3IURA

Appep_d266nx+h2h3 opened state
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
684
structure length
668
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
molecule keywords Prolyl Endopeptidase
total genus 211
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iurA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iurA01
2Y1KA 4C87A 4EZIA 4EY7A 1H22A 3M81A 4UBNA 5K5EA 4WFJA 1XRQA 1ZICA 1GT6A 3BJRA 5D6OA 2J4FA 1LNSA 4GBGA 5F4ZA 4U2EA 2VEOA 2RGUA 4PSCA 1W52X 2XI4A 3HZOA 4CIBA 1XZFA 4OB6A 1XZGA 4YASA 5T4BA 2GBCA 3PFBA 1XZBA 4DNFA 3G8YA 4FLEA 1QJ4A 5EI5A 5ALEA 2XDWA 3R3XA 5BWCA 4Y2QA 4QDXA 2XQJA 4Q34A 5ALLA 2OXEA 5HFNA 1YS1X 1IZ8A 4NS4A 5EIHA 5KWJA 4EB0A 3E4DA 2ZYSA 1JU3A 3B5EA 1LZKA 4FBLA 3DEAA 3DYVA 1TK3A 3ANTA 2H7YA 2QM0A 1SC9A 2W6CX 3OG9A 1P0MA 5AKXA 3QMVA 4MEBA 1YS2X 4BDTA 3R3VA 2Q0XA 3M82A 4FTWA 3F9CA 3DJYA 3CXUA 1QIDA 1N8SA 2HADA 4JUIA 2WFZA 2HRQA 3LCRA 4L3WA 5E4TA 2PUHA 1A8QA 4Q05A 2PUJA 3ANSA 3QPDA 3LS2A 4H35A 1XZIA 5HCUA 5ALOA 2WU3A 1LZLA 3IURA 4Y2XA 5JD6A 4QDZA 2ZSIA 1QIGA 2AJ8A 4B9AA 3L1HA 2OGSA 5ALPA 1ZJ4A 1K63A 1R3DA 3CN7A 3ZI7A 2PSJA 3ESAA 4LIPD 3DQZA 3LIIA 6YASA 5ALIA 3PE6A 5DYYA 3O4GA 2UZ0A 2WTNA 5JALA 4FFWA 1Y7HA 1XZEA 3VJLA 1GQSA 1A7UA 2WIGA 1TRHA 2GYUA 3D2BA 4FFVA 1EVEA 4P9NA 4BVLA 2XUIA 1JJBA 5ALXA 4OYYA 4FKBA 4PV7A 4FBMA 3IUMA 1W1IA 3LP5A 4XX1A 4EA6A 2DQZA 5AKGA 1QLWA 1YA4A 1W76A 5ALHA 3FCXA 2QXUA 2OLEA 4QLAA 3WWPA 4B6GA 1CRLA 3AILA 3KWFA 1LPSA 4FWBA 4GLBA 1EDDA 2O7RA 2PU5A 4JNCA 5AM0A 1UXOA 4MYSA 3BF8A 5EFZA 1U4NA 4MWTA 1YAHA 5CT5A 2I78A 3JWEA 3WIBA 1YSCA 3FSGA 5CH3A 1XLUA 5AM1A 5FRDA 1VXOA 4FHZA 5LKAA 2OGTA 2QXTA 3PFCA 1AKNA 2Y6UA 1CFJA 1EK1A 1KU0A 2RHWA 4QWWA 2D5LA 5LZ9A 2JGFA 3QMMA 4GI1A 2HA3A 5AK6A 2QKYA 2DFPA 4J7AA 3C8DA 3ED1A 1IUOA 3I1IA 2WHPA 1YAJA 2JGEA 4BBZA 5FUMA 2OQIA 5K3EA 1QFMA 1THGA 3AIKA 3NUZA 1DT3A 4J0GA 4UHBA 4BC0A 1HBJA 3IIIA 3V1NA 3G0BA 3WWEA 3LIPA 3IBTA 3HSSA 4BRSA 2H9YA 5AOAA 4CCYB 1XRPA 3WA6A 4BB0A 2ROQA 5C7YA 1CUHA 4BAUA 5AKHA 5ALFA 4QZVA 2Z8ZA 4Q1VA 1AZWA 1LPNA 3HJUA 1CUWA 1J2EA 1MTZA 1ZJ5A 4N8SA 4AO6A 3IUJA 2XUHA 1IMJA 1VZ2A 4ZI5A 1EX9A 3FVRA 1XZHA 3H2JA 5HF6A 1XZCA 5FLKA 2WU4A 1CLEA 4CG3A 1UK9A 1AMNA 4G8DA 3G0GA 5K3BA 1C7IA 1ODCA 3R0VA 3W04A 3L1IA 4ZXFA 5AICA 3VXKA 4HRXA 5BOVA 1MN6A 1SFRA 5I9IA 1USWA 2WHQA 5DWDA 4M0FA 1DQZA 1EA5A 4FDMA 3C5VA 3R3ZA 4DNOA 3UUEA 1CV2A 1WB4A 5JARA 1CUSA 4LXIA 3WJ2A 4UHHA 5JD4A 5AKJA 1AQLA 4W1PA 4N5IX 4XWGA 2VATA 3GFFA 3NOXA 4J0HA 3WKEA 3KD2A 1BRTA 2BKLA 1XKLA 4FNGA 3V1LA 2ZVDA 1XQVA 2WJ3A 3STYA 3O0DA 4B80A 4BRZA 4H0CA 1UOPA 1R4ZA 3H1AA 5CTAA 4G4JA 5CT9A 2GYVA 2XE4A 5DYWA 1A88A 1B41A 3R3UA 1WM1A 3O95A 1L7RA 2VQ6A 2CBGA 3HLKA 1CUGA 4QWMA 4ETWA 5AIBA 2C4HA 2FUKA 1UKAA 4LKOA 2HA5A 3F8SA 3WL5A 5EHXA 2XUQA 1XFDA 2BFNA 2XMCA 4GW3A 2GZRA 3OPMA 1ETHA 1E8NA 3D7RA 1UK6A 1MT3A 5SYMA 2DHEA 4G8BA 3VKFA 5JD5A 4M0MA 3IUQA 1W75A 4B0PA 3WZMA 4O08A 2Y6VA 3AIMA 4I4CA 2WQZA 2WIJA 2Z3WA 1F8UA 2XMQA 2D0DA 2ORYA 3P2MA 2XUPA 1LBSA 3PUIA 2QZPA 4QDTA 1NU8A 2QOEA 2VJAA 4FLFA 1VJ5A 1TQHA 1FFAA 2ZYHA 3GUUA 5AK3A 3STVA 1K8QA 4RE6A 1N5RA 1G42A 2ZYIA 2RHTA 4BC1A 1WB5A 4C4YA 2AJDA 1QOZA 1VXRA 1UFOA 2VJBA 4BZZA 4TGLA 4X93A 3ZLVA 2WILA 1SOMA 3WK7A 5CURA 3EQ8A 1OCEA 3LLCA 4AMYA 5AOBA 1C7JA 3PICA 4KAJA 2AJLI 1MO2A 5ALGA 2JGKA 2VT6A 4UBLA 2BUBA 4QA9A 1UOQA 3HC7A 2WHPB 1E8DA 2DQYA 2HA2A 4GHWA 4DM7A 3SX4A 1JT2A 4QNNA 3WK5A 4X94A 4KAAA 5E4JA 4JYMA 5ALKA 4Y2VA 2XMDA 2V9ZA 3GZJA 2RONA 2VTVA 5AKZA 1YA8A 3H2IA 1UT6A 4L9AA 4K2AA 3G02A 3O4IA 5AKYA 4WDQA 4G1FA 3OM8A 3WWOA 2Y2UA 5FPPA 2XLBA 2B9VA 4ROTA 1FFCA 4X85A 1XQXA 3RKSA 1XZDA 3WWCA 4I19A 1RYYA 4H7DA 1LGYA 3H2KA 2YXPX 3C8HA 4JYPA 2QRUA 1QO7A 2X5XA 2BGNA 2BAGA 1ISPA 4X6UA 1ZI6A 2RIPA 1AC5A 5DNWA 2OPHA 3WQHA 5D3ZA 2PSDA 2PU7A 5HKAA 1M33A 1ZIYA 2I03A 4N8EA 3G0CA 4X90A 1OILA 1JFRA 2WUDA 1MJ5A 1CQZA 3I2HA 4X97A 1XROA 2QR5A 1F0PA 4EUSA 5ALVA 3WI7A 3DNMA 1QZ3A 3G0IA 3DL7A 2PBLA 4UBKA 4EY5A 5HZGA 4G5XA 4QLOA 4CCWA 4F21A 2WIKA 4EY4A 2JGJA 2QJRA 1N5MA 4KE9A 1W6RA 4H7IA 3WZLA 2FJPA 2XUAA 5HF8A 2BCEA 1VA5A 5HK9A 1R1DA 4W9RA 1Q0RA 3IB3A 1YR2A 3FAKA 3DL4A 2VJCA 3IA2A 2PKYX 4Y2JA 3I1YA 5AK4A 1TCCA 1HPLA 3H04A 3FSGD 3WL8A 4DNQA 2G5PA 4N8DA 5LIPA 2PVSA 3O9MA 4RE5A 3FYUC 4BCBA 5AJHA 1S8OA 4K6GA 1RP1A 3H2GA 2JEZA 4B84A 2H1IA 5C8XA 2G63A 5HKBA 3BL8A 4UHDA 5LZ4A 4BP8A 1BCRA 1EXWA 2J4CA 5ALRA 2WSLA 1XRLA 2HU8A 4BAZA 1JJIA 1JMKC 3HXKA 4AX4A 3F98A 5HQ3B 3VVLA 1PJAA 2WFMA 4FMPA 1DWPA 3V1KA 3TJMA 1ZD5A 3BDVA 2VF2A 1K4YA 2WIDA 2V96A 1J06A 4ARBA 3MUNA 3GROA 5EHZA 4X71A 3ZLTA 1MX9A 1IUNA 4W1QA 2VAXA 4F60A 2C7BA 3WKCA 1EDBA 3WKAA 1BROA 1WCYA 4BZWA 2OAGA 1DX6A 3HRHA 3TRDA 3AUKA 3O4JA 5C81A 1GPLA 1OXMA 3WK9A 2QT9A 2ZYRA 1P0IA 1Q83A 3EIOA 3N2ZB 4P92A 1CUBA 5JZSA 5AKEA 4XVCA 4DIUA 2PSEA 2I3ZA 2YASA 5DNUA 1IVYA 2NW6A 2XUFA 4X7BA 5AOCA 3JW8A 2XMRA 3BWXA 2XUGA 4V2IA 4GECA 4DTCA 3I6MA 4ZRDA 3DKRA 4PF1A 3QH4A 1UK8A 4B9EA 2XQKA 1DQYA 4KRYA 1F0NA 3CCCA 5E4YA 1PFQA 1LBTA 4N5HX 4OU4A 1FSSA 3ZLUA 1XRRA 4IO0A 4Z49A 1LPAB 3I6ZA 5AK5A 4U2FA 4IH9A 5CH5A 3FOBA 