3IURA

Appep_d266nx+h2h3 opened state
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
684
structure length
668
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 211
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iurA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iurA01
5JALA 5ALXA 2GZRA 2WG2A 5AKEA 3ESAA 1HQDA 3O9VA 5JD5A 3BL8A 3HJUA 3STUA 2ORYA 5FUMA 1JJFA 5ALDA 3OTQA 4A16A 2XMGA 1THTA 4MYSA 5K3CA 5EIEA 4Q05A 5JAUA 2GBIA 2WUEA 2J4CA 4LIPD 4KRYA 2WJ6A 5ALQA 4B9AA 1LPMA 4AXBA 1TKRA 5A7GA 1QIJA 4FLEA 3PF9A 1BE0A 1ORVA 4DMHA 3FLEA 3FLAA 2OGZA 3AFIA 4AZ0A 4UFOA 3Q0TA 3H2HA 2G63A 5KREA 1EA5A 3KOOA 3DCNA 3F67A 3WK9A 3WK7A 2QUAA 1F0NA 1K8QA 4FKBA 1GPLA 2OCKA 1JI3A 5ALFA 2WUFA 4B0PA 1VZ2A 3FBWA 4LXGA 4N8SA 2JGFA 1EDDA 3TEJA 1WM1A 5HF9A 4FBMA 5A6VA 1EX9A 1LPOA 1LZLA 2XMZA 2HA2A 2PVSA 4KRXA 1QIIA 4QLOA 4LXHA 3WIOA 1X70A 2VT6A 2AJLI 3IDAA 2G5PA 3C6XA 4QE3A 5IVHA 3W04A 5AM4A 1L7RA 5K3EA 1Y7HA 4KE7A 2CMFA 1AGYA 3VJKA 3L1JA 3DJYA 4TVKA 3VVLA 2C0PA 3GA7A 4ZV9A 1E3QA 4IH1A 4QZVA 5DNVA 1OILA 1CFJA 3QMMA 2QTBA 4DSAA 4BVJA 4DYHA 2EDAA 1R4ZA 3OURA 5EIAA 3STVA 5ALTA 1CUJA 1MJ5A 2XLCA 4GW3A 4UHDA 4BC1A 5HCUA 4EY8A 5LLSA 4I19A 3ILSA 3R3XA 2J4FA 4JUIA 1K6EA 3ANSA 1BROA 5D7BA 1VA5A 1W1IA 5LZ2A 5AOCA 3HLKA 2JGJA 4NS4A 3G8YA 1W76A 4QNNA 4P08A 5I8PA 5AICA 3PUHA 1GKLA 2JGLA 3I2GA 1EDEA 2XUOA 1WB6A 2GZSA 1QIMA 1EXWA 1AMNA 3D4LA 3D0KA 1FSSA 2C58A 4KAFA 5D6OA 3G9XA 2BJHA 2V9ZA 1YB7A 4PSCA 5AKXA 4G8BA 1AURA 5LZ8A 4IO0A 1EVQA 1EHYA 2D5LA 1QIFA 3F96A 3D2BA 1YCDA 4L3WA 2UZ0A 3ICWA 5C8XA 3K6KA 2WG0A 4H7IA 2OQIA 2PSDA 2JGKA 3K2IA 5CURA 4RPCA 2XUHA 3PICA 3TGLA 1NU8A 5EGNA 2HL6A 2PM8A 3VKFA 4KACA 1LGYA 4JYMA 3H1AA 1MPXA 3CCCA 4H7DA 1MNQA 3SWWA 3HEAA 3R3WA 5AM3A 3PFBA 4OPMA 5JANA 5EIHA 1MTZA 2OGTA 3I2JA 4DMCA 5ALGA 4J0KA 1R88A 2QT9A 4E46A 3I2IA 5LZ4A 3F97A 3STTA 1USWA 2IITA 2WM2A 4LYDA 2QKYA 1EB8A 4U2CA 4P93A 3VJMA 3IURA 3AINA 4FHZA 4C4YA 1WOMA 1QO9A 2XQKA 4BYMA 3NUZA 5AHXA 2GYWA 4ZGBA 3BE8A 3FVRA 1H2WA 4G4IA 4KE8A 4LXIA 4J7AA 3IVMA 1XRLA 2RHTA 1WB5A 2Q0XA 1UKBA 2H7XA 2WUGA 4Q82A 4XIIA 2BCEA 1GT6A 3HYSA 2JIDA 4ZWNA 2G5TA 4KE9A 4OYYA 4X97A 4AMYA 4DNOA 1OXMA 4EA6A 4C89A 3ICVA 2VF2A 3F8SA 3RKSA 4HXEB 3W05A 4YASA 1AKNA 1XRRA 3T4UA 2VJDA 4Z49A 2G4LA 4J0HA 1MN6A 1XZAA 5JASA 5DNUA 3QYJA 4C4XA 1SCIA 3DDUA 2VJCA 5LZ5A 1QONA 5AOBA 2XE4A 5ALRA 4ETWA 5CH8A 1TCBA 4BDTA 5AK5A 1Z68A 4UBLA 3H18A 5CW2A 3H2GA 2H7YA 1FFCA 3WK5A 4J0DA 5FDFA 5H3HA 5ALJA 5ALLA 2Z3ZA 5CMLA 5CTAA 4KJXA 3I2HA 3DOIA 1H2XA 1MAAA 3WL8A 2DHCA 1J1IA 4AO7A 3H2JA 1CUAA 4BVKA 1DT3A 5AK6A 2WKWA 3UMJA 1PFQA 1JT2A 1VLQA 4G9EA 3WWOA 3VJLA 5JATA 3A70A 5AM5A 4Y2RA 1ETHA 4EY7A 5T4BA 1ORWA 2XUQA 1XZFA 1KU0A 3ZLTA 1QIKA 1P0PA 2O2IA 1VKHA 4G4JA 5DWDA 5AKIA 2X5XA 1C4XA 1CQWA 4H77A 5CXXA 4A5SA 1TCAA 1CIJA 2PX6A 1LPBB 2XB6A 4CG1A 3YASA 2WUDA 2Y2VA 4CI9A 4HTAA 1SOMA 2H9YA 4FDMA 1KEZA 2XDWA 4Y2YA 1QGED 1XZEA 2BGNA 4GDMA 3IA2A 2E3JA 2VJBA 2GYVA 5ALNA 1E8MA 1ZD4A 3H04A 4PF1A 4BTLA 2JGIA 1O6FA 1G66A 5AM0A 5ESRA 3OC0A 5AKYA 3W06A 1LPAB 4RGYA 2ZJFA 3P2MA 4PSUA 3R3ZA 1IVYA 1EB9A 1CVLA 1XZLA 1VA4A 3A2NA 1QIEA 3L1HA 3DYIA 1JJIA 2PU7A 2C0QA 2ZYIA 2X8BA 5KWJA 3C6YA 3D2AA 4X6YA 4BDSA 2PBLA 2XMCA 4FBLA 1LPNA 3BDIA 1MT3A 1PJAA 3PF8A 4FOLA 4BZWA 4N5HX 5AKJA 4KAAA 3ZWQA 2WG1A 3KD2A 3V1MA 3AZOA 1GKKA 3WZMA 1DQYA 2XUJA 4M0FA 1WHTA 1M33A 1F8UA 3UUEA 2HDWA 5ALVA 4BB0A 1ZICA 4B6GA 4MYDA 1XZMA 1UOQA 1ZGCA 1ACJA 4QDOA 2V98A 2HHAA 3G7NA 5K3FA 3O4JA 2RI6A 5AKZA 5LIPA 1ZD2P 2XMBA 4OD0A 4I4CA 1VE6A 4GBGA 1MX9A 1VJ5A 1L7AA 4QWWA 4LKOA 1YA4A 2RAUA 4N5IX 4UHCA 5HF8A 5I7UA 4ITVA 1CUZA 4W9RA 3NOXA 5IVKA 5FKJA 1XRPA 5EI5A 3WZLA 1WPRA 2HU5A 1CRLA 4PQEA 5EHXA 5BWBA 1XZIA 2EEPA 1YSCA 2BUCA 2WQZA 5A62A 2ES4A 3C6BA 1GPKA 2HRRA 5I9IA 5HZGA 3ANTA 4B80A 5HK8A 3R41A 3O95A 2GBFA 4OU4A 5K3BA 6YASA 1U8EA 5ALEA 1YAJA 1UKCA 4INZA 1AQLA 1MX1A 2QS9A 3EQ7A 1F0PA 1YB6A 1QJ4A 1WCYA 3PDCA 1EVEA 3H19A 5ALOA 1XZCA 3WKCA 3H0CA 3RLIA 2XLBA 4B81A 2OG1A 3CXUA 4QA9A 3DD5A 2C5FA 2HFKA 1YS2X 4UHFA 2JGMA 2I3ZA 2WILA 4OUKX 2P8SA 4XWGA 3O0DA 3BJMA 1SC9A 3IUJA 3FYUC 2HFJA 1IUOA 4O08A 4Q3OA 4X3CA 1YASA 2QOEA 3RK4A 4MEBA 5SYMA 1VXOA 3E3AA 5AI8A 3ZLUA 4UBJA 2QM0A 3VDXA 1UZAA 4J0JA 3PE6A 3DLTA 1DU4A 1ZD5A 2VT7A 2O7RA 1J06A 1E89A 1CUIA 2JBWA 3MUNA 1XZGA 4GLBA 3ED1A 3FCYA 4DNQA 4IH4A 4K6HA 5AKGA 4Q1VA 1MU0A 1CUCA 3WK6A 3LIPA 3JYHA 4L0CA 2C5GA 2GBCA 2VJAA 3LLCA 4FNMA 1UK9A 3R3VA 5CT8A 1IZ7A 3HC7A 5CRIA 3OPMA 3I6MA 3A2MA 4W1RA 4AZ3A 2XUKA 3I6YA 1N5RA 5CT5A 2Z3WA 2PUHA 3FSGA 4UBMA 5JAPA 2B9VA 4DM7A 3S2ZA 4NZZA 5IVDA 3SX4A 2Y6VA 2K2QB 1CUWA 4LHEA 1BEEA 3AZQA 1DX6A 4UBIA 1T4MA 4ARBA 3R3UA 1XRMA 2Y1KA 5AKLA 3D7RA 2O2HA 1BU8A 4HRYA 2HIHA 4WFKA 4N8DA 2PU5A 1CV2A 1HKHA 4B84A 4BATA 1DWPA 2Z8XA 4H7KA 4Y2PA 4WY5A 1A8QA 4EUSA 2QRUA 1DQZA 2VA9A 2QJRA 4V2IA 4FLMA 5LKRA 4G5XA 1TAHA 4AO6A 1BS9A 3V48A 4U2DA 3BF8A 3STXA 3M82A 5AJHA 4GECA 