 1BEUB 3QVJA 3T3GA 3V8BA 2D7CA 2Q3DA 4MV5A 3H1PA 4PCLA 3RROA 1P18A 2YN4A 4GPEA 2W48A 1LLDA 2C42A 3Q5GA 5LNK1 2PUGA 2R1TB 1P1RA 2Q7XA 4E2YA 1O8BA 4GOMD 4PAQA 3ZLVA 1I4EB 1JAXA 3KU1A 5IN5A 3VXKA 2JHAA 3L7CA 1HQKA 1TMGE 4HDMB 1TAUA 3HO1A 3IIIA 3WYEA 3ZGXA 1YFJA 4N14A 3REQA 4QYXA 3TTVA 1EGMB 1W2HA 1FDRA 2OUIA 4TYNA 1C1HA 4DPKA 1QYVA 3DFIA 4D9MA 5CT5A 1II8A 5F9FA 4H15A 4MI6A 3VRHA 3IQIX 2ZG6A 1E2LA 1QGOA 1B93A 5KDDA 4IL5A 2BC9A 5IJ7E 1PL8A 1POXA 2PZMA 2P6MA 3IPLA 3V2GA 2VH1A 1PW5A 3DW3X 3GWGA 1NG9A 3KYDA 3WLEA 2PK3A 2V3WA 2G1UA 2R6GA 3FOEC 1J0AA 4CI9A 4QJ4A 3CKMA 3PHCA 3SIPA 1XXHA 2YY6A 3LQRA 4YRRA 1RQLA 4KTVE 2E37A 2RI6A 5DW0A 4EG7A 4BZPA 2FW8A 2HEGA 3NXSA 5E8RA 4J90A 3T5BA 2H7XA 3R7WA 1K2WA 1G5TA 4RDIA 4ZGWA 2NAPA 5H0IA 1N2HA 3BGSA 3I6ZA 4PWYA 4D8XA 5IRCD 1SZDA 4F96A 1N6IA 121PA 1V35A 2C20A 4DW8A 5GONB 3O4VA 4B8WA 1Q0PA 3HU2A 2EX0A 4FMDB 2YNNA 4U7PB 4WOPA 1L9KA 1TQ8A 1ULAA 1Z13A 2VCHA 4BO8A 4TKLA 1UBMS 5GVSA 1E1QD 3WX0A 4MS4B 4UFPA 3U3DA 2B0JA 2W83A 2P9FA 3PS9A 1Q1AA 4JEUA 4OTZA 2XD9A 1ESCA 2CLFB 2ASVA 4QASA 2A84A 4OIMA 5KYWB 1QIHA 4BMNA 1IZZA 2A9VA 3LRPA 5F1OA 4ZYUA 3ZHXA 4HEHA 1POWA 1A82A 4OP2A 5EKXA 3TXYA 3V00A 1XIVA 3HCRA 4HSGA 3JYPA 3TR5A 1BCRA 3FYSA 5CFMA 5FNVA 1PG5A 3SMQA 3FFXA 1TYCA 4PICA 4ND1A 3WJ1A 4B4UA 1UWVA 3NBXX 4OJQA 5K1ZA 4MVJG 2F8TA 2JFNA 4LGYA 3TQTA 1TQ4A 1JIUA 5EJAA 2G09A 1TM2A 4WJZA 3RQIA 2Q4OA 4I9UA 4GM3A 4RSHA 5L3ZA 4QWWA 1TZJA 2AFIA 1WSBA 4BNNA 2QN6A 1WTAA 3O8DA 4BB9A 1QTQA 3CZAA 4QD3A 4IZHA 2WILA 4Y0AA 2BKLA 3WDKA 4ZJZA 3I45A 3HO8A 4ES6A 1R6XA 5JYDA 1COWD 1OXXK 2CV1A 2B69A 4UARA 1KVRA 1T6NA 5TXGA 4E2ZA 2J8ZA 3NIGA 2Q8NA 4M8SA 3H87A 2FHSA 4RLHA 4D79A 3EC1A 3MELA 2CFTA 4X6UA 4MWSA 1LK7A 1FFWA 3C7AA 1HDCA 4GLFA 3TZ6A 1E3MA 1EQ2A 2BMVA 4OHOA 3ZHZA 1U5BB 4DA6A 1N5LA 3HFRA 4JA0A 4V3CA 2XY4A 4WV3A 2IIQA 2IY7A 4BNDB 2HJHA 4KEAA 3IC5A 3QXJA 2O1XA 1ZK4A 1KI4A 5IAAA 1PP4A 1PJBA 3G5AA 4GHWA 1DPFA 2QB5A 2R6DA 4A92A 1RAGA 2YXPX 3BFXA 3CKYA 5K4GA 5ISMA 4QTUB 3TLJA 2P2GA 3NGMA 3G1WA 3VPDA 2VAMA 3FUTA 1N6PA 4MVJD 1ZUD1 5DNWA 4WERA 4RHXA 4HVAA 1UF9A 1RXVA 5DU2A 2I7TA 2Z4RA 4Q4JB 1BKSB 1G6KA 3ROTA 3C0KA 4WKGA 3RC7A 3D4PA 1EBBA 3HC7A 2IV2X 4JJKA 1VRVA 1PR1A 5L8VA 1L4MA 1P1KA 3LG2A 4C4AA 3PE3A 2EG5A 4WACA 3RUAA 4ESHA 3DKIA 5KVVA 1CEEA 3A10A 2Z2IA 4LHZA 3UM9A 1I6WA 2ZUCA 5K0SA 5EXTA 3CNBA 1C0EA 3VU3A 1NU8A 1GT91 1DEHA 4N0PA 