3IUQA

Appep_d622n+pp closed state
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
682
structure length
667
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETTPVAKLIEQSADIYAFTLYEMGYRELPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 214
structure length 667
sequence length 682
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iuqA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iuqA01
2AJLI 2QXUA 2O2IA 2XQKA 4H77A 5AKHA 3F96A 1LZLA 1QOZA 3G9ZA 2PBLA 1DT3A 3DOHA 2EEPA 5AI9A 3WJ2A 1GKKA 3O0DA 3C5WP 1TRHA 4ETWA 4J0KA 2WHPA 3CN9A 5HF9A 5CT9A 4E14A 3A2NA 4AN0A 4JH0A 3TGLA 3FYTA 3R3YA 1WB6A 4Q82A 1JJIA 5FKJA 5KBYA 1ORVA 2GBFA 4LXIA 2C0QA 5E4YA 2DQZA 3HJUA 1CUHA 4G1FA 4W1QA 5DNVA 3QYJA 4B82A 1L7AA 4HVTA 1ZI9A 4Q3KA 4OYYA 3DL7A 2X76A 5C7YA 1QIIA 2G4LA 1DTEA 5CRIA 3QPDA 3V1KA 5SYMA 3JW8A 1ZI8A 2XMSA 1H2XA 4XIIA 3FSGD 2Q0XA 1UK9A 2QM0A 1HBJA 2BFNA 3BF8A 5C8VA 1EI9A 4KAJA 4ZV7A 1R9MA 1YAHA 3I2GA 1GGVA 2RONA 2Z8ZA 3G8YA 2XUIA 1ISPA 2WHPB 2XUOA 1XROA 2ES4A 2DQYA 5DTIA 1CIJA 2XDWA 4WFJA 1VLQA 3WMRA 1Q83A 6YASA 5JANA 1BN6A 3KXPA 4AO6A 4FFWA 1PFQA 4PO3X 5AP9A 4X94A 3JYHA 3W9UA 1XRMA 3D3NA 2VAVA 4DTCA 2XMGA 5T4FA 3ESCA 4EHBA 1RWQA 3KWJA 1CVLA 4EY4A 4FTWA 3WKEA 3H1BA 1ZGCA 1O6FA 1IMJA 1U65A 4OPMA 3S2ZA 4X91A 3OPMA 4DNQA 1DWQA 2ZJ6A 1TKRA 2I3DA 3WK8A 2PPLA 4KACA 1IUPA 4U2GA 1EDDA 3STTA 5IKXA 2OGSA 1G42A 3RK4A 2W6CX 5EHXA 1I6WA 5AKYA 2WIFA 2WFLA 4GW3A 5K3AA 5AI4A 4BAGA 3ICVA 2X5XA 3LCRA 5AKGA 1MX5A 4A23A 3FSGA 3FVTA 2GBCA 2WJ4A 2VAXA 4G4JA 3W06A 2BCEA 3R3XA 3MUOA 3GELA 1LGYA 2B20A 4BCDA 4B83A 2WTNA 3L1HA 1VZ2A 4OB7A 3DLTA 3QMMA 3STXA 1K5PA 5C81A 5LZ2A 5CBKA 3PF9A 4DYHA 1T2NA 2EDCA 5FUMA 3IUNA 5JAOA 1AX9A 5CT4A 2H9YA 2CMFA 4QWWA 5ALVA 1XRLA 5K3BA 1AQLA 5LZ5A 5CXXA 3ANSA 4UBKA 1YA4A 1LLFA 1RP1A 3H1AA 1LPPA 1C4XA 1W4LA 3D59A 1AZWA 4HXGA 3FVRA 5DTJA 4FFVA 5AIBA 3SWWA 5AK6A 2WUFA 4DNOA 4Y7DA 1VA5A 2WFLB 5LZ4A 3NWOA 1YA8A 1QIGA 3D2CA 4HRXA 4J0IA 4CFSA 5AKIA 2CB9A 1UOPA 5JADA 1MNAA 4XWGA 1HQDA 3AZOA 3MVEA 1K6EA 3IIIA 2O7VA 4U2CA 1QGED 1ZOIA 3LS2A 2BKLA 5IH7A 2ZYIA 1H2WA 1QONA 4L3WA 5DJ5A 2HA3A 3WK9A 3AIMA 4QDUA 4B81A 5T4BA 1XZHA 4IQ4A 2CJPA 1K63A 1N8SA 4Q34A 1XLVA 3DNMA 4PV7A 5JZ9A 4MXDA 3ZWQA 4IH9A 1SFRA 1W52X 1CUSA 2WG0A 1QIFA 3WIOA 4BZWA 1CUGA 1CR6A 5CH5A 4NS4A 2O2HA 2RI6A 3RLIA 3QVMA 1E8NA 3B5EA 1WHSA 5BWBA 3GZJA 3C87A 2V96A 1XKTA 3SC2A 2C4HA 4DMHA 1H22A 4H35A 1JMKC 4NVRA 2AXEA 4X6XA 5A7GA 4X00A 4MYDA 3V9AA 5F4ZA 1TK3A 2OAEA 3G0DA 1A7UA 5ALHA 4UFOA 1CUBA 3I6ZA 3ZLUA 2Y6UA 4WY8A 4ZXFA 3WKBA 3TEJA 3WKAA 1F6WA 1EDEA 4DM7A 1A88A 1ZD4A 3H2KA 4D9JA 5LLSA 3AZPA 1ZD2P 5AK4A 5H3HA 4WJLA 1UXOA 2XQIA 4KE8A 1DWOA 3DD5A 4N8SA 5AI0A 3FYUB 1XKLA 1VE6A 5A62A 4CCYA 3IUMA 5JAHA 1DQYA 2HDWA 1XFDA 3GA7A 2DR0A 2G5PA 1EXWA 2ACKA 5LZ9A 1Q0ZA 1E89A 2IIVA 2GBIA 3C6BA 3AFIA 4YK7A 4W1SA 5AI8A 3WL7A 4G8DA 1BEEA 2O7RA 3G0IA 4PNZA 4Y2VA 5DYWA 2C5GA 2XUGA 3QMWA 5CW2A 1EK1A 4BRZA 2WFZA 2V9ZA 2XUHA 1CUWA 2WILA 1TIBA 1EA5A 3W04A 3WKCA 3DL4A 5AM3A 4QLOA 4JUIA 4X95A 3ILSA 3U0VA 4BDSA 1CUZA 4Q3LA 5AM1A 3WA7A 2HA4A 3BL8A 1CUUA 4OCZA 2HU5A 1C7JA 4I4CA 4L0CA 2GYWA 3B12A 3E4DA 5T4HA 5DLPA 5K3DA 2PX6A 3CCBA 4UBOA 5LYYA 4H0CA 2VA9A 2J4CA 3DKRA 2QKYA 1LPSA 3W2TA 3N2ZB 1JT2A 5ALMA 2DFPA 1EB9A 4RE6A 1BEZA 2IITA 4F60A 3HZOA 1SCIA 4K2AA 2LIPA 4N8DA 3UMJA 2HU7A 1JMYA 4DIUA 3FAKA 3WA6A 4FLEA 1FFEA 1R88A 3C6XA 5HQ3A 2WUDA 3QPAA 2RAUA 1A8UA 1UK8A 1JKMA 1XZMA 3WK4A 1BRTA 2DSNA 5A71A 1WCYA 4UHEA 2XUPA 3STYA 3IBTA 4C4YA 4WFIA 2AJCA 1VKHA 4J0HA 3NUZA 3AILA 2RIPA 5I9IA 1D07A 4GEGA 3PUIA 1LPBB 3STVA 3WWCA 1CEXA 1PJAA 4H18A 4F5ZA 2JGMA 2ZVDA 2XUQA 3WI7A 2Z3ZA 3D4LA 2OQVA 3IVMA 5A7HA 1QE3A 4BCBA 4ZGBA 1EVQA 3K9BA 2WJ6A 5AI5A 4HRYA 1UK7A 3R40A 4ARAA 5JD4A 1WOMA 5CH3A 1USWA 1AKNA 2GZRA 5CMLA 1XQYA 4X97A 3QBJA 1VOTA 4U2BA 3IB3A 3WK6A 5ALTA 5CH8A 1LBSA 1MT3A 4BCCA 2XE4A 3L1JA 5HQ3B 1PV1A 3D0KA 1WB4A 3F97A 2UZ0A 2PM8A 1B41A 4MEBA 2IX9A 5FPQA 1SCQA 4IH4A 5AHXA 4BTVA 4C4ZA 1XRPA 4UBMA 1CUIA 5D3KA 3RM3A 2XMCA 4AMYA 1XZDA 3H0CA 2V98A 4G9GA 1RYYA 3ESDA 2I03A 1XRNA 2XUJA 5AKXA 1TQHA 4X6YA 3V1LA 3EF3A 1HL7A 4J0DA 4MJ3A 4Y2JA 5D3ZA 5DYTA 5A6VA 1GPKA 2WIJA 3HRHA 1SCKA 2QTBA 4L9AA 4WY5A 1UFOA 5IVKA 1OCEA 4J0GA 3O9VA 1E66A 3A2MA 1E8MA 5EHZA 3QM1A 5JYCA 2CKMA 2XQJA 4RGYA 1LZKA 4ZRDA 2HHAA 2VF2A 1DINA 3PI6A 2VT7A 5IVHA 1G4HA 2B4KA 5AK3A 1E5TA 2HM7A 4BC0A 4UHDA 2ZSHA 2JGKA 3WJ1A 4FHZA 3WL5A 4PQEA 3ICWA 1FFAA 1TCAA 1QLWA 1ZIYA 1ZJ4A 2V97A 1YSCA 4LXGA 3UUEA 2DHEA 4GBGA 1TAHA 1SOMA 3E0XA 3CXUA 4ZWNA 2VJCA 1CV2A 2ZYHA 1AC5A 1K8QA 1R3DA 2DHCA 2RGUA 3K2IA 3LLCA 2XUKA 1Y37A 2WUGA 3E1GA 4X6UA 4QDTA 5LP1A 5AKEA 5FV4A 4ZI5A 1BCSA 4H7EA 3M83A 3C70A 1THTA 3S8YA 3WL6A 4BAUA 2QMQA 4H7IA 4I19A 4TPKA 1A8SA 2PSEA 2CUTA 4H7DA 4Y2SA 1N1MA 1CUCA 2WHRA 4QEKA 5A7FA 4H7JA 1XQVA 2I3ZA 2E3JA 4HAIA 1QIJA 1J07A 3BJMA 4GDMA 2XUAA 1WHTA 5KWJA 1NU6A 5DNWA 1YB7A 4K5QA 1NX9A 1F0PA 5ALPA 3QITA 4PSUA 5IVIA 2B61A 2JF0A 1U8EA 2OXEA 3O4HA 3QH4A 5HFAA 4CIBA 1AMNA 3T4UA 3ESAA 2D5LA 4Y9SA 1CUYA 4CI9A 2OQIA 4ROTA 2PUHA 3WIBA 2JGEA 2WU3A 