5AI9A 2PSHA 3JW8A 5AK3A 2PPLA 4DIUA 3G0DA 3G02A 2AJCA 4HZGA 3VXKA 1QIHA 4HXGA 2DQZA 1H23A 1QTRA 1LPSA 4RE6A 4X90A 3E4DA 1R50A 3EQ8A 4BC0A 3C87A 5ALKA 4Q3LA 3M81A 3UUFA 4CG3A 1W52X 2XMQA 2HA4A 2WIJA 1CUHA 3WA6A 1Q83A 2XQIA 3WKDA 5JYCA 4L72A 1CEXA 3AIMA 5AIBA 2WHPB 2ONCA 3C6ZA 4MQLA 1ZJ5A 5HF6A 2JGEA 4ZREA 2ZYSA 4OYLA 4WFIA 4K6KA 3FYUB 5EHZA 5K3DA 2BGRA 4UFNA 1BCSA 2XUIA 3BIXA 3CCBA 5IVIA 1ZOIA 4BCBA 3HRHA 4P92A 3N0TA 4RE5A 4BAGA 3IUNA 4DLNA 1S8OA 5YASA 3FYTA 3QPCA 3GUUA 5C7YA 3EF3A 3ESCA 3FCXA 4AMZA 1O6GA 1QO7A 3B3QA 4A23A 5AM1A 2HADA 1A8UA 3WIBA 5A7FA 4BCDA 3WKAA 4BE4A 4UHBA 3WA7A 3W2TA 2DCMA 1JU3A 1YA8A 2EDCA 2OCIA 4CIBA 5AI0A 1QOZA 4KEAA 4G1FA 3BIWA 1ACLA 2WIKA 1ZI8A 1W4LA 1ODCA 3ZPXA 1DINA 1LLFA 1UXOA 3I1YA 4GEGA 1J07A 2QMQA 4H0CA 5CT6A 2X76A 4U2FA 1THGA 5HQ3B 5EHNA 5AK4A 3LS2A 2HA3A 5JIBA 5JD4A 3SC2A 5KWIA 4HS9A 4BAUA 3A2LA 1XRNA 3A6ZA 2Z5GA 1Q84A 2CKMA 4OSEA 5JZSA 3GFFA 4XJVA 4AX4A 3WQHA 4TGLA 3Q8WA 3WK8A 4X6UA 2WU4A 1FFDA 4DNPA 1P0MA 1UT6A 2PKYX 4EY6A 3WJ1A 2DHDA 4EBBA 3HXKA 3QBJA 1N8SA 1U2EA 5DLPA 5BOVA 4EB0A 2PSJA 3C43A 2WHQA 1XZKA 7YASA 1ISPA 2ACEA 2NW6A 2I3DA 4J0GA 1E8DA 3M3DA 5HKAA 5T4EA 4L9AA 4Y9SA 1GPNA 1UKAA 2WHPA 2QXTA 2B20A 3RARA 1CUEA 5C8VA 3FYUA 3VISA 4XX1A 2XQGA 2WIGA 2OCGA 3V9AA 1G42A 4BVLA 2ZSHA 3IB3A 1JKMA 3R40A 4RNCA 3W9BA 2PUJA 3KWFA 2WFLB 3D59A 4IH9A 2DQYA 3O4IA 3DNMA 1EINA 5C8ZA 1HLGA 4B0OA 1JMYA 4Q34A 4QDZA 3O4GA 3WKBA 5FRDA 4C6HA 1CQZA 1WHSA 1H2ZA 5SYNA 5LZ9A 4OCZA 3AIKA 3ESDA 3IBTA 3DS8A 3QM1A 5ALMA 2WJ3A 2H1IA 3IUQA 1U65A 3BJRA 5JZBA 4IQ4A 3QPAA 3TRDA 3WJ2A 4LYEA 3WYDA 1XZBA 5CXUA 1VXRA 3FNBA 2BKLA 1DT5A 2HA0A 3D5EA 5AOAA 4CCWA 1R9NA 1TIBA 5FPQA 5HQ3A 1HBJA 1QZ3A 5CH5A 4Y2JA 3NGMA 4FMPA 5DNWA 3DKKA 4ZV7A 5DTJA 4WFJA 4FLFA 5JADA 2VQ6A 2O7VA 5LKAA 3BDVA 2I78A 3U0VA 1BEZA 4B85A 2XQJA 3H17A 1LBTA 2OLEA 4Y2UA 1U4NA 3I2KA 4BTVA 4WCVA 1RP1A 3K9BA 4W1SA 4B7ZA 2FJ0A 3N2ZB 2BFNA 4PV7A 1E66A 5DYWA 2QZPA 5A2GA 3JWEA 2HRQA 1IUPA 3CN7A 4G8CA 5T4HA 1CUXA 1Y7IA 3MUOA 5HFAA 3AIOA 5IH7A 1UK6A 2ACKA 5HKBA 2WLSA 3L1IA 5FOQA 4X00A 4QDTA 4ARAA 1XLUA 1YS1X 3GROA 4S0XA 1UOPA 1K4YA 2ROQA 1VZ3A 2CUTA 3GBSA 5AM2A 1HDEA 2GBGA 1GXSA 1JU4A 1CR6A 2YH2A 4HVTA 5HF5A 5BWCA 1F6WA 2CJPA 2LIPA 2XUAA 4EZIA 4DTCA 5JAOA 3WL6A 5CBKA 1Y37A 4F60A 1IUNA 2DR0A 4KYVA 1XRQA 4MXDA 4BE9A 1QIDA 3FAKA 4OU5A 2AJDA 2JEZA 2DFPA 4CFSA 5A71A 1J2EA 4J3JA 3H2KA 4G8DA 5ALWA 3NWOA 1MNAA 5FP0A 3WI7A 2XUDA 3C5VA 1UK7A 3C5WP 4M0EA 4B83A 2XMRA 2HM7A 4OB8A 3OG9A 4UHHA 5D3ZA 3STYA 1GQRA 4X7BA 5AI4A 1KU6A 1QLWA 4C88A 1QFMA 2BUAA 2R11A 4W1PA 4W63A 2D0DA 4K2AA 3WL5A 4H7EA 4QDXA 2QR5A 2IIVA 2OQVA 1ZI6A 1SFRA 4NVRA 4U2GA 5EFZA 1UK8A 1DWOA 1H22A 4EY5A 4B82A 1FFBA 4CIAA 4BRZA 1G5FA 2OAGA 3QZUA 2VAXA 4HAIA 4PO3X 1LPPA 4JNCA 1QFSA 3HSSA 1PV1A 3GELA 3FWHA 4YK7A 1BRTA 2B61A 4HRXA 2YASA 3ZI7A 3KSRA 5FV4A 5HK9A 4CG2A 4AQDA 4ZI5A 2OXEA 2WFMA 3MGAA 1CUUA 1CUVA 4FFWA 3C8HA 5HFNA 3DKRA 1P0IA 5D3KA 5AI5A 4KE6A 2YYSA 2XUFA 3O9MA 4BP8A 1ZIXA 3WWCA 2WIFA 2IX9A 1SCKA 2FUKA 4H18A 4YPVA 1AC5A 1ZJ4A 1R9MA 2O2GA 2JEYA 3DL7A 3BWXA 3M83A 2WIDA 5J3JA 1HL7A 3G0BA 1C7IA 1W6RA 4OB6A 3LP5A 5JAHA 1UWCA 3T52A 4E14A 2PSFA 1NU6A 1JJBA 3IUMA 1LNSA 3QVMA 2OAEA 4ZRDA 5AKHA 4DSZA 5IKXA 3H2IA 3D2CA 2FX5A 1ZI9A 2XT0A 4N8EA 1W75A 4GXNA 4IHAA 4W1QA 2RONA 3EBLA 2QJWA 4ROTA 3I28A 5JARA 3G0GA 1XLWA 3MVEA 1R1DA 1XQXA 4EHBA 3C70A 3I6ZA 3E0XA 1IZ8A 3BXPA 1R3DA 3WYNA 4KR0A 4KAJA 2RGUA 4UBNA 3H1BA 1P0QA 3F9CA 3OM8A 2CB9A 4U2BA 5AKKA 2ZYHA 3ZV7A 3EIOA 1RYYA 2OCLA 4Y2QA 2J3QA 5LZ7A 1JFRA 3OOSA 4Y2TA 1BCRA 3V1NA 1CUBA 2V97A 4BRSA 5CH3A 3WLAA 3FLBA 3AILA 4U2EA 4YX9A 1CUDA 3ESBA 3O4HA 1VE7A 2WHRA 3V1LA 1TCCA 3R0VA 4CCYB 4X85A 1ODTC 4QWMA 5AH0A 2CBGA 2Y2UA 2VSQA 4DMFA 3U1TA 4BAZA 3DQZA 2OPHA 2OGSA 4Y7DA 2WSLA 1EI9A 1WPXA 3X3HA 4FTWA 2WJ4A 2WTMA 4QDUA 1CUYA 4JH0A 2BUBA 3R3YA 2BAGA 3WWPA 5K5EA 2W22A 1RWQA 4MWTA 3B12A 4PW0A 4FWBA 5E2IA 5EHQA 2DHEA 1LBSA 1C7JA 5ALHA 1XZDA 2VAVA 4F21A 2ZJ7A 4AN1A 1TRHA 2RIPA 2B4KA 1YR2A 4BZZA 2WTNA 3F98A 5LP1A 4BP9A 2R8BA 4P9NA 2XUPA 3DL4A 2QVBA 3GZJA 4JYPA 1BN7A 4X93A 3QMVA 1T2NA 1GGVA 1MAHA 3DOHA 1Q0ZA 4DGQA 4MEAA 4K6GA 5C81A 2AJBA 1E5TA 4C01A 5JZ9A 3G9UA 1I6WA 4GI1A 4G9GA 4K5QA 3V1KA 2C7BA 2AJ8A 3G0CA 4I3FA 4B9EA 5F4ZA 3LIIA 1QTIA 3DEAA 1K5PA 1XQVA 3D3NA 2RHWA 2Z8ZA 1DWQA 4X94A 3PUIA 3TJMA 2HA5A 3SK0A 2XI4A 4UUQA 1XKLA 3FSGD 1Q0RA 3C8DA 3WKEA 1VOTA 5FLKA 1E8NA 3QITA 4H35A 1EK2A 5K3AA 3PI6A 2W6CX 2HA7A 1ZD3A 1XFDA 5JD6A 2XUGA 4E15A 4QEKA 1K63A 4EY4A 4HXFB 3AJAA 5ALZA 4MWSA 2PSEA 4CCYA 4X91A 3QMWA 1XLVA 3IIIA 4G4GA 1BN6A 1FFEA 2CZQA 1QE3A 1IMJA 3B5EA 4WY8A 5AI6A 5DJ5A 1ODSA 3FVTA 5DTIA 5FPPA 4H7FA 3WL7A 3KXPA 1TQHA 5K3FB 4GHWA 1H2YA 3CN9A 4OB7A 1MX5A 2VATA 1A8SA 5DYYA 4X71A 1N1MA 1MO2A 1A88A 4MQMA 4XVCA 2CEKA 1XZHA 2H7CA 1XQYA 1DX4A 3I1IA 5ALYA 1G4HA 4BCCA 2JF0A 1B6GA 5E4YA 1D07A 2AXEA 1CUGA 2XMDA 1AZWA 4AO8A 3KWJA 5A7HA 5ALSA 1JMKC 