3AJAA 4GDMA 1H23A 1HQDA 4X91A 1VZ3A 5AH0A 3WMRA 1EI9A 2OGZA 1QIJA 5JASA 2V98A 1O6FA 2CUTA 1CUIA 2EDCA 3WA7A 5AI9A 1Q84A 1LPPA 2WIFA 5JAOA 3NGMA 5EIEA 3AFIA 4KEAA 4Y2YA 1E66A 5JIBA 4X00A 3M3DA 4OU5A 4PO3X 3FBWA 2WFLB 3I2JA 3W2TA 1X70A 4X6YA 4C6HA 1QFSA 3SWWA 1FFEA 3A2NA 2HU7A 5CRIA 2Z3ZA 3T4UA 4YX9A 4J03A 5ALWA 5SYNA 4K6KA 5FOQA 4AZ3A 2HM7A 2ZJ7A 4Y9SA 1U2EA 2B4KA 5A7GA 1ZD4A 2DCMA 2DR0A 1XLVA 1JMYA 1QIFA 3C6XA 4ZWNA 1CUXA 3A6ZA 4Y2SA 1ODSA 1B6GA 2WKWA 4CFSA 4LXHA 2X8BA 4H7KA 1VA4A 4J0DA 2YYSA 3C6YA 1SCQA 2VAVA 1CUFA 1EINA 4HXFB 4MXDA 3I2FA 1QTRA 3FNBA 4KACA 1NU6A 4UUQA 1FFDA 1QIMA 2XLCA 4C01A 2IIVA 3BXPA 3WJ1A 2WTMA 3I28A 3SC2A 3H2HA 5A6VA 3D4LA 1BN6A 2IX9A 2Z5GA 1CUVA 3ILSA 5AI8A 3PUHA 2JIDA 2CKMA 2XMZA 3ESBA 4QDOA 4UFOA 5AHXA 5K3CA 4AO7A 1L7AA 1BN7A 3YASA 4W63A 5JADA 1XKTA 2CEKA 1WPXA 5K3AA 5H3HA 1A8UA 1VE6A 1EB9A 1H2XA 5LYYA 4YPVA 1CUAA 4QE3A 1YB7A 3ZPXA 1CIJA 2HA7A 2O2HA 1AX9A 2X76A 1DX4A 4L72A 2ECFA 3HI4A 4Y2UA 2XMGA 1XZAA 5IKXA 2XMBA 2OAEA 2RI6A 1UKBA 4C4XA 3STUA 3QBJA 4UFNA 1GPNA 1LPBB 3TGLA 4M0EA 2CJPA 3OC0A 2XQIA 2GYWA 4G8CA 4HVTA 4MQMA 4H18A 4IH1A 4UBJA 5ALSA 5ESRA 5YASA 4BTLA 3DKKA 1MNQA 5ALNA 4FNMA 1WHSA 1T4MA 2ZJFA 4WJLA 3S8YA 2JF0A 3FVTA 2AJBA 4B0OA 3ICVA 1UWCA 5KREA 3CCBA 4NMWA 5AP9A 1THTA 4S0XA 3BE8A 4J0JA 4QEKA 3V1MA 1MX1A 1QE3A 3PDCA 2G5TA 3QZUA 1AURA 4BDSA 1ORVA 3OOSA 5T4HA 4H7FA 3D5EA 4DGQA 3OURA 1U8EA 3EBLA 5EHQA 3U0VA 4BE9A 5E2IA 1CR6A 1A8SA 4KYVA 3KDAA 3STTA 1GGVA 2R8BA 3QMWA 2O2GA 4KJXA 1R9MA 4LYDA 3PF9A 1DWOA 1EVQA 1BEZA 4WCVA 2DHCA 3G9ZA 4U2GA 1QIEA 1FFBA 4INZA 3AIOA 5IVIA 4J0CA 2JGIA 3C87A 1YB6A 4MQLA 3DS8A 2ACKA 4ZV7A 1MAAA 1XRNA 4A16A 2DHDA 4AXBA 3B12A 1J1IA 2XB6A 3BJMA 4X3CA 1XZJA 5A2GA 1R9NA 2JGMA 2HDWA 1HKHA 3AINA 1XLWA 1LLFA 5EGNA 4RGYA 5ALJA 3W9BA 4DSZA 4H7EA 2JBWA 5LZ7A 1PV1A 3QYJA 3C70A 4Q82A 2WUGA 5DTIA 3F96A 4NZZA 4WDRA 3G0DA 1GKLA 4E15A 4J0KA 4MJ3A 3O4HA 1K5PA 3G9UA 1GPKA 5D7BA 7YASA 4NVRA 2ACEA 4AQDA 3OTQA 4BCDA 3FYUA 1EB8A 3G9TA 4WY8A 2VA9A 5DJ5A 1MNAA 3IVMA 3FLAA 2ONCA 4UHFA 1GKKA 4W1SA 1T2NA 1EH5A 2OCLA 5AM3A 4JEIA 1QIIA 2G4LA 1VLQA 1QGED 2WJ4A 2C58A 4Y7DA 1EK2A 1JU4A 3WL6A 1CQWA 1I6WA 2EEPA 3H1BA 1R88A 4U2CA 3T52A 3HYSA 1N1MA 2WG2A 1DTEA 5A62A 4OPMA 1ZGCA 3VISA 4QDUA 1KEZA 2QTBA 4DMHA 1TIBA 2HHAA 3DOIA 1ZD3A 2C5GA 2PL5A 2O7VA 2VT7A 5K3DA 5JAPA 2HU5A 1UZAA 4CCYA 1QONA 4MYDA 3VVMA 1ACJA 2AJCA 2LIPA 3IDAA 4U2BA 1L7QA 1XQWA 2OCKA 1KU6A 4AO8A 3E3AA 5AI6A 4UBIA 3K9BA 3V48A 1CUDA 4XJVA 5FDFA 2BJHA 1GQRA 5HQ3A 3EQ7A 1XQYA 3B3QA 1E89A 4HXEB 2BGRA 1E8MA 1R50A 2QUAA 3X3HA 5AI0A 4HZGA 3R3WA 3DD5A 4H7HA 5ALMA 2CMFA 3V9AA 2WM2A 4G9EA 4ITVA 4HAIA 4PSDA 1ODTC 5LP1A 4HRYA 5JZ9A 3QITA 1AGYA 1ACLA 3W06A 4IH4A 3WWDA 4B82A 5CXXA 1Q0ZA 3DYIA 4EBBA 4BCCA 2BUCA 3VJKA 1G4HA 4Y2RA 4Q3KA 4OSEA 1BU8A 2OG1A 5DNVA 1G66A 4YK7A 2QUBA 3DDUA 5CW2A 3W9UA 5AKLA 4CIAA 3QPAA 3H18A 4PNZA 3C5WP 5LLSA 4F5ZA 5IVDA 3JYHA 5A7HA 2XMSA 3AZPA 1ZD2P 5HF5A 2WG1A 3WL7A 4TVKA 5AM2A 5K3FA 5AM5A 3I6YA 5T4EA 4RPCA 4UPDA 4HTAA 2ES4A 4IHAA 1MU0A 1GZ7A 1BEEA 4ZREA 4ARAA 2WHRA 3I2GA 4B7ZA 3GELA 3E0XA 5EIAA 4D9JA 3EF3A 1MPXA 4WY5A 3WYNA 2HRRA 2Z8XA 5J3JA 4E14A 2OCIA 5FV4A 1X2BA 3GA7A 5LZ8A 1VOTA 3ZV7A 3TEJA 1ZGBA 2VJDA 5AKKA 4ZV9A 5IH7A 1D07A 1BE0A 4PSUA 1Z68A 2HA4A 5FPQA 3BF7A 3ESCA 1HL7A 3HABA 2HFKA 1Y37A 1ORWA 1VKHA 4DNPA 4DMFA 3MVEA 2WFLA 4OUKX 1LPOA 2K2QB 1ZOIA 1CUJA 4HS9A 2WUEA 3A2LA 1U65A 1CUUA 3UMJA 4H7JA 2FJ0A 2QJWA 5JYCA 5I8PA 1UOOA 4GEGA 2GBFA 5A71A 2WJ6A 4UFPA 4BATA 5DLPA 5JATA 1IZ7A 1O6GA 3A70A 1X2EA 5ALDA 3VDXA 4LYEA 2P8SA 4W1RA 2PX6A 4H77A 4A5SA 1DU4A 5A7FA 2WUFA 4Y2PA 3H19A 4B85A 5LZ2A 5ALYA 5ALUA 3SK0A 5LZ5A 2PM8A 1QO9A 3IULA 3GBSA 1TAHA 5ALQA 2RAUA 1ZI8A 4XIIA 2JGLA 2QS9A 3RK4A 5JZBA 2OCGA 3I2KA 4UBOA 1NX9A 4LHEA 1BS9A 2XUJA 2HFJA 1BCSA 4TPKA 1W4LA 5EHNA 1CEXA 4KAFA 5AO9A 3WIOA 1H2ZA 3QVMA 1E3QA 3FCYA 2HA6A 1HLGA 4E46A 3NWOA 1P0PA 4BAGA 5BV7A 1E5TA 4GXNA 2GBIA 5FKJA 2W22A 4BVJA 4EY8A 2VSQA 3L1JA 5CXUA 3ESDA 2HIHA 4J3JA 4KE6A 2ZSHA 2J3DA 2H7XA 4EHBA 2C0PA 4KE8A 3WK4A 4OD0A 3H17A 3MGAA 4WFKA 4F0JA 5T4FA 2C0QA 5AI4A 4L0CA 3D2CA 4IQ4A 1DINA 4C4ZA 2XUKA 1SCKA 2R11A 3KWJA 5CMLA 3PI6A 2CZQA 1LPMA 2EDAA 1UKCA 5DYTA 5KBYA 1XRMA 3G9XA 3C43A 1XZKA 3WK6A 5CH8A 3CN9A 5AI5A 2XQGA 3DOHA 1DWQA 5CT4A 4K5QA 2C5FA 3RARA 2AXEA 3R41A 3HEAA 4G4IA 1QTIA 3VJMA 2B20A 4GWLA 4ZGBA 4X6XA 4MEAA 4AZ0A 3STXA 2GBGA 3C6ZA 4K6HA 1K6EA 2BUAA 3AZQA 1DT5A 2Y2VA 1TCBA 5AM4A 3C6BA 3K2IA 4AN1A 4AMZA 4AB1A 3KOOA 4DMCA 1Y7IA 5ALZA 3WK8A 1P0QA 3D0KA 3Q8WA 1ZIXA 2FX5A 2PSHA 4HXGA 1TCAA 3WKBA 1F6WA 1J07A 3F67A 1WOMA 4KR0A 4P93A 5K3FB 2XUDA 5IVKA 5I7UA 3DLTA 2QMQA 2ZJ6A 3STWA 1GXSA 4BTVA 3I2IA 4I3FA 3MUOA 1WB6A 4OB7A 3FLBA 4CG2A 3C45A 4DLNA 4DSAA 3PF8A 1UK7A 3EQ9A 3WLAA 4FLMA 5ALTA 2XQFA 1RWQA 5C8ZA 5AKIA 2B61A 2CB9A 4C88A 3E1GA 4G9GA 1C4XA 1CUCA 1CVLA 2DSNA 5AIAA 3KXPA 1CPYA 3R3YA 1H2WA 5CT8A 2WLSA 2WG0A 1YASA 1QIHA 4P08A 4OYLA 3K6KA 1TKRA 1HDEA 3D2AA 1MX5A 4U2DA 3H0CA 2HA0A 1CUZA 3BDIA 2V97A 5HFAA 1FJ2A 4PQEA 3BIWA 5JAHA 4KRXA 1EHYA 4X95A 4MWSA 2I3DA 1WPRA 2E3JA 1H2YA 3O9VA 4JH0A 4UBMA 5D3KA 4C89A 2O2IA 4G4GA 3D3NA 1WHTA 1QIKA 4Q3OA 3ZWQA 4PW0A 4DMKA 2YH2A 4Y2TA 2GZSA 5LKRA 3FWHA 4A23A 4CI9A 2XT0A 1EDEA 1JI3A 5JANA 1VE7A 2QVBA 5ISMA 3FYUB 1CUEA 1JKMA 3RM3A 4BP9A 2IITA 2JEYA 4BE4A 1YCDA 5KWIA 3DCNA 4RNCA 3QPCA 3QM1A 3AZOA 3RLIA 3D59A 5IVHA 4UHCA 3FYTA 1AUOA 3ICWA 3A2MA 5JAUA 4WFIA 1IUPA 5DTJA 3N0TA 1ZI9A 3WKDA 2PPLA 4EY6A 3BIXA 5BWBA 2OQVA 5CT6A 1SCIA 2H7CA 5FP0A 4BYMA 2PSFA 4UHEA 1G5FA 5HK8A 4OCZA 3G7NA 1CUYA 2XUOA 3IUNA 1XZMA 3UUFA 4OB8A 4X92A 1XZLA 3FLEA 3R40A 5HF9A 3KSRA 3WYDA 4DYHA 1JJFA 4Q3LA 5CBKA 3W05A 4FOLA 4BVKA 3M83A 4E11A 4J0IA 4LXGA 5C8VA 3HACA 3U1TA 5FXMA 4B81A 2HL6A 1MAHA 4KE7A 4CG1A 2J3QA 4B83A 3S2ZA 3F97A 3Q0TA 4AN0A
