The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
211
|
sequence length |
684
|
structure length |
668
|
Chain Sequence |
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb |
| molecule keywords |
Prolyl Endopeptidase
|
| source organism |
Aeromonas punctata
|
| molecule tags |
Hydrolase
|
| total genus |
211
|
| structure length |
668
|
| sequence length |
684
|
| ec nomenclature | |
| pdb deposition date | 2009-08-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00326 | Peptidase_S9 | Prolyl oligopeptidase family |
| A | PF02897 | Peptidase_S9_N | Prolyl oligopeptidase, N-terminal beta-propeller domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | 7 Propeller | Methylamine Dehydrogenase; Chain H | Prolyl oligopeptidase, N-terminal domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