4NMWA 1L7QA 4QLAA 3G0IA 4J0CA 2C4HA 3E1GA 1UFOA 5E4TA 3QPDA 1FFAA 5ALPA 5E4JA 1LZKA 5CT4A 2VEOA 5T4FA 5LYYA 2YXPX 1EH5A 3RM3A 2I03A 3LCRA 4MJ3A 5AP9A 4ZXFA 3HI4A 5ALIA 4C87A 2PL5A 2Y6UA 4UBOA 4UFPA 3KDAA 3QH4A 4WJLA 2ZJ6A 3G9TA 3IULA 2ZYRA 2XMSA 3WWEA 4H7HA 2ZVDA 1CUSA 1X2EA 2HA6A 1ZIYA 4X95A 2ZSIA 4DNFA 4PNZA 4D9JA 1XZJA 4Y2VA 1CUFA 4Y2SA 1XROA 1WB4A 3I2FA 4BBZA 2HU7A 4PSDA 1X2BA 2XQFA 1B41A 1ZGBA 4F0JA 1QIGA 3WMRA 2QXUA 1XKTA 4J03A 5ALUA 1NX9A 3HABA 4FFVA 3WWDA 1OCEA 5FXMA 4TPKA 1XQWA 4UBKA 4UHEA 2WU3A 1GQSA 3BF7A 3C45A 4H7JA 1UOOA 5CT9A 3W9UA 4WDRA 4X92A 3S8YA 2DSNA 3DYVA 3STWA 1GZ7A 3AZPA 5DYTA 4GWLA 4Y2XA 3HZOA 1FJ2A 1N5MA 3G9ZA 1SCQA 4AB1A 3FOBA 5ISMA 2ECFA 2J3DA 1TK3A 3EQ9A 4Q3KA 4F5ZA 5BV7A 2QUBA 1DTEA 3VVMA 1EK1A 4WDQA 3WK4A 2VTVA 4X6XA 2WFZA 1CLEA 1YAHA 3ZLVA 4M0MA 5AO9A 1EDBA 2GYUA 4JEIA 4C4ZA 1AX9A 5KBYA 1AUOA 1A7UA 2V96A 4FNGA 4J0IA 4E11A 2HU8A 3PFCA 1HPLA 1CPYA 4DMKA 2FJPA 4UPDA 2WFLA 3AUKA 4AN0A 3HACA 5AIAA
chains in the Genus database with same CATH superfamily
2BGTA 1AZLA 1C4WA 4Q9NA 1AGNA 1YC2A 2XV1A 1NM5A 3KYBA 3Q9NA 1QR2A 2F8MA 4JOSA 3OTQA 3ONEA 4CPDA 1QGUA 2HIMA 3RJMA 2QD4A 1QVAA 1LPMA 3TAHA 4EYEA 3HCOA 5IHPA 4HLDA 3DZHA 4MWBA 4XWOA 5KKCA 2B4RO 5KREA 1EWQA 4MW2A 3KHUA 3BORA 5EMJB 1OE0A 3F67A 5FX2A 2AFIE 3GRZA 2Q6KA 4QYMA 4KXUA 3ZY5A 2JGFA 4UTVA 1L5KA 5JDIC 3OQBA 5KPDA 2GN0A 4YC7A 1U8UA 3IEVA 5AVOA 1KBQA 4ERYA 3FHOA 1IWOA 4NJMB 2V8BA 4UVDA 1X70A 2JHPA 3HJGA 2AJLI 3IDAA 2YCBA 4FAND 4G4SO 3PJFA 3SKYA 5AM4A 1Q7CA 2FMTA 5K3EA 2ZZNA 2MSDB 3L1JA 3PEWA 3MKSB 4N48A 1PRYA 5DNVA 4FYPA 4WA8A 3GLHB 4PXWA 3TVDA 3GUHA 2DBZA 4B45A 3TL2A 5C1IA 2D2FA 2C8JA 3KBOA 2AG6A 4J0FA 3F74A 3LLSA 4LF9B 1V43A 2QL5A 4NV0A 4LY3A 4GOLD 2DR3A 3H9QA 3K71A 2HDOA 4TYMA 3LI2A 2KBEA 3GG9A 2ASVA 1IZZA 4QNNA 3UAGA 3BX1A 4DNXA 4D5GA 1CBUA 1ZXLA 4O2BB 5JAZA 1FSFA 4JT4A 3G9XA 5AKXA 1G8YA 1RYFA 4UCWA 1WXEA 5EXTA 3W2EA 1I2ZA 4WLVA 1J90A 1NU8A 3AHFA 1SUAA 4A10A 3K1AB 5LLDA 3LPLA 5TR9A 1A4UA 3DFUA 1WEHA 3SWWA 1XYGA 3FWZA 2WR8A 3PFBA 1QANA 3GEEA 1IN6A 5JMOA 1VL1A 5LLTA 2IJGX 2OOSA 3AKYA 1XD9A 3QKWA 5FUWA 4YXWA 3O2NA 3GIWA 3FTEA 1WSWA 1T4BA 1JQLB 1ZMXA 4AS3A 3PR1A 1QDLB 2Y99A 4LFCB 3SS8A 4ZGBA 1PK8A 3HI6A 2G1AA 4GR4A 4R9SA 1N9KA 4UMFA 2C7OA 1H2EA 4YCDA 3DMRA 2H7XA 3W3AH 4IQGA 2FQQA 4MYHA 2IH5A 4NEHB 4ZO4A 1BX3A 2M6KA 3H4MA 3DVQX 1W36B 2PK3A 3G6WA 4AMYA 2IU3A 4UAGA 5CA0F 4HXEB 4DUPA 1NR1A 4NBLA 3AVTA 3RKUA 5B6JA 4Z49A 4XIJA 1YA6A 1TCUA 2W43A 5GZ6A 2V6MA 2GCOB 3DZCA 3Q12A 4I79A 1DQSA 4BDTA 3H9UA 5AK5A 4TL7A 4L57A 4OHCA 3VR3A 1K3UB 5IANA 1TM1E 5FI5A 3AF6A 4HGZA 4J0DA 4JXXA 1YQUA 5CTAA 1S2NA 1GLVA 3C4JA 2BN4A 1U3DA 4F92B 4AO7A 4DZRA 5EGSA 3Q3IA 5BN3B 4G9EA 2PH1A 3N6VA 3T95A 3I34X 2WJWA 1YRHA 1M0WA 4Y2RA 4OQQA 1U1GA 2FZWA 3PNKA 1N6KA 1TJ4A 2R5NA 3KT6A 2OD9A 3IJEA 4BUJC 3CE6A 4MUXA 1JEYA 1JEDA 4WEQA 2FG5A 5FWNA 1SCAA 1JR3E 4H77A 3S2GA 2AXPA 1FUEA 1WUHS 3WIEA 2VHWA 2A30A 3KT3A 1KEZA 4KFSA 4IUYA 1XTJA 3HE3A 4KBYA 2G9RA 5KAMA 3RO7A 3EDQA 2QQ0A 2R5FA 1U0BB 5L95A 4B35A 2XVAA 3GMSA 1U7WA 3MRTA 3HU2A 1KMQA 2FWNA 5KWJA 4Z3KA 3ONNA 1KYTA 3E27A 4X6YA 4PS0A 1LLDA 2K4MA 5F51A 1L7EA 3KD2A 3KG2A 1W46A 2ECKA 3WIDA 4EJFA 1GKKA 1X39A 2OECA 1UXJA 3VC3A 4UTRA 3JALA 3HDTA 1FW6A 1YB4A 1UOQA 5DKFA 1E7MA 4QDOA 1RVV1 3MJSA 1AN9A 5D1NA 4EABA 1DARA 5J2TF 2OFOA 5IMSA 5EAIA 2O52A 1GUZA 1ZRHA 1CUZA 3U4QB 1I2AA 2A9QA 2DBRA 1KEEB 3A06A 5H80A 4Y1EA 4WJKA 5FXYA 1E1QA 1RADA 2GEVA 3X1JA 1E79A 1FDIA 3RJTA 3V4VA 2NP7A 2E48A 3UPUA 4PIPA 1IHYA 4FDUA 3L84A 1KH1A 3LJKA 5A62A 3TD9A 4GMBA 3R3HA 1SVWA 4HX5A 2AR0A 4GZMA 1QBGA 1AQLA 1R6BX 3G0HA 4AYWA 1IPHA 3LT2A 4MIEA 4K9SA 3L4KA 3KWLA 3AEZA 5KDOA 3H19A 3M49A 3BILA 1RM5A 1JDTA 1J8QA 1JHZA 1Z38A 1OREA 4IIFA 2GF9A 1R64A 5ELXA 3SIWA 4I50B 3QU4A 5HIIA 3W79A 5HA5A 1QM5A 2HFJA 1AUPA 1IBCA 4NJOA 4IF4A 5J1SB 1NHGA 4EL0A 3NDIA 1SQ9A 1UQTA 4JHXA 3OEHA 2D8MA 5E3HA 2VT7A 4IFIA 4QECA 5C34B 10MHA 1RQ7A 4ESOA 2WVAA 1FYDA 1RYBA 2B1QA 1PVOA 4MIYA 2ZREA 3L7LA 4K87A 3S3TA 1DS6A 3PXXA 1KC3A 2P40A 2EZ8A 1E6WA 1EP9A 3T9EA 2HUNA 2CHFA 3F5SA 5BSFA 5BVHA 3BAFA 4L0CA 2R60A 4FNMA 2JJMA 2E4WA 4GE0A 4W7SA 1PGOA 2B0CA 3FA2A 2EATA 4PHFA 1T0HB 4J77A 3A2MA 2OBLA 2ZJ2A 2V3WA 1N1GA 4R2MA 5T5QA 4JOBA 2ZYGA 1RD4A 3KZXA 3KE8A 1K6JA 4Z7NB 3QUAA 1QHEA 3PXEA 3OLYA 4EOGA 3AU8A 4H3KB 3R3UA 2ZAGA 1X42A 4C05A 2Y1KA 5IG2A 3BIFA 2IAAA 5G0SA 1DWPA 4PVCA 1CZRA 3L01A 2JCGA 2F3PA 1BQ3A 1FFHA 4Q47A 1A8QA 4EUSA 3K53A 5TGDA 3GZTB 2R8OA 4Q5IA 1C0EA 2NSDA 1P8AA 4FLMA 3USZA 1UKEA 4RY2A 3STXA 4NDZA 2I34A 1OMWB 4EZEA 3SJUA 2UAGA 1P1KA 5TXGA 3G0DA 1QIHA 2KI5A 3RPEA 1CS0B 2RHLA 4PXAA 3KQKA 2H1RA 3BFVA 3HNRA 1Q83A 1L7DA 3KR9A 2WTAA 2OCAA 1ZJ5A 2JGEA 4HDOB 4UE3S 4WXRA 3OECA 2H5LA 1R6AA 2XUIA 4DA4A 2ZYTX 2IDKA 4BCBA 2NPFA 4L74A 2X8JB 3PLNA 2UUAB 3LZ6A 4Q3CA 1ZVJA 2XDAA 3NDBB 3GUUA 2RBEA 1C8VB 1XEWY 1P3DA 1YZFA 2AOVA 5EE9A 3TMYA 4GOMD 1JLHA 2EDCA 4UI9R 1EP2B 