chains in the Genus database with same CATH superfamily
1Y6JA 1NFRA 1SUIA 3BXXA 4J77A 5E7JA 4EG6A 1P60A 3UO8B 3KQKA 1I2AA 4CDNA 4J84A 2PN1A 4RXTA 3OJXA 4EY7A 4KHPB 3P2JA 4EEZA 3OQ1A 3UR4A 1B9YA 1O2DA 1G1MA 1J0EA 5IJZA 3OCWA 5D6OA 1HYEA 4FDTA 4Y98A 4E7OA 4Q66C 3PRKE 2XF2A 4D4LA 4JT2A 3JVVA 1W52X 3KFXA 3LD9A 3LT0A 5LM3A 2IWRA 2IBSA 1PL6A 4WWHA 1PTKA 2VOEA 3C3XA 3HUUA 4YASA 3CRRA 4KYIB 5KX5B 3A9CA 3WSWA 3GRVA 1YUNA 4UTPA 2ZYVX 1NVDA 1CZOA 3H3XA 1Q17A 1LNZA 4X20B 3G8YA 1QJ4A 3AESB 1LU9A 3UT0A 1E1CB 4V1CA 1AHIA 4W8HA 1N6DA 4BNIA 1R6BX 2HJ4A 1NASA 4YAIA 2FCAA 4JQOA 5CA1A 2ZUEA 4BB6A 4KXQA 2VYVA 2Q4OA 3H83A 3SF0A 4HVAA 2X6QA 1NRIA 4R7AB 2XCIA 4YJ3B 1T6BY 4AJOA 5A4FS 1QU2A 1PQYA 2HESX 1T8PA 2XHZA 3BGIA 3CSSA 4FZJA 3EWAA 4GMHA 4A2QA 3G2MA 4RVSA 3AC0A 2NYAA 2OXEA 4CLXA 1UWLA 3RRJA 4RVDA 3U49A 3OO0A 4PQRA 4F1WA 3H75A 3OT5A 3AR6A 4EW2A 1IZ8A 4NS4A 5K19A 3EMHA 4O4IB 4Y2HA 5DRYA 3EVDA 5FO1A 1QVZA 4QQRA 5DM0A 4EB0A 1IG3A 5CVJA 2B78A 3VYWA 2GB4A 1X8JA 3B5EA 4FBLA 2I2BA 3Q15C 3DEAA 5C8YB 1F0YA 1EWKA 4GICA 1XXHA 3PG5A 3PJDA 1L9KA 1H8HD 1SUPA 3DYVA 3U37A 1EUZA 1TK3A 2CMHA 3QLVC 4MRVA 4RQTA 1Y4DE 1OYYA 4IIVA 2BGKA 1XVTA 3K0AA 5LA6B 2BRUC 4PAOA 2LWIA 3IUPA 4A82A 1D6JA 1P18A 5CX1B 2QM0A 4OHMA 5IGQA 2W6CX 3U4CA 3OG9A 1V7CA 2J45A 4IJWA 4JCCA 5GVSA 3AVTA 2GA9A 1T9KA 3KSUA 3LK7A 4ND1A 3EFEA 2M2IA 4MEBA 3BWEA 4YACA 5JH7F 3FOFC 2B2NA 1RWPA 4IIHA 5B37A 1A7JA 1HQYE 4R31A 3M82A 2QL6A 5ECDA 3UK1A 2DEUA 4RTPA 5FQNA 1W59A 1DBIA 5F98A 5CDFE 2GH1A 1HDRA 4IGIA 1EFRD 4MMYA 2AKEA 2HF9A 3JQBC 3ENVA 1E77A 3C5CA 3EI4B 1JFLA 1ZRNA 2UUPA 3CVVA 1HE2A 4BLQA 4CNQA 4WJKB 1M2GA 3DONA 5BRAA 2I3AA 4ZC1A 2YMMA 1N0HA 4J7XA 4L3WA 3EFHA 3H9QA 4GEKA 5E4TA 2XNJA 3PXDA 2I3TA 4RY0A 1G21B 3MBIA 2PUJA 4Q05A 5EIWA 4D6VA 4GR5A 4N3AA 2W2LA 1Z5OA 4JLVA 2P27A 4QBIA 4AMUA 1QQTA 2AK3A 4XYGA 3H5WA 5HCUA 3FVVA 3PFIA 5ALOA 1F2UB 1KP9A 3THOA 4U9IS 2CXXA 1DRVA 1W8IA 2ASVA 2WU3A 1I4EB 2PWZA 4URHA 3BH0A 3N2GA 421PA 3I42A 3QWAA 4NBSA 4Y2XA 2WWYA 2ZSIA 3AVYA 2AJ8A 3GVXA 1PWXA 4HGQA 1XD2B 1NL3A 1DXQA 4BFUA 5DSZA 4C7XA 1N25A 4ZOLB 3CW8X 2ZAGA 1VKZA 1ABFA 2CO0A 2X5KO 1N1GA 3CEJA 4CKZA 2DAPA 4XPIB 2CNWA 1H5NA 5F73A 1RI4A 2YUTA 1QVRA 1VL0A 4BO0A 1N7JA 1R3DA 3OZSA 4LVNA 3ESAA 4ERNA 3DQZA 2JJ2D 3ZEAA 3M6UA 3BHJA 1XF9A 2H2FA 1A04A 4JP1A 1Z5ZA 3A3OA 5DYYA 2QX8A 2D1TA 2PANA 2KI5A 1ODIA 2OORA 4IGEA 4QVKA 3H8JA 1M2EA 3DMHA 2BV3A 5E1BA 4M0KA 5JALA 3HP7A 4MS4A 3HWRA 5FPKA 1BX1A 5ITSA 3TMKA 2WIGA 3QV1A 4LYHA 3OOYA 2OQ2A 4MUEA 1TRHA 4XDGA 2BEKA 1U7OA 3QNMA 4E32A 4P9NA 3SN6A 5DH9A 1R4MA 4P22A 4H3SA 4LMRA 3A7DA 1Z0FA 1UDRA 2IOFA 1Z7GA 1BIFA 3OWXA 4LQCA 5BNFA 1A5SB 2GPBA 3LLSA 1RRMA 2GEBA 3MRVA 3OJ0A 2NVBA 1ZX1A 2PRZA 3UKRC 4OQEA 4ZYTA 2ERXA 4JBYA 2F4VB 4DNVA 1W1IA 4FZVA 4XX1A 3R76A 1WHSB 3TK1A 2DQZA 1SC1A 4RVUA 3WMWA 3X1XA 1Z0KA 2VDNB 2ETVA 3H84A 3D64A 2QU8A 4QU8A 5AKGA 1U28C 2EZTA 4BPRA 1I30A 4OBWA 4XYIA 5CDGA 3I0NA 2F8SA 4Q9LA 1E18A 1X7XA 3DFMA 1THZA 3R0QA 4MITA 3SIPA 3LUHA 3A10A 1CRLA 1J9GA 2B8TA 4IJVA 4IHKA 3MT7A 3P0JA 3ZGVA 4RNDB 3IJEA 4TXHA 1YJ8A 1FQKA 1SXJA 1O89A 3OM9A 4W5QA 2W4QA 4TT8A 3E23A 4MDEA 1L7PA 3AUAA 3IE1A 5F33A 2JLWA 5AM0A 1EUQA 1UXOA 3H8VA 2F9LA 1KYYA 3C74A 5BT9A 1UFRA 5MGNA 1U9IC 3UV6A 1TJNA 2IEAA 5SICE 4FWTA 2V7VA 1VJCA 2G77B 2JAQA 3A7EA 3LHDA 3ECAA 1Z4MA 1NE7A 1U4NA 1SVLA 2W71A 1Z4LA 2YHIA 3BL5A 4X3OA 3TQSA 2A0YA 5F9FA 4TTQA 2WFAA 1ZXXA 3OPNA 4ZYZA 4WK4A 1W5SA 3WRVA 3WIBA 4KPFC 1G8YA 1ZUWA 2FFBA 1OZHA 1RXYA 2ZROA 1US8B 5D86A 1K86A 5ECWA 3VR3D 5AM1A 4LG9A 1XJ5A 5EP1A 5FRDA 3RRFA 4NY1A 1YR1A 3V2IA 2C5AA 4G89A 4KKXB 4OAPA 1N5DA 1NW7A 4A6DA 3CF2A 1EE9A 1FUKA 3Q3VA 4UUPA 4D0NA 1QF6A 1TZBA 4JBHA 1ECBA 1ONPA 1ZFNA 2JFFA 5EWMB 1ZSVA 4FS3A 4BKOA 5LLTA 1KU0A 1OF1A 5D00A 4EWLA 3HY6A 3VI3A 3RSGA 5AW4A 3T7KA 3PKZA 2D5LA 1Z6YA 3MWGA 4DKXA 3CZMA 3GT0A 2JGFA 1R6VA 1L4LA 2A1TR 4CW7A 4TSKA 4EJSB 4UMDA 4J1TC 4K6CA 3C8DA 1ZVVA 1O6BA 2EJTA 4PHTA 1PNVA 2FXVA 1DHRA 2OOKA 4PO8A 5MFPA 1I0IA 3ROXA 3UWSA 1J8MF 3CINA 3Q2KA 4IIGA 5JO0A 2YQ4A 3JQPA 4HDOB 3WNCA 2V0GA 2QD3A 1ZYUA 1E3LA 2ZJ1A 2H14A 1YAJA 4K8RB 3EARA 4WNCA 2OQIA 3RIGA 1T1EA 4DXAA 4EF6A 1NX6A 5GP1A 3GP5A 4M99A 1CRPA 5L7TA 4RH3A 1V96A 1GZ5A 2NACA 3HG7A 5U1PA 5SV2A 1RHKA 1ICIA 1OXKB 1RWNA 4KZKA 4QOHA 3K15A 4YCMA 3VPDA 1Q0LA 2HUNA 3GAMA 1THGA 1N2JA 2CBXA 2JFHA 3BMQB 1MB0A 