1CR2A 2I8LA 2XE8A 3RC2A 4C06A 4GVLA 1CR0A 4Q34A 5FLYA 4XSHA 3R5XA 1IIBA 3E0QA 4HYQA 3CX4A 1L0BA 4AP6A 3KAKA 3HJGA 3IS3A 4QGSA 4MS3B 1FCJA 1CYEA 3H5RA 1QCYA 4A0SA 1ZVVA 4HDAA 2XCIA 3OF3A 4H7DA 1CUZA 1B43A 1KDRA 5HW0A 4L6CA 2WTNA 2ZKLA 1UP7A 3N75A 5L3SA 3EIHA 2CUKA 4XARA 5AVYA 2GN6A 5LXTA 1BROA 1EHYA 2QNRA 2XGSA 1JG3A 4OYHA 5THAA 3RS3A 4OX9Y 4YJDA 3VU9A 4BE7B 4YJKA 5IULC 5LB2A 5K8IA 1XRLA 3CYFA 2VH2A 4LZLA 4WW0A 1L5OA 1T2EA 2ZZNA 2B4AA 4GMGA 5JVDF 2VJMB 5IDWA 3UQZA 4PV7A 1W75A 1F6DA 1M34B 1UBLS 3E3AA 2W4QA 3K73O 3RYFB 3I6BA 4DJDC 5A06A 3B5JA 3UYKA 1RYMA 1EGVB 1JEOA 4Q7LA 5CA0A 1J49A 4MDEA 5DWDA 1QF6A 1G4UR 4PBYA 1UWCA 3MAGA 3P2EA 5E2IA 2QTTA 2OVPB 1VI2A 3KE9A 3IB6A 5HIIA 4CJXA 1NONA 4IPTA 4LW8A 3A4LA 1DUSA 2QF7A 4Q02A 1NC1A 3ZWQA 1PYOA 2VSYA 3GFRA 3JALB 4Y6GB 2HJGA 3GZNA 4X84A 4LG1A 4GOXA 2D1QA 3WHPA 1QIMA 4WE3A 5L3RA 1XMPA 1KSJA 3WADA 3UMRA 5CEJA 3IKTA 4HPXB 1G21E 4LJ7A 1N8SA 2I0RA 3F7MA 3MMPA 1RTKA 1JNYA 1VPDA 3M9WA 2GVZC 2W6OA 3G2HA 4W1PA 3DB2A 2DLNA 4LJKA 4J0DA 4PC0A 1ADBA 1KH3A 1Y8CA 2ATIA 5E4YA 2P2NA 2HJSA 3H2SA 3QYFA 2PMEA 4EHJA 5ADUS 1QTIA 5AIBA 2N1MA 3ANYB 4H1HA 2P9LC 2UUPA 2PTGA 3UIEA 3C5CA 2NZWA 1JB1A 4KN5A 4FIDA 3C5EA 5AVXA 7GPBA 2J3QA 2OVBA 1QYRA 3VDXA 1PEAA 1UBNA 1Z15A 2HM7A 3LVRE 3Q3VA 3SEFA 3EIQA 3MJCA 3QXCA 4BX8A 5H70A 2OIZA 3MGBA 1B9XA 1H2XA 3EGCA 3FBGA 4HSEA 5HFJA 3A4TA 4MHTA 3JQDA 4GMDA 1ZD8A 4HUQB 4B1FA 2OCXA 4YLYA 2KSQA 4MUXA 2VTDA 4ERZA 3DA8A 1GQQA 3UJ6A 3WC4A 4TWJA 3Q2OA 2CNNA 5ICMA 3K94A 1ILEA 3AR7A 4ZO7A 5EALA 1EVJA 1RM4A 3JZMA 3WRYC 1M2VB 2B37A 2QQGA 4EARA 3ONEA 2VZ3A 3EE6A 2MSKA 3BXXA 2P7IA 2XMSA 5F5XA 3G2PA 2PE5A 5LXTB 1CJVC 1FTGA 1N1EA 1ZXXA 3S2YA 2A67A 1NMQA 5K0GA 2CD7A 2C2XA 5TX7A 2XUKA 4UUPA 1O9BA 2YUIA 2X9QA 3Q7SA 3NKVA 3BH0A 5BQFA 3E3LA 3CUUA 5JDIC 3KTAB 1B1CA 3NOXA 1MDAH 4IDGA 3T3PB 2RHGB 4NCIA 3WLOA 1BOOA 4P0TA 2ESRA 4P38A 1XYGA 2P1ZA 3FNGA 1T0PA 4YRJA 3SKYA 1L4FA 2QTWB 3QOXA 2X6RA 4IQ0A 3FPSA 1DI0A 3LFUA 2PQ2A 2QLNA 5FNZA 5HQJA 4N3CA 1VYUA 3W4IA 3ZCUA 1AHPA 1H9CA 4Y18A 1ZQ9A 1YBMA 4DQXA 3BXZA 3AQIA 2WZBA 2CHGA 1BH2A 1K5DA 5B53A 4ZVPA 3VPXA 2XCQA 4POAA 5EWLB 2W9XA 2XAAA 1AZTA 3E61A 3JALA 2NXNA 3I8SA 4I2VA 4YCJA 3U0VA 4DUGD 4WT7A 4Z8YA 3SLKA 2WWRA 2B30A 1MT3A 2WHXA 3T5TA 2VUIB 3Q3GE 1KVQA 3PQ7A 1WHTB 4HAUA 4EHLA 4GI1A 2N3ZA 3F90A 1TKAA 2Q2NA 4ASUD 4V0LA 1KY2A 4GPBA 1KKMA 4XH9B 1W47A 4AU1A 