4GL2A 1GNLA 3VYTB 4G1FA 2E5FA 4OXKA 2CCKA 1M6NA 5CVUA 3RUHA 3CVVA 4O29A 1HDYA 5F52A 3REQB 3IJPA 2VBGA 1A82A 4AF8A 4EJSA 5L3SA 4JI1B 2J7PA 2H4HA 3T6KA 3TM5A 2DUMA 2HA3A 4BO8A 2BDTA 2BBTA 1TRKA 2D1QA 3CTPA 1ZAKA 2PS0A 4NNJA 5K51A 2BM1A 4RBNA 4XTCS 1RZVA 3IEXA 4LE1A 4CKBB 3H9EO 4PICA 4DNPA 5LQSA 3HY3A 1WWKA 3A3OA 3EZFA 2ZRKA 1SIWA 2A1TR 4B4OA 1N78A 1Y3FE 2PGOA 3PTZA 4KR7A 5EYPB 5G02A 4J29A 1JFFA 4L5YA 3LUDA 2W6NA 1D8TA 3RU2A 2CV1A 4E30A 1IB0A 3RRFA 2E85A 2ZAYA 3BCUA 4CM1A 4BY9E 3FYUA 1YBHA 2P2YA 1N0WA 1L8LA 2OCGA 5J5VA 3A0UA 4BECA 1OWMA 3PRHA 1JR3D 4D3YA 3PYXA 4GNKA 3R40A 2FZVA 2H00A 3TNLA 1LLQA 3T3GA 2I4LA 2I0SA 1RCTE 1EINA 2I6FA 4C6HA 3DB1A 1JBEA 3HRIA 4RF3A 3S7ZA 4ZOBA 3UMFA 2Y3IA 1DJQA 4Z7QB 4GXRA 3CBQA 4JL5A 1JHXA 2ZBRA 2AQHA 4KN5A 2GC7A 2OZEA 4E2XA 1WCIA 5EWMB 5M04A 1U28C 3LV8A 3TZBA 4RANA 3RS7A 2A58A 2VHCA 4FCWA 4NZMA 4UZEA 3ZVKA 4EG5A 4KI7A 2R7LA 5AUQA 3C3XA 3RFUA 3COYA 3FMGA 4B40A 4R1TA 3GPIA 1BXZA 4BO7A 1X7ZB 2Y1LA 1LBTA 2OLEA 1OC4A 4C7VA 1SCUB 4PPGA 4MUYA 4BLQA 3TDMA 2QZPA 3FCOA 2HRQA 3QEJA 4FFLA 1QH8B 5CNIA 4FB4A 3K0FA 4I5IA 4MVJG 1A71A 3VVBA 3V7YA 4ARAA 4PTLA 3N2EA 2V9CA 1LLUA 3SR3A 4FE7A 5AM2A 2BEVB 3FUXA 2XMPA 4KXLA 4D4MA 2DHQA 5LM3A 3N2KA 2XUAA 1X1SA 1L6RA 4JD5A 2AN1A 5FOVA 2QAGB 3WL6A 3B1KA 2EL7A 2NOAA 4LFBB 3NBUA 4EHLA 3H87A 1KAOA 3K16A 1P9NA 1U0SY 1R0XA 4D26A 3CG0A 3WGIA 2VPZA 1JX6A 5IS2A 5ALWA 2BR5A 2HLNA 3NIGA 4TWZA 4TTIA 4P1ZA 4N47A 2F3UA 1P1JA 4CL2A 3GLKA 3B85A 3PNQA 4M7PA 4OK6A 5D3ZA 3SLRA 1F48A 2GCGA 3OT1A 1D5CA 4K03A 4Z2AA 2YV3A 2BUAA 3HU5A 4J81A 2X4DA 4PLYA 3TTXA 1W4RA 1TCVA 5G3YA 5AVZA 4H7EA 4N39A 3FRXA 1PT6A 1TEHA 2Q4RA 3L8EA 3U1VA 1B1AA 1PU2A 5HR5A 2H68A 3DE1X 1JG2A 5AXAA 5G0UA 4XPZA 3OCUA 1O8CA 4QSMA 5T64A 3ZI7A 3M5DA 1JWBB 3KU4A 5HK9A 1YL6A 1X0VA 1AKUA 1G6OA 4PR0A 4LBZA 1CUUA 1BQ4A 1A9TA 4TS4A 5I3CA 2NMVA 1DELA 4IG9A 2YYSA 3DLAA 3NCHA 5DWQA 3NYIA 1IE3A 2VDKA 1BKDR 4F5DA 1KYZA 4C1NA 4LYYA 3ETCA 4JIMA 4Q3EA 5KTNA 4OB6A 4AWBA 5JAHA 2VHJA 1LNSA 4BE7B 3IAAA 1WUYA 5AKHA 1CF4A 4DSZA 1OIWA 1NQAO 1N6IA 5C46F 2DX7A 3K92A 4CN8A 2QZ9A 3GJSA 2H08A 2YVUA 3K5WA 1B8UA 3QF4B 2QVXX 3W3AD 1V41E 4KWEA 4ALIA 4QOHA 4BKOA 2DPYA 3VC7A 1H2BA 1M2WA 2X22A 2V8OA 5IFKA 4NFLA 2VBFA 4LRWA 3OM9A 2Q1WA 2FKNA 3ZJTA 3OX4A 3TCNA 4AP9A 1VFNA 3R1IA 1RP7A 2HYDA 2ODAA 4CQLA 3ESBA 4WLUA 4Z1OA 5TT1A 4RFSB 5JRZA 2F1IA 2Y2UA 1DBRA 2GZAA 3OZRA 1B8OA 5KTTA 2WSLA 1GLGA 2PWBA 1ECCA 1UJ6A 1X80B 1NM5C 3OETA 5K5EA 3HR8A 3LO5A 2J5RA 4C20A 3N5KA 1PHPA 3CF0A 5A1TA 3P0HA 4MSUA 3RAFC 3FTQA 1U5BA 4NKRA 5CA0A 3QKRA 2I2BA 4NV1A 2ZUDA 1MABA 3GXBA 5I7VA 3KAJA 3V8QA 1ILEA 3TB6A 3VV3A 3GCDA 3Q7PA 1P45A 3VR6H 1OT5A 2MT9A 3P5SA 1Q0ZA 1IG0A 1UPXA 4JSPC 1FTNA 3KETA 4C01A 1KYIA 2G1PA 4LTMA 1LNQA 4ZVVA 3U4CA 4BJ3A 4OAPA 4MCAA 3AJEA 2E4YA 2H0AA 1ODFA 5DLEA 1JMZB 5IEBA 1B00A 2H2DA 3UG7A 2DP4E 3DO6A 3D8HA 3BIOA 3GRYA 4AZVA 1ZBQA 1A7KA 1E8NA 2FF7A 5KYUB 4MZDA 2QL6A 4BGVA 2IHBA 4II2A 1K63A 1T2FA 5PNTA 1V45E 3T5MA 5JH7F 3BBLA 1Z6XA 4XIYA 5LBIA 4CCYA 3HG7A 4X91A 5GVSA 2G9VA 2F9LA 3VJRA 2CNKA 4GE3A 2VF4X 4OREX 2DY0A 2IRWA 1QE3A 4FSHA 3EI4B 5AJUA 1VSVA 4U02A 3T7KA 3H97A 3WQQA 1XI2A 2E1RA 2AEJA 1K7CA 1NUPA 1R5BA 2VATA 1AZTA 4NBSA 1EQAA 2P68A 3NHAA 4QYIA 3UWOA 1P9WA 1Q0HA 1MO2A 5C7LO 2P9YA 3OKFA 2YRXA 4JR2A 1D5WA 2PM9A 4ZOZA 16PKA 1UFOA 4C5CA 4AJHA 3F7TA 1NVUQ 5C37A 1FFAA 4WWHA 1P7CA 2CUNA 2YXPX 4G63A 4MCJA 4NYJQ 5ICCA 1SXPA 3EIUA 4OK5A 1O97D 2QYHA 4WJLA 2XMSA 2ZVDA 1MAVA 4TXHA 5A02A 2BM8A 4Y2VA 2AE1A 1BG6A 4FE3A 4C76A 5J2TA 2NZ8A 4JS0A 2ATVA 1QWOA 2GKOA 4GXTA 5ALUA 4X1IA 2GX6A 1PK7A 2PFGA 3T41A 3MIZA 4EPYA 1UOOA 3DZFA 2WWIA 1JYEA 3DMPA 4JXJA 4O2WA 3H11B 1FYEA 1CRWG 1G21A 3A4TA 1LVGA 2HHCA 3BMQB 5KNCA 3R0QA 2R1VB 4PYNA 4AKIA 4YYEA 4P3XA 4DLKA 2VJLA 4YT4A 4L9RA 2E1PA 1ZVQA 1ZN8A 4JA0A 4CMEC 4KOEC 4H5JA 5AVUA 1G19A 3F73A 3IVAA 4WCFA 2G6BA 5FKQA 3R7DA 2YVAA 3VAYA 3LX8A 1EFRD 4P7KA 5FL7D 5JCOA 1Z5GA 2PUEA 3CRQA 2GERA 4AMVA 1VMIA 1GR1A 1GP2B 4DMKA 4HH0A 4MUHA 4AN0A 4B3CA 1ZM7A 3HP4A 4FSXA 2ZBQA 4Q4AB 5H3LA 2PD6A 2ODQA 1WOYA 4Q05A 4UD2A 2WUEA 3KVNA 4F5EA 2H3EA 1BKSB 4YB8A 3VMFA 2Z4RA 1NQUA 4HDMA 4DMHA 3FLAA 4E32A 1B9XA 4YRMA 1VL0A 1ZONA 1Q11A 5EE1A 4QUKA 2VDOA 1M0SA 4HJRA 1LB1B 3PFKA 3LU1A 1D2AA 1GPLA 5HBRA 2BGWA 4B0PA 1TMYA 4RVFA 4TLMB 1EXMA 2EP8A 5K09A 1YB2A 3QOFA 2NO4A 1PTKA 1BKYA 2FR1A 4UVGA 4IVPA 5L9AA 2ZULA 4YCCA 3OQOA 5J5CA 1RMTA 1T2UA 1Z3IX 3GARA 3W04A 3ZHQA 4ZO9A 4JENA 1AGYA 3JATB 1XJQA 5E0OA 4ZV9A 2EF0A 3O2QB 1KAGA 2AOWA 2I91A 4H2DA 1CFJA 3BWVA 3NDPA 2ZRHA 4LQCA 2JFUA 3RGGA 2AYZA 3DPIA 3OZXA 3IQHX 2ZJ0A 2CFOA 4MH0R 3FTDA 1Y3AA 1RQGA 2A3RA 3FOEC 4BASA 4BNUA 4HXYA 1L1RA 1WW3A 3BT7A 1LS6A 3R23A 1IM2A 2AN4A 1W1IA 4AS2A 5LZ2A 2Y4NA 2G09A 3WGVA 1JIJA 2I8CA 1SOWA 1EM8A 4QTZA 5ECDA 4LGVA 1NP6A 3CH5A 2JAPA 3INGA 4X1YB 5BUZA 1MEEA 4NXMB 4YAOA 1RAHA 1WA5A 1PS0A 4G8BA 2XXJA 4EBFA 5KSYA 2QY9A 3F96A 2PNJA 3OKYA 3UGQA 3T7SA 2PSDA 