1CCWA 2B30A 3EGCA 1E7RA 3KE8A 4OQ4A 1HE3A 3RFTA 4A08B 5BT8A 4ZOVA 2HMVA 1HTWA 3N0VA 4X3EA 1LI7A 1W6UA 2PQ0A 5DLDA 4M46A 4DPMA 5HRCA 3V1NA 3U7GA 2CXQA 3EIXA 3G0BA 1EWQA 2Q2VA 1ADFA 3LG2A 1C29B 2TYSB 3TMYA 5BSFA 3FDJA 4NLLA 2H9YA 2EIDA 1OHHD 3DO6A 1VQ1A 4MS1B 2NM0A 3F3MA 4OQFA 3SX2A 4CF6A 4PSWB 1NXQA 1PJ2A 2PJZA 4BAUA 2GZHA 3MTEA 1DBVO 3NVAA 1PJSA 4LQLA 2OILA 4D0SA 1TNDA 4W8OA 4UXIA 3EPLA 1LPNA 3W15A 1PCXA 3DBLA 1E92A 3HJUA 5A6SB 4DLRA 1CUWA 1J2EA 4GBED 1R5MA 4O1HA 3UJAA 3MS4A 1V3UA 4HNTA 5B6PA 1NLYA 1IXRC 1WXFA 2FSVC 2QI9C 2WWXA 1IDN1 2HZ7A 1P2FA 3DXZA 3F4LA 3PC8A 1YL7A 1SVUA 4NH0A 4R1MA 1J8YF 1CD5A 4ZI5A 1ZITA 4X8OA 4FAVD 1Q3HA 1ZZGA 1YQQA 5KOHB 2J9FB 3H2JA 2YN2A 3M5CA 3WRXC 4OHZA 4CKBB 1XZCA 4GI3A 2GQ0A 2M32A 2PRIA 3SS7X 4CKEA 1TJPB 4KR6A 4FKZA 1CLEA 1G20B 1MCZA 3RUIA 1I2MA 2Q2NA 1R8YA 3QVSA 4QUIA 4WN9A 1P2GA 1V3TA 1AMNA 4HS4A 2B8JA 2IYZA 1TF7A 3FCAA 5K3BA 1HE5A 3IXQA 4EKGA 3RSSA 2OO3A 3LF1A 4ZXFA 4C0SA 4POOA 3IE0A 1YWGO 1U0BB 1FVFA 4PZAA 4C08A 4JXXA 1GRVA 4DW8A 3NDIA 1MN6A 1SFRA 3TQTA 1NP6A 3JQ9C 2I54A 1F2TB 2QVCA 4PZ0A 1I80A 3A3NA 4NSNA 5AJTA 4KREA 3VC3A 3O2QB 2X0IA 3OCUA 4KVZA 5AXAA 1ID8A 1HNXB 1CBUA 2RAFA 3FVWA 5TQ2A 1N6PA 3VHXB 2DFLA 3KT8A 1JVBA 5F12A 2Q2WA 2BCJB 3WDSA 3GBVA 1IPHA 1KKMA 4FDMA 3IQZA 4A10A 5I7FA 1WF3A 1PG2A 2WJAA 3MJEA 3WV5A 3K09C 5SZIA 1TF5A 1IRXA 4YJKA 3I12A 4KGDA 3EUWA 5FWXA 1SY7A 2C2WA 4JMPA 4UEKA 3H8SA 2VP4A 4B44A 3WJ2A 3AW8A 4UHHA 1SG9A 1DCTA 3A6HA 3UAZA 4I8IA 1WEKA 2V59A 3ZV3A 1E9CA 5J58A 3DE6X 3CVUA 4YCBA 1GR1A 2DG2A 3HM2A 4HEJA 1FLAA 1N2CB 4QICA 5A05A 4B4OA 1AQLA 3NIDB 4EF4A 1GA1A 2X7JA 2RH9B 3RRZA 2CF6A 4JU8A 1NQOA 1KI9A 3GFFA 4MV5A 1UZMA 3H99A 4LJ5A 1XJWA 2PPVA 4IHJB 2YYYA 1V7ZA 1TJ4A 2XT9A 3H2ZA 3C3AA 1LTQA 2JI6A 2AB0A 3DSMA 4HDCA 1XKLA 4G5GA 3FFAA 3R5SA 4D96A 2R25B 1DG1G 2VJKA 4DT1A 3STYA 1E9RA 3O0DA 1FDRA 5JLJA 3KETA 1D2HA 3A3YA 4Z7OA 5DYGA 4BRZA 2WU8A 3BMNA 3E3MA 2CE9A 1RBYA 1UOPA 3D8NA 2GNQA 3N6RA 5P8WA 4EPTA 4Z7QA 1R4ZA 2HJ9A 3RSEC 2V4MA 4TS1A 3H1AA 1UFKA 3DW3X 4G4JA 5CT9A 2GYVA 2A35A 1GRQA 3DT6A 4LF7B 4OX9B 2OV1A 1PVVA 2XE4A 1GZSA 1I1QB 1A88A 2OENG 4ZQEA 4YCCA 1C2TA 1KZGB 3R3UA 5CEJA 3U44A 4IYJA 4C5BA 3SDZA 2RH4A 4GNKA 4ESEA 3CLUD 2CBGA 3JALB 3HLKA 4J4HA 4QWMA 5BYKA 3J81k 1H9BA 2RJ3A 4GOKA 1E60A 3LHIA 3NOVA 3QU7A 4PG7A 3SJBA 7ABPA 1N7GA 5H82A 1WY7A 4IXWA 1ADJA 2H1LA 1Z74A 2VUUA 3D3KA 2WZCA 2FPMA 1Z45A 1YGPA 4JLNA 1B74A 2HJRA 3DDHA 3N5KA 5K9ZA 3P0IA 3KWLA 5GTDA 1H8EA 1QANA 3TIIA 2HJSA 3F8SA 1O7JA 1U2ZA 4LF6B 3DH0A 3OD5A 4UVHA 3W6NA 4BOYA 5GV7A 1QP4A 4NH4A 3OZEA 1SKQA 4NOJA 3WTCA 4NOMA 2VSYA 2ZWAA 4PX3A 1F38A 2E4VA 1XDWA 4GX0A 2H92A 3B7PA 2EQ5A 1H66A 3EAQA 1CJUC 2OZLB 3AR3A 1G0OA 4E03A 1WVGA 1EM6A 1H2FA 2VDRB 2QROA 4J0FA 4NC4A 4N76A 1DIAA 4WZBA 3PX3A 2DJ5A 4FBGA 4KH1A 1Q0HA 2GZRA 2PJUA 4BNDA 4DIFA 3U1BA 3PV0A 3OPMA 4OKIA 5CYKB 5K01A 5ECYA 4DA8A 1QRSA 3KUKA 3N07A 4QTXA 4F3YA 4F8JA 3W90A 1Y80A 4DILA 4L8GA 4DA6A 2H9AA 2I99A 4LI3X 5JD5A 2IV7A 4WT7A 1RXWA 3RHTA 4KQEA 3OJEA 1RI2A 1E3SA 2REBA 2XNSA 4GLLA 3SQMA 4B0PA 2HIAA 2FVYA 2JAPA 2PX5A 4DADA 3PVWB 1G5RA 2Y6VA 4WK2B 3H9BA 2HPZA 1PKEA 3AIMA 4WOPA 5KU7A 4J8PA 1DQNA 4FK8A 2CLSA 5FUXA 4JKOA 1VMKA 2C29D 1EU1A 3LGSA 2OPBA 5CJJA 3R9IA 4FM9A 1S2GA 3TW8A 2DPGA 3H2YA 2ZUUA 4DQUA 4A8JB 3B6JA 2Q3HA 4OEHA 3P2MA 4Z51A 2XX3A 4HSEA 2UUAB 3OAAA 5JXWA 5IT9g 3SY8A 1IOLA 1ZAKA 3D1JA 2I4MA 1T0JB 4HAOA 3PUIA 4RKQA 4CGYA 2HR1A 1VLLA 5BVHA 4IIJF 3RSCA 1L5FA 1RLIA 1Z82A 2AOTA 2QOEA 2C0CA 2Z2KA 3BE6A 5LBTA 3KKOA 1ISMA 4P4GA 3I1FA 4KFSA 4CI1A 1PNQA 3WQBA 3GLHB 4FX5A 4DJDC 3T3OA 3GJSA 4RPHA 5I5GA 3U56A 5M5RA 5C2JB 5CDSA 1SD1A 1K8QA 3IUSA 1E3JA 2YJNA 3SKVA 1MA0A 1LVHA 2AD5A 5JXJA 3PEWA 1G42A 1DFHA 1C0IA 4HGRA 5JNUA 3QKRB 4EYEA 1ITZA 4U6QA 3GOHA 2PT6A 4C4PA 3MXXA 2GEJA 1N5OX 2G07A 3AL3A 3KR2A 3PIDA 4Q4AA 1GNQA 4PYNA 4TYMA 1G291 2X0EA 1UFOA 3PVCA 5TPWA 3WGGA 4C4RA 2Q6TA 3IYLW 4NMLA 3V7DB 1LBEA 1W29A 3SLGA 5KHOC 1FNMA 3DHNA 3KX2A 4XKJA 1GL3A 1ZA2A 3PPYA 4RTLA 3WK7A 5EJ6A 2FFAA 1E2IA 1OI3A 3GHYA 4LC1A 3MXTA 5TEFA 1W96A 3NIDA 4MR8A 2BRUA 3IAXA 3RS9A 1I33A 1ZIPA 2IY8A 3IBSA 4KJZA 4XIFA 3FWPA 4IDAA 2XW6A 3R75A 3SC4A 4ZYVA 3B52X 2H1HA 2G1AA 3SQDA 1G8KA 5JXGA 4DLVA 1R4NA 1C7JA 4DJEC 5K8TA 1WULS 2WTAA 1AKUA 1H2BA 4KAJA 2CFTA 1JKIA 1KP2A 3H5OA 1XE3A 2VT6A 3O3OB 2YXNA 4DV0B 5I3CA 1W5EA 2BJVA 2BMDA 2GJ9A 2JZNA 1IJEA 3JQDA 4Z7OB 4XOUA 2R6FA 4EABA 4MMXA 3E2PA 3KV3O 3T7JA 2AMJA 1U7WA 2J5KA 4MV8A 1CS0A 3MYYA 4PQFA 1XTSA 2HA2A 2H8KA 2J9GA 1GAEO 3STHA 4C0XA 5CA0B 3ASVA 1V4NA 3E0QA 5KCMA 3WK5A 3C1TA 3DGEC 5TEEA 4FZ5A 3UOWA 1IQPA 1SWVA 4P0TA 4DAEA 5ALKA 4Y2VA 3KL2A 4CMCA 2CV0A 3KEGA 3GFBA 2CEAA 2XMDA 3CUUA 3I9NA 3DAYA 1NVFA 4WEOA 3KE9A 4IA9A 5AKZA 4JODA 4XTCS 2W9XA 2A4KA 3D4IA 3TLGB 1A77A 1X7DA 4RJ2A 5F9HA 3C1UA 3TRKA 1H3NA 4K28A 5DP1A 4UDOA 3UGKA 1JH8A 1G60A 3FTNA 4BNUA 2GZAA 4LFAB 3A9VA 4O3FA 5AKYA 3LY5A 5KI6A 1G2QA 2IDMA 3GZNB 2OAQ1 5G1PA 2Y2UA 3NC1C 1P1RA 1W2HA 2B9VA 5TT1A 2DQKA 4S1TA 1L5NA 4OWRA 3ZJYA 1B6TA 4EZEA 1ZN8A 3ZOKA 1VIVA 2PV7A 1YBHA 3H9CA 4EUNA 4XVQA 4QUEA 2CO0C 