2I6XA 1SMKA 1NXWA 5AFU3 3PT9A 2OG2A 1A2QA 1K8KC 2QN2A 2XWBF 4X8MA 4IXTA 3BK2A 3ZIAA 1M7GA 2XNHA 1HE3A 4N6NA 3WGUA 2OORC 1RXEA 4G4IA 4CCAA 2OBMA 5FORA 5EMLA 2WWFA 1T2XA 3ET4A 4JJFA 2V8OA 4BNJA 5JPDA 1HDRA 1W94A 1CKEA 3WP1B 3H2HA 2P35A 5CIQA 3B2NA 5G53C 5HCNA 3C1AA 3SOPA 2CMFA 3ASUA 4DNVA 2KJQA 3ABOB 5AUNB 2DQSA 1LSUA 4FT2A 3KFLA 2MU1A 2R6HA 3DMPA 1T5DX 1IEXA 2FF5A 2PWZA 2BBWA 1SHUX 2A7XA 1DBIA 1HT2E 3IJRA 3P9CA 1QHIA 1H5QA 4IDHA 4B3GA 4NJEB 5C7IO 3PD1A 1DJMA 1GO2A 1U28A 2CLKB 3B1YA 4MAAA 1K7CA 1K92A 2PZEA 2R7AA 4G0OA 4PG5A 4Q05A 4QO7A 3A0FA 1E9RA 1WOYA 1XF1A 4NJMA 2VDJA 5JMPA 2CFCA 4CGYA 3FDXA 5F7OA 5K0CA 1Z88A 1UBJS 3PR3A 5AHXA 1FF9A 3VU1A 2Q9BA 4EYEA 2C4NA 3BRWD 3DF7A 3JQAB 4M60A 1TCVA 2YZGA 4QOHA 3RIEA 1TUIA 5F9MA 5AFSA 1J1ZA 3GFSA 1U0BB 1N0VC 3U16A 3VZRA 4RESA 3MZ0A 4JGIA 3RK1A 4BMDA 3O4IA 4XLTA 1Z2AA 4EYKA 1EXDA 1CDDA 1TO2E 5FR1A 1DJQA 1NQOA 3CRMA 3M83A 4BV8A 2QIOA 4PAMA 1X8XA 4Y2VA 4ACBA 4UTZA 3O8OA 5L3QA 1YCDA 3UH1A 1IY8A 2HHAA 3FNIA 3T3PA 3YASA 5D3MA 1KJIA 1E6WA 4HDRA 1SKYE 1JSLA 2H5JA 5DV9A 2QUAA 4NZPA 3T7AA 1X9HA 5UKDA 3S99A 1DCFA 1R66A 4I3HA 2WPDD 4W1SA 2L69A 2HZ7A 2P6OA 2RK6A 4BY9E 4Y7RA 1DIAA 2FWAA 1ODJA 1SVIA 1ZPDA 2ATVA 3MJHA 2H2AA 2ZRIA 2PQ0A 2QRKA 3G79A 3RN1D 4KODA 4U63A 7REQA 1NN3A 2NWQA 2JEOA 4W9NC 3GFOA 5G0TA 3T3OA 1RCUA 2RH8A 2WJGA 3MPOA 2AOWA 5F7JA 1YB7A 5GJCA 4ARVA 2EP7A 1PUXA 3I9NA 3JQ7A 3MCUA 3PSHA 2QM3A 3K2IA 4D57A 4ZKDA 5JS6A 4V2UA 3W6PA 3E8XA 1AO0A 5KI6A 4P4NA 5B7GA 1M8JA 1IZ0A 2DBYA 4LHVA 2JGJA 3PDWA 3KCIA 1O6BA 1VMIA 1B15A 1FEZA 1YQUA 2ECPA 2IEDA 2PZ8A 3AWDA 4RL6A 4OQDA 3G9ZA 4ZWNA 3IURA 3PUIA 5TGZA 3GRVA 4RS3A 4W6QA 2ZCUA 3KPYA 4D96A 1Z73A 3HI4A 2GK4A 2P9GA 2R79A 4A0BB 3PEVA 1GL7A 3R77A 2C4WA 3D4LA 4QQKA 2FFJA 5EM2A 2HYDA 3D5QA 4V0SA 3RAJA 1FXUA 2CV2A 1ZWLA 4B87A 2NSLA 2DUNA 2QAJA 3UV3A 3HZRA 3OETA 2ECOA 5JNLA 5CA1A 1FP2A 3N9IA 3I5XA 5AM5A 4NH4A 2O8EA 1F4LA 2B7BA 2B1GA 2QTLA 2WVGA 3VR6D 2OEPA 1QH1B 3TNYA 2B9VA 4OMFG 3O8CA 4NJEA 2Q45A 2X1MA 1K08A 1V2GA 2RC5A 2XCTB 4NK5A 1SOWA 3OM1A 4UAUA 1CVRA 1AKWA 4XQCA 1QK5A 3ROZA 1WTCA 5EP4A 3ESXA 3FWZA 2O59A 1ZD2P 4FN4A 1JAIA 3R3UA 3LZCA 3E1GA 2V45A 3P0RA 1KMQA 1OPXA 5GGYA 5A3VA 3U7JA 1JSXA 3I23A 1VPWA 13PKA 1P1HA 3IVXA 2Q7OE 3GMTA 3AVUA 2IBSA 2Y0EA 2HADA 2JG3A 4DVGA 2C99A 2GJ9A 1LJUA 2IP4A 1P73A 5E9AA 2FZVA 4PSUA 1T34A 3F74A 3BIOA 2P2DA 3BMNA 3KWFA 3HJBA 4X63A 