4BEJA 5KHLB 3M4YA 2QZSA 2X9GA 4ZEOA 4ZZIA 1PR9A 3HB9A 4JYMA 5GAJA 1RBYA 4ARZA 1UEIA 3U61B 4Y0NA 4KDCA 1MORA 2E0IA 4V0MA 1K9VF 1GM5A 5EKUA 1N7GA 4KREA 1T5IA 2P9EA 1QRRA 3DDHA 1R88A 5IDWA 3LHKA 4LUCA 3STTA 2OV6A 2J0UA 3N3AC 1Z5UA 3CZ5A 4ZVMA 3QIVA 2RK4A 5A0VA 2FZLA 1BW9B 2FLKA 2W0SA 2AIRA 3BE8A 2IT1A 2G80A 4TKVA 4BP1A 4JJEA 4D6VA 4QXRA 4C7BA 4Q02A 3I89A 1KFBB 1ZW6A 3E70C 4FKMA 3KEGA 5BQ3A 3MYYA 2A9RA 1BPOA 4LA4A 1HE4A 1B2LA 1U6IA 4UJ5A 1IM8A 3CUTA 2FJUA 3LDHA 2W6JD 4J78A 4JT6C 1QK5A 4D0SA 2VHVA 1MQSA 2V7UA 5COQA 2A6PA 5AVWA 3BXFA 2JC3A 4FJ0A 3R0JA 1YH3A 1KE1A 1JN0A 3IJRA 4KGXA 3P2OA 3NO4A 5CW1A 5IWCA 4FVTA 1Q17A 2ZWVA 4MDFA 3IUSA 1FFCA 4Z4EA 2PGXA 5SV2A 2IIBA 4MV5A 3RJ5A 5TQJA 2OK4A 3RRXA 4NE9A 2MR5A 1H2XA 3HUFA 5IULC 3AH8A 3Q11A 1GGNA 3R4VA 3NX4A 1YDGA 1Q74A 3OZSA 1M6EX 3UMMA 2F3SA 4O59O 4DXHA 1JHAA 4JBNA 4R2XA 4OZUA 4XCVA 1XZFA 4DLAA 3ZLTA 1N6LA 5JFTA 2R8ZA 5DWDA 5K0CA 2A7QA 1GARA 4HKTA 3VU0A 4B4DA 4J90A 5EPUA 3LTEA 3LMKA 1HX7A 4Y30A 2WUDA 3E7PA 1YRYE 8OHMA 4TMFA 3KV1A 1G8MA 4M1SA 5LU9A 1E6CA 1XZEA 4PONA 1U0EA 2BGNA 1KMNA 4NBUA 1HT2E 1L0QA 1M66A 5LYJF 4U7DA 1V47A 3D3JA 3KAKA 2ECPA 3HFGA 1T8TA 3O4RA 2OV1A 3FAZA 3HZZA 3DLIA 3LNCA 1QIEA 4KLRA 5IXYA 1PL6A 1LDMA 4IYJA 2FR8A 5E6SB 1SBTA 4R1UA 3V8BA 3V1MA 5EVJA 2GWRA 5ALVA 1MDFA 3OE7D 3TRIA 1M74A 5KQLA 3R0IA 1HURA 4QULA 5EMLA 3AM3A 4QQRA 1N25A 1KVQA 2VZ0A 1W5FA 3IMGA 2YNPA 2XMBA 3CGWA 5ARDA 2GCEA 4I4CA 3LHFA 4NSXA 5EM2A 1KRXA 1B8VA 2D2XA 2PFSA 4QWWA 1U9IA 3KS9A 1M3SA 4M7OA 1CQPA 4CQNA 1K8ZB 3LXMA 3FWNA 3WZLA 2J41A 4EJSC 1Z15A 4LDAA 3KZ1E 1XZIA 4R9NA 1RQ2A 4JBLA 1A8HA 4HR7A 1GA4A 4W82A 1GG2A 3FRIA 4HGYA 3D4BA 2CWDA 4KSCA 2LGJA 4PE5B 1YQQA 5ENZA 4I08A 4RADA 5HYVA 3PNMA 4BGIA 3CX7A 1ZL2A 5E7MA 2MSCB 1NN3A 2FSVA 2WFAA 4TV8F 1C41A 4JLAA 2OZLA 3SJ7A 3L7BA 3TZCA 2QTZA 4Z7OB 1CHDA 1EFPA 1NI4B 3FYUC 1K68A 3RC7A 4CVNA 4YJ3F 3Q1LA 3CISA 1NW4A 4HV4A 2ZYUX 4HRVA 4H16A 1KO4A 3S1LA 2CB0A 1U8XX 4RD1A 5LL6P 3DBHB 3B6IA 1UQRA 1GV0A 1CJSA 3DXFA 5T7BA 2R2GA 2VNIA 4QELA 3FCYA 1VECA 3JQFA 3ZS8A 2F8SA 1T4CA 2WJVA 2FN9A 1Q3TA 1EVKA 2YYYA 4KQ9A 3MBOA 2PZFA 1AKQA 1X13A 4Q9JA 1TUGA 4KVZA 4C08A 2WWVD 3B70A 1TVKA 5DTMA 5BW8A 1G9TA 4X3EA 1BU5A 3ASZA 2CL0X 3MMPA 2P65A 3L4JA 1J1UA 3OL2B 1G3IA 4QFDA 3UGKA 2WC1A 4FHFA 1D2HA 4O2RA 3O8DA 4H15A 1A9OA 2DPHA 3KR1A 3PQ5A 1U8AA 3FFBA 4LDNA 2XYHA 5JTTA 1N6RA 4BB6A 1BU8A 3TNYA 4L7QA 4Q7JB 5FFOA 5JYDA 3CX3A 1NDQA 2X0JA 3ZDBA 2I71A 2QJFA 2AQKA 1W35A 4CM9D 1O0SA 5AMSA 5DF1A 4N7JA 1M6YA 2NAPA 1PSDA 4Y2GA 2POQX 5DN6D 1ZK4A 3IPAA 3PC4A 4RSHA 1PJ2A 3BEOA 2NYAA 5C18A 5AJYA 3JW8A 2VF7A 4JI4B 1B23P 4JVSB 5WRFA 1A5AB 5KO2A 1TB4A 3L4MD 1TVMA 5F5NA 3FGZA 3D7SA 4HI0E 2VYQA 4M37A 1F9AA 4XFJA 1MOQA 3ZDYB 5L4SA 1OLSA 3QXGA 4JL8A 3WNZA 1W52X 2WIJA 4LWPA 2YZ2A 1CEXA 3TK1A 2RGEA 2VT2A 1PG5A 3OKPA 3K0SA 4JVNA 4LS3A 4CM8A 3NCTA 4OLBA 3PFGA 4KLCA 2C2HA 5JH7A 1NPTO 3LNTA 3FCXA 2X41A 4L08A 4EAAA 4H4DA 5EXSA 4CY5A 2P2DA 4C04A 3LHIA 4Q03A 5IEJA 2DB3A 2H4WA 1W8IA 2B7LA 2IC5A 2AWOA 2NN3C 3PPXA 1FWXA 3RNOA 3D1VA 3U7QA 1C0IA 3CLUD 1UXOA 7MDHA 5HM8A 2RG1A 1ZUD1 3WGJA 2P67A 4MQEA 4XYMA 3QVTA 2OV2A 5AK4A 1EX1A 1EBFA 2OO5A 3SEFA 4YRFA 3SBEA 1Z6YA 4DUGD 4GZLA 4JLSA 4DDMA 3JAMg 2EQ5A 3IP8A 4OSEA 1Z6QA 1OBVA 3A58B 1NIPA 1QHHA 1YVUA 3H2YA 4MARA 3LZDA 2UVDA 1C0PA 4X1KB 2ORIA 1KY3A 2D2VA 2PO7A 1ZW1A 4RHUA 1CJBA 4EB0A 4XEHA 2HXYA 8AT1A 3NZEA 4RD4A 3QUCA 7YASA 4MIKA 3EFOB 1ISIA 1LKZA 5BN5B 1TUEA 4YDQA 3B6MA 2YNMA 5EOVA 1Y0BA 4Y9SA 3NFYA 5EXDA 4OV6B 5D5HA 9ABPA 2VAMA 4Z4CA 1A95A 5C8VA 2OYSA 2F1HA 2WIGA 2F43A 2FEXA 2A7XA 2WYIA 2O57A 5BT9A 2AGLA 4ETIA 2NO1A 4RNCA 1B15A 4JB8A 4BTEA 2I65A 2PUJA 3WRYA 3JAWA 4IH9A 5ADWA 3TOXA 4RIGA 1EFVB 4OCZA 2XZLA 3AG6A 4JT2A 3DS8A 1SKYB 4D4HA 1J0CA 2V5AA 5BSEA 3VOAA 4M86A 4RQTA 1GDTA 1BJRE 3RK1A 4KGZA 3V8MA 3H8JA 1DT5A 3HGQA 1VHJA 2MYNA 1SU8A 1WULS 3JQRA 1RWXA 4ZCRA 4FMPA 1DXHA 2J0EA 2JFVA 4QDJA 5FWYA 2WT9A 4WFJA 4DQ0A 2GNAA 2FVXA 3A25A 4NQRA 3IALA 4RYLA 3LGSA 4YCSA 3BCSA 4PINA 2WINI 3EVCA 4NMHA 2VDVE 5DYWA 3ABZA 4AS1A 3G2KA 4DWOA 4FC6A 5EUBA 2B1JA 5HFAA 3TXAA 3CEMA 1O95D 3CUWA 2X3YA 2ZJ5A 1KAMA 1L5GA 4CLEA 4X7MA 1X74A 4GMFA 2B1RA 2HYEA 1G3MA 1E6LA 4FW8A 4I1OA 1SKAA 1QG2A 1WDWB 1X7XB 2PLRA 3I8XA 2OVQB 4LXTA 5JS1A 4D5EA 5JSZB 3LT1A 4AJPA 1X19A 4MR9A 3TW6A 3THYA 4XB6B 1F2DA 4A91A 2I6QA 3ZWAA 2A9PA 2HM7A 3OTGA 4NBTA 2YMUA 4O4LB 4A0GA 3SC6A 2XKBA 3L0PA 2WKPA 1MENA 1S01A 4E3ZA 2A9OA 5CX4A 4J0XA 4D9NA 3F6CA 4K2AA 3BHJA 1GWNA 4NARA 4KQXA 3NNSA 4L7VA 1KOGA 3VR1A 2O3TA 1IBSA 3FDZB 4EW6A 1N8KA 4PO3X 4M1EA 2X86A 2EZTA 4V0RA 3GELA 1GZ6A 3KZVA 5ILOA 2ZJYA 4II7A 5F2NA 5T3UA 1OA1A 1DUIA 3SXJA 3FE2A 1VE5A 3IEIA 1FDOA 1ZH6A 1IY2A 2NXEA 3QVWA 4YEDA 2W8ZA 4DA8A 1XZ8A 3NP7A 2NUBA 4D96A 2B36A 3IT3A 4YRSA 3DL7A 1Y98A 4E31A 2EHDA 2W11A 1V0JA 4V02A 1L3BA 3GH1A 3UHOA 1UEJA 1XLTC 2LXNA 2E2WA 1SK8A 3LYHA 2VDUE 2J30A 4ERZA 5C4MA 1UM9B 4N8EA 1D1SA 4LQ4A 3Q6NA 