1RHQA 2R7LA 5ESWA 3WWCA 1EUDA 3OJFA 4MUNA 3BZBA 3HHEA 4YROA 4D4IA 1RYYA 3EIFA 4CUKA 4D7AA 1KETA 3ZDXA 4NV1A 1OH6A 1R4AA 3QFRA 5CYKA 1I2DA 3CQ9A 5A4IS 4N3GA 1QO7A 3QI0A 2MSKA 4HUJA 1ARZA 3W1WA 2G6TA 3QIVA 3QJYA 4R9VA 4GS5A 1K8KC 1JUDA 3CUWA 1ZI6A 3N3AC 3LL4A 4MVJD 4TWIA 5UKDA 3UMCA 4F4JA 1T9HA 1GJRA 3KZMA 2GRAA 4HGZA 5FAXA 4AU1A 4EHDA 2RIPA 4TL9A 3HBMA 2IK8A 1CRWG 3RUEA 3LT2A 1HFKA 1Z5NA 2IHZA 2EX0A 5D3ZA 2FXIA 2H1WA 1XTQA 3CNBA 3AI2A 1UAAA 3OU6A 1UM9A 2Q7QA 1B0ZA 2PSDA 3AEQA 1YRQA 4ZVKA 3FTFA 2QP9X 1U0JA 4UMFA 4RDCA 3AVOA 4N8EA 1PO7A 2A9RA 3HWWA 3DKPA 3TLCA 2F48A 4GLFA 2R1VA 1RWXA 2DQ4A 4OHWA 1UFQA 1Q11A 1WKVA 3DV9A 4C1NA 4DYHA 2PAAA 1NI4A 2AHOA 4O9DA 3V32A 2BI4A 1E69A 2HWUA 2ZXEA 3OZTA 2FMXA 2R7MA 2WUDA 5JAZA 4G5QA 1T5LA 3FNRA 1NVGA 1PGOA 1CQZA 2WF9A 5IJWA 3I2HA 2IYUA 5TARA 3FZYA 4KNYA 1XROA 3W0LB 1A8IA 4PPGA 4ZO8A 4O0MA 3ET4A 4KWHA 3RW9A 3X1JA 4E5ZA 2ZR7A 5CCDA 4X41A 3AIIA 3OQIB 5ALVA 3ZE0A 2RD2A 5CP8A 4LJAA 2ZSJA 4O0LA 2XBMA 1NF3A 1ZOOA 3N2YA 2QZJA 3LHKA 1G63A 2IKQA 3COVA 2OXTA 2IHNA 5JDIC 2EBFX 4ZDIA 4ROSA 1NJ2A 3FKSA 1GAQA 4FB5A 4KR2A 3H7IA 4EFMA 5THQA 4OYRA 2R5FA 3TW0A 2FUNB 3TR0A 3QEMB 1NXVA 3BTVA 3MGCA 1WXQA 3AXTA 2INGX 3QK7A 2IS1A 4WKCA 1IYZA 3QE0A 2NIPA 4AUNA 5EJ8A 2BM8A 1M7HA 4QLOA 2C4TA 1TMYA 4CY3A 3FGPA 4HH4A 3SYLA 1QAOA 1ML3A 1W93A 5T6MA 3WMGA 4ZT2A 4GXQA 4H3HB 3BFJA 4L4YA 2JGJA 2QJRA 4K0KB 4UDNA 4LC9A 4WBNA 3FHJA 1N5MA 1OLUA 2NP7A 1W6RA 4QU0A 4I3HA 3BSWA 4YRJA 3WZLA 1BQ4A 1MA3A 1H0RA 3AUSA 3ZY5A 5B58C 2JK1A 1TA4A 3D54D 2VWHA 2BCEA 4QBFA 1ECGA 3AF6A 5HK9A 1SHZA 2I6TA 1QKIA 4CQNA 1H6CA 2P9SC 3AY0A 3IBFA 4C05A 4CCSA 3T5TA 4JVMA 4ZQBA 2V6JA 3DL4A 3RF6A 1P4SA 4GUAA 1RQXA 2BM9A 1KVSA 3RDPA 4BVFA 3RASA 3SNKA 2ZIWB 3UQYS 4UCXA 4KQ9A 3S1AA 3VR2D 1IOWA 3MBOA 4Y2JA 5BYJA 2OHIA 2D7CA 1BFDA 3K0BA 1BZYA 2FYTA 4BGVA 3WL8A 4TKVA 1PZEA 3TAHA 1VE5A 5FUQA 4I2NA 1QX3A 2XWSA 4ZT6A 3RK0A 5KDLA 3A9WA 3HFRA 2Q28A 3KEFA 4J90A 3THYB 2X5JO 1IIRA 1NNI1 2QW8A 2R4QA 4J3NA 4P80A 1ZVKA 2ZAMA 5FWDA 2YV2A 2A33A 4DS3A 5AUNB 4CLRA 4HVLA 3FYUC 1IZZA 1T3LA 2Y68A 2C84A 4TKMA 3S1LA 3NDJA 1DQPA 3SHVA 2KSQA 4DBLE 1Y6GA 2BI8A 1JHRA 2JEZA 3ORYA 3PC2A 3BAFA 4B84A 4RIFA 1SIWA 1IRIA 1KBQA 2G63A 3P4FA 2VXYA 3VPAA 3FR8A 5D6NA 1YBAA 1ZVJA 4UHDA 1PJRA 3CUSA 1M9NA 2VHTA 1G19A 4MGEA 1CR0A 3KOWA 3V8EA 2EXXA 2A84A 3EI2B 4ZMRA 5L3QA 1JOFA 2HNBA 3RTBA 4LOHA 4MQFA 3PHLA 1XRLA 1WQ4A 1GLVA 2KMLA 3QVOA 1JMKC 4M0LA 4F3RA 3HXKA 1VPWA 2X5NA 4AX4A 4CFYA 5KTMA 1H9CA 4NYJR 2X9GA 1J21A 1ENOA 4IICA 4MAMA 4AKIA 3B7GA 4WKGA 2D13A 5HHTA 3O8NA 1MAWA 3O8OA 2GAIA 4OHUA 3TZLA 2GKSA 3PCRB 4AJ1A 1QU3A 4G1BA 3PC8C 3MRTA 2XSZD 2DB3A 2UKDA 1DWPA 3J81g 3WMXA 4YTEA 4YLGA 3LZDA 5K3OA 2KLBA 1U2VC 1OFIA 1ZD5A 2B4YA 3TSZA 3ZH9B 2B5LA 1GTVA 3RS7A 2GN8A 4QPPA 3KJGA 4RANA 5KMGA 2VF2A 3CPSA 4M1MA 3U7RA 2WIDA 1SK9A 1G3QA 5EE1A 3RGGA 2V96A 3CVYA 3ZW8A 3PE4A 1WW8A 5EHZA 5I7SA 4G0VA 2LZ0A 1PV2A 3SZ3A 1UM9B 2LCFA 4HAVA 4X71A 3TRIA 3BQMB 3ZLTA 1MX9A 3SHTA 1GV0A 1NJ5A 1GTSA 1NUTA 3AERA 3FDZA 2GCNA 2I7XA 3O21A 1Y1KE 3EG6A 4TQ9A 3SEQA 4XVRA 1JXAA 3WNZA 4C4SA 1H4SA 1IQ0A 1U5BB 2C7BA 2HK7A 4IJ5A 2WHYA 1TX4B 4RK7A 3SBDA 3WKCA 1FUIA 4HQLA 2IYLD 3F3YA 3UGQA 4ZVSA 4B4UA 2I33A 4GKBA 1G7TA 3QLJA 5LR6A 3W5VA 1YFZA 3RU9A 1AKVA 4B40A 2NSJA 1OLOA 3FGOA 3O8QB 3LRXA 4PHFA 4RA9A 1X3SA 4JZYA 4BZWA 1OPRA 3L4OD 4Q3DA 1ICEA 2DECA 2CLEB 2EZ9A 3LFHA 1DNPA 2BBTA 3CPJB 2VHCA 3WRYC 2OAGA 3TRDA 3GYBA 5C34B 5F35A 2FPPA 3F5FA 3LXXA 2PUVA 1Z12A 3B3AA 3G2IA 4L73A 3M5WA 5HDBA 1W9HA 5E3IA 5EYPB 5TDHA 3LSYA 3D7MA 3VR5A 3AVVA 2AC7A 1OV4A 4AIIA 2REQA 5EMHA 2J57G 3PTAA 5FNVA 2FQQA 2JHCA 5BP7A 2ZWIA 2QP3A 3IJCA 3GARA 4JI1B 3HDTA 5JJLA 3IQGX 2ZI3A 4K0RA 5COQA 4ZXPA 5JZSA 1SXGA 4XVCA 2PSEA 4BVEA 2I3ZA 5C31A 3PIRA 3K9WA 4XEUA 5DNUA 5FV7A 5KVCA 2ZRHA 5HIMA 4AMBA 4ZKDA 2UUBB 4TXLA 5J2TB 3NT2A 5PNTA 2PRSA 1PS9A 3JW8A 4Y9DA 3KKEA 4DNXA 1GNPA 1TKBA 3DDCA 4V2IA 1XU7A 3JQAA 4IYRA 3K32A 2Y0BA 2YXEA 3I6MA 4BS9A 5BWLA 1JAHA 2HLDA 3K1AB 5KPDA 3GJ0A 2ONKA 4IW3B 4LOIA 3IKTA 2F67A 5CR9A 1JFSA 2RBEA 2VLIA 4RXMA 2JHAA 5IHPA 1GUDA 4JENA 3RMZD 1KKLA 3AWIA 4OATA 4R81A 5LBIA 4B73A 3TNJA 1H2HA 3TIVA 2GVNA 2JB9A 5CCEA 3EFOA 4BV9A 5K8JB 5LN1A 4ZPJA 4EAQA 3NXKA 1Z75A 2B35A 4FYYA 4MMZA 1SHJA 3CCCA 3R6GA 4I6JA 4EDFA 3OPYI 5ADVA 5LVAA 1MFZA 1XVLA 2OHXA 1W87A 4K46A 1IU9A 3AFHA 1JYFA 2H1CA 2NNLD 3H9UA 4F11A 4AYXA 4OQYA 3ZGXA 4WUTA 4MARA 5K0EA 1GAXA 1Y33E 3BXHA 3JATA 2NTNA 3CRVA 4A8TA 1VM6A 5A1JA 3OVMA 4PYOA 1C9KA 2A9FA 1XU4A 3PLNA 3BXEA 4IFIA 4QYIB 3VZCA 3CR3C 1CT9A 2X4LA 2NP6A 4IH9A 4GOMD 4JWTA 3HB7A 5CH5A 4JBWA 3FOBA 3R23A 3RIMA 2RSLA 4FCTA 5L7WA 3LYHA 1AKYA 2HN9A 3ESZA 3JAWA 3DTVA 4QRDA 5DVZA 4TSFA 3WMRA 2O54A 2FG7C 4E5SA 4IR7A 3OPQA 1LW7A 2A86A 5ARBA 2ZE5A 4JQCA 2Y0CA 2F1IA 1G7CA 1NPDA 1KI2A 2GFQA 2ZRPA 4PZDA 2WY2D 1K27A 3GLFA 1LLQA 2V98A 4UTXA 4D43A 2CUTA 4F2WA 1CUIA 3AHHA 2EDCA 3BWSA 3L4MD 1I8TA 1U8TA 1Q84A 4KX3A 1DB3A 4M1ZA 4Q18A 1EFPB 4G2NA 4Q9IA 1GPAA 3FUUA 3IJPA 1N4AA 3BCRA 1J2JA 4DIBA 3SMVA 1YC5A 1S7GA 3NYQA 2IEZA 1CQJB 5CIQA 5E38A 2QRQA 4TYYA 1AHNA 