4P9NA 1W6RA 4Q3OA 4HS9A 1CQZA 3DS8A 3HI4A 3C45A 4DSAA 1YS1X 4BE4A 4P92A 1QO9A 4OB6A 3FLBA 4OYLA 3DQZA 5EI5A 4U2FA 4QNNA 5EGNA 2VJDA 1ACLA 1AUOA 5AH0A 5K5EA 4DNPA 5HCUA 1EH5A 1Y7HA 2PKYX 2PSDA 2BGRA 1WPXA 4Y2UA 2C0PA 1GQRA 3H18A 1JU4A 3C6YA 5HK8A 4RNCA 1U4NA 2CEKA 2HA5A 4WDQA 1GT6A 5HF6A 2QR5A 3WYDA 4ZV9A 4NMWA 4DLNA 4DMKA 2HU8A 3G9TA 3R3UA 1QFMA 2ONCA 3G0CA 1MJ5A 4Q1VA 5AO9A 4LYEA 4X85A 2BAGA 1P0QA 5ALXA 4EY7A 1AGYA 5JAPA 5ALSA 3HYSA 1ODCA 1UOOA 3BIXA 3DJYA 1XQWA 5AJHA 1HKHA 4Z49A 3G02A 4NZZA 4J7AA 4CG3A 2PUJA 1OILA 3KDAA 1MN6A 4LKOA 4G8CA 3F67A 1QIDA 4QZVA 4IH1A 3C8DA 4J0CA 3AIOA 1DWPA 4K6KA 3C8HA 3PE6A 4P08A 4ITVA 1VJ5A 2QS9A 2BUBA 1IZ7A 4UHFA 4YPVA 4B9EA 4KRXA 1HLGA 1P0PA 1FFDA 2XMBA 4H7HA 2FX5A 3BWXA 3BXPA 1JU3A 2G5TA 2WFMA 3IDAA 4UBJA 3BJRA 4W63A 4OU4A 1BROA 1LPOA 3M82A 3EQ7A 1UWCA 3D5EA 3VDXA 5HFNA 2X8BA 3G0BA 1SC9A 5JASA 3D2BA 3H2JA 1A8QA 2XLBA 1X2BA 4N5IX 2JBWA 3Q8WA 1XZAA 3I2JA 3DCNA 4GECA 5ALOA 2P8SA 1ZI6A 4C89A 3LIPA 1CUEA 3CN7A 3PDCA 1CUDA 5ALKA 1CUAA 4BVLA 2VT6A 4QDZA 1MX9A 2QJWA 2WIGA 2PU5A 5JD5A 1CQWA 1CUFA 4CG1A 3G0GA 3D7RA 2QRUA 1YS2X 5J3JA 4I3FA 1CPYA 1LPNA 1BCRA 1DU4A 3RKSA 3SX4A 3M81A 1UT6A 4UFPA 1M33A 2VJBA 4ARBA 3ZLVA 4GXNA 1WB5A 3BIWA 3BE8A 4U2DA 4FLFA 3NOXA 3WLAA 4DSZA 4BATA 4A5SA 2WIDA 4N8EA 5CXUA 5AKZA 3EQ9A 1EB8A 5EHQA 4AZ3A 1TCBA 4G4IA 2QZPA 1MAAA 3NGMA 3LIIA 1CUVA 3G9XA 3WWOA 2WUEA 4AO8A 3HABA 3MUNA 4RE5A 3I2FA 1FFCA 2PL5A 5ALDA 5AKKA 1ACJA 3AUKA 4LXHA 4CCYB 1T4MA 2CBGA 3LP5A 5ESRA 5AIAA 5JAUA 3E3AA 4BAZA 5CT8A 2Y2VA 5HZGA 2Y6VA 5ALUA 3B3QA 1W76A 1ZD3A 3KSRA 1C7IA 4CIAA 5AICA 4PSCA 3K6KA 1ZD5A 4ZREA 1XZLA 2WTMA 2B9VA 1TCCA 3W9BA 1XLUA 1MTZA 1QIKA 3BDVA 3W05A 3T52A 4EY6A 1LPAB 1YAJA 1J2EA 5FXMA 3I2IA 3A2LA 1FJ2A 5AKJA 4MQLA 1XZEA 5HKBA 1BU8A 5YASA 5BV7A 3RARA 2BUAA 3OOSA 4QE3A 4E11A 4YASA 2WHQA 5IVDA 1JI3A 4LHEA 4P93A 5ALWA 3WL8A 2WU4A 1YR2A 1H2YA 2XUFA 4Y2YA 2VQ6A 4QDXA 3V1NA 2G63A 5EFZA 4BVKA 3H19A 1AURA 2HRQA 4LYDA 2YASA 1MO2A 4OU5A 3IUJA 4KE9A 3D2AA 5K3CA 3C6ZA 4IO0A 3WWPA 4GHWA 2BUCA 2Z8XA 1X70A 2WM2A 2D0DA 4HZGA 3EQ8A 4F0JA 4AX4A 5ALJA 2HFKA 3HACA 3I2HA 4UFNA 5FPPA 3H2IA 3FBWA 4K6GA 5E2IA 3YASA 4V2IA 4B80A 2JGJA 1VXOA 2J3QA 5ALNA 3EIOA 2VATA 4AO7A 2XB6A 4RPCA 5AK5A 4HXEB 1QZ3A 3I6MA 2K2QB 1ODSA 3F98A 1R1DA 4G8BA 2C7BA 3FLEA 5BOVA 1IVYA 1OXMA 1MNQA 5AOBA 5HKAA 4J3JA 3ZPXA 3GBSA 4QLAA 3TJMA 3FCYA 4KJXA 4FWBA 4MWSA 3F9CA 3QMVA 4G5XA 5D6OA 2Y2UA 1FSSA 2PSJA 2OLEA 2GYUA 3O4GA 2ORYA 5FP0A 2ZYRA 5EIAA 3OURA 2HADA 1THGA 4AQDA 2VJAA 1QO7A 4TVKA 2C58A 1DX4A 1EX9A 5DNUA 5HK9A 5ALRA 4B84A 2OCGA 1QTRA 5CTAA 1KEZA 3H17A 2OG1A 2WQZA 1CUXA 2OCIA 4Y2XA 5AOCA 2BJHA 1JJFA 3AINA 2AJBA 3IUQA 5LIPA 2JGFA 1XQXA 2YYSA 2J4FA 3MGAA 1UOQA 5E4JA 4EBBA 4FNGA 3I1YA 4BBZA 5T4EA 3HSSA 4A16A 3WZMA 1FFBA 3R0VA 2W22A 4JNCA 4GI1A 2C5FA 1QIHA 3DKKA 1IUOA 2R8BA 4G4GA 4W9RA 1VA4A 5ALIA 1N5RA 4PW0A 4BTLA 4FBMA 4OB8A 3O4IA 3OTQA 1N5MA 3I1IA 5DYYA 4JEIA 2FJPA 1CLEA 5ALZA 4N5HX 4B7ZA 2FJ0A 4C87A 5LZ7A 2AJDA 5JZSA 4F21A 1ODTC 4KE7A 3ESBA 1G5FA 5FRDA 4WDRA 1XLWA 3FLAA 4XJVA 4DGQA 4FLMA 3VKFA 3KWFA 3FCXA 3VJMA 4FMPA 4FNMA 1EHYA 3TRDA 1EINA 4UBLA 4JYMA 4B6GA 5K3FA 2XMRA 2O2GA 4TGLA 3ZI7A 3M3DA 5JALA 5AM4A 2I78A 2YH2A 3GFFA 1S8OA 4AMZA 4KYVA 4UHBA 1F8UA 1XRQA 3R3WA 4KAFA 3A70A 4L72A 4MEAA 4CCWA 1LPMA 5HF5A 4M0MA 5EHNA 2WSLA 4BYMA 1HPLA 1XZFA 2EDAA 2JGLA 2XMZA 5CT5A 5BWCA 3HXKA 2HA2A 4MYSA 4AZ0A 5AM2A 4FDMA 4KE6A 4B0OA 4QA9A 2OAGA 1ZIXA 2ZYSA 3ZLTA 4W1RA 3ED1A 4HTAA 1UK6A 5JZBA 1XZIA 1WM1A 4DMCA 4INZA 3F8SA 3O95A 4UHHA 4C4XA 4W1PA 1H2ZA 3OM8A 1R4ZA 3WQHA 1GPNA 2JEZA 1LBTA 1W75A 4BP8A 1CFJA 2NW6A 4M0FA 4BRSA 3EBLA 5K3FB 1XZCA 5FOQA 2CZQA 4J03A 4C88A 5ALGA 4BZZA 1VXRA 3WWEA 4YX9A 3STUA 2AJ8A 5ALEA 5JARA 3FWHA 4OSEA 1YCDA 3VJKA 1H23A 1K4YA 5KREA 2JIDA 4EA6A 3ANTA 3STWA 4Q05A 3DOIA 3O9MA 2HA0A 5DWDA 4X71A 5JIBA 1P0MA 4EUSA 4BVJA 3VISA 2JEYA 1QTIA 4Y2QA 5AI6A 4BP9A 3FYUC 4WCVA 2VSQA 4X92A 1NU8A 3DYIA 3H2HA 3QPCA 3ZV7A 2FUKA 1KU6A 1ETHA 3H2GA 4C01A 2H7YA 1BE0A 3FYUA 4GLBA 4B0PA 1X2EA 5JD6A 5I8PA 3OC0A 1F0NA 1XRRA 1B6GA 1DX6A 4DMFA 2JGIA 2QVBA 1R9NA 2ROQA 3FOBA 4H7KA 5LKAA 5LZ8A 2XMQA 4KR0A 1ZJ5A 1ORWA 2QJRA 5E4TA 3QZUA 3IURA 4C6HA 1Y7IA 1O6GA 1IZ8A 4X7BA 5AM5A 3JWEA 1CRLA 4M0EA 3KD2A 3OG9A 5KWIA 5ISMA 4JYPA 3X3HA 3VVLA 2Z5GA 3PFBA 2HA7A 1WPRA 4X90A 2XQFA 5FLKA 3PF8A 2Y1KA 5C8ZA 2QUAA 2QOEA 2XUDA 5K3EA 1EVEA 1U2EA 4XX1A 4FOLA 1MPXA 1YB6A 4Y2RA 4UBNA 1G66A 4GWLA 4KAAA 1XZJA 3H04A 4IHAA 1J1IA 3PUHA 3VVMA 3DEAA 4AB1A 4OD0A 1VE7A 1GKLA 4E46A 4B9AA 4OUKX 3HEAA 1Z68A 4G9EA 1GXSA 2WJ3A 1GZ7A 4QWMA 5AKLA 4DNFA 2HFJA 1LNSA 3AJAA 3WYNA 4QDOA 1QFSA 4UUQA 1E8DA 1P0IA 3C43A 3I6YA 1Q84A 1DT5A 1E3QA 2VEOA 1Q0RA 1DQZA 1UKAA 3IA2A 4CG2A 3AIKA 5ALLA 4J0JA 4O08A 4EY5A 2GYVA 2XLCA 2OGZA 2ECFA 1HDEA 4UHCA 4UPDA 1CUJA 3R41A 1L7QA 2DHDA 2WIKA 3L1IA 1XZKA 5SYNA 1EK2A 4MQMA 4LIPD 4E15A 5I7UA 2PU7A 3WKDA 3DDUA 1R50A 3IULA 2WKWA 3Q0TA 2RHTA 2GZSA 4BDTA 3I2KA 2BGNA 3WZLA 3G7NA 3HC7A 3WWDA 3HLKA 2XT0A 1GQSA 4B85A 2WLSA 4KRYA 3VJLA 4MWTA 2WG1A 4EZIA 1KU0A 5FDFA 2QXTA 