2JJ1A 1YVPA 1E3TA 3NWJA 5L3QB 3L0CA 5HKKA 1QIIA 3T9EA 4RTRA 5K4AA 4GZ3A 3H04A 4Q7MB 4NAHA 1Z5PA 4EZBA 1EVKA 2I54A 1P2BA 2ETVA 3NAZA 3V1UA 3JQ9C 2CSXA 3Q7PA 2XU7A 3TLEA 5I7UA 1ISFA 1XDZA 3IDOA 4CKWB 3GGCA 1SZCA 4KXQA 1VLVA 2HO4A 1ONBA 4PWZA 3SU8A 3EXIB 2BIFA 3IT2A 521PA 5TPWA 4D0LB 4M1WA 2RFLA 4GFDA 1EFLA 2IWFA 5JAQA 1SBTA 4K6CA 1LK0A 3ST7A 2J3IA 3NEAA 1PEKE 1V8OA 3I2YX 3N8KA 4KCGA 7REQB 2WM8A 3W5SA 4FAND 1P5FA 2ZJ8A 4I4IA 1H42A 2OXEA 4F8YA 1ORTA 2PUDA 5K05A 4H1VA 2HQSA 4EKNB 4YMTA 1DB3A 4TVOA 1QH8B 2KPOA 5C9ZB 2E5FA 1SQ9A 3W2HA 1Y1SA 2UU9B 3OC0A 1NW9B 3KP1A 4D3XA 5F2EA 2F62A 3RNOA 1H9AA 1TUBA 3LUAA 4IFIA 4EI8A 4D0SA 2A5DA 4AJ9A 1SCNE 3EPJA 3CGGA 3ADDA 1EFPA 1SCBA 3SNKA 3E9MA 3L1HA 2JCXA 3P5BA 4Q15A 1CBUA 2JFYA 3OIDA 3R24A 2WD8A 2X3YA 1RWPA 1YTLA 1B6GA 3KHTA 1TRHA 3CW8X 2P0EA 1GZUA 2MCFA 1JMXB 1IMOA 1WCIA 1KZ7B 4BRUA 5CA1B 1DXHA 1KDTA 2H1HA 2WU4A 3TKYA 1AQLA 3FKQA 4CCYB 2AHRA 2BZ1A 4KRXA 1QH1A 4IIEA 3RRMA 3RSOA 1VSBA 1GCOA 4KGVA 1RJ9A 1USKA 2OPHA 4X20A 5IAGA 4A10A 3K6KA 3THYA 5D84A 2E55A 4PYMA 3GBSA 1LWOA 4BDSA 1FTSA 4EHNA 4A8JA 1LQTA 4KBGA 2B8EA 3SS9X 3LLMA 1E3IA 4QOFA 2A1IA 3IP7A 2PZLA 2J6IA 1PSZA 4AF6A 5A02A 1VSUA 1DMSA 1GDHA 1WDLA 1CUFA 1TAGA 3N6XA 4WCFA 2A1TR 5A9TA 1UZMA 3RHTA 4EJSC 5IK2D 3W6OA 5IZ4A 2ZJ2A 3C4JA 1AKVA 2PMCA 1U7UA 4OXXA 4DRZA 3KBBA 3PXGA 1KSFX 1G6OA 3KLNA 4Q1CA 4URZR 4M1EA 2PNFA 5L40A 5KX5A 4Q6WA 1BFKA 1RWMA 4PBZA 5E4JA 4EY7A 1RKBA 1DNPA 2FQ1A 3MWFA 4HCJA 2NVUA 5CYOA 3NALA 4AMZA 3FZNA 2ZYVX 3OQIB 5JDCC 1IBKB 4EGQA 3G68A 1ZJJA 3D2LA 4E5YA 2J6HA 3GXBA 5HJEA 1DKOA 2C9CA 4Q18A 3JB9L 3A0RB 1V39A 1OFUX 2VOEA 2IZ6A 3Q0TA 4GPIB 4OGLA 4BLOA 3FUUA 1OV6A 2QRVA 2WNHA 3ICPA 3NM4A 2A5JA 2DAPA 2OC4A 2X58A 3EBLA 3H19A 2W2PA 4JK3A 2A3RA 5TQJA 3SYLA 4ETIA 2HRBA 5FWNA 2IRWA 1XQWA 1ZYUA 2AG0A 3IO3A 2ZRFA 4OMUA 5A3SA 5JECA 1JXAA 3R6WA 5MGBA 1WCYA 5EMNA 3VR4A 3GX1A 2FVYA 4NY1A 5DHTA 3CW2A 3KDSE 3W5UA 2W90A 3RKRA 3TS1A 3QU4A 2G5PA 3C6MA 3W7BA 1PHPA 1A8HA 2OCYC 3OMLA 2X8BA 3O3OB 4JI5B 1BXZA 2KWIA 2GCEA 3KOXA 4ROTA 1XAGA 5DISB 2G9ZA 4RGBA 5TQ2B 2SECE 621PA 1I4DD 3M1IA 5FIUA 3UA3A 2JC3A 1II0A 3IYLW 2J5BA 2QQEA 2VS1A 1YZTA 3W34A 1YDFA 2AJDA 3MCVA 1GTZA 1BVRA 3V97A 1R0YA 1D9XA 1NN1A 3PDUA 1RM5A 3KPJA 4IGEA 2JKVA 2ERCA 2JEZA 2ZSBA 4ZI7B 4DCNA 1DWPA 3I0ZA 1YQQA 5G3ZA 5KNBD 4TXHA 1VBKA 4OJMX 4MH0R 2ZB4A 3EZGA 1NVXQ 1QFYA 2FEKA 3GH1A 