3M3DA 3KSAC 1WHTB 2I8CA 2IE0A 1II9A 2BI7A 2WAXA 4X8LA 3OTTA 3P9KA 5ERGB 1B23P 5BWOA 1Q57A 4EYQA 2ZRAA 1X70A 4P53A 1SMKA 1DBWA 2RK6A 3JR3A 3LFUA 2PDAA 5JR3A 4DMLA 1WSWA 3AM1A 1IXZA 1SBNE 2XR1A 2EX4A 3NOQA 2ZYUX 3GQVA 5CRIA 1QVAA 2E87A 1E3WA 4WZBE 2TMYA 3B6KA 4EB6B 1W30A 1F6DA 2OYCA 4Z0HO 4TMVA 1S9HA 3T4UA 5H1YA 1FSZA 3CGWA 1FCJA 2HRBA 1DFGA 5EPUA 3CUEF 1T5IA 2PKQP 4O33A 1ML4A 2ZRFA 2AI3A 4JSYA 4K6KA 3SE0A 5FOQA 2J46A 3VBCA 4YWHA 1EVJA 5JVDA 4MVXA 2HM7A 4PIMA 2WQ6A 4UUNA 2KPOA 2NQ8A 3BTUA 3OLVA 3OTIA 4NJMA 2R60A 4Y9SA 4QRJA 2B4KA 2CDRA 2DR0A 2B4RO 5D1HA 4JL6A 4NPCA 1RD4A 1N5LA 2WJZB 4CFSA 1B6GA 2QB5A 4PPQA 3B1WA 2ZSEA 4FFPA 4H6XA 2UZ4A 4J0DA 3AKEA 4CDRA 4LJKA 1JVNA 2O2YA 2GA8A 1YE3A 1HNWB 5JQGF 4HNQA 5KO2A 4B17A 1WDLA 3V8NA 4DBZA 1NJFA 3GW8A 4OHKA 1NYTA 2QLTA 1XCOA 4L78A 2AN1A 1QTRA 3ELBA 3H0EA 4RPKA 4ZAWA 4C04A 1A8PA 3GO4A 4I55F 3RG2A 2HWYA 2BFFA 1SO8A 2O8EB 4NOKA 5TR9A 2Z57A 3AEKB 3HRIA 5JISA 16PKA 3W4JA 1UADA 2WRZA 2W4IA 1EK0A 2J9XB 2MSLA 4R7TA 5A2QA 1DXOA 3PE7A 4DLZA 4MVCA 4JYAB 1CC1S 2XLCA 3R0XA 4HDNB 4U9UA 4OHFA 4C01A 2IIVA 2MINA 1OGJA 1C3JA 2FRDA 1F6BA 1N6FA 3PDIA 2A8YA 4UVGA 4DGSA 3EPJA 1OQAA 2YIDA 5CIYA 2AG5A 3DNPA 3EG5A 4J82A 4QXPA 2YWGA 2OFFA 5BW5A 5MN6A 5DBHX 4PCVA 1AV7A 3H2HA 4Q47A 4R7GA 2HNAA 3DLPX 2XYQA 3D4LA 2WNSA 3HGMA 1GZ6A 1P3DA 2UVQA 1T36B 1V16B 3A32A 3HBFA 3UB3A 2IX9A 4A23A 2Z5GA 3C2QA 2C1EA 1HFWA 3N0EA 1ES9A 2XNDD 4I99A 5ICGA 4M9SA 1R9JA 5I7WA 3P45A 1JH9A 2FSSA 3MWLA 1NT4A 4IJKA 5LYJF 2C7GA 2PX2A 3E9YA 3KSZO 4EJMA 1CX9B 3HBLA 5AHXA 5K3CA 1Y8RB 4M7PA 1JG6A 2OC4A 2QN1A 1AQUA 1QFXA 5HXAA 5KSYA 3D9QX 4TRRA 4AD8A 4JLPA 4QAJA 5KOIA 1EGMB 1ZCJA 4GPBA 3VU9A 1BN7A 1H1LB 3NBYC 4Y0NA 3YASA 3UA3A 3VI4B 1SUAA 3ZDEA 5JADA 5LQJA 2CEKA 5JNVA 3NASA 2X22A 1BCRB 4X1IA 1WPXA 4ZQGA 4FCCA 5KNBD 3HFQA 1DELA 1BA2A 1T3HA 1OE0A 1DP4A 2P6OA 5H3HA 4JI6B 3GWZA 1C4WA 4UUBA 1VE6A 3GJYA 3L0DA 3C7CB 1FRZA 3D0QA 4QJIA 5F5XA 3ZXIA 5DP2A 1T8YA 2QAGA 3G2KA 1CUAA 5K1ZA 3JAWB 2A9KA 1WB9A 4NBMA 3UH0A 3UFXA 4RK4A 5DIFA 3JYQA 1A8HA 2CUNA 5CVCA 4O2BF 5AMXA 1KQOA 3MPOA 1GVNB 3GLVA 2O2HA 4ZVLA 1E3EA 2X76A 3G23A 3KKPA 3WBFA 4L72A 2DBQA 2ECFA 2VJLA 3G0OA 3MSCA 4Y2UA 3U80A 1KYXA 3G1TA 1A9XB 3U1VA 2GHIA 1VGQA 3V7WA 4NESA 1PBYB 5FPYA 1U0SY 2FW0A 4I5EA 2ZT7A 4BNTA 3T34A 4J0XA 3R9WA 2PZEA 4FUTA 5GIOE 2F1JA 2OAEA 2EP8A 3L7OA 1WD5A 1ZKDA 3OECA 2ZRNA 2XKAA 3SDBA 2O7QA 7GPBA 1DGQA 4IZ6A 3RI3A 2XF8A 5L4NA 3VSEA 4CU2A 1HGXA 4OGKA 4C6RA 1P19A 1NVWQ 3N87A 1PK8A 2JFOA 3NGXA 1K75A 4M0EA 2QN9A 2Y1XA 5FFNA 4B35A 1WD7A 4MQMA 2FZCA 4YJ2F 1QLJA 2WKSA 4IH1A 2MTAH 8AT1A 3QLVA 2I91A 3KT6A 4Z99A 1P39A 1X87A 1MO6A 3GZTB 5ALNA 2XV1A 4AZ3B 1IVNA 1EPUA 2PGLA 4NYMQ 1E2MA 1D0SA 1VYHC 3SWSD 1A4RA 2IZ5A 2BTEA 1X13A 4C0KA 4G1EB 3QPVA 2R5NA 1DKLA 3KM0A 4CL3A 5C1OA 3M1AA 2ID8A 2AJBA 4Q1BA 4NMMA 4BUCA 2C5LA 2J3HA 3VTFA 1OFUX 3OUZA 5AP9A 4HZUB 5KHLB 1B0PA 3GJZA 3SAJA 3V4SA 2CNBA 2UYYA 2QDXA 3JQQA 4YCAA 4OJMX 2OYRA 5BUZA 3LAWA 3BE8A 3ZE6A 4J0JA 4KOAA 3GREA 1OTHA 3V1MA 1MX1A 1CJVC 4M9ZA 3K0FB 1RLMA 5H80A 2HPHA 4IXNA 1JIQA 1G8JA 4OQLA 2BFCB 4EW1A 5GINE 3MZKA 1N0UA 2G5TA 1YR6A 2XA9A 3Q8XB 4M0PA 3VO1A 5CYPA 5TPZA 3B9QA 1AURA 2QRVB 2A0KA 3OOSA 1WLYA 4MH0R 4R8MA 5LLDA 3RRMC 1AN0A 3SR4A 4CM9D 2FPWA 1IM5A 5AVOA 1L7BA 2XWPA 1GDHA 2H31A 3EBLA 3EUAA 3OURA 4N54A 1C0PA 1P7YA 4QODA 2VF4X 4L0QA 4GDFA 1TXGA 4WW0A 4G1MA 4QGFA 5AFU3 1RHRA 1FC0A 4BE9A 3ONDA 3C3DA 2VQFB 3FTPA 3ANMA 3LX5A 3P71T 5BW8A 3A1TA 3OUUA 5J4KA 4LJYA 2R97A 5HPYB 4XTRA 5EESA 4CT5A 2JLSA 3DVLA 1GLNA 1XTRA 4L3OA 4ENRA 1OLXA 2GCOB 2V5VA 4M1OA 3PHJA 1VSVA 1M5UA 2QSJA 2ZWVA 5F7ZA 1ODJA 1OMWB 1ZM2A 1NMZA 3AUFA 5FLEX 1MAVA 2CJXA 3OEEA 1GGVA 5KNCD 4MCAA 3LBYA 2HT6A 4MWCA 5KTOA 2AOUA 3B3GA 4WXMA 1WTAA 5CPFA 4GPEA 3BRSA 3OO1A 3K96A 4KJXA 4H6VA 4PU0A 5LJLA 2JBAB 1IOVA 2BH9A 1NBEA 1QQ7A 3BE4A 1Z0ZA 2JG3A 3E9EA 2B1IA 1KOJA 1FP4A 2CHVA 1R5BA 3BVPA 5HMMA 5BSKA 2ANCA 3TL6A 2BH2A 1EESA 2B92A 3GD5A 3NZEA 1ZY2A 3P2OA 2R8PA 5C5IA 3MWJA 1RIFA 3EXFA 3V46A 2VC2A 2EL7A 3I8CA 1L5YA 1QCYA 2IEIA 5TF0A 3G9ZA 1IBLB 3HB9A 1UKEA 4U2GA 1TU3A 3L1VA 4L4XA 4INZA 4UAGA 4XPIA 4JXZA 1SK8A 1JJVA 1V7QA 3B51X 3GCZA 5IF3A 1XO1A 1T9GS 2EQAA 2HF8A 1WOYA 2C2BA 4IEIA 4YJFB 2IE8A 5DHUA 3L8HA 2JGIA 3C87A 1JDZA 1VSTA 3PQ3A 1KOGA 1JYSA 3ADDA 3RAEC 4LZJA 3OESA 4B6PA 4QSMA 1Q1AA 4TXJA 1Q7BA 3K8ZA 3UBMA 1MAAA 4BQEA 5B2EA 1YQGA 1KBOA 1U28A 2OWEA 2PV0A 3AP1A 3G7UA 3RT1A 1JKFA 1X7WB 5DNYB 4AXBA 3K2EA 4P83A 2IUTA 1ZIOA 5FJJA 1EE2A 2RI0A 1WJGA 3AF4A 4GKKB 1O4WA 4C22A 4JS0A 5A2GA 1XQ6A 4B4KA 4DJ5X 3FCEA 1M2JA 5CFZA 5JNTA 4CEIB 3VR2A 2YS7A 4TSFD 3QVLA 2QX9A 4E6EA 1U2GA 2FQWA 1E0KA 1X14A 1X38A 4QXRA 2B8WA 1HKHA 3Q85A 4RA6B 3IALA 4MUXA 2MHCA 4OG2A 2B8NA 5EGNA 2AGVA 2HMTA 4Z3KA 1B9XA 1XX6A 1IXSB 3M49A 4QATA 1H5QA 3GN2A 3UH1A 5BN4A 3CVWA 1U9IA 2JBWA 3JQ8A 1A5AB 1YBMA 2JH8A 4YT4A 2LCIA 4RVFA 4KDFA 2NPFA 1PV1A 2YQZA 3RU7A 4N49A 1F51E 4X54A 4E2XA 2IHUA 2IU6A 2IPOA 2E5WA 5DTIA 1J5XA 5DM70 4BMCA 1T13A 1SQ5A 3BMCB 3LF2A 5FA6A 3OP1A 1CDEA 1P5JA 1K6IA 4E15A 3LQFA 2HBQA 2QV7A 3VZDA 4RIHA 1B1AA 5EQDA 3EPHA 1C30B 4NVRA 2AKAB 3DLIA 3OTQA 2OB2A 2ODPA 1DRKA 1EB8A 1AQIA 1ABBA 1NTOA 2X2PA 3AO0B 4H6PA 3CF4A 4WVFA 5A5FA 1IATA 4GI7A 2BLNA 2PGIA 4H27A 2QRZA 4TTIA 4X24A 3UXHA 4UQPA 2IDZA 4F93B 1FDSA 4KW7A 1A5BB 3S6JA 2J6HA 4LMAA 3SJZA 3RTCA 3SQOA 5HGXA 3T3MB 2IUYA 1O57A 4UHFA 2X58A 3UAVA 4FC7A 1DAKA 1GKKA 2BSAA 3AETA 2XAUA 4I5IA 4M6WB 2Z5FA 4WRRA 3K0FA 1T2NA 4DRXA 1KA9H 1EH5A 3EI3A 1T9CA 3W7VA 4QL3A 2QTNA 3NCTA 1G7SA 1O6CA 3KSDO 5ECGC 4OTZA 2M9MA 5AM3A 3CEPB 1N6EA 2VDLA 1LBQA 3PNQA 4JEIA 2QQEA 2G4LA 2H63A 4HEA6 3LYAA 1R5JA 4ZGGA 2JKVA 2ZTUA 4L5JA 4R6XA 4QC2A 2VZ8A 4L1QD 1DV2A 1QGED 5EKTA 5EWMA 4BFTA 3VR5D 1XNJA 2P1ZA 3QTLA 2C58A 4RHUA 3MQ2A 3K4PA 1UPBA 1E2EA 3NPAA 4NU8X 2QRJA 2MR6A 1MB2A 2OVPB 3RYFB 1IC6A 5C2WB 3FFTA 3VM6A 4PGHA 5DW0A 4LNHA 2BCGY 4I4TB 2NV6A 1NQUA 2IXFA 4MZDA 4ACBA 3LC0A 4FYIA 3B82A 1J25A 4IX9A 3ANNA 5BV2P 1Z63A 4U2CA 1MAUA 2OLJA 3PYLA 4U8GA 4UM9D 3DM9B 4AAYA 3M8KA 1NJSA 2X2FA 4D42A 2WG2A 2EG5A 1DTEA 2P4HX 1Q1QA 2NYUA 3BD9A 2N9UA 3F7MA 1W85A 2RC6A 3JYPA 4KWTA 3UC5A 3NIFB 4QREA 4JJAA 3EF0A 5CBPA 5ILGA 5F7OA 5KJ6A 1ZGCA 2P1DA 2PZ8A 4I79A 4OOEA 5DBGA 2Z04A 2FG5A 4HHEA 3UEOA 3FRJA 8OHMA 1XYYA 1KEZA 2QTBA 4PC6A 4YJGB 3UOGA 4BMYA 4JI7B 2CDCA 1TIBA 2HLNA 3IUEA 2ZEJA 3DOIA 4Q6BA 4HRVA 2JCSA 4Y1RA 4A08A 2D5AA 1JDSA 2OUIA 1KYIA 4OUDA 1IN7A 4BO9A 3EH1A 4CIWA 3R7FA 2ZCUA 3EXG1 2G3YA 2VT7A 2I0SA 2ZJ4A 4ZVMA 4CNBA 1EA7A 3DOJA 5AR1A 3JSXA 3AJDA 3GC6A 1X92A 4WA8A 1O5OA 2GJ4A 1UINA 4CCYA 1UMBB 1VCOA 2GD6A 2NOAA 2VC2B 3A27A 3L0CA 3QOWA 4HB2A 3C97A 4XFDA 4U2BA 2AFIA 3IDAA 1SQJA 5JSKA 3AEYA 4FMBB 2H9LA 2BCJQ 3EZ2A 4FEYA 4AVYA 4EL0A 4UBIA 3RFHA 2QZ4A 4XFKA 4DIKA 4G84A 3D8RA 6REQB 1G5HA 2ZSDA 1XP8A 3AUUA 2EV9A 4LTNA 4NBWA 1OB5A 1V8PA 4XJVA 5FDFA 1YE5A 3GLGB 2NO1A 2BJHA 2PS9A 3D6MA 4IF4A 2HCFA 4GKAA 4KPUB 2CN2A 3V4PA 4BU0A 1OB2A 4BO4A 4FB1D 2HMUA 2PZKA 5ERXA 3T61A 4AJ4A 1NBOA 3B3QA 5EUQB 2NO4A 3I52A 5A9RA 4OX9Y 2O8CB 2FUG6 4LNUB 3VJRA 1JIJA 4HGPA 2QUAA 4PFKA 1I2MB 3DUFB 3MLAA 2GTHA 4HZGA 3VOSA 4AJIA 5CD9A 3F3GA 4IDOA 1NBWB 1FMCA 3WGHA 3JWHA 1SKAA 1G8SA 3F5MA 3VR4D 3KV1A 3UCFA 3DD5A 4H7HA 2RGNA 3DMGA 1MIHA 5ALMA 5AQEA 3GLFE 4HH3C 5I47A 4QULA 4TLEA 5KVQA 3NJ4A 3AI1A 4PSDA 4YCNA 1H85A 3SQNA 2DUJA 2XB9A 5AW9A 4R8VA 4CDGA 3NBFA 3RVDA 8ABPA 1GO2A 1EX7A 1Y3HA 2I80A 3KZXA 4TYQA 3IQXA 5EXSA 2E4WA 3W06A 3WWDA 1I7NA 1XTPA 4QARA 2J0EA 3NJ8A 1Q0ZA 2Q5JA 3KR1A 4G0OA 1YIAA 3HU2A 2I22A 1N2GA 3ZLJA 1UQRA 3ZQ4A 1QDEA 2F64A 1BVYF 1IZ0A 4IDCA 4BCCA 4BN4A 2J07A 2BUCA 3LOQA 4P7FA 1W4BA 4G8JA 5F78A 2BHLA 4JK3A 3UT5A 1T5OA 2EOAA 2BF4A 4MRAA 3TOZA 3CH6A 2DE0X 3IAAA 1J5EB 1MP0A 3FPSA 5T41A 1OC2A 1BU8A 4F12A 1G66A 1TZKA 2GPWA 4YK7A 4BZPA 4URYR 3DHVA 5CW2A 2QUIA 3AHIA 3KYCB 1E7YA 2GPYA 4PAWA 4U1RA 3CC8A 4DWVA 2GC4A 1RI1A 4BNXA 2R3SA 4QGHA 3A0FA 4C5AA 3QPAA 1RXCA 1VBMA 4PANA 3H18A 3TRHA 4H59A 5FYDA 1GG9A 2F17A 1TUEA 1XXHB 2YVKA 4RVHA 3H11A 5JZOA 2GXUA 2Y76A 3C5WP 4B7AA 4ENSA 5TS2A 2CCJA 4TN5A 3NVNA 3WB2A 4W5NA 2IXBA 3JYHA 4UM9B 1QHEA 2J31A 5A7HA 3DE2X 4JNKA 4RXUA 2V7UA 2KYRA 5BVGB 5CFOA 2WG1A 3NH9A 1SGWA 2ST1A 1I7PA 1Y5NA 4BFCA 3DWFA 1ZM4A 4FYVA 3UIEA 1T4GA 2VSOA 3GLIA 4PTLA 5LMUB 5AM5A 5BUQA 4AUMA 3OE7A 5T4EA 4BZQA 2FZ4A 1XNGA 1O0BA 3ONWA 2CXUA 2FWJA 2QUJA 3WGYA 1RM0A 2DR2A 1MU0A 3NWPA 2JJ8A 1GZ7A 2PT9A 3GK3A 3PXBA 1FA9A 2D8AA 1BEEA 2FMUA 4ARAA 4FGSA 5KDOA 4BUJC 4O1IA 3WGZA 4R4JA 1K32A 1QXSA 3SQLA 1TTTA 4MMYB 4KO8A 4N1AA 2HW8A 4RIEA 3A58B 3EI4A 1G17A 4NEQA 3BCHA 4I8XA 1QWOA 4LHYA 5D5QA 1MPXA 1FLVA 5K45A 5M7EA 4WY5A 4MGYR 4XVHA 1L6RA 1KK2A 3T0FA 2IOFK 1MXHA 4I1UA 3TDKA 4NV0A 4XJXA 3TIXB 4J9UE 1GA4A 3QXJA 2OCIA 4NENA 1SPXA 4RLFA 1X2BA 1GUZA 2B99A 3N5CA 4N9QA 3AWDA 3PP8A 1VE9A 5IULC 3TXYA 3RNOA 3GA7A 2Y67A 4IM7A 4KUGA 4YUVA 2Z56A 4TV9B 3WWZA 4EEKA 1JWLA 1BGWA 1HYQA 3I8XA 3I09A 1TZCA 3RFCA 3ZV7A 3ELUA 3BRCA 4KQHA 4QOJA 3CX3A 4GG1A 1UJMA 1J8QA 1FFGA 5FFOA 4IOMA 1PFWA 2AT1A 1E3DA 1L1QA 2PG3A 3FCUB 2C8LA 4XEIC 2Q8QA 1G0NA 1H8ED 1BE0A 3F2IA 4Y3UA 4JT5C 1YHZA 1XKXA 4PSUA 2BHTA 3I9V6 3ZI0A 5AW6A 1HL7A 4RCZA 1SIUA 1TVMA 3HABA 5K51A 4AN4A 1E2UA 2Q4EA 5L3SB 3KUUA 4MV3A 1SVSA 3OPYA 4DNPA 4F5EA 2XRZA 3EG9A 4Q9JA 4IUCS 5K8CA 2OHFA 4ZHQB 2WFLA 4OUKX 1EP2B 1Z4IA 1E9DA 2IY9A 5B1SA 5KYWB 3J81A 4NDNE 3U5ZB 5E4FA 1T5HX 3OZAA 4DBVO 5DN6A 2DUUA 4HS9A 2ZRGA 5FUBA 1RC0A 4ZCSA 1E6UA 4EA9A 3IIKA 1Q77A 1UQTA 1C9NA 1ZMTA 3A2LA 1MC4A 3D6FA 3DVRX 2AG6A 1U65A 3G8DA 4K7JA 4EG8A 5L4LA 4EJ6A 3UMJA 2VKQA 1TC2A 1UBTS 2FJ0A 3NYWA 5HE9A 2QJWA 3V97A 2RCNA 5L40A 4G0UA 1DL5A 1MGPA 2X8LA 3CLKA 3AL8B 1T4CB 5F1KA 2RHOA 4MZXA 2DY0A 4CR6A 3HJFA 1FLNA 1OFTA 5J5AA 3OZVA 4O2AB 4YP6A 2OC9A 4GMKA 2Q4BA 3TGPA 3CRQA 1GUFA 2ZS8A 3R6DA 2HO4A 1PJQA 5A71A 4UFPA 4HTFB 4GGPA 4RQAA 3BG5A 3JWGA 5U4XA 5EZ6B 1QKJA 4O5OA 4G3XA 5DHPA 1T5BA 1TE2A 3A70A 1HE8B 4QYSA 4ETMA 4N7MA 2XYHA 1J09A 1ZESA 4TMFA 2P4SA 2YNMC 4Q19A 3ICPA 3K72B 5CB8A 7ADHA 1JJ7A 2OZKA 2B4TO 4W1RA 2I65A 2QD1A 3QKRA 4FHGA 2VDMA 4H77A 4A5SA 4NS1A 3A6PC 2YV4A 4LYGA 4MO9A 1DU4A 1RXEA 4KMSA 2OD9A 3L0IB 4Q24A 4PZEA 3IQWA 3V55A 5A7FA 2WUFA 4LYJA 5IBRA 