4K6HA 1UZAA 4BC1A 5HF8A 3U1TA 2QT9A 4X3CA 3SK0A 2H7CA 2PVSA 3GUUA 3R3VA 3PFCA 1L7RA 3P2MA 4PF1A 4FBLA 3DYVA 4UBIA 4X93A 2YXPX 4H7FA 5ALQA 2QUBA 4BE9A 3WK7A 1UKBA 5AM0A 1JFRA 3BDIA 4PSDA 2ACEA 2DCMA 1J06A 2OPHA 4EY8A 5ALFA 2R11A 4Y2PA 3CCCA 2H1IA 3KOOA 4KEAA 3WK5A 2ZSIA 3FNBA 1ZGBA 4BB0A 2GBGA 4S0XA 2HIHA 3N0TA 2HRRA 2RHWA 5LKRA 3AZQA 2VTVA 1BN7A 2HA6A 3UUFA 3V1MA 2H7XA 2XMDA 2Z3WA 5ALYA 4FKBA 4Y2TA 2HL6A 4U2EA 1XZGA 5A2GA 7YASA 4XVCA 1QIMA 3R3ZA 1JJBA 1ZICA 5CT6A 5EIEA 5JATA 3O4JA 2ZJFA 4AN1A 3GROA 1VZ3A 4WFKA 1MAHA 2WG2A 5CURA 2OCKA 5D7BA 1W1IA 2PSFA 2XI4A 4EB0A 3A6ZA 4AXBA 1QJ4A 5EIHA 2OCLA 2XQGA 1MX1A 1BS9A 3C5VA 1XZBA 3VXKA 1GPLA 3PICA 2ZJ7A 4HXFB 2PSHA 5C8XA 5AOAA 3I28A 3BF7A 1IUNA 1YASA 3V48A 1UKCA 2J3DA 3G9UA 1QIEA 1MU0A 1EDBA 2OGTA
chains in the Genus database with same CATH superfamily
5B30A 1RM5A 4JYBA 4HDMA 4OQZA 3ZVRA 1EPUA 3B89A 3PLAE 4CM6A 1GCGA 3BD6A 4IIEA 2PD3A 3NATA 2ID8A 4WLEA 2YJ3A 5C4GB 1GPUA 2CXPA 3CN9A 4TWAA 4ZCIA 4BASA 2RGXA 3RR2A 1MCZA 4Z9BA 3KTAB 4GMKA 4TOIA 3E4CA 2FLKA 4RDXA 5H1YA 1TM5E 4HVTA 3KOYA 3N07A 1ZI9A 4OYYA 3P9NA 3MT8A 5IDVA 4PZLA 4EJFA 3V1KA 1SBIA 4FINA 4F1JA 1ML3A 1H2XA 3K35A 4RJKA 2A4MA 2L18A 4MUBA 3OLCX 4EEZA 4MV9A 1WUJS 4DCTA 2VRWA 3R0IA 2UUAB 2ID9A 3R1IA 4WFJA 2L2QA 2JIZA 2VHQA 2CB0A 4BGVA 1OV6A 4C1BA 3O92A 4L6AA 3T9FA 4HBGA 5MGBA 4R98A 4AFNA 1H0HA 4JC4A 4GR9A 1C14A 3EC2A 2JLAA 2VPWA 4X91A 3G1WA 3MBIA 3KJHA 3ORQA 3W5SA 3OM9A 4E3WA 4MW6A 4N12A 1LC3A 3DE1X 5TQ0B 1ID1A 2WIFA 2F4VB 5AI4A 4BAGA 4EITA 4H1WA 1EFAA 1GOHA 2FWBA 1QS0B 521PA 2XB4A 4LGNA 5B4UA 1SUSA 1WE2A 1L4MA 4IJVA 2YWXA 2X77A 1P4RA 3PX2A 2RJNA 1KZYC 4TKZA 3AM5A 1NQVA 5CBKA 2H1LA 1EVIA 3MCWA 4NENB 5KYUA 4FU0A 2AQKA 1QORA 4EF6A 4HZUB 2HMYB 1JHPA 1AQLA 3JQBA 3BKWA 5JNTA 821PA 3DDOA 1KKMA 1U9ZA 2J85A 2ZJAA 1E9CA 2ZBPA 1MQSA 1O96A 2HY7A 1KAOA 2HWXA 1ZVKA 3DXMC 2V7EA 2ZW9A 1P1KA 2IHVA 3USCS 3QVTA 3MJFA 3D2CA 2D62A 4FB4A 1VG1A 1GTMA 2XYHA 2X1MA 1C1XB 1OA1A 4XLLA 3IAS6 3T38A 4OWRA 3FPJA 1U8CB 3HLYA 3DMFA 3T3HA 2FVYA 2V45A 2BHNA 4FA1D 3X2EA 3OAAD 4TXJA 3RJTA 4DUPA 2XDYA 4QAMA 3GFGA 5IJXA 4EP1A 5JFTA 2YMLA 4R4JA 1T25A 3AR4A 2EIEA 2WMOB 4KPEC 4YDHB 3ONFA 3QIVA 3CTPA 4WN9B 4DMHA 4Q9DA 4NVRA 5A7GA 2YW9A 3GJ6A 4H1VA 4I55F 3MUEA 2YWGA 5CB4A 2O8NA 2NUPB 4FZ3A 4Y9RA 3PU6A 3WP0A 3HE3A 3K4HA 1NN3A 2HXYA 4ZXFA 3RSCA 4BMSA 3PYLA 3CPHA 2I3SA 1I51A 4ZN4A 4DM7A 1T10A 5HIAA 3AZPA 1JLLA 2XQIA 4RZIA 2BPOA 2X23A 3EOZA 3NBUA 5IUKC 2YVUA 2JH9A 3ZE8A 1N6EA 4H6VA 1Y8RA 1E1QA 4W7SA 3GA7A 4KUEA 2ACKA 3CSUA 3MJ4A 3H5RA 3P7MA 1W9MA 5DYWA 5LR6A 5CLJA 2V7QA 2EXXA 2WKQA 1XI2A 3H4TA 2WFZA 4JL8A 3FTDA 3C7CB 4QJ5A 4QUJA 3QUQA 5KNBH 3NBAA 1EU1A 3G8DA 3OW8A 1YQQA 2R5WA 1D2NA 3VYSB 3CY6A 1IOLA 2A9JA 1TE2A 3PJRA 2NQ2C 1JH8A 4GSLA 4L0CA 2XWPA 1X13A 2VUHB 4WN3A 3EFOB 5NLLA 4IFEA 4FYMA 4DTIA 1OOEA 3P26A 2C2BA 4JP3A 2HOQA 5BMVF 1SKAA 1KZGB 2NVUB 2WWWA 4HDRA 2BEVA 3ND6A 3WSVA 4S1VA 4I9HA 3UTDA 1FFEA 1LH0A 1W34A 2WUDA 3DE3X 1JKMA 2ZVPX 1LD3A 1IIBA 1KRXA 2VNKA 4B3XA 4IR7A 3QKRB 4BZPA 2UYCA 2NO6A 2PFKA 3NRCA 4OREX 5CD1A 1PDWA 4I8DA 1H2FA 3IVMA 3D81A 3LLMA 1Q57A 3WNCA 2I34A 3F7MA 2YBDA 4LWPA 1TB4A 2W6JD 1JYFA 2Q3LA 3UK2A 1J4AA 2ETVA 4V1CB 1ZHHA 3RS0A 3DCIA 4O3TB 1NWHA 4D9BA 3IQZA 4Y7CA 2BMFA 3T0FA 3NHJA 2O8EB 4O25A 4Y2HA 1K27A 5JMOA 3MMYA 2J32A 3GFOA 3G89A 3KCIA 4JX8A 4RAOA 1GAQA 2WSSA 3X1WA 2B8WA 2JRLA 1OB2A 5AVZA 1I9GA 4J3NA 4XX0B 2QTHA 4LAFA 3PQ4A 4XYLA 2XF8A 4KQ1A 1GPBA 3V1LA 3A1CA 3F8TA 3GZNB 4MJ3A 2TSYB 3ZKAA 1LBHA 2GN4A 2VBIA 3A32A 3BL6A 2VDUE 3SYNA 4BKOA 2AJTA 3NANA 3VRHA 5G1PA 4ZC1A 4ALJA 4QGSA 1RZRA 4WK6A 3R3JA 1GOTB 3V6LA 3G8CA 3DO6A 5K6AA 1JW9B 2B4KA 4UUPA 5LUAA 3G2MA 3PKZA 4JODA 1FQWA 4DCNA 4A27A 2FR0A 2WA2A 1QK3A 1ECFA 3DBIA 5A1JA 4LXGA 3UUEA 1SOMA 1TK9A 4ZWNA 3UJ3X 2ZI6A 3SMRA 3PHHA 3K2IA 3LQ1A 3WS7A 4OHCA 2XCLA 2BMDA 1L5LA 3E1GA 1SHJA 2CCGA 2WU8A 3UK6A 4HK4A 2JLXA 3LWDA 4H7DA 5L7YA 5TJ9A 2WHRA 1C1DB 2GN2A 2P9KC 2JHAA 1JEAA 1SUDA 4K8RB 3WB0A 1NR0A 3GEBA 3ON5A 3WLNA 3VI3A 4F97A 1ZUWA 2JGDA 3E9DA 4HWTA 4BWYA 3IOMA 3QH4A 2YUTA 3B5IA 4JI7B 2Q1TA 5DV9A 2FZ4A 1DVRA 2ZANA 2QTRA 3T3EA 5EZSA 3UKJA 1HYGA 2JAHA 5JSHA 3A2KA 4KR3A 2R1ZA 2H07A 5J5AA 3TOSA 3HI4A 4DLXA 5BYKA 3I53A 4UXHA 2P77A 3WGLA 1ZGJA 1PZHA 4OB6A 3KV1A 1BCSB 4Z9AA 2HNBA 5HJEA 3I7OA 3AYZB 1PL8A 3KDSE 1XTJA 5DE3A 1M8FA 4FM9A 3B3AA 1C1HA 1BIFA 3TLXA 4FSHA 3AF0A 3SKXA 5TMDA 1JF8A 2CEKA 2RGRA 2HLDD 3ZD6A 4F4JA 4X20A 3W1WA 4ZV9A 1G6KA 5E8RA 2HU8A 1OZGA 1G98A 1MJ5A 5CB6A 1JIKA 4FJ1A 2BWJA 5IARA 4AS1A 3EIXA 4PFQA 1P0QA 3N8KA 4I0WB 2E0IA 2WPNA 1HXHA 4WV3A 1C2YA 5J5CA 3I76A 3K94A 4U7HA 4DA8A 3PA6A 1KQGA 2VQEB 3I0MA 2A9RA 4S1WA 5BNFA 2MSDB 3I12A 4YAGA 3T8YA 3FYCA 2JAQA 2DPXA 1TW3A 4Y6QA 3PKIA 3QOXA 2P91A 1QP7A 3DFKA 1BHQ1 1FJXA 4ATNA 3GOHA 4ZEWA 4E09A 4QGHA 1HE2A 5DEOA 4RQBA 2Q6VA 1FDRA 2QS9A 3AEZA 4QELA 3SNKA 1E1NA 5B58T 1HLGA 1DBQA 5D51S 2NXNA 3ZWMA 5FFFA 4QUIA 3AESB 2A9FA 3IFSA 1CY6A 4NAUA 2G40A 1WTCA 3FNGA 4OU4A 4W9NC 2EBWA 3RC2A 2ZRQA 1AY0A 5J5VA 5JASA 4EATA 3IQDB 5ES3A 2FA9A 4PNKB 4YBRA 2HYEA 4YRSA 2IX3A 2JFOA 