2UVQA 1R4AA 3L9XA 2V5VA 3CZ4A 4TSFA 5IDYA 4CCYA 5DKFA 3OQMA 4UHBA 1HT1E 4WVFA 5FYDA 2H2HA 1J0DA 3J81A 4HS9A 2M1XA 1RJ9B 1U2DA 4N03A 2PWBA 4M0PA 3N2GB 1ISPA 1UBKS 2IPNA 1KZ9A 3K6RA 4UNSA 1R9JA 3VJRA 1XK7A 3DCNA 2FE4A 5AK5A 3E1KA 1WUYA 3CNLA 2DCMA 1B16A 3CSDA 4WAUA 3AHDA 5JAOA 6ABPA 1BQEA 1PJZA 2O9JA 3GCZA 3KTFA 3U7RA 5J5CA 2J9GA 4A2LA 1RHKA 4HAWA 4UE2A 4UM5A 3NBUA 3WQSB 4DCSA 3HP4A 5LQDA 1GT6A 3CH5A 4H2DA 4PBRA 2GPBA 1HL7A 2J9FB 3NVXA 2DOKA 3CN9A 3N2KB 3A1CA 4JJZA 4OHBA 2P9KC 2CL0X 3HV2A 4PPGA 5HBGA 2QP3A 4GQ1A 1CUYA 2BONA 1IC6A 2M9MA 3GVXA 5C31A 1G4HA 5JFTA 4NU5A 4OQQA 2GF9A 4CTKA 2QD2A 1JJBA 1KIFA 3NEYA 1WUTA 3E81A 3H9BA 1N77A 1NN0A 1KPHA 1FNBA 4MUIA 3ZY6A 1LKZA 4BQOA 3K9NA 3UTCA 3W4KA 3PEUA 4PX3A 4PTLA 2BY4A 2FUNB 3ZDFA 1QP7A 1EPUA 2EGUA 1YZHA 4EUNA 3E5HA 2NQ8A 3C1UA 2QRVB 4PC2A 1O96A 4OO3A 4RX1A 3NFRA 3CEPB 3M5WA 3FCOA 1E1RA 1GGNA 1YH3A 1ZUHA 4C7XA 1QS0B 1WMBA 4ZVRA 4G07A 3BTVA 4EF4A 5JS2A 4ZN4A 1O3YA 2NXJA 1OGIA 3H2IA 4G84A 1V96A 3WKEA 1VBMA 4CUKA 5EE0A 5KWVA 2AQIA 4P0PB 2GS9A 3WOHA 5JEEA 1KYYA 1C3OA 3HFGA 2LKCA 1GPAA 1QO0A 3LMKA 3OIYA 4P6VF 4HN2A 1XVTA 1KJ8A 3KPWA 4JI6B 1SPXA 3LLUA 1VYTA 1C30B 1Q15A 1VL8A 3ZWBA 3KVRA 2VK4A 1RHJA 1J06A 2QD5A 3OQVA 4FJ0A 3OESA 2Q1SA 1P4RA 2AJ8A 4AMYA 1H0HA 2EGHA 1RC1A 1B1AA 4RBNA 3VR4D 4DR5B 4DG9A 2BI8A 4R98A 3UUEA 4FHCA 2A0KA 2IDKA 5A2GA 4DBLE 1RS0A 4YMGA 4TS9A 5JXHA 3DUFB 4N47A 2FUG6 4ZI7A 3F78A 1BFDA 3ZWPA 3DZIA 4GXQA 4F2HA 4YDQA 1RNLA 3JVIA 3DBHB 2P5TB 1U65A 3M5PA 4KMRA 4LKRA 3QHYB 3NWBA 4IHJB 4RY0A 5JLJA 4BJ6A 2WIDA 3OFNA 2HSEA 2OECA 3A3YA 2PKEA 4XW2A 1YA4A 2F64A 2PG3A 4Q0MA 5KHAA 5DWQA 3VHLB 1YKSA 4DDMA 5CFLA 2NZYA 3E2MA 2QR2A 3RWBA 3NHKA 4BO1A 1FU7A 1UMKA 1SEVA 3MGAA 1XJCA 4HAVA 2C3UA 4MLPA 3UANA 4ENSA 1JECA 4GRAA 1I33A 2QZSA 3I3SR 4MEAA 5IU6A 5A2Qg 1GL6A 3UWOA 4C3ZA 3EIOA 2BJVA 1U6KA 1QZTA 4HB3A 1I14A 3RW9A 5JAMA 4IBOA 4RJLA 4UHKA 1EX9A 3GEDA 2YV4A 3PGMA 4R84A 3U5TA 3G2MA 5LBUA 3DTVA 1O87A 3FCUB 3PPWA 4RTKA 2ZWIA 2EF0A 4L73A 3BD7A 4RD1A 5LQAA 1S4UX 2HT1A 2XCSB 2COEA 1I6MA 2FK8A 4V0KA 1E1YA 4MW5A 5ICEA 5HP4A 4L0CA 1JR6A 1D6JA 4ZI3A 2L2QA 3BH6A 3ZXXA 5T5QA 2B21A 4Q4LA 2B9EA 3GEEA 3RWMB 2YHIA 4UVIA 2BV3A 5TF2A 2D54A 4MQMA 1ZW6A 4TQAA 3WMGA 1CJMA 2PLFA 3ZGOA 1JE0A 4H1WA 4JUBA 5TDHB 1S0UA 4I9FA 1TJPB 1DG3A 1NF8A 2EEPA 3F73A 5P8WA 1BS9A 3DXZA 4TT3A 5EKDA 3G0IA 4XOUA 5AWFC 3ZHYA 1C1XA 