4B85A 2NZXA 5H3LA 2DBZA 2PH1A 2WVJA 3DEHA 2CLDX 5ALYA 1I36A 1G6OA 1Z4NA 3RFXA 1IVSA 3AH8A 4YAWA 2EFEB 4RACA 3ZX4A 4V24A 1E61A 2ZJYA 3KB2A 3SK0A 5AJUA 3EDOA 4JEHA 3DB2A 2PJDA 1U8CA 3IOBA 3TLGA 1LVUA 2H2DA 3I4LA 4A1OA 2UUCB 1FYDA 1TAHA 5ALQA 1Q7EA 3RK4A 3JVDA 4E08A 1T1SA 4PIPA 4DLWA 2HMAA 3RRBA 1OWNA 3I5YA 3NFYA 5TGTA 1CY2A 4EMUA 1BXGB 3N8GA 3I3SR 4P98A 5DHRA 4ISBA 1JBQA 4BNZA 4UUOA 4H5IA 1CQPA 2OHHA 3OM1A 5EHNA 1XK6A 4BN0A 4A09A 3V4RA 2XZPA 3D4BA 3MJSA 1QP7A 3CS3A 5AO9A 3T1YB 5CNIA 2JAOA 1N2BA 4Q4HA 2G9VA 3WIOA 1DEAA 1IE3A 4NU6A 5KQRA 2F3UA 3DVQX 4DCVA 3BPSA 5B4UA 2JHPA 2DWCA 2Z9BA 2HHHB 1E3QA 4HDRB 2HA6A 3WR5A 1PI6A 3J80A 4OHCA 3CISA 1W9MA 3ZWWA 3IMKA 3NWOA 4BMPB 3RFVA 5JCXA 2ON6A 3KQPA 4N6OA 5L53A 1SBIA 3I5UA 3IEXA 1TM4E 1WUHS 3MTQA 3W8EA 3IP9A 3EMBA 4URXR 1NW4A 2NSDA 1MRNA 1NZFA 2WR8A 2VSQA 3GFQA 2W2KB 4DVGA 1ESMA 1KKUA 2I5PO 3QWIA 4CWAA 1X8XA 5CXUA 5AW0A 3SC3A 2HSEA 2OP0A 1DZIA 2HIHA 1KK0A 5FLXg 2G80A 1JLKA 2AGLA 4J3JA 4YA6A 3TNLA 2A5DA 2FEXA 3T7DA 3KXDA 1SOAA 5L45A 3U3MA 1CW2B 3VC1A 4R9UC 3NLLA 3HKCA 1DTWB 4EHBA 3RBZA 4OD0A 3KO8A 3H17A 3QFFA 5EZ5A 2WSYB 3R6WA 4NQZA 2WYWA 5ITZB 3DHYA 4Q1DA 2C0QA 5I5MA 4JLOA 4MICA 4L0CA 1KY2A 5JAQA 3D2CA 3Q1LA 4YXFA 2JC3A 1RU3A 4KQWA 2XZTA 2PT7A 3NEPX 2QQ5A 1SCKA 4UVIA 5DGIA 2C2GA 2R11A 3OQBA 2FW1A 1J0XO 1Q19A 2X23A 3KWJA 5CM2Z 5CMLA 5EPEA 2H68A 1RVDA 1W1WA 2WD7B 3EW7A 2OCBA 3GD7A 4JXMA 4BGDA 3A1UA 4XA8A 4BNMA 4URVR 2CLCX 3OF3A 1NQ5A 4R05A 5AHKA 3VMFA 4ETNA 2AMFA 5HE1B 3PEUA 4W5RA 2OK8A 3VNUA 1ZL0A 2VK4A 1DE0A 3C85A 5A0FA 3T38A 3HCFA 1SKMA 2P9YA 1XRMA 3G9XA 3HN2A 3C43A 1RABA 1G6KA 1BRMA 1ZLYA 3N6VA 1F60A 5CH8A 1NHGA 4QUKA 1GG5A 2WEKA 4M4SA 2Y1WA 4Q12A 4PONA 3ZVMA 1DWQA 2Q9AA 5CT4A 5EJIA 3V4ZA 4K9PA 2YWCA 3UHJA 3MT8A 5FI0B 4CKEB 4MRSA 4DEVA 1U6JA 1ZUIA 3UAOA 2CHQA 5CLLA 3HNRA 5LQNA 1W0JA 4OIFA 2GM5A 5DSXA 5FOSA 4C4OA 1ZEMA 1SU6A 2H1OA 4F97A 2W00A 1KPGA 2Q0SA 3LC7O 4S24A 1Y3CE 3U3XA 3VJMA 4QIHA 3WGKA 4A27A 3VBEA 4AQ7A 3PX7A 2IYYA 1HMYA 1Z47A 2YOHA 5ELXA 1XKSA 3A6DA 4FONA 3DHWC 2O8BB 1T8TA 2Y1OA 3ITKA 2IUEA 4MQEB 2Q5HA 4UNRA 2V7TA 1V95A 2IPAB 1YJQA 2Y77A 3ENQA 2PUAA 1TCBA 5IMBA 1POXA 4R3WA 1E2FA 2ZCVA 3OZIA 2DH6A 2GZ3A 2C31A 2FRXA 4MUYA 1X1CA 3R09A 4MW6A 3SU8A 1WLSA 1B16A 1DQRA 1Y3AA 1XF1A 3HFSA 3KOOA 3QX8A 1Y7IA 4UTZA 1FNDA 4BL5A 4DMCA 2O8EA 1PBTA 3DJFA 4OGGA 4AKEA 4NCXA 1RZRA 1GFIA 3LK6A 1E4EB 4Z2YA 2IYVA 3LOPA 1SC6A 1BDJA 2WD9A 4FD2A 4FI3C 4EWRA 3E15A 3RIYA 1TKCA 1ZIXA 2O0JA 1T91A 2QIPA 4DEYA 3CG0A 3O74A 1MG0A 4R2KA 5CDYA 1ZRMA 2G0NA 3H9JA 4Q39A 2CLHB 1J07A 5CJ2A 2C57A 4V38A 4BL0A 3F67A 4IVRA 1VLMA 1WOMA 1BYIA 3MWEB 3S7ZA 2X8JB 2XD9A 1D6SA 4P32A 5K3FB 1LDBA 2RGRA 3KAQA 2EW2A 4HZIA 2X7XA 4LDAA 3ZBUA 5JNWA 4JJIA 4AWBA 1KYQA 1C3EA 2VT2A 3DZJA 3ITDA 3TD6A 3I61A 4J6EA 2HXSA 5BQFA 1AO0A 1T6YA 3BWMA 5KNDA 3O83A 2ZJ6A 3Q0EA 2QUHA 1SVMA 2ZE6A 4RC9A 4EKDA 2VDKA 1GXSA 1NW8A 1PSWA 3RAPR 4ZFNA 1QGYA 5AVUA 4QPDA 1QE0A 1WBBA 1NR1A 2XWQA 4K3VA 4I3FA 3T3IA 2Y0DA 5A4AA 4YI3A 4A09B 4FCWA 4CMHA 1AB5A 4WK0A 2YOGA 2P2LA 4QBTA 1NXPA 3C45A 3EXAA 3LCJA 4M1YA 1JHXA 3K70B 2XDQA 1F12A 1L4KA 4ZMBA 3ZHTA 3PRHA 3RVRA 3WLAA 1AKMA 1VIMA 3B2NA 3AY7A 3I9LA 5JS2A 3WB1A 4G0XA 4PGAA 4ZHSA 3BT7A 4R8KA 4F2PA 1RWQA 5K03A 1N2SA 2IZ7A 1GQOA 2PGAA 3QWFA 1L8QA 2GPTA 1GEGA 2N0SA 3B6IA 4XEHA 4XRRA 3CYFA 4DDVA 2OFWA 1NVVR 1RS0A 4FR2A 3NWJA 5AKIA 2B1GA 1BO6A 1JQ5A 2Y9MB 3CTMA 1XZQA 4FQ5A 4JOBA 5FR2A 3V33A 5HOEA 3GD1I 4KK3A 4WA7A 2RCYA 3P0RA 5B2FA 2HZBA 1KI3A 1WVIA 3CPHA 3OJWA 2ZAIA 2VZLA 3GEHA 4IHQA 1IPEA 3EAFA 3CUYA 1AZSC 3ZC3A 2FFRA 5AIAA 1USVA 1JQLB 1H2WA 1UBHS 2P9LC 3BM5A 5CT8A 2Z95A 4D3YA 2EKBA 4C6TA 3A4YA 3EI2A 1RAFA 2J6BA 1SCAA 3WP1B 4D3FA 4QUJA 5L3QB 4AY4A 5KYYB 4LYYA 2V0NA 3BSSA 4H1UA 3PXWD 2WV9A 3D2AA 5C32A 4Q1AA 2NSYA 2R0QC 2B0JA 1Y63A 1JHMA 5CM8B 1G20E 4H16A 1XLTA 1ZUNB 1F2UA 1Y3DE 4M9UA 5IT9A 2HA0A 4RZSA 2Q9CA 4Z9YA 2V97A 3VFDA 4D9HA 1CY0A 2YMUA 3IP6A 5KAMA 3BIWA 3QELA 4HWGA 4D9FA 2MIIA 3P27A 1P0FA 3ENKA 5ALDA 3DG9A 4KUHA 3S2YA 3WFJA 4AKSA 2O5EA 5CNMA 4K9KA 2AH1A 3VUEA 2GZDA 2Q0HA 2V0CA 1O0CA 1WPRA 1ESNA 4HFRA 5FA5A 3KELA 2FZEA 3OU2A 3B78A 3K8QA 4MYTA 5COAA 4DQVA 3L01A 1I14A 3HI6A 5C4GB 1U11A 2CNXA 3PXCX 3EVBA 4U4AA 1BHO1 3WRYA 4EATA 2O2IA 1WG8A 2C42A 2KB0A 1PL8A 3A25A 3P7MA 2N47A 4G4GA 3NVMB 5EQTA 2GXAA 1O5TA 3FJOA 2I6QA 2C5HA 2O2EA 4FI3F 4M49A 2OV2A 3M6LA 4XRGA 1T2UA 3RQSA 3DXMC 2YH2A 2J3LA 4MS4B 1NAIA 2GZSA 4Y2TA 3MNFA 5KYNA 1U6KA 5LKRA 4RTSA 1KEWA 3HY3A 4DV2B 4N48A 3MTGA 3D3JA 2IH4A 2C8KA 1JILA 3LQYA 3G9QA 4O02A 1SIOA 5A4MS 1I1OA 3HXTA 1EDEA 4R8LA 1B2LA 1RZVA 5F4BA 3QY9A 3URKA 1YDGA 2Q8PA 4TYNA 5CG2A 2GBPA 2XJ4A 3SF8A 1VE7A 3G2HA 3NQ41 3HCWA 1V6AA 2R1TB 1AA9A 1MABB 3V80A 4FOOA 4K3UA 3ZCRA 3KQHA 4CY5A 3LA6A 3PXEA 3FYUB 1YKGA 1HNZB 1W35A 1JKMA 3AR5A 4Q4CA 4R16A 3OCCA 4RORA 3CM0A 3WFIA 1JR3D 5GJCA 1YOVA 2HK8A 1C5KA 3J7TA 1AQYA 2H1FA 1DADA 3DCNA 2H3HA 4RNCA 1YQDA 3FMIA 3WLOA 5IFKA 3DE1X 2GCIA 4MR7B 2QNBA 3S27A 2BHRA 4HC4A 1SN7A 1Z36A 1KIFA 1QZXA 1DAEA 2UV8A 3ASZA 1GOGA 4RV5A 1L5HA 2WSBA 4HQKA 2XSZA 3VR6A 3ZCTA