1Y1TA 4OAPA 2HQ1A 2TRCB 1GL9B 1CUEA 2QX6A 5BN1A 1GPAA 4M4SA 4MARA 4LMRA 2FQWA 3NJRA 4QDZA 3C16C 1IZZA 2W00A 1E3TA 4L8FA 1HLDA 3IT0A 2BBTA 4K9PA 1YDWA 3H8WA 3H87A 4OI1A 3CRMA 1SUBA 1KMIY 1OC4A 4B4WA 2VJBA 4H08A 4KR2A 4MI6A 5CB4B 1E1MA 4A2MA 5EKUA 5IH3A 4KP7A 3I9OA 2CWDA 3T3PB 1D6SA 2Q0QA 1JMXB 3SZLA 2WAAA 2EAUA 1P8JA 1E5DA 4EYKA 4G4IA 1S4QA 4EEXA 1JLLB 4KUHA 1WPGA 4UNQA 1O94D 4LY3A 1YCHA 4CV0A 3WR5A 1J2YA 1A9PA 4GGPA 1KKUA 3L6OO 2O2XA 4BB6A 2H51A 2P4SA 3HDQA 4OQYA 5CLQA 4YHHB 4ZICA 4GQIA 1CRPA 3DDHA 2ZRPA 3T95A 2QPLA 3VU9A 2PA3A 3PDUA 3W05A 4B43A 1COWA 4DQKA 3QRWA 3NEPX 4PC1A 1HE8B 3RARA 3R8FA 3P2JA 1V48A 4HD8A 1IBKB 4AY6A 4P81A 3OIGA 10MHA 2J48A 4Y2YA 1KAEA 3CS3A 1X87A 4Z1MA 3GDHA 3KOXA 1AURA 1QV9A 2YASA 3L6UA 1FIUA 5LXTA 2P2ZA 1QC5B 1CZKA 4HDRB 2AD5A 3LAWA 2BUCA 2HUNA 4E5MA 3KVRA 2WR8A 1KTVA 4EAAA 3HDJA 3DA8A 4EHFA 3HVKA 2NPOA 2C3PA 3M1LA 4CM7A 4RV9A 2J3QA 4JLMA 3TM4A 4QYXA 1MGPA 3PNMA 1W85B 3JWPA 5JD3A 1GL3A 4LMBA 4X0EA 5BOVA 1MNQA 2LPMA 3VYTB 3COSA 3WIUA 5IBQA 3NTVA 3C5HA 2Z8YA 4RA6B 2P90A 2AC2A 3U09A 2ONKA 5F2OA 4JLSA 2BE9A 2VSFA 4ZMBA 2CNWA 1K86A 1NT4A 5IM5A 4AQDA 1JHRA 4AK9A 1LJLA 3WGTA 3QNUA 1MLDA 5CVCA 2JHCA 1D2GA 3I6BA 4A0AA 4NXNB 2P4EA 1PCXA 4Q7QA 4E4TA 4Z1OA 1DBRA 4Y2XA 3AINA 2ZAMA 3CRW1 1HFKA 4RETA 3N2GA 3BFVA 1V16A 4CU2A 5T4EA 1WWKA 4XWTA 3U13A 1EVZA 3TQRA 5C2JB 1QIHA 4G4GA 2CZGA 4D4LA 4ENPA 1N2JA 3WDKA 4PW0A 3SOZA 1ZEJA 3PRYA 4YFYA 1H65A 2P2DA 4X5OA 2B5LA 4QOJA 5LCXA 2A78A 1XLWA 2ZSJA 4HVLA 4DGQA 4RK7A 4DIBA 4EHDA 1U0HC 1PLJA 3KOUA 2PUDA 4H7PA 5KS2A 1Y5RA 2BI4A 1OPRA 3C3DA 2MYUA 3KK0A 1QKKA 4F5WA 3PYXA 2AMYA 2C04A 2J0VA 3CLUD 5JALA 3KOMA 1AV7A 3T5BA 4YDQA 4LV6A 4HNSA 1I94B 1RWBA 3BRWD 3EF1A 1NVAA 2GHIA 2WA1A 4Q1BA 5B7PA 2D7CA 4UPVA 1UH5A 3K20A 4YP6A 3G68A 4MB6A 3G2LA 1R8XA 4PZPA 4TYPA 3GLKA 4IINA 3KQLA 4BBAA 2BH2A 3T1VA 1KDYA 1XZIA 3KKKA 3VI3B 3ITNA 2RHBA 2VWHA 3F8SA 5DP1A 4IOJA 1W75A 1L5MA 1RTKA 4LVUA 3WLKX 1OFHA 1RQ7A 2NO7A 3U62A 4KXFB 1NQXA 5K3FB 5H7XA 1T8YA 5HBGA 4C88A 1T2AA 5ALEA 4O33A 1C41A 2D5IA 3GRZA 5AXCA 3B36A 2Z2OA 3ORFA 3HKDA 3IAS1 2B3DA 1GDHA 3H2HA 2G9VA 1VSVA 2RGAA 3EQ2A 5FR1A 3H2GA 2E85A 4G84A 4JBGA 2PLWA 4GX0A 4WL0A 3CX4A 2QVBA 1BAPA 5FPHA 4X20B 1TMOA 3T41A 1ZESA 5F76A 2IYPA 4UMEA 3ROFA 4G2TA 4G63A 3T94A 3H0KA 1J56A 3R3SA 5I51A 3KJZA 2IU4A 3QU7A 4US1R 3TS1A 5B36A 1EZ4A 2Q99A 3PFBA 2EATA 2HA7A 1J9EA 2XQFA 5LMZA 2R2GA 1ZHFA 4A10A 2QC5A 4BX8A 4LHZA 2V0CA 3GNLA 5LU9A 2WZDA 4NYJR 4GI5A 1I30A 4OHOA 4ZYUA 3S6JA 3W15A 2PUCA 4B9AA 3GMTA 2C4NA 3NBXX 3NC0C 3I8SA 3V2HA 5LQNA 1Q1AA 3MYRA 2RARA 4NONA 4Q24A 2X2EA 5ALLA 3GJ5A 4XWKA 4HQNA 4O4JB 1ZSYA 4UHCA 1JEYA 4S2UA 1CUJA 2W7TA 1H6DA 4QBHA 1BXGB 3CZ4A 3PFFA 3DXYA 5C46F 5SYNA 3M49A 2AOUA 1U6JA 4AKGA 1USKA 2GPBA 2DT5A 2I87A 2QTMA 1M34A 5K0ZA 1NW6A 2HTFA 3K70B 1WDMA 4H31A 3G7NA 1RNLA 3IL2A 4YUZA 4G0OA 1TUBA 4WACA 2CHGA 1MKYA 4POAA 1F1BA 4ZVOA 3G82C 3OE7D 1SVOA 4D25A 5LP6F 2ZJ2A 3OL2A 1JPJA 5LMUB 2IEDA 4Z0PA 1OY1A 3AOEC 4C76A 1JH9A 3P2MA 3V1UA 4PF1A 5KTSA 3FBTA 5SZHB 5MFPA 5HM8A 1HH4A 3P45A 5F7OA 4JSTA 3KJEA 5A5GA 5E6UA 1M6VA 4WQMA 4MW2A 5DPMA 1I0LA 1KH2A 1NUTA 3PL1A 1KO7A 4MW1A 1OXKB 2B35A 1ODKA 3GIWA 1NI3A 4F8YA 1ZICA 4P34A 1W4RA 1T9HA 5I7FA 3DGFC 1RE1A 2H63A 1COZA 2WG2A 4B3FX 3RODA 3K1AA 5CIWA 1AIPA 1JJVA 4FR0A 2YRXA 3PICA 5EOVA 4IL5A 9ABPA 3IR6A 5BSTA 4XUGB 1S9HA 3ZQJA 1EDBA 2D06A 4KN8A 2AJLI 4EGQA 1OIXA 4X44A 1KEKA 2QQGA 4TV8F 1QCYA 4NC4A 4JKIA 4NFLA 1Q91A 3TNFA 5HUJA 4URFA 2IU0A 4C0AC 4ND2A 3AO0B 1E6MA 1Q0TA 5KQRA 2FPXA 4RDIA 2IHUA 2WRZA 2G80A 4RQAA 4RFSA 2O2ZA 3W8RA 4XFKA 3R3YA 1F06A 1X8XA 5LC1A 5I7RA 3ELWA 3DEYX 4WXEA 2DQZA 5LLDA 3TNYA 1CUHA 3W9SA 4RTSA 2VSOA 1LQUA 1N2IA 3R74A 3DCJA 5AUQA 1T4BA 2QTTA 4BH6A 3A0RB 1TEZA 3SP1A 3DR3A 2BR4A 3CZMA 3MLEA 1XJ0A 2AG8A 4A11A 3QPDA 3WYBA 1CEQA 1P2GA 4P0QB 1DUVG 3JQDA 2G08A 4A0RA 1ZI8A 2IXDA 3VKHA 1DCKA 1O5OA 3TFQA 4DLWA 1KY5A 1Z2DA 4HDOB 4QGFA 1MIHA 3D6TB 1FE8A 1OLSA 1VP3A 1PL0A 2C54A 3HCBA 4PPNA 1VCHA 4FCTA 4LJ9A 3NW9A 2PRZA 5D87A 4JJ8A 4QXMA 4I1YA 1FCJA 3RUPA 4CIXA 4HY3A 3VO9A 3W6NA 2V3CC 5AP9A 5I9NA 3MZKA 1XRMA 1P45A 4A0AB 4GKJB 4R2LA 5JWHA 3PC3A 3WICA 4PFKA 3ZWNA 2MTAH 1ZEMA 2Z9DA 4CKCB 4KG7A 2YOGA 3T7CA 2ZS9A 1IG3A 1JRLA 4XEUA 3ZDRA 4PZZA 4FYXA 4G81A 5CLLA 4O9DA 1GSOA 1G55A 1KJYA 3F47A 1I5OA 2FMXA 3U31A 2PGNA 3ZJTA 1Y3BE 2GBCA 1Z7YA 3NOQA 4UU7A 4L76A 4LEIA 2JFVA 2PT6A 3GJTA 4YNBA 5C5CA 3E9RA 3IAEA 3DBLB 4RXMA 5G02A 3L1HA 4Q6BA 2ZBRA 5IZ4A 5FPSA 1MG5A 4M9XA 2OLJA 3K5HA 5KYYB 2P78A 1H0SA 3DVRX 1ML4A 1RP1A 3H1AA 3URMA 1LPPA 4GICA 2OPBA 4UNRA 3D59A 1A0OA 2J3HA 1D04A 5JY6A 5JPIA 3N1UA 1C9KA 4ZDKA 3W8EA 3CH6A 4CFSA 5GVRA 3HH8A 1X19A 2OV3A 3NI2A 5CA1A 3PWKA 1QONA 3AR7A 1CEEA 3ADKA 2D3WA 3F3KA 1IN1A 2W93A 2B34A 1OWLA 3OE1A 4PV7A 5A4IS 1TYAE 3FR7A 5FA5A 4ZI3A 1SFRA 2YNMA 4TKLA 1U1FA 3GVCA 1VKRA 5CH5A 1A7KA 2C95A 4A1FA 4N6NA 4AZTA 2BONA 2BZGA 3GI1A 4KGZA 1Y34E 4BO1A 3OF3A 2AXEA 3MKQA 2NU7A 2X7JA 3Q10A 3MTQA 1FNMA 4UFOA 5BPHA 1M76A 1SUFA 1JDZA 3DOFA 1MF7A 3B20A 4MWEA 5FNVA 3Q88A 4N8SA 1ZR2A 5LQSA 5HHTA 4NBNA 4G1VA 