4NK4A 2BEKA 5GTDA 3UV7A 3LUJA 1FP7A 2ZDGA 1FL9A 2XWBF 2BH2A 1CJCA 1NP3A 1CEYA 5F21A 3QPVA 1H05A 4PG7A 1P22A 1JQEA 1MC8A 4LYJA 3ZVLA 1VCOA 4EQZA 4GM1A 4DBVO 1JFRA 1OH5A 3I8CA 3BREA 5CH3A 1KXJA 1MMFB 2VHEA 4RF2A 1I3MA 4L78A 3P96A 1EUCB 4QOGA 1JW9B 5C53B 4G5QA 5EZ5A 2CYAA 2ASEA 4DMFA 2BM0A 1IAVA 1ARZA 3WLHA 3WLNA 2BFDB 4YCNA 4KYUA 2FFRA 2QV0A 3FM0A 4KVAA 5KKNB 4DEYA 2DC1A 5JECA 4M6WA 4QBHA 1T9BA 3T3OA 3BZWA 2DHEA 3PQ8A 1XZDA 3NWEA 3BTUA 1TRHA 1IN4A 3SOZA 3BKWA 1ESDA 4X7PA 3IKMB 2FSSA 3DL4A 3UK0A 1AKYA 3PD7A 2WV9A 4HFRA 1J33A 1J5XA 5F7OA 4A2WA 2YC4C 2HBRA 5BYAA 5MN5A 3TIVA 4ALJA 4IIXA 3G9UA 5D5QA 4JZKA 1OX4A 1Z4KA 2ECQA 3ZE2B 4JJFA 4PR3A 1XK6A 2IUUA 1XJ5A 1Y5RA 2B5NA 4ZI7F 1QB8A 2ZDQA 2YVKA 5DNCA 3WKEA 4YFYA 4OQNA 4QT0A 4NCNA 1KS9A 2Z9BA 2GCNA 2BFFA 1E1DA 4WK4A 4HC4A 1EJ0A 2ATXA 1CY6A 2EIEA 3EGVA 5KNDD 3AUXA 4IFBA 1N2CB 1XF9A 2O8EB 2HAEA 4EJ6A 2JI6A 4G89A 2FW7A 4D9IA 1K3TA 3Q3CA 1EFRA 3RIGA 2WE7A 2WICA 1BDHA 3RRMC 2GQ0A 2ON6A 4R1NA 5JMPA 1G38A 2C20A 1V11A 4WCDA 5KNLA 3QU2A 5LYJA 4HNAA 3U37A 2HMAA 5EQDA 3ZHTA 4BCCA 2XMDA 3VDNB 4BUCA 1YZVA 4YH1A 2CHGA 4RM3A 1NKVA 4IGEA 3CRVA 3QPDA 1TI7A 1JU9A 3LUGA 5AESA 1XTRA 4PZDA 4OFXA 3X1ZA 1HI9A 1N7IA 2HTEA 2DULA 3H2ZA 3QU9A 3I7KA 3DQQA 2W9XA 4LNAA 2VQFB 1JFLA 3IULA 4J7CA 2XVZA 2OXFA 4WOPA 5JJBA 4UATA 3WC4A 3ZHVA 3L6OO 1YTLA 1Y4UA 2P6RA 3USES 4ODIA 4L95C 3LSYA 4P4GA 2XQFA 1YRBA 3GQBB 3M9LA 5ITZA 4NYIR 1ZRNA 3HABA 4LC9A 1TL7C 4I4IA 1XMQB 1R0WA 2QBYA 3COPA 2LCFA 3S8YA 4DJFC 4MQFB 5HQGA 3PXUA 3OTOB 4Y2XA 2FP4A 1HSOA 2SICE 3L8GA 4MK4A 2HC9A 3HKEB 1UF9A 3BSYA 2C95A 4KQKA 4E5SA 5FI3A 2QUBA 2GZMA 3NKLA 3L4BA 3BK7A 1ZIPA 1WBDA 5B2EA 2HN9A 4JC8A 2XZPA 5C2JB 2J9XB 4X9XA 4TV8A 3UHAA 1RXIA 1PGQA 5DNDA 4YN3A 4DS3A 1OMOA 4K3VA 3NEYA 3IKVA 1NF9A 2NU9B 3K73O 4HD8A 1PD0A 3M6MD 1YQTA 3LECA 5KTOA 3Q2OA 1VTKA 4FFBA 4YJ3A 5CB6A 4L4RA 4OHPA 3GPCA 4RKYA 1TZ2A 4MKRA 1NMSA 1Y6FA 5F2OA 3BL8A 5MN6A 1P1IA 3LO8A 2J4CA 1IYZA 4RTSA 3PC7A 4FI3C 1QYVA 1Y4ZA 1ZVVA 3KWMA 3OTIA 4WNIA 5F98A 3COSA 3FUVA 3H2HA 3LY8A 3V4PB 4UW9A 3QLVA 4HO1X 4R1QA 2XB8A 4A27A 4WBSA 4LXGA 4H6PA 1V5IA 5BYKA 4AICA 2C5EA 3E2PA 4XUEA 4QL3A 2PRKA 3OJWA 4ZCMA 4EGSA 4NYMR 4URXR 3JASA 4WZBE 1Z06A 1IJEA 2VI5A 5JWRA 3T7RA 2O5EA 3VYSB 3ICQB 1KGDA 1T2DA 1U02A 4MUNA 3HK2A 3QLTA 2ZR0A 2Q49A 4IH1A 4D8YA 1RTKA 4ECEA 2XVMA 1K8KC 4LOIA 2AK3A 3RFHA 2FPXA 4BVJA 2Z57A 3OURA 2W6JA 1KFEB 1MVLA 4ZQFA 1XQ9A 1L4YA 3EVNA 1H1LA 2FR8C 1MGOA 3MWDB 5A4IS 3KKZA 2Z1MA 1W581 3OCJA 1MOPA 3PEUA 2O3JA 3PGLA 5FQNA 4JBYA 4EKYA 1LI7A 3T7TA 4F3TA 4ZYTA 5EJEA 4B4KA 1VLJA 4N1AA 4MDHA 3GLVA 4BB5A 3ANXA 2R4UA 3RC2A 4ZFNA 3CYFA 4F2DA 2EARA 3S2FA 4QBKA 2PT5A 1I2MB 1U9IC 5EQFA 1EZ4A 1FFYA 1EVQA 3S55A 3HDGA 4RTNA 2C78A 2BE9A 5EMMB 1C9NA 4H7IA 2OQIA 2IV2X 2DLCX 3V7NA 1KBZA 2XUHA 4OM7A 4BFUA 3PICA 2WI8A 2REOA 3LF1A 5CYKB 1JL3A 1FNSA 1BFUA 2X9NA 3F4LA 5REQB 3KKPA 2C96A 1PCXA 1W44A 3SJZA 4KQWA 1GGMA 3PWSA 5DNEA 3BSFA 4DMCA 2FSVC 5EJ4A 2W58A 3ZG6A 3IJEB 1QB7A 3KJNA 2X1MA 4ZMSA 2QKYA 1G2IA 2QIOA 2CJYA 5EP3A 2XQKA 3AUJB 5H16A 4F8EA 1XXHE 3TZQA 2AFHA 3FVRA 3BULA 1A2KC 4FHDA 4GGCA 3VU1A 1Q19A 4CL0A 1KL7A 1XNRB 2H1WA 4MUGA 2JBAB 2I3BA 2WIBA 4H0NA 4MMXA 3KTAA 2JCVA 1RM4A 3OE7A 4MVJE 2IZ1A 2J0VA 5L40A 1XZAA 1A9PA 1H69A 4F5YA 3NBMA 4AN4A 5AVYA 2Q9AA 5KQSA 4J49A 3JTMA 1TCBA 1VIVA 1RHKA 3LC1O 4WOJA 2H7YA 2GN9A 3BRQA 1H2HA 1AS3A 3SD7A 1YUBA 1V5FA 1YE5A 2JFHA 4TM8A 3X2SA 1W94A 3JALB 2RHCA 3B1XA 3BQNB 1JKXA 4KV7A 1QE0A 5HS6A 1HE5A 4DWWA 4I4LA 1JT2A 1XE3A 4IKOA 1CR0A 2R0QC 5IBQA 4P38A 5D1HA 1BMTA 2GJ8A 4ER0A 2Q3CA 1G18A 1ORWA 2MMGA 3E1KA 1V16B 1XVLA 3PJRA 5EAMA 3B9BA 1FJGB 4WJKB 4HMQA 5CFLA 3D0QA 4HB3A 3T5TA 4AK9A 4LJ4A 1ST2A 2R4TA 3RHSA 3W7VA 4OXYA 5CXXA 2NO5A 4XUDA 1KC1A 1SN7A 2QW0X 3EUFA 3KZNA 3TQCA 3NR2A 1G8PA 3LVQE 1FQKA 1QF9A 1TVEA 2PE5A 2HJ9A 4Y2YA 4E2FA 2J07A 2NNWB 4MKXA 1R4NA 4XCQA 2O9KA 3MPOA 1NONA 4MP6A 2ZPAA 3H5OA 4ENSA 1UXKA 1PEAA 4K28A 2IQIA 5KDOB 4UEKA 3CF2A 2A5LA 4E5KA 2XTAA 3LWNA 3EXIA 1XA0A 2RHHA 3RTAA 1EWKA 1W1WA 1ISFA 1JDNA 4HGNA 4MRRA 1SRRA 1CB0A 3LVBA 4FZ3A 3DR5A 3GPDG 1USUA 4FOLA 4DCUA 3ZWQA 4C3UA 5FFMA 3URMA 3GBPA 4AY6A 2GH1A 2L18A 1R5MA 2WZCA 5A4FS 3WNQA 3G89A 2P9TA 1BTOA 1JKFA 1E1RD 3A27A 3AY0A 2OSBA 3S0JA 3VR6A 5IJXA 4HDNB 1ZZEA 1ID8A 1MX9A 1H65A 3TRKA 1FF9A 3AEUA 5JSUA 3D8BA 3K1TA 3M2TA 5FFGA 1LFDB 4RH1A 1QVRA 2HU5A 5CLHA 4HNUA 5EHXA 4L85A 2OO5C 1SKQA 3L49A 1QHXA 3I4CA 1OLUA 1GO2A 3HCRA 3ENKA 3T0IA 1KO7A 1H6AA 3CFVA 1YSCA 1YU6A 4QO8A 2WQZA 1DUSA 4DADA 3CRMA 1NVVQ 1E1KA 2VCHA 6YASA 1L7BA 5ALEA 1YAJA 3LC0A 5J23A 5BSMA 3NBXX 1I5RA 2WJGA 4EFMA 4OQYA 1F0PA 2XNCA 3THOA 3EBPA 1EJ6A 1ORDA 1ESMA 3ZTYA 4G5SA 1EVEA 1YOVA 3JXEA 4V0OA 2PH7A 2F8TA 1SVNA 2DYKA 1VLLA 4I99A 1BYUA 2TMDA 4BLTA 2GXUA 2YNMC 3DP9A 4DCCA 3ZDZA 3PVUB 5K0NA 5I6DA 4L5IA 2ZT6A 1U0GA 4N3CA 5M2QA 4Y9RA 3Q8XB 4L16A 1YZHA 4MOWA 2V7XA 4RZ2A 3OI7A 7AT1A 3VDXA 3AL3A 3PE6A 3HFRA 