2JZOA 2WLTA 4JENA 5CNIA 3RRBA 3K0FB 1M54A 2DPMA 2AC2A 4FE7A 4L2IA 2O3JA 3PSLA 2BKUA 1C2YA 1HBJA 1TF5A 2BI4A 3GG2A 4PZ9A 5DLDA 3ONDA 5ALPA 1T1GA 4ZQFA 3ZDYB 2VQFB 1PEDA 4WQMA 4NPHA 3VZBA 2PX6A 3ADBA 4G4SO 4N5IX 1KEUA 3EVCA 4JBLA 1DRVA 5LCXA 4DILA 5B7PA 3MZLA 1TM5E 3GZ4A 3Q85A 1JLHA 4A0AA 2MOKA 3MCTA 4CIBA 1RYYA 1TFRA 1XPJA 3OPNA 3R20A 2BL4A 3EFHA 4X7BA 3ZWCA 5BOSA 1NY6A 1TVKA 1C30A 1U8EA 1RYFA 2MINA 3QELB 2JIZD 4LX0A 4BVEA 4G0ZA 1A8SA 1FQKA 5FKSA 1ZWKA 2C0CA 2WHPB 4MRPA 1P22A 4FR0A 2HMTA 2RONA 1XZBA 3I2IA 1A5ZA 2BP7B 2H85A 4HOYA 3EOAI 4J8BA 4IDCA 3UVLA 3ZBTA 5HWSA 2DERA 3GUUA 2JI4A 4UD2A 3LP8A 3ACCA 5ELXA 2WQ6A 3NP7A 4HF7A 2W2KB 3S1AB 1XZ8A 3KL4A 2YN2A 4R05A 1IVSA 3ZVMA 4ZAYA 2R97A 4TQGA 3PXTD 1KI7A 2VPYA 3FF4A 4QICA 2RJ3A 1SHTX 1UDCA 3M82A 1GNLA 1XZHA 3V7DB 2OLKA 1AUQA 2OO7A 2IF0A 4J7UA 4B3SB 1THMA 3E9CA 5EZQA 3IOEA 4QBTA 5CD9A 1JBKA 4II3A 3PFKA 4N82A 4CR6A 6LDHA 1DC5A 5M5SA 5IXJA 1IXZA 4XTCS 5LZ5A 1EK2A 2XUAA 1A9OA 3BG1A 5L6MB 4X6LA 3QE9Y 3H4IA 1FVFA 2YMQA 3OJWA 4LK2A 2JJMA 1JEAA 2A33A 1Z47A 1TPYA 3P9ZA 4CWAA 3I53A 3G0OA 3ZQJA 5AJAA 2C9BA 3B36A 3PFBA 5EUMA 3OFJA 3W8FA 3ONNA 1K3FA 1KEPA 1QCDA 3X2EA 2C8JA 1COWA 5JNRA 1I7SB 4OK3A 4CMJA 3F98A 2CN3A 4RK4A 2J0UA 3TMAA 1U7DA 4I5IA 3BIFA 1B0UA 3UA4A 2YOGA 3V5WB 4JJ8A 1VKHA 4GLBA 3AFOA 4YP7A 1AH2A 3SX0A 2X2PA 1GNPA 1M83A 4DBVO 3AUTA 3SEZA 1Q12A 1VC2A 3SQLA 6AT1A 4DR1B 2GCOB 4GKVA 4COOA 3J80A 3ZDYA 3E22A 5EJMA 2R1TA 3E8MA 3I9LA 1WDMA 2BFMA 1PAUA 3UUFA 5FL7A 3QVGA 4LYFA 5HKBA 3B8HA 3Q3JB 2QMZA 3ONVA 4P4LA 3W3ZB 1CP2A 2WAXA 5K51A 1FVHA 3UK0A 2O0MA 3BD6A 4N7MA 1Q1BA 3TW8A 3NJ8A 4MUGA 2Z6AA 3H8WA 1H8ED 2FSUA 2JVIA 1Q1EA 2BM0A 1R8SA 2XNDD 1A2OA 2Z04A 5E4FA 1PBNA 3RU7A 3MN1A 4L5JA 2C29D 1N9GB 4TM7A 4ZICA 3IBTA 1JR2A 1FFAA 3E15A 3E18A 3GT4A 1UKAA 2BFAA 3EXHC 4YCAA 4QRDA 4AKTA 4EY8A 3W5CA 4XKJA 4TWAA 1D04A 2IHUA 4F5WA 2GOYA 3I8CA 3M0EA 1VA4A 3D6MA 5GWXA 1E2BA 4UQLA 3GYGA 2GHIA 4JT8A 4A26A 4AB1A 4GRIA 2VP6A 4FA4D 1ZH4A 1VKRA 1KC3A 1JLKA 2FZLA 1NNSA 2AI3A 1E59A 3QRWA 4CIXA 3E6AA 3COPA 4MA5A 3E8SA 2EBUA 4L50A 4QHYA 1OQAA 2VPQA 4U8HA 5C1IA 3TL6A 2X1HA 4OAOA 4KO1S 4TTIA 2YS7A 3UMCA 4C07A 4E5KA 2ZWMA 3C74A 1ZH6A 2VBCA 2WE7A 1AGNA 3FX2A 3FGNA 5GONA 2VJDA 3HRHA 3OTQA 4TL7A 2F90A 4S1NA 3PLNA 1Z4JA 1E5LA 1JEDA 3DMHA 4XRRA 1BMFD 5CIYA 4RTPA 1E9CA 5D7BA 4UJ3A 4ND5A 5JNUA 3PR1A 1NBWB 5DCWA 4BMVA 4AJHA 1X1TA 2PXCA 4B0PA 4FE3A 4W6ZA 3C5WP 4W9MC 5FOSA 4CLRB 1DCMA 3M70A 4W7SA 5F7XA 4RKFA 3JQFC 1BWPA 4JYPA 5BSKA 2A5LA 2PNJA 1T36A 4D8UA 5DX8A 5JUWA 5BSFA 3D8SA 4GGDA 3HFQA 2QX9A 4F92B 4OLHA 1MB3A 2ARKA 2JIOA 2IKSA 4MP3A 1CY7A 1OD6A 1KYZA 4BN5A 4R0MA 1TZCA 3ETGA 1DSSG 3S2UA 4JAVC 4Q4HB 5JV5A 4FI3F 3CVVA 2HXCA 1KR2A 5JJKA 5IJ0B 1QPGA 1T10A 2IUVA 3RHZA 3KZCA 4EO4A 2QXUA 2GCOA 1IUOA 4BNWA 3W79A 2G77B 4PNKB 3LWZA 4BZWA 3TZBA 2R8YA 1I2ZA 3NRJA 1JYFA 1RCTE 4J6FA 4KLRA 4V0RA 1P39A 4BNMA 2G99A 1TM1E 2X5JO 4NARA 5T67A 1IRIA 3VR0A 3LE8A 4I66A 1SUIA 1YV9A 4M8LA 5IT0A 3FAZA 4JB2A 2C2WA 1YUBA 3HEBA 2XUOA 4L9AA 3OECA 1E3SA 3DYIA 3RS9A 1ZVJA 1U7OA 1PR9A 1TECE 2FFBA 2RIPA 1Z4KA 1MF7A 3DO5A 5JCJA 5B4UA 1ZD1A 3GFTA 1V3QE 3JQBC 5DOVA 3ZHOA 2QTCA 3AT1A 1F38A 4E4YA 1XZQA 1NR1A 5BP7A 4O45A 4JJIA 2CCGA 1CTQA 4PGMA 3FDJA 2AKAB 3I12A 2Y6VA 2HRQA 4GKJB 3LGAA 4AY5A 4OB7A 2JFOA 4XIJA 5DT9A 4XGNA 3KAPA 1LW7A 1HPLA 1RTTA 1AZLA 1XZDA 5CUQA 5EZ6B 3VDRA 5CAEB 4XX0B 3EZ9A 4Q66C 3EH1A 2ZSDA 2DBQA 1ZONA 2IITA 4DJEC 1HDYA 1NVKA 1FYXA 1UBTS 2D4HA 2F59A 1FE8A 3MUEA 3CG0A 2DLDA 3E9ZA 2PM8A 2VAVA 1J56A 2JIQA 5LDHA 4DLXA 1WABA 3MJSA 3OHSX 4M0UA 4C4PA 2XQKA 1DP4A 2XCUA 2HV9A 4JCOA 4QXOA 3V8QA 1BS1A 4BNGA 4ZOYA 1JA9A 1OFHA 1XRRA 5HSGA 3AZQA 5JZMA 1BZYA 1L7OA 4TLBA 2E6UX 3MUOA 2NADA 2QU8A 1R74A 1IXRC 1GGJA 3N0EA 1HV8A 1HMYA 1QXSA 1UDRA 2BBSA 4YRDA 1M2WA 2A9KA 2R00A 3F0TA 3GJQA 5MN4A 3IAHA 4RY2A 5CU7A 4QDKA 3BQNB 3IUEA 3VKFA 4B17A 3UTDA 1RAAA 2HMWA 3W8NA 1XRJA 3O4FA 2QAGC 4B32A 3ZEAA 4YUXA 4QJ5A 1FJXA 3AF3A 4L08A 2WF5A 1O77A 3K8YA 3U48A 2IV3A 4E88A 4RPIA 1NP6A 1NBME 3EAQA 2B92A 3C5MA 3QBJA 4X3PA 5FJIA 1PLLA 5A5GA 4TSKA 3GHYA 1YMQA 4U2KA 4PLYA 3A37A 3L1KA 3WTBA 5PGMA 1J42A 1Y8RA 3L6CA 3O84A 4NCAA 1N4DA 2BKXA 4TSFD 3D7NA 2BR3A 4M9UA 2QR5A 4MWCA 3L6RA 3QBEA 1YDMA 4Q39A 5IJ0A 4KPEC 4IIXA 4E51A 3GFPA 3ZJ4A 4XJVA 1Z9BA 1KYVA 4REMA 3TW6A 1VHLA 2HRRA 4I46A 1HR0B 3BDVA 3LC7O 4R0NA 2O8CB 3LCUA 4C5CA 2CFIA 1NPTO 2FFQA 3IQXA 2JBAB 4L16A 4LBZA 5F77A 1GFIA 3ZBQA 1YFQA 2XB2A 1BWSA 4KUEA 5KQSA 4N9WA 3ADCA 1IZ7A 4N12A 2NUAB 2AQ5A 5B2EA 4K6GA 4EIWA 2GKSA 1WY5A 2Y8EA 1F20A 3JQCA 4UHCA 1BGXT 1B76A 3N2NA 4WGGA 4EB0A 4KFCA 3LY7A 5H1MA 3VYUB 2GN4A 4KKVA 4UHEA 4KOAA 3QMPA 4W8HA 2NM0A 4HEA1 4UBLA 2X0DA 3WKAA 4IFTA 1UODA 2ZIWB 1SFRA 3ESZA 1J9GA 3HCCA 4MRNA 2ZQZA 4A0HA 2FRVA 2RDMA 2HU5A 2YJGA 1KE2A 4IG4A 3DTNA 2GK6A 3C4QA 1BDHA 3LHKA 1RKVA 2DPXA 3LHFA 2HRCA 1M6VB 4X71A 2HJRA 2NU8A 3PEYA 1F8XA 2QI9F 3QI2A 2JGRA 3QVUA 5BUCA 1J00A 1DAOA 1MO5A 1SQJA 2Y68A 4TKUB 2C31A 1R18A 4ZZIA 1ZI8A 3B9RA 4LJ8A 3OX1A 4L1KA 4B4KA 1YHYA 4L3GD 4RADA 2J0QA 1ECGA 3OTWA 1G3QA 3H16A 4RGYA 5GXIA 3EWSA 2RHWA 4DMLA 2YX1A 5HF6A 1B9YA 4DE5A 1JQ3A 4D9FA 4P92A 1Y3DE 2Z8ZA 3FYCA 1TC2A 4ZI5A 3U6BA 2VTEA 5TV2A 1BVHA 3TRDA 1V5FA 3N5KA 1ZU5A 3B1XA 2EQAA 3PJGA 2ZROA 3HGMA 4EG4A 1BCSA 1ZD5A 2ZJFA 5COQA 2XUGA 1Q44A 3AERB 1MV5A 5I9MA 4D8TA 2NIPA 1XTZA 1M2VA 4YVFA 4NPCA 3BKWA 3FPHA 3M7IA 3IOYA 4H3SA 3G23A 2YNMA 2W6IA 3BN3A 4RPHA 2PLWA 2WNSA 1P6QA 1V4NA 1W4CA 2GETA 1SNYA 4OG2A 3V3TA 2H1WA 2VYFA 2Q50A 1R88A 1VG1A 2ENWA 3L49A 1H2FA 4KVAA 4F6LA 1PS9A 4FLEA 4NC4A 1WUKS 2ZI5A 3KTAA 5HA5A 1ZVQA 3X1WA 4C0LA 1P5JA 3ASVA 5HDQA 3F3GA 4Z4FA 1S96A 2Y9PB 4DWWA 3QEJA 2BW0A 4N5MA 4O3FA 1SXPA 3H2ZA 1ZNQO 4K8OA 2BGRA 1L5RA 5T4EA 2BT4A 3S81A 5HQ3B 2AG8A 4I5EA 1R0LA 5HRCA 1E7YA 4EFMA 2WBLC 1CHDA 3E5NA 2WFAA 1E1DA 3ZDQA 4CG3A 2DTDA 3K6SA 3E23A 3L0OA 4A16A 5IEJA 1ODFA 3PI7A 5K4HA 3R74A 4K28A 3ACDA 2NUAA 3ILYA 4W7HA 2F3SA 3R7SA 3ZQUA 1R37A 4YAKA 1UWLA 4M0CA 1IH8A 3UH0A 1NC3A 1M2HA 3F49S 2Y1KA 3GDWA 5DCYA 1OTHA 3MS2A 3Q4GA 4INPA 4EPYA 2ODTX 4HFNA 4HH4A 3D8HA 2RHCA 3IDFA 1Q11A 4EG6A 5JSQA 3K53A 2IODA 5G0VA 4RF5A 4D4KA 3VAAA 3ADKA 5DH9A 2DULA 4J77A 3PQ5A 4EFKA 2PO7A 3CLRD 1M6VA 2X15A 3FOZA 3DEKA 5CNMA 5C8XA 5K6TA 2PH3A 1W0KD 4INAA 3K1JA 3IIJA 3OJFA 1BN7A 1GAWA 2O0KA 1CC1S 3C98A 1FSZA 1SU8A 4TSRA 2LNDA 4S04A 2XZOA 3VSCA 4TTJA 4WLOA 2VDOA 3H11B 4DNWA 3A9VA 5L4LA 2O2SA 1W1WA 3M3HA 3SKVA 1CR1A 1RQ2A 3U9SA 4DQDA 5C5IA 3FNEA 4GX5A 4CF6A 2JK0A 1TB4A 1E0KA 4FGZA 5TVGA 1FVXA 2VHXA 4EDFA 4YPOA 1UKBA 1WCV1 3ECCA 1WMDA 2KE5A 2VEDA 3PE4A 4H5JA 4R2XA 3TCXB 1UR5A 2XSZD 3NTUA 5K0FA 1MABA 1OX6A 2OQRA 2X0EA 1X7YA 2PRKA 2PT9A 1HFWA 3ACBA 5BR8B 1IN8A 4LY9A 1GILA 3OE5A 2FJ0A 4DV1B 4MB0A 2OZPA 4C4RA 3F6YA 2W2QA 3TRIA 4MV9A 5IC7A 1IUPA 1MPXA 4BKQA 4PNEA 1YQWA 1XOIA 1H5NA 2ID8A 3HBJA 1PJRA 1NYLA 1XTKA 2C2ZA 1JR3E 2G4CA 3PNMA 4ZK2A 1XQYA 1DRWA 1QQ6A 2VPXA 1M74A 1S2IA 1WXIA 2Q4RA 3KEQA 3W5AA 3HXLA 3TJZA 5C92A 2JBWA 3G2IA 3B7FA 2H7VA 2O4CA 4AAYA 2O52A 2BELA 4ZYYA 4Q21A 3ZS8A 2HWYA 1N8KA 1RAIA 1NVWQ 3BCSA 4KACA 4ZMRA 3JYNA 2BGUA 1OIVA 3A2MA 1YR6A 4V0MA 4K3UA 2AR7A 2QPTA 2GZDA 4IVNA 4GBMA 4GMFA 3C3MA 1SUDA 4YRSA 1XA3A