4Y18A 4IDNA 4LFCB 4ZCQA 1XFDA 5DYGA 3G13A 1R5OA 2Q46A 1LVUA 1N5IA 2IQ5A 4H1TA 1ISMA 1WSWA 4L9OA 2AZTA 3M4NA 3Q85A 3O83A 5C2WB 2ZRAA 2RGBA 4O2BF 2V9ZA 4CU5A 4YPFA 4MKZA 4RSRA 3QI0A 3W3AD 4CODB 5DMXA 3JZIA 4UVDA 3FZGA 2FSVA 5A5FA 1DBIA 2PBZA 1OUMA 1N2OA 1S2MA 2XVXA 3P9CA 3BIJA 3VNBA 2JI7A 1FWXA 2BGLA 5LVAA 1B00A 2I9PA 2TMDA 3ZWPA 3K4PA 3G2NA 2G9RA 3VNVA 2HWUA 1XXHA 2C7PA 2CFRA 3L77A 4F60A 1JT9A 3IB6A 5HS6A 4F84A 2JJYA 3CRQA 3FHLA 3VH1A 3AI1A 3K6SB 3HB7A 1OI7A 2PKQO 4MI3A 3IH5A 2JAWA 2J59A 3SZMA 4RD2A 4TUYF 3BE5A 3UKRC 4YMSA 2GGSA 2Z2YA 3FCEA 2O0KA 4P6VF 4J0HA 4JGIA 4GL4A 1ZD8A 3BXOA 4A91A 1P0FA 4WK2A 1TUBB 3B1YA 4JJGA 1S8NA 1SZDA 4P54A 1QKIA 4GMBA 4DUGD 3MTEA 3EWIA 4DIEA 1U6KA 3ZR4B 1CQPA 2YS7A 3OL2B 3HFJA 1E9VA 1PD1A 2VSXA 3LP8A 2AEJA 1NM5C 3EF0A 5ALTA 2CXUA 1LBSA 1QO0D 1ZIOA 4U3JB 4EWLA 4W5RA 2FW8A 2YCLA 1WB4A 3MPOA 2Y3IA 3MTAA 4TL6A 4FOTA 2NO5A 5K05A 3PXGA 3OT5A 5FPQA 1J8YF 3C1OA 3IUSA 3MJVA 3HI6A 2FWAA 1YU9A 4HI0E 4BLTA 3D8RA 2AS0A 1A9XB 2GZ2A 1P81A 2PL9A 3FOEC 2HLHA 3LX4A 3VOTA 2GNAA 4JOQA 3B9PA 2QRQA 3UB4A 5HGJA 1UFOA 5CYPA 1NZDA 4WKCA 1IHUA 1E8MA 3ZI4A 5CDTA 4Q1FA 1JJ7A 1RAEA 1P2BA 1T9CA 5KYWA 1XCBA 5KHOC 2FMKA 3DMNA 5DGIA 4DCOA 1KQFA 4OLFA 3ZCXA 4G0NA 3L7AA 3UA3A 3V55A 1CF9A 1MQ8B 1FJGB 1Z4PX 1G2OA 1O3YA 3FAZA 1JG6A 1SVIA 3B82A 3H2BA 3AM1A 2XOKA 2GSDA 4JBIA 1UIRA 2W11A 3IKVA 4ZVPA 2OYCA 1P39A 2L82A 1OMWB 1T0HB 2VZ1A 1ESMA 1YTLA 4RFSB 2PUWA 1YDHA 3RW9A 4PZEA 4W5QA 4L75A 4LJ5A 2PSEA 4AP6A 4JT8A 1SBYA 3E18A 3NBQA 1T5BA 1P77A 3HCOA 3WLIA 2KJQA 1NU6A 2R65A 4N6OA 4RZUA 2WF5A 3B13B 3WLQA 2B61A 1ZM4A 2GPTA 3CA8A 2W6ZA 4YQZA 3NDJA 4DM3A 2AZDA 2V74B 1D0IA 1YVUA 1CUYA 2QTGA 5AJXA 2P68A 2QHXA 3DDNA 2QM3A 2ZLBA 1S2NA 5HG0A 5IXSA 4IDOA 5FBRB 1IXZA 5CXSA 1O7JA 1G20E 4E5YA 3FTPA 3IOYA 4U2FA 3DZBA 3K1JA 1C0IA 4JI0B 5LIRA 2IHJA 3K2QA 1TUIA 1URPA 3Q3EA 4JITA 4LF8B 3R5KA 5HILA 2Z5FA 1KP3A 3RFGA 1SQ5A 4JJFA 1TA4A 4U7JA 5JAIA 5HK8A 3EZXA 1F8XA 4ZU1X 2JHPA 1BA2A 5IW8A 1JR4A 3JD0A 4LRQA 1BMQA 3T3MA 3FCCA 3D6JA 3RN1D 4YMVA 4FFRA 2PWBA 2O52A 5AO9A 4R1OA 2HPAA 2H92A 4HNTA 1PVDA 3W34A 3T15A 3LQFA 5KSWB 5BW5A 4GP6A 5TGTA 3GEPA 4D9MA 1G4UR 4NNPA 4ERQA 3R9WA 2NGRA 2ZQZA 1XFAA 3MMNA 3HBLA 4ZXPA 1NUQA 2H3EA 4QZVA 1U7DA 3HRKA 1YHYA 5A4MS 1DDOA 2BR3A 4NV0A 3V2GA 1PJSA 2REQA 3AC0A 1UQUA 5ITVA 3RVJA 5B7QA 1POXA 4UHFA 2J9XB 3ODPA 4MAFA 1UAGA 4B6RA 2XMBA 3C6MA 5HIIA 3KQTA 1GIAA 4NS1A 2F59A 2EP7A 3CWCA 4PLHA 1Z4LA 1LPOA 5F5NA 5KDLA 5HFNA 4R1LA 5G0WA 1Y6FA 3EVNA 4WA8A 2IQIA 1AGPA 4LZZA 4XSHA 3Q8WA 1XZAA 3ZDZB 2JIMA 3LIPA 2H57A 1N6HA 2OILA 5ALKA 5ES4B 1XDSA 5FA5B 1SIOA 3LKZA 4GP9A 3N75A 1TZMA 2B83A 2XTNA 2NYUA 3ZY3A 4A6XA 4FUQA 2CNDA 4PXYA 4ZOQI 2ZU6A 4RKWA 1K1EA 1JDJA 5CP8A 3BE8A 2FKNA 3GNQA 4PHTA 4JSRA 1MB3A 1YJQA 4LF6B 3QQPA 5KJFA 1MAAA 3JSAA 4P5DA 2QYHA 4KJZA 5SY6A 4D8VA 5FNVB 4U6SA 1R16A 3PC2A 4ASUA 2IODA 3VPFA 3ZXYA 4FWWA 2CBGA 2XCIA 3P0IA 1ZUNA 3L8ZA 4PTLA 1Z2OX 4RMHA 2VNAA 4OBWA 1G64A 1VJGA 5C1DA 2GBPA 3Q7QA 3D3QA 3B3QA 3GXBA 3BXXA 4WTOA 3RVQA 2CMGA 3O73A 1WRBA 5J4KA 3DQQA 3EZNA 3OC6A 4A8PA 2XSZA 4WLFA 4KNYA 1N2SA 2WTMA 1XLUA 1OH7A 4INOA 2H2GA 2PMCA 1IXSB 5GPBA 1FNDA 4XH9B 4D3DA 3C99A 5GONA 3A2LA 1FJ2A 3T3DA 4KPGA 1DC7A 3LLUA 1UF9A 4R31A 3ANMA 3IKLA 2R0QC 3FNHA 3IJCA 3FSEA 2AW5A 2DG2A 4LJKA 2LW7A 1E7SA 2LBPA 1YIOA 3B6IA 2ZUBA 1P4JA 1PTJC 3CB2A 2HRQA 1MO2A 3TLAA 5L6LB 1IIRA 2PXXA 2AA3A 1XXHB 4IO0A 3DWGA 1JQKA 3N0WA 4FUTA 2WM2A 2JANA 1EP9A 1ULUA 3PJFA 2CF5A 2PS1A 3EG9A 1I14A 4EQ6B 1UMCA 5AYVA 4K6GA 4D8YA 4V2IA 2JGJA 1ZONA 1J5EB 1VXOA 3R23A 2ZKLA 1YQEA 1X86B 2X0DA 3HADA 3KC2A 5GJVC 2BFWA 1ZNXA 1T2EA 4MI9A 4DSNA 3FZQA 3LHSA 3JTMA 1IONA 1BXRB 3IQGX 5HKAA 5FOVA 3OPYA 3EXIA 1HTTA 2X0IA 3QXJA 4JUBA 4B3SB 4MHSA 3T1HB 4F3NA 4NULA 3RFVA 1FSSA 2QPTA 1ZCFA 1P75A 1QNIA 1TYEA 2XKBA 2HBQA 3S1AA 3ROMA 3TR0A 4UUOA 5CGZA 1QF9A 3ZCQA 5TQ2A 2OBBA 2UYGA 1ZMTA 3MSXA 4X84A 2GBLA 1ICEA 3TVTA 2BI7A 2QD2A 4A03A 3ZDDA 4WJZA 3JU3A 5IG2A 1MB2A 5B6JA 3J81k 4H17A 3TX2A 5C2VB 3O5AA 2PX0A 3GLGB 1PNRA 2CN3A 5DASA 2ZJOA 1OE0A 1VA4A 1WVIA 2Z30A 1N5RA 2D13A 3RVPA 2VUTA 4IIYA 4EKIA 1AHPA 1K7CA 2PZ8A 3NP7A 1G19A 4JLWA 4B7ZA 3HP4A 4N3GA 5TMPA 3KAKA 4UU8A 1YJ8A 3HY4A 2QJTA 5GMKn 3PNLA 2FSHA 3FDIA 4ZVTA 4PEVA 1LSSA 4IHJF 5B5SA 3HCRA 2O1EA 2UKDA 4R7TA 3W1EA 2C07A 2GEKA 3VNSA 1X77A 2FAXA 3FGZA 4DPMA 4JEUA 3OOJA 1NVUQ 5JT1A 4CM8B 4J43A 3AU8A 4L72A 4B74A 3O9ZA 5HF5A 2IURA 4JKYA 3PHGA 2UUCB 1HPLA 1QANA 1XLTC 2PS0A 3QF4A 1BYIA 5DNDA 3AF5A 3PQ5A 4Y2GA 2QJOA 3TG8A 4ME6A 3OMWA 1T9KA 1DFIA 2EFEB 4TMXA 2MYPA 1MO4A 1P74A 4PYOA 4MQ5A 2JRCA 2PGDA 1CFJA 5KOIA 1EG2A 5AD1A 2GARA 1XZCA 2ZUSA 5HQTA 5GIPE 2CZQA 3ENWA 1VXRA 4YX9A 3STUA 4FIDA 3SF8B 3FWHA 2O4UX 5EXXA 1H23A 4P2BA 1KZ1A 5B3LA 1XT6A 3E9ZA 4QFBA 1ODFA 2H00A 4Q05A 5HKLA 1M3SA 1LNZA 3AEQA 1K7SN 4UDYX 4J1TC 3MCVA 4B09A 1IN8A 1ISSA 5BUCA 2ZRJA 4HQ0A 1LCIA 4CGZA 3H5WA 3OZVA 1SXJA 3QVGB 2YWHA 4IQFA 4M0DA 3BMQA 5GXHA 4RHUA 3WYEA 2XMQA 2X2OA 1FLAA 2BSAA 1TKCA 2QRJA 3K09C 2YMMA 1B9YA 1L2TA 4FGSA 3BX1A 2YVAA 4QNMA 3RMZD 3UVLA 3O1LA 5GIOE 4AQ7A 5DM70 2HDNB 3WB2A 