1AKVA 3I64A 4D9SA 4JGBA 4ANFA 1Z0JA 3CM0A 1SHTX 5TMBA 3UBMA 3ST7A 4QUJA 2E4XA 3KEOA 4E5UA 4S1TA 4N0MA 2ZUFA 4CU5A 2QG9A 2FQ1A 2FPUA 5KJFA 1TTTA 2IP1A 1OB2A 3LHSA 3ISVA 2YRFA 3QWIA 2XL2A 3CF4G 3HBJA 3NORA 4I4TB 3ZJYA 1XU4A 5AFSA 4ZVLA 1OVMA 3I6MA 4IMPA 5B1YA 3VZBA 2QVZX 2HXGA 3QUBA 3WGKA 4HCJA 1R00A 4P0TA 5DCLA 1E4EA 1DKOA 2ZIGA 4BFXA 4C1BA 2IGBA 3DMTC 2EIDA 4DUGA 3EGDB 1QE5A 3E48A 4OKSA 4UBIA 4LVNA 1DO2A 2O2HA 3T9FA 4WFKA 4N8DA 5AW2A 3T3HA 1F2UA 1NNUA 1BXRB 2AQ8A 1DBIA 2BWJA 3ZGLA 4EJSB 2VCEA 3GRRA 1JDPA 1RMQA 4Q9AA 4FKZA 5A3VA 3TIGA 2VUTA 2P6NA 1VHQA 2GMWA 3BF8A 2Z2XA 4IHJB 2B5WA 2JFYA 3UK6A 4BZXA 3IJ1A 3PA6A 2PGAA 3VXKA 4C6TA 1U0HC 5IARA 1T13A 1UWKA 2PD3A 3SKVA 4B2LA 1DIAA 6AT1A 3N6RA 3E4DA 4P3OA 1NLYA 3A26A 3EF0A 4F86A 5B1DA 3TJRA 4IWNA 3MWJA 4ZI7A 3FVVA 1ZL0A 3RYHA 3OP1A 1N9GB 4DDTA 3IERA 5IDYA 1FX0B 3AVYA 3RDPA 3VU9A 1FW8A 3FYUB 4EB6A 1SJ9A 3IMEA 2G83A 4HT3B 1C80A 4MCIA 1ZUNA 4XTRA 1BWQA 1XVVA 1O4WA 3JAMA 4GGMX 3BHNA 3EIFA 4UDYX 1A77A 4FCTA 4ZEXA 4B32A 1YGPA 3LUAA 3SVTA 3WLKX 4I9HA 3NW9A 3DV2A 4BWYA 3MUFA 1JWLA 4BUZA 4XM2A 4RLHA 3EOBI 4P83A 1F7VA 3N8IA 4QGSA 1QOZA 2G9QA 1SVOA 3BD7A 4IO1A 4M54A 1DMSA 3N7AA 2AI2A 3I1YA 3OIDA 1I2CA 2A86A 1WCIB 3SSOA 4MVJD 3RFTA 3B36A 1TADA 2J6HA 4ZO8A 3UTDA 3B8HA 4XDGA 3GZNA 4YJHB 4WSOA 5KWIA 1X7HA 4BFZA 5UKDA 4F3RA 5JZSA 4XWKA 2HNAA 1O95A 1C1XB 1FFDA 1JBQA 4LZZA 3DH0A 2DHDA 1ICEA 1RXSA 2IKQA 1PG2A 4J4TA 3L40A 4J1NA 4E21A 1PD1A 3I2NA 4XUGB 1XJ0A 4MGKR 2OCPA 3GCGA 1ISPA 2ACEA 3WB0A 3EW9A 1JKJA 3M3DA 1WF6A 1C9EA 5TQ0A 4K1XA 1DLJA 3L3BA 4QOFA 2XRFA 2JAQA 4HLNA 1T1SA 4A0BA 3WAKA 1LQUA 2OR3A 3O1JC 1L4HA 4TLEA 3GA0A 3TD2A 4YECA 3N2KB 4MR7A 1JKMA 2QENA 2ZS9A 3UMRA 3A6LA 2DGDA 2YJTD 4QATA 3NU1A 3O7MA 1OSNA 3ROPA 3L43A 3U4GA 3D59A 3K0KA 4MHSA 2RFLA 2H31A 5C8ZA 4Q34A 5BO5A 4QDZA 1WHSA 3JQ7B 3WGTA 3HN7A 1WZEA 2WJ3A 5CYGA 1K6MA 3T1HB 5ULLA 5JZBA 4HAVA 2Q8QA 4UTXA 2E4VA 3NMUF 4IRZA 4F2PA 4KLZA 3DTVD 4LDRA 3KJGA 4NESA 2IZ0A 2ZTUA 2R4QA 2JASA 1LUAA 4N9WA 1L4GA 4J79A 4UNNA 3Q2KA 3ROEA 2BHNA 3QFCA 4NLLA 3VKUA 4Z3OA 1O9GA 1P5JA 1UBLS 3T5PA 4QU8A 3E9NA 4B7ZA 3SI7A 1BGVA 2D5CA 4Z9YA 5CPFA 2G8LA 2FU5C 1FNMA 3A4IA 2VDKB 2D0OB 1UOPA 2YHIA 2H1SA 1ES9A 1DC7A 2JI9A 5AJWA 4R5MA 4CC9A 4YACA 4DR5B 5AJZA 1JPJA 3DZDA 5DDIP 1GDHA 4U6SA 1TF7A 4Q7KA 3U3DA 3RKRA 1HETA 3L46A 3EVDA 3HM2A 1RM3A 1OJ7A 5ER6A 2DR0A 1A9XB 1EZ1A 2JDID 3D0RA 1C29B 2AJDA 2BBOA 2NTNA 1ZM9A 3I7PA 1E62A 3SN6A 3NWOA 4DCJA 1XN1A 4YQEA 3WOVA 3ZIAD 3GD5A 4DMLA 3VM6A 1PL0A 2B4AA 3B9QA 5A4MS 3V2UA 3T9BA 1NBHA 1KJNA 5IGOA 5DM1A 4WKCA 2BEUB 3PHBE 3NFRA 1Z5OA 3K20A 2V7VA 2Q0HA 1CY7A 3QJYA 2NPIA 1IRXA 4I81A 3KTOA 4GT1A 3RASA 3JRXA 5T57A 1L5HA 3HXOA 2ZCUA 2VVTA 1M8FA 3WO1A 1JSZA 5CYOA 2YHAA 2Z9DA 4AJ1A 5EWLB 4JI5B 2CCGA 4BNYA 2JFPA 4OQZA 4HWRA 4CG2A 1NAHA 3F7OA 4J16A 2WFMA 3RUFA 1II8A 5HFNA 1JEQA 3W1WA 1V4BA 4M8NE 2IBTA 4X60A 1D0IA 1SEVA 3WWCA 2WIFA 1U5BB 3UKUC 3RNLA 5CA0B 3EPHA 1MABB 2WP8J 4QNMA 3Q7QA 2DLNA 3PGA1 2O2GA 3G0BA 2LW7A 4EGQA 1KQGA 4EARA 1NU6A 5AJVB 1RRKA 3RYCB 3UY4A 1PSZA 4FOTA 3D2CA 3BICA 4KMSA 1XIPA 3ETNA 3RYIA 3EMKA 5K0GA 1KH2A 5IN5A 5IXSA 1SVKA 2QJWA 5IK2D 3K30A 4ROTA 1SZDA 3ASVA 3U3KA 3G0GA 3GJ7A 3LUFA 1Z45A 2AK2A 5FA5A 3JQBA 1Z88A 1DBPA 2CB9A 3L4BC 3O2SB 3QBDA 5FIUA 4D56A 1ZGAA 2AG5A 4KXXA 2J6BA 1UAYA 2VHQA 2G0AA 4WQMA 5BMVF 4UVHA 2OV3A 1U8TA 1PLLA 4RY9A 4U2EA 3FG9A 4TS9A 2ZVQX 4P98A 5DX8A 4CCYB 2CN3A 5FPYA 2X40A 2OPHA 3UW1A 4JT5C 1E2HA 1WPXA 5JWHA 1AV7A 1XD2B 2BR3A 3NUGA 3EDMA 1Z2OX 2ONZA 4ZEVA 4MRAA 4HH1A 1NXWA 4Z0TA 2CGEA 5CM9C 3GD7A 5HW0A 2GTPA 2ZIAA 3E2IA 3RROA 4NU5A 2PX5A 3IE2A 5KYNA 1YONA 4Y1RA 2FPRA 4D82A 5DEOA 2OFPA 1ZH8A 2GR9A 4NE2A 4ZJUA 2XIQA 5LP1A 4P9NA 1FOEB 2V0CA 2YFYA 3CLSD 4TT8A 4UMDA 3MEQA 3DAGA 3Q8MA 3DV0A 2ANBA 2PM9B 2OWEA 1Q47A 1WIWA 2FA9A 4BNIA 3KXLA 1MAHA 1UDCA 4I5FA 2PUVA 3ER6A 1RYEA 2H17A 4EA7A 3D7KA 4FEYA 4DWVA 4QFBA 3T06B 1YIAA 4G9BA 1YHNA 5F4ZA 1O96A 3IIMA 4OFWA 4DMUB 2EBSA 1B8NA 3D3NA 1RRGA 2QE7D 1V96A 2J3JA 1KP9A 2VRWA 1SU4A 4YGYA 5BV8A 2QN1A 4WFQA 1QVVA 2IGTA 4LISA 2H5JA 4O45A 4YRRA 1RJFA 1DLIA 4X1IB 3J7TA 1XFDA 4DB4A 4XRGA 4JEMA 3L8FA 1CNEA 4B6PA 1U1IA 1VMAA 3R5TA 3B13B 3L7NA 3CWZA 2BEJA 1G21B 4ZA2A 3PP8A 5DIZA 3P0FA 3H16A 4S0ZA 4ZTZB 1G64A 4KFCA 3DEYX 2O8FB 4P36A 3E3MA 4KL8S 3QEOA 4ZOYA 1C2YA 1GCOA 1D1QA 5K3FB 2IEZA 4B34A 1E2EA 2DKFA 4I2NA 4OB7A 1E1YA 1EE1A 1RI6A 2VQSA 4M1OA 4FXOA 1A88A 2CEKA 1O77A 4FOOA 1XQYA 5IAGA 3UWPA 2UZIR 3A4VA 3MCZA 3IIKA 4W7HA 4YP5A 1THZA 4OK3A 3HA7A 1U7ZA 1ZC4A 3C7TA 2C8KA 4OM8A 4YUWA 4RJ2A 3AM1A 3MKQA 2H4FA 3BRSA 3WMFA 3TGPA 1ZITA 2B21A 2AOTA 4PBYA 1AG9A 4QNRA 2WQ8A 3WWEA 2HGZA 2AFIA 1E32A 1W2HA 3QYPA 4QVIA 2OVPB 3KALA 1WB4A 1SGWA 1B41A 4JQOA 3WNBA 2VDRA 2VDOB 3T4XA 4JA2A 4LV6A 1XCPA 1XQWA 5KNDH 1A69A 3PDIB 1U9ZA 2PD4A 3W9UA 4KQCA 2HCTA 1BGXT 4X92A 4PO9A 3EVGA 4E09A 1G8KA 1QK4A 3O8OB 3EGXA 3F3SA 1XNHA 4R2WA 5BV7A 1RXWA 4I6JA 4MB2A 