3NIGA 1Q6ZA 2N3ZA 5F2KA 1GADO 4Q01A 5GAJA 2YRWA 4ZVQA 4XDGA 2NZVG 5EMLA 4IZHA 4K8OA 3LC7O 2AGZA 1ZMBA 4YTEA 1XJCA 1XZJA 3KTDA 1SWWA 2RB5A 2PZKA 3NBYC 3JY6A 1SKMA 2C2OA 2D7DA 2BHSA 4M21A 4NBTA 1QFSA 3Q98A 2WJIA 1SA0A 3C43A 5C80A 1SD2A 4HGOA 1Q84A 4LRXA 3H5LA 3TIXB 1CWUA 1G41A 1N0IA 1WD5A 3PGMA 3Q7PA 2FOIA 3W2EA 3BGVA 1EVKA 3A6LA 1CIVA 1XZKA 4R1TA 3M1AA 3FOCA 3O8OA 1W7AA 1FFGA 2IH2A 4DEXA 2PUFA 1E2LA 4A9AA 3UAWA 3O8NA 4LW8A 4NFHA 2G67A 1S89A 1N3LA 4AF8A 4JT2A 1QK5A 3HLKA 3FNIA 3B1WA 4OGGA 3H5IA 3ZY2A 5AUOB 3TIVA 1L7RA 2J0UA 5KSPA 4PSKA 3LDFA 1Z0SA 2PPVA 4J6EA 4HT3B 4PN3A 4CZVA 3REQB 4HGYA 1HFEL 3AV0B 3KZ1E 2R11A 4KLNA 2CLEB 3GEEA 1Y8ZA 2Q5JA 5A5VA 3PDJA 4DCMA 4YQEA 1QMGA 4DA4A 3IBSA 1NUUA 4DGSA 3DDWA 4YJHA 2AE2A 2HWKA 1MT0A 4H3HB 1ZUNB 4FXOA 1L1QA 4ZOLF 2WF9A 4LZJA 5AW2A 1ZVQA 4IXWA 3WX0A 1SHKA 4CZXA 7YASA 1GPDG 3M3PA 2GKOA 1SR8A 5EKTA 3GROA 4EMUA 4EB0A 4P33A 2FETA 3PI7A 4JP5A 2UXBB 5KNDH 4R1NA 1P8AA 3C5VA 2DGDA 4RO0A 1XZPA 4INJA 2G72A 5GONB 1KI6A 4OLHA 4YI5A 4P7JA 2PSHA 5C8XA 2HK9A 3HHEA 3LRTA 1NR7A 4WINA 1N3BA 1ZXXA 1WEKA 1E2HA 2YJGA 3G9UA 2Z04A 1ZSVA 3MT9A 3JQ6A 2OGTA 3S2IA 4OY3A 2IJGX 1KRHA 2GPJA 2CZCA 1W4CA 4A8TA 5SXMA 1EFUA 2EEPA 5AI9A 2V5AA 3IOBA 2QGNA 4C0JA 2W4IA 5A2Qg 5JSFA 4JH0A 3A6DA 1NNSA 2HJRA 1AXRA 1JJIA 3MGGA 1ORVA 3S81A 2C0QA 4LGCA 2D1RA 3I9NA 3K31A 3NIWA 4ZRMA 2X58A 4W1QA 4RJLA 3KQSA 1L7AA 1XG5A 2ZOSA 2IHZA 3K4QA 4A8JC 1F48A 2DUMA 1JAHA 3M6VA 1XMXA 2BR5A 4KAXA 3TQHA 1IRXA 3VUFA 4CY5A 3KBBA 2Z6VA 3DZIA 5BVGA 4BHTA 5C34B 3L02A 2JBHA 4HDMB 4HG2A 5THKA 4XIIA 1WOYA 1HBJA 3ELDA 4DCGA 3OPYB 1RHUA 3ZTTA 2FMUA 2RHMA 1G8KA 3QWBA 2ZGVA 5LOVF 3O8BA 2O48X 3ZWOA 3QXGA 4QU9A 1JHVA 3ZCSA 4YWJA 1TYEB 4JUDX 3R7DA 1U7WA 1G9TA 3L6RA 3SS7X 3S1AB 5DI3A 4YDRA 1PFQA 4PO3X 2JB9A 3UBMA 3DE6X 2M6LA 4KIJA 3N2NA 3TBKA 1P7WA 4FFOA 4BNWA 1JG3A 1U65A 1YCFA 4O4HA 2G3YA 2Z95A 3LF1A 5TX7A 4CDMA 3WK8A 3G7SA 5FQOA 1LLCA 2QDKA 1CDDA 4XARA 5K3AA 5FPYA 3U6KA 3INRA 2X5XA 4HAOA 4JC5A 1TI7A 2H0AA 4A23A 3FVTA 3HO6A 1LY1A 3CLHA 1C9LA 4JSPC 4I9UA 5ICEA 4MTLA 1IQPA 2ZIGA 4PQYA 3W3ZB 1Y9DA 1GUZA 3PXTD 5BV2P 3PUXA 1S01A 3LO8A 8LDHA 1TTPB 3OUTA 2CFIA 4HDNA 1OVGA 2I3BA 1P44A 2QN3A 1N5LA 3NP9A 4AZWA 4D5GA 1M10A 4UZSA 4A8HA 3JX9A 5IC4A 1M74A 1UBSB 2CXOA 3S27A 1AZWA 2C61A 3AETA 5HE0B 1NJ2A 5AIBA 4HEQA 3SWWA 2A30A 4L5YA 4TWIA 3U49A 1CE8A 3PFNA 2NMVA 1T5SA 5AKIA 2Z2JA 2BFMA 1RQXA 3QE0A 2W2NA 5IH7A 4CQLA 2Q5HA 3TR5A 1K97A 5TT1A 1R6AA 5TC4A 1RCUA 4BFXA 3OICA 3UMFA 3A1DA 1XLVA 5K8LA 3DZKA 5C4IA 3C9CA 5JAZA 3TQCA 4IH9A 5KYUB 1YE5A 3IALA 3WO0A 3IRUA 3UUWA 2X9LA 2XGMA 1OF1A 3DLHA 5EE5B 4EPVA 1U0JA 2GZHA 4G5YA 5G0UA 2V9PA 1K6XA 5KVCA 3KOWA 1O96B 3V9AA 2NYVA 3G0DA 3KZCA 4BMDA 4ZVRA 1Z3CA 3CG0A 4RVUA 5IBCA 3PXAA 1E92A 2VPXA 2ADMA 2AG0A 1OAAA 1BE1A 1JLRA 1UXOA 4ZDJA 4PN7A 3OJOA 1C0KA 4J75A 3VYUB 4E32A 1MHTA 2B4YA 1PI6A 3ISTA 3EGVA 3UICA 3NVQA 5L3ZA 5J4HA 1GUDA 2QYSA 4LISA 4MGIR 4LK3A 3EGEA 4OHUA 4KREA 5TEWA 3OAAA 3UT5A 2QVXX 4G0XA 1BOOA 4CIDA 2J6CA 3KT0A 2C5BA 2V7BA 3L6BA 2J07A 2XWQA 3UO8B 2CVQA 1B43A 4U7AA 1TTHA 3L0PA 1F17A 2VHJA 2FXVA 2H7VA 1E6UA 4OFZA 2LCIA 4X1YA 5I4IA 1CUUA 4QJIA 3VPXA 2QUKA 3GX1A 5IABA 1A76A 5K0TA 3E4DA 3F6PA 2DBZA 1YKGA 1Y8RB 3A1EA 2HJ4A 4QBTA 5GSAA 4RE6A 1TBGA 4JCCA 4UJ5A 4XYHA 2V03A 3A4MA 3U4QA 3RSEC 3F6BX 4X64B 4FVTA 4D1YA 1PJ3A 3BE6A 3O8OB 1Z75A 2H65A 1MX3A 3JASA 5TJHA 1OJLA 3TRJA 3IBTA 5FH9A 2O5CA 4NP6A 3SJCA 4CJXA 4Z9XA 4NICA 1NLMA 4JQYA 1JLKA 1E2MA 3PE7A 2WJ6A 4ARAA 2C4MA 1GSIA 4X45A 3SHQA 5AW4A 3A4IA 2VZEA 3W9YA 1KR2A 1X1AA 1E4YA 1QDLB 2PKCA 4V0ME 2BEVB 4AKHA 2VPQA 3WGYA 1YJ5A 3HYTA 2F9FA 3P96A 3PSAA 16PKA 1ZM2A 1M6WA 4EL5A 2PXAA 4G89A 1K8KC 2UZ0A 3C98A 1OD6A 1B41A 2Q3DA 3K6RA 3CH5A 5F9MA 3I4CA 4KN9S 3GUCA 2OORC 5D6NA 3V5NA 4YJHB 1Q6YA 5D3KA 1U28C 4G9GA 3EIWA 4D9SA 1H8ED 3LUJA 4QOHA 1RAHA 1JFSA 2DLCX 3JD1A 4NBWA 3HRHA 2ILVA 4BQOA 2QMOA 1GPYA 5COAA 5EVCA 1RHRA 5A4JA 3MIZA 5KYGA 2GRJA 3RHFA 2RK3A 2CKMA 1TYBE 1KI6B 4ER3A 3RYCA 3UA4A 3PI6A 3NCTA 1HOTA 3IP9A 1BRMA 1CB7A 1XWFA 4C5BA 2O8FA 3EIUA 3ICWA 1QLWA 3OQMA 3B53X 3N76A 2WNHA 2BF4A 2JFNA 1C9IA 5BSUA 4NCAA 4WVFA 5DP2A 3RTDA 2ZRKA 1RRCA 2WPDA 1OYVA 2VH5R 3LLCA 1I4OA 4PX5A 3BB3A 2UXDB 2BGMA 2XBUA 2J5BA 2FQYA 2F1RA 1FP6A 4J07A 1VDZA 2A5LA 1WZCA 2GI4A 5A7FA 2R8ZA 2PJDA 5BNZA 5TVGA 2JVIA 2OE2A 2AG5A 1SC6A 2ZI3A 1G1AA 4L0DA 3VGJA 3C1TA 2XUZA 2PRJA 1BGWA 4WECA 3N8GA 4QUAA 2M2IA 4OQQA 3AFOA 1TCVA 2BGKA 2YXNA 3OD1A 4IIDA 2R5FA 1G6OA 4RJTA 1JI0A 1CQIA 2OECA 4IWXA 3WGUA 3EWAA 1N2GA 5IXYA 4HS9A 4RKYA 2RK6A 2QSYA 2AUTA 1P9OA 3SDBA 3EEIA 2A84A 3IE0A 1NYRA 1D3AA 1WJGA 2FLWA 2ZPUA 1JOFA 1JFLA 1Q44A 1SUEA 2EZ4A 3WVNA 4CL3A 3RRMC 1T0BA 2QV0A 5HF6A 2JGDB 3L7MA 1RLIA 2VJNA 3S40A 1V7QA 1K66A 4Y67A 1W5BA 1FTSA 4KQ2A 4AMUA 3AJ8A 3ZV5A 3VOSA 1E9BA 5G2OA 2HEIA 1AGYA 2GC4A 4C06A 3OQ1A 7MHTA 1FDUA 4C7BA 3ZCTA 5JWZA 4U00A 1Q74A 1QIDA 4JLKA 3DJFA 1J8MF 2YZ2A 4OQNA 5MDHA 2V3VA 4HDNB 1LDGA 4JXZA 3RH0A 4BKMA 1MUUA 4N7RA 1ZXBA 3G59A 2AX4A 2ZSFA 3B7PA 4JLAA 2C84A 2EF1A 2JZOA 2C5AA 1YFKA 1YF3A 4HLNA 2HLDA 1FUYB 3IIKA 1P2DA 1V7PC 2Q7QA 1VSQA 3W79A 1HT2E 3QG5A 1ZA2A 1ECPA 3BWMA 2C5LA 1W4ZA 4PS0A 5GVSA 1WBJB 3LP6A 4N3CA 4RW0A 3JVUA 421PA 2XBMA 1UXHA 4J3FA 2A67A 4I46A 2HJGA 3VZDA 1VSUA 5CHEA 3MB5A 1VFPA 4LGYA 2YICA 1UQTA 4HSGA 3CIOA 3N0XA 2QF7A 2W70A 3NWJA 1EVJA 3SZRA 1E5LA 3ZLVA 2TMYA 1E6WA 2Q1XA 4DDKA 3HO1A 4JWTA 3DXFA 5FO1A 13PKA 1L7EA 2ST1A 5DB4A 2FW7A 2GR9A 4RJ2A 2PKWA 4RHCA 4PCVA 1OBVA 2A5YB 1FFCA 3AHIA 3GOQA 3I01A 2EQBA 3ESQA 4LXHA 1T4MA 4WERA 2D00A 3E3AA 3K1TA 1GQQA 4P5EA 5AHWA 2RC6A 4TVBA 3I73A 4X3OA 3I04A 2NOAA 1ZMRA 4PSCA 1X14A 2AOVA 3LD9A 4UVIA 3BZBA 1SB8A 3W9BA 1G2PA 1JQLB 3BDVA 1JFFA 1FW8A 1JHMA 4D4JA 1J2EA 4MTCA 1X1CA 2OVFA 3HCCA 4QE3A 4QTUB 2JAPA 3U2QA 1FP1D 4X1YB 4C0WA 1YR2A 4BMPB 4MITA 4O3FA 3D6VA 4EG8A 1NONA 4JYZA 3LGXA 3C8MA 1K0UA 5KAPA 2QZZA 1EJ6A 3RO7A 1YHZA 5C1BA 5FLXg 5DCYA 4Z7OA 1SCNE 3C8ZA 1GNLA 3KQWA 1EMDA 5BN4A 1T1IA 2D2VA 3TZEA 1MOSA 4TTIA 3V8PA 3R77A 3H5NA 4OQPA 4UFNA 3IR7A 1JECA 3VU9B 1U0LA 5SY9A 3JASB 2ZI4A 2N47A 3WP1B 3L4KA 4NJEA 5IP5A 5FOWA 4MOWA 3Q4GA 4LX8A 3LSTA 4Z3KA 3E15A 2OVQB 1NJSA 1KBQA 1ODSA 1K8YB 3ETHA 4PICA 2IGTA 4Q48A 4XYEA 5CM8B 1E7MA 2DETA 4Q4CA 3ABOB 2PCLA 4KJXA 1QB7A 1P5HA 1C7RA 3HR7A 3QMVA 1P62B 4P84A 5LXTB 2OLEA 4K1XA 4K6OA 4CQJA 2FMTA 1NOJA 3DL0A 5HDQA 3I7LA 2ZYRA 3DM0A 3FGBA 2ZTMA 4N14A 1FS6A 1THGA 5TPWA 4DREA 3UKOA 2C58A 5FKTA 4DQVA 4CZYA 3ZKWA 1YCGA 1ST2A 3ZZUA 4U7PB 2RGNA 4XLTA 4TYYA 4NDAA 4EA9A 2NUTA 1FP4A 2YYSA 1BVHA 4UPEA 3FWNA 3U4MA 4XRRA 3X1XA 1SOVA 1XEFA 1NX6A 2W6NA 4BJ1A 5LU8A 4GGMX 2XNHA 1NIPA 4KMMA 4K03A 3P32A 3LFTA 1ZWLA 2WHYA 3RVLA 4H4CA 2VOEA 1K5HA 3LBYA 4ZZ2A 3GRKA 1HE3A 1ZK2A 4KI0A 1J0XO 2PWPA 1VL5A 4F21A 3RYCB 1P1BA 4G65A 5M04A 5ADHA 3QEMA 5DLQC 2BP7A 4AG5A 5LYJF 2GK6A 4Y6LA 2O8FB 2OBXA 5DBFA 3QBEA 3SVLA 2RGCA 1E98A 4R1PA 4QYSA 4EHLA 4KR6A 4JYMA 4B6GA 4DLBA 4YJ3A 1HDOA 5HDBA 4TGLA 3ZI7A 1JHXA 3N2GB 4QOFA 3QEKA 1V16B 3TYXA 4LRTB 1FXUA 3R3WA 1KKLA 2OGWA 2B3TA 3DG9A 4XFDA 2WC1A 5CM2Z 3GVPA 1L9KA 4AJ9A 2EQAA 2VDOA 4Q93A 1N3YA 3LLVA 4ISCA 4HFJA 2FR1A 2RI1A 3ONEA 1G3IA 3R0QA 2BJVA 1T8PA 3SKYA 1H9AA 4W1RA 3Q2IA 4D9NA 4D9HA 3PEEA 5JMTA 3O95A 3PYMA 4MQUA 4K9LA 3IP6A 1QYCA 4BJ3A 3CVOA 1V7CA 1MD9A 2R1VA 4GZMA 4A08A 1O8CA 1UC4B 4J03A 1JAZA 5JARA 4TWJA 5F9FA 2IOHA 1D6MA 2C42A 2DVMA 4LF4B 2QN2A 1HOXA 2ZJ8A 1C3EA 4NU8X 4BYGA 4TZ6A 3E8XA 3BRWA 3P4XA 4KXYA 3TZLA 2PS9A 3JRWA 3L41A 3D4NA 1SQGA 5AW5A 3K96A 4DMFA 5IMBA 1OJ7A 3RANA 1VKOA 3HFQA 4DDWA 4RM3A 4BJ5A 5HCNA 2QJRA 4BVAA 3HY3A 3ZZTA 1IJEA 1N36B 2ZTLA 2FUEA 3TLJA 1IZ8A 1KIFA 1V47A 3ZK8A 1RJWA 7REQA 2I6FA 1Z2PX 2PEYA 1YKSA 1VPVA 1M2HA 1HWYA 4D9IA 4JI8B 4PBTA 1U5BA 2OXCA 4TRNA 4B76A 1KH3A 2SKCA 2C57A 1NNEA 5CA0A 5I6DA 3HKDB 4GOLD 1G66A 5IAGA 3EI4A 5JBQA 3T5GA 1J1IA 3KT6A 3K1YA 3P52A 4GYYA 2R84A 1PDOA 2C98A 2FEKA 1GZ7A 3KJGA 4A1OA 3LF2A 3AJAA 4MR9A 4TM8A 2YMUA 1CRQA 4RCYA 4GZ5A 4B3TB 2IUFA 3PNQA 1E3QA 1RQRA 4LTDA 2C1ZA 4EMTA 1UKAA 3PQEA 1XU4A 1NBOA 1NR5A 1Z34A 1JBQA 4XPIA 3D7MA 4D8UA 1YZUA 4CV2A 4UPDA 4EG1A 3A1FA 1J2RA 2WIKA 3EWNA 1F0YA 4C3OB 3CIFA 2Q9CA 4NCKA 3LXUX 4ND7A 2C78A 3TSYA 1Q0SA 1QP8A 2VTKA 2UU9B 3O3CA 1LFDB 1PSDA 4IGIA 1QPBA 1E3DA 2CHEA 2KMLA 2JI4A 2WG1A 2WABA 1JV2A 3FMGA 2Z5VA 2P1DA 3ZHBA 4QM6A 1SU8A 2OMKA 2C5SA 1DUIA 1XPUA 2V7PA 2QRHA 4RH0A 3NAZA 3ABQB 3CHYA 4FB5A 4FBLA 3DYVA 1YULA 1PYDA 4I50A 1Q1BA 4XCXA 3RRYA 1JEYB 1NI4A 5JS2A 1J06A 4GZ6A 3WAGA 1IL0A 2Y1LA 4YXFA 2X0JA 1Z0IA 4EL0A 4BGEA 1XMOB 4Y2PA 1OXTA 2AOUB 4DMRA 1L1RA 1Q19A 2RH4A 2ZBEA 3U56A 2P2YA 3OCJA 1PWYE 3SLED 1M34B 1ZD9A 2RG1A 2EZ9A 1CY0A 2D1TA 3AZQA 4AYWA 4D82A 3QWHA 1HTBA 1GKIA 3AKEA 5H9VA 2PZGA 2ECPA 1DMSA 4OOEA 3THRA 2PSFA 2DCUA 2Q28A 4DMMA 4KXLA 1GDDA 2E4UA 2GTHA 3K72A 3REGA 3RADC 1JFFB 3K92A 6CHYA 1KNXA 3V2IA 3G2HA 2ZJ7A 1Z8DA 1DELA 5E6RA 3HJHA 3T5PA 1DC6A 4LBWA 4OIFA 4E5UA 1O0BA 1MV5A 3WMGA 5E6UB 1M6VB 3LUAA 4H77A 3M34A 1QOZA 1QTQA 2V1UA 2H2AA 3N28A 4Z7OB 2GT1A 4FR5A 1TRHA 2XZPA 2WHPA 3L2OB 3IEVA 3TZKA 2VSNA 2WJYA 2X1HA 3K1AB 4Y0NA 3VR3D 5KOHA 1XCMA 1IHYA 4LRSB 1N2EA 4U9HS 4XZ3A 5EZYA 1J9ZA 4HRVA 4MRPA 4HEJA 4G5GA 5SYMA 4YFVA 3KXDA 4JROA 2BDEA 3ZEIA 4ZCMA 3PD7A 3MT7A 3UW3A 1BWQA 2NX2A 4EKNB 2C7QA 2F43A 4MA4A 2BFNA 2AFIE 4GUDA 2QN1A 3KUDA 3ZGZA 3MD0A 4NMXB 1R9MA 1QR6A 4OATA 1Y4SA 4MYUA 2BGWA 4HX9A 5M29A 4H3KB 2ZJ4A 1YRAA 4O5AA 3S7ZA 3NWPA 5CLIA 1Z82A 3W9UA 1NXOA 3I1JA 3FPAA 4W8HA 1PQUA 3ZKWB 4RPKA 5CAEA 1E2BA 4H1HA 4A11B 5M2QA 1D5CA 2NUTB 2DM6A 4DV3B 3C6QA 4ESOA 5EIBC 2WZQA 2CNBA 4MDEA 1Y4AE 3VBCA 3V4ZA 3QE4A 4PYKA 5MN6A 4H1UA 2W6CX 1OLSB 2I9KA 1A5BB 3DMTC 2Z08A 1U8AA 3SC4A 3L7LA 4CLDA 3NHBA 4G4JA 2BCEA 4MUMA 3PTZA 3JVIA 4F9EA 4ZKDA 3GELA 2P7IA 5IS2A 2PMWB 3IX7A 3HDHA 1JILA 5IAEA 3PRHA 1L4UA 2QM7A 2P5TB 3TKAA 1EWVA 4CNQA 1JSRA 4L4SA 5IN4A 4PG7A 2Q7DA 3PGA1 3GBVA 5LZ2A 3AB3A 1G21E 4H6PA 3IEXA 2H4JA 5DGXA 3NG1A 3PUZA 2ZWVA 1MW9X 3R6TA 2IGBA 4DIDA 1U2VC 4BNNA 4HXGA 4V39A 1JLSA 5DTJA 5LNK6 3OCVA 1W0KD 1U9YA 3N8IA 3DR5A 4OP2A 4BECA 5LB4A 3JYLA 3RQIA 3L8GA 4TLEA 3SQMA 3RREA 3IS3A 1MNAA 3LPNA 1ZLYA 2IPNA 4DG9A 4F9TA 2BKLA 2CBXA 5DM1A 3WK9A 1E2JA 4GQAA 3C7KA 4AG6A 