3SF8A 5A6SA 1QP4A 2ACVA 2C03A 3LQYA 4TMWA 3ZXXA 3B7WA 4WDQA 5B4TA 2GESA 2VTVA 1QQ7A 5TJHA 3L7CA 2FEMA 2H8KA 3RS8A 4GMXA 2HXCA 1JR4A 2FW6A 4O2LA 3AUFA 2DWUA 2GPTA 3U3XA 4CM4A 3HB0A 2J4DA 3PFCA 1OVGA 4EI7A 4E94A 1CZHA 1QHYA 3OPXA 2WG2A 1M1YE 3HL4A 4M21A 1Q77A 1C3LA 3LX4A 4RABA 3G7SA 4F7WA 3G2QA 1FFWA 2CK3D 5IUNC 2YWHA 3F46A 1P1CA 2R7KA 2JIMA 1TU3A 3EPLA 2HIAA 1YKSA 2J48A 3FLEA 1ZXXA 4O4JF 3BBPA 4DIDA 4QGFA 1JIUA 4FKBA 4TTVA 4JQCA 2Z2KA 1C1DB 4N8SA 2FDRA 5HF9A 3P2EA 1QNIA 3ODTA 4V03A 3QWAA 4H6XA 4PYIA 4ARZB 2YXBA 2WNHA 5DYGA 3KQQA 3GEHA 3WIOA 5JMWA 1FP2A 3IDZA 1V6AA 2C54A 4U0JA 4HATA 1L7RA 4W9NA 1SQJA 4E5DA 1KDYA 3BCRA 6GPBA 1FTSA 3PC8A 2DPLA 1E3QA 4OSOA 2O1EA 2J0UB 3L4OD 3LLVA 6ADHA 3VNQA 1FBTA 3DEFA 1Z18A 1BMFD 3IESA 1OTXA 1US8A 4JELA 3AXTA 1VL6A 4GW3A 4L8WB 3ETEA 2ZYAA 4EGJA 5CG2A 3RVDA 1T9GR 2BSQA 1YRAA 5IDVA 4Q4DA 3LFUA 1ZJYA 1LSSA 1QX4A 1XPJA 1VLHA 1XOIA 1LSUA 4L6AA 4W8GA 4MMYB 1F12A 2IXEA 4R41A 5CB0A 3AVOA 3PUHA 4NDNE 1EDEA 1P9LA 3DPUA 2WK1A 2PMBA 1AMNA 2GKSA 1FSSA 2OGUA 3ES9A 3PXWD 3U3MA 3JPWA 4L22A 3QFSA 4N3NA 1MEOA 4GEKA 2D5LA 1QORA 2UZ0A 2CD7A 2IXGA 2QYTA 1TTPB 3UENA 5DBEX 3B82A 2PM8A 4CV3A 3G8DA 4KACA 3RSOA 3I52A 4H7DA 4NPAA 5D86A 3L6BA 3AH8B 2IUVA 5E7IA 2Z6UA 3CLRC 1MTZA 1JR3A 3PIRA 1X7YB 3WYAA 3FNFA 4RIIA 5KEIA 4L73A 3DHNA 5HILA 1CR4A 2WM2A 5FTWA 1VBFA 4ZC1A 4G25A 1Y9AA 5JNWA 1E3EA 3GLGB 1QRTA 3KR2A 1C9JA 1SOVA 4YUXA 1RKUA 5FBLB 5CB8A 1HXHA 4TSFD 3H3FA 4LXIA 3WXMA 1XRLA 1WB5A 2GVZC 5E0KB 4BFSA 2ZRNA 1PDVA 2BCEA 1GT6A 4C0KA 1GLNA 4B3JA 5K19A 4QQKA 2PT6A 2OVFA 3O31A 3RLFA 4X97A 1H85A 1OXMA 4F4FA 3CUVA 2PZMA 4LI0A 2P4QA 5IW8A 3ZWOA 2VDLB 4BL5A 3VSCA 1J4AA 3NONA 4KBFA 3PT5A 4J0HA 1I33A 2CC2A 2VJCA 4BX9A 3N2GB 5CH8A 1E1RA 1Q0PA 3TBKA 5D51S 5F78A 3H18A 2OFWA 1XVUA 4R2JA 1W5TA 2QMEA 1Z26A 2YY5A 4QOSA 1S8FA 3AETB 3W7BA 4A0QA 4EHKA 4ZCTA 1N5DA 2Q5JA 3B9PA 2IY7A 4PCUA 5EM2B 4BNDB 4K6FA 1DKMA 4R8LA 1NUAA 4KO3S 3S81A 1VHLA 3RJZA 2AH0A 3PFNA 1N2BA 1QOQB 1FCJA 2VJKA 5TPWB 3HVRA 2CLLB 1Z36A 2O2XA 2O14A 1O5IA 2ZGVA 4RV5A 4K3UA 1J2JA 1NOJA 2DMRA 4A36A 1FE8A 3ZNQA 4CI2A 1R7RA 3EUWA 1AJEA 3CURA 1ISSA 2E3JA 4Z9FA 3CO0S 4YPOA 3C2QA 5EWJA 4FZVA 1WRBA 3A6GA 2OZLB 5ITVA 2AYYA 4PSUA 1Z37A 1UC9A 1IVYA 1CVLA 3GLUA 3DYIA 1EFPB 2I4IA 2X8BA 3O8CA 2R44A 1CX9B 3ENVA 4IFTA 2AHOA 1O8BA 4EQ6A 5CLJA 4I5DA 2H9AA 2GEKA 4TYWA 4O4IF 4AKEA 5PGMA 2RI6A 1IQPA 1L7PA 1KZHA 2F3RA 2XNJA 3ZCTA 1A9RA 1QV7A 3VA6A 1T4CB 3KBBA 4AVYA 1CQJA 1QNFA 4CT4B 4PZLA 4W9RA 2HEGA 2EIHA 4ND4A 1WPRA 1MP0A 1XYYA 3TLJA 4PQEA 3W3AA 3SIPA 5C5DA 3WWZA 1YU9A 4JUDX 1OT3A 2ES4A 3C6BA 4EYKA 2GK6A 4IMIB 2YDXA 3CUSA 1FS5A 1JQKA 2P6UA 4PYOA 4GPTA 1A7JA 3WLIA 2VF8A 2UXDB 3ULEC 1YJCA 4LV8B 2W37A 2B82A 1C9YA 2HJ4A 2YR0A 4DCMA 2KJQA 4MCHA 3KM0A 3UA4A 1L1FA 1Z9BA 3RLIA 1XR3A 3U39A 1MRZA 3PEFA 3WRXA 5T41A 5DGHA 1TX4B 5E38A 2YV5A 4TRRA 1KDPA 1JRLA 4V2UA 1J2YA 3VH1A 4EWLA 2Q9CA 2I2AA 2YRWA 4WNYA 1IEQA 5AJAA 3RT9A 5KSWB 1UP7A 4WI1A 2WABA 3LT0A 2VYND 1XV5A 3ELBA 3EDYA 2JEOA 3Q72A 2PG3A 3DLTA 1Z8FA 5G2OA 2HWYA 3IFSA 3EOAI 4KLNA 1WLYA 2HWUA 4NCXA 2Q3LA 5BUSA 1OLSB 4IKPA 2WU0A 5L45A 3WYCA 1K75A 4FGJA 2Q1TA 4JSTA 1UOEA 4XIGS 1RRCA 4EECA 3B3JA 1N92A 4CEIA 2YUTA 1EFAA 3WLLA 4D97A 4LXUA 5HGJA 2P35A 5BMVA 2Z2OA 2NACA 4TS3A 5JH7B 3W8FA 3KO8A 3F3MA 1GG9A 2QVGA 3FETA 4NMLA 1RZRD 1YL5A 1UBTS 3GZ4A 2PBZA 1ZINA 2Y6VA 1BDBA 2ODEA 5GY7A 4AJIA 4WEOA 2IEDA 2BKVA 4IMMA 3D3WA 2I7CA 1HFWA 4HJXA 3U7QB 4HRYA 3H1EA 1I30A 3AUTA 5JC1A 4A09B 1ZCFA 3FIJA 4N01A 2V9PA 3UWSA 2FEAA 4F46A 3ZE9A 4MQEB 3GLIB 2PBRA 3D0OA 2Q28A 5JT1A 4LVUA 4NNOA 3L1UA 3V8RA 4WCFC 3B53X 1D3AA 2O3UA 3IR6A 1U7TA 2EZUA 1QHHB 5JCOC 4O02B 2GVNA 1G8JA 4I46A 3DT8A 5EUQB 3DDCA 5MFPA 3VH4A 1SXJE 3KJZA 1ZMRA 2CLFB 1TT5B 2Q4BA 2OGWA 2VFAA 3W8RA 4HSEA 5FI1B 2WVGA 1G7TA 1ZVMA 2A88A 4KTTE 2H14A 2L42A 5E4FA 5FUBA 4BO0A 3PZBA 3D7MA 1T2CA 3I7LA 1L5ZA 5EHZA 3ZHZA 3LX6A 4M1KA 2BGRA 2F43B 2BI7A 3OIWA 1O0CA 5C3MA 4Q37A 1M6VA 3MWEA 3OA0A 3CEAA 5LFAA 1S8OA 3FGPA 1Q5PA 3EY9A 3QPCA 4MJ7A 1Z74A 2ZQZA 2ZXUA 3KB1A 3ELYA 1DOZA 3WKAA 2AG8A 1WD7A 2PDAA 4GVXA 5AI0A 4NC4A 3HJAA 4N3AA 2UZ3A 3WBBA 3GRFA 1P3JA 4B8YA 2RKBA 2BBSA 4P2GA 4KUGA 4IBOA 2P3QA 4KO1S 1N2SA 2YOHA 6NULA 3UJ6A 5EHNA 1BXGA 3I61A 2IS6A 2ONJA 3PCXA 3ZOZA 1UKVY 1P7PA 2C2WA 4OFZA 1JQ3A 2Z5GA 3K2QA 3DLPX 3SLKA 4BNJA 2VP6A 2IOFK 2RI0A 4Z2YA 1T2EA 4IIBA 4I2VA 3NHBA 4N9QA 5FL7A 3H42B 4N4AA 2NW6A 1U5CA 5HKAA 4LEIA 5B36A 3JQBC 3EGOA 2QSJA 2JDIA 2WHPA 1ABFA 1SQ0A 2MSLA 4Z4GA 3EIEA 2B2CA 2CZCA 2JK1A 4RLSA 3EMBA 3J81k 3OZ7A 2MWMA 4KMMA 3U6KA 1WXHA 4BVLA 3SYRA 1E9AA 4E6PA 1FP4B 3CRRA 3AR8A 2H5EA 5HHTA 2REQA 3H7IA 1J8FA 3HDJA 4F6CA 3HWSA 2W83A 4AROA 1RQPA 1BDJA 3VQTA 4QODA 3FWYA 4HQ6A 3L6DA 4D6XA 5JFOA 4MR9B 2L69A 4R6XA 3THYB 2QJTA 5F73A 1V1JA 3ZHSA 4N5LA 1KBOA 4GRAA 1FNDA 4JBGA 4MVJH 1QGUB 4D99A 4HEA6 3BH6A 1I0ZA 3NGMA 4MLCA 3FX2A 4YJDA 4D9BA 1VSQA 2ATEA 4WLFA 4KQ6A 2UVPA 1LC0