4OZUA 4MV8A 2CJPA 5HIJA 1XRSB 3DNMA 1YD7A 5E3IA 2ZROA 5IM4A 4O2WA 3JZNA 5EMHA 4EM6A 5TLSA 3RNLA 5BWBA 4MKFA 4ZJUA 1R6XA 2HD4A 3V1TC 3VU8A 2I4IA 1PF7E 1CNEA 3KKMA 1WVMA 4TTRA 1CR2A 3GLFE 3B70A 4MMYA 3F3SA 4E22A 1GGKA 3CF4A 2WJGA 3WKAA 3CX3A 3QXHA 5I7SA 5M7EA 2ZM6B 5CA1B 3VKGA 2AOXA 3ZCVA 3KZXA 1D9ZA 1ULSA 5G41A 4CEHA 5AI0A 1TLTA 3IKTA 5KYTA 4M9UA 3MWEA 5D8DA 1WUTA 3HQ4O 5EYPA 4HQRA 4LC9A 4R81A 4R1QA 2YIMA 2XL2A 3NHWA 1LI5A 1MGOA 4XWOA 3OKPA 1AB5A 1GRRA 4PNZA 4Q18A 4Y2VA 4TQAA 2C5GA 2WWYA 3QMWA 1E79D 7REQB 2GFIA 4K46A 1LA2A 4L3HD 5C5DA 1GSAA 2NU7B 4I79A 3CZ5A 1M2EA 1VPLA 2C83A 4ZTBA 4MCJA 3SJUA 2JLWA 2JKYA 5CA0B 2R4QA 3SE0A 3PNOA 5AM1A 3W6OA 2XGGA 2NU8A 3GFBA 4DADA 2PRYA 3MG9A 4YYZA 1KO1A 1I6MA 4UBOA 4EYOA 2PBRA 4H0CA 4MR9B 5FEMA 3Q7IA 3IP8A 2AZMA 3HGTA 2A5DA 1Q1EA 1QMPA 1Y7PA 2CL0X 1FSGA 4C0XA 3UMJA 5BYJA 4YA6A 5HQ3A 2YOHA 2IH5A 1Q21A 5FWAA 5A71A 3OEYA 3N0VA 1FRZA 3PGKA 4UQPA 2ISSD 3BHMA 4ZANA 2GN0A 1KI4A 4EW3A 3WDMA 5B3KA 3W3AA 1PJAA 4KLZA 5AFSA 2XKAA 3GHHA 1VJCA 2AG1A 2I4RA 2G1AA 4BCBA 1JV2B 5HRCA 1A12A 5U4XA 3QFSA 1DAEA 3ANXA 4QUBA 3LM8A 2VHUA 1Z22A 3TQIA 2AOWA 4U2BA 5JNVA 1CD5A 4IX9A 1PR9A 1MV8A 1L4GA 1Z2AA 5JRJA 3PFKA 4IM7A 4M9RA 2ZUUA 5B7NA 2ZI7A 5JNUA 3GJ8A 3M89A 4NE7A 2PX2A 1HI9A 5KOJA 1OAOC 1RSZA 4CIWA 3M8KA 2QK4A 3FLMA 2VP9A 3RC9A 2XMCA 1IBCA 3H0CA 4LN1A 2V98A 3AM4A 4WK2B 4L78A 2YIDA 1H1DA 3FHCB 4JAVC 2QQFA 2GVZC 4L07A 1U11A 5A6VA 1MH9A 2NZXA 5JVDF 3PB3A 2QTBA 4HO1X 3TOXA 4L9AA 5HIKA 1FUUA 4DUGA 1IY8A 1OCEA 3LH5A 3P2OA 1L6RA 5BT9A 4IMRA 3SS8A 3QM1A 1Q0QA 2GCIA 4RVSA 4M99A 4UM8A 2BZ0A 1A4XA 3RFHA 3GMIA 1PLLA 2VYVD 5IULC 4RABA 4K6MA 4KGDA 2XB9A 2OHOA 5DWVA 1QO0A 2GJSA 4OKIA 3I5MA 1E3LA 1TCAA 4Z7QA 2B25A 3HG7A 4M8NE 4DKXA 3V7NA 4DNWA 3DE2X 4D0GA 3K27A 3MXXA 4RWZA 4YRPA 2GUWA 1PFWA 4UMFA 4MQBA 4CPDA 1CV2A 4C2AA 1I1OA 3O8RA 1XMJA 4TT3D 1D4AA 1Y37A 1WLYA 3QUAA 4FEAA 1P18A 1TKBA 1HDYA 1THTA 1WZEA 3S8YA 3M6WA 2JLVA 3B2EA 4ARZA 5KOHB 2VL7A 5EN4A 4QEKA 5J1TB 3KZMA 1K0FA 3SSNA 3FCUA 5EZYB 1WHTA 4JP2A 3SBQA 1U2DA 4K5QA 2HJSA 5KYWB 3SDZA 4A09A 2XOEA 4I4NA 1ZVVA 2G71A 2OXEA 1ZL0A 1RYZA 1OHHD 1LLUA 4J0WA 5J2UF 2D5LA 1O97C 1PZNA 4F4FA 2EERA 3GG2A 3HYCA 1KO4A 4BU1A 2XZOA 4Q3OA 2JLBA 1T3HA 4H15A 1MEOA 2HBRA 1PEYA 4D4HA 2TRSB 2Z43A 1QO9A 5F2EA 4YLGA 1GZVA 1P60A 4JQCA 1PWEA 1SG9A 4YMWA 2ZRDA 5EP2A 3SQOA 2Y8EA 5CAEB 4XPZA 5FTWA 2HSDA 4TS1A 1ZU4A 1SXGA 1U4NA 2XGJA 4EARA 5UKDA 2GDJA 3DT8A 2FN4A 2GASA 4JJ4A 3VC1A 2Q0SA 2VXCA 3QW2A 5EPEA 4ERZA 3C41J 4Y5RD 2IP2A 3DJYA 2CK3A 1OWMA 4OGLA 5KMGA 3OMXA 1UP4A 5TPZD 1H8HD 2Z4SA 3V4SA 5JZVA 4FJ2A 4QTZA 4JJAA 4X1KA 1MQAA 1TZKA 3PE6A 1SC3A 4XEIC 5EIOA 5FR2A 5K0EA 4LY9A 4JHXA 3T3MB 1W59A 2FX5A 3CNHA 3JD3A 4Z0TA 3IQHX 2E4AA 3IDAA 1ORHA 3FMOB 1DOHA 2JAXA 5DX0A 2YR0A 4RIIA 2JJ8A 4M86A 5BV0A 1JDBB 2I2CA 1QZTA 4KHPB 1NR1A 2RJOA 2CDNA 2XLBA 4TWRA 1W48A 4ND6A 3BMXA 3IPYA 4CM4A 3KZNA 3UW1A 4B6EA 1IPHA 3SR0A 2F3TA 3PDCA 3E23A 1GR0A 3HCWA 4NMMA 4GMHA 5JD5A 4FFPA 5L4NA 2J3JA 2REQB 3D2LA 4L08A 3NCHA 4JY7A 1BX1A 1ISFA 1BCRA 4WBSA 3AFCA 1DU4A 1HDGO 3M81A 4BNTA 1AVTA 2PZJA 1G8SA 2VPPA 4MMYB 2QVCA 3OJ0A 1VB3A 1D1SA 3KG2A 4LECA 3EVTA 4N8EA 5CXUA 1N2CE 1L8XA 5JY1A 5TQVA 1TK2A 2JC3A 4UD6A 3UH0A 3A3KA 3L4MD 1GA6A 3T6KA 4L5CA 4LF7B 2DPHA 1VMKA 1R00A 3JTEA 4KYUA 2QJFA 3DLBA 3KFXA 1ISHA 1ACJA 2NVOA 3MWEB 1V95A 3DBVO 2AFHA 1JTEA 1NMZA 2FW9A 5EYPB 1DX9A 2FZGA 5CT8A 6LDHA 2XITA 4K87A 1W76A 4F91B 4RTJA 3KSRA 1J2UA 3QFRA 3JAMA 2ESRA 3K6KA 1T8RA 3SBXA 1Y3IA 2M6RA 3A9UA 1G9XA 5TEFA 1NVDA 1FSPA 2QTWB 4YC7A 3I2NA 4TMFA 3THYA 5E2AA 2ZM5A 2WDPA 4CMGA 4UVHA 4LHEA 2IYSA 1EM8A 3TZBA 3I4LA 2NU8B 3NETA 4UTOA 2VQ6A 5ULLA 1TF5A 4U6QA 5ESDA 1E6CA 3V1NA 2VDKA 3DBOB 4ZYVA 3USES 2E87A 1WF6A 1RW4A 5FLYA 2EJTA 1GT91 1U4OA 4JBWA 1IQ0A 3A0FA 4LZOA 5ALJA 2CXXA 5BR4A 3JQ7A 5GGYA 5IF3A 1KY4A 2VT2A 1IVNA 5CVDA 2I2XB 4M1MA 3R44A 2FEMA 3L4SO 4X66B 3KQPA 3T5DA 1A9QA 4UTRA 4LVCA 4RSMA 3ACDA 1QZ3A 2EKPA 1V6AA 4QQFA 1OYWA 2NZJA 1ZGAA 3DV9A 3WXBA 4J49A 5LD2C 1XVLA 2WU0A 5FXYA 4NABA 1GUAA 1JJUB 4QHTA 1JR6A 4QVKA 2O1SA 3QWIA 4X60A 4UQLA 5IYZF 3EAQA 1AKTA 2I2FA 3GUHA 1SU6A 4V38A 4HH1A 3N05A 4EEKA 1LW6E 5I3CA 1QO7A 3NBZC 5AJTA 3EG9B 1N33B 1UMCB 4L5IA 2GMWA 4JSXC 2VDRA 2IP1A 2IU6A 4IWYA 3BGIA 1RTTA 2WB2A 1NV9A 4DNVA 1BKSB 4PLFA 1X38A 5JI2E 4DCCA 2XADA 1N6DA 1HR0B 1X1DA 1GZ3A 3TNDA 1U8FO 4L8WB 1TQDA 1VPWA 4M98A 4GI1A 3EXIB 5A03A 2OK8A 1KMHA 2NNWB 3ZXIA 4PBZA 3DM5A 4XSGA 2G09A 3AB7A 1DTSA 4FDUA 2R6AA 5T41A 4UCQA 2B9EA 4Y6RA 4FA9D 2Q4EA 4UM8B 1FBTA 3ZQ4A 3IC5A 1SC4A 5IHPA 2NP6A 1U2GC 3Q0EA 3VKFA 5TQ2B 2YDXA 4FMPA 3Q12A 4JOSA 1I7LA 3TTSA 4AJ4A 3A1VA 2NYRA 2QL6A 4IF6A 1NKTA 1BMTA 3UFBA 1GG2A 2NTYC 4INAA 3KTOA 2AN3A 2I78A 3AEKA 4GVPA 4D46A 1X1QA 2Q29A 2QXYA 1RMYA 3CLKA 3P1JA 2OZVA 3A70A 4PCUA 3LXMA 1QRDA 1SCAA 1AUQA 2Q62A 2ZP1A 3AHFA 3HXKA 2CLDX 4NAVA 4HMQA 5GV7A 1T0JB 5ERYA 2B2CA 1WHTB 2ZYSA 2QLMA 4YB8A 3ZDYA 1TA9A 4BWFB 4ARCA 1T9DA 4PHFA 4UHHA 3F71A 3E7DA 4W1PA 4IRUB 2KLHA 4DQXA 4XR9A 5HRAA 4ZAVA 3EDYA 3PVZA 4QVGA 3UTCA 3LLSA 1E7QA 5JZOA 4QT4A 1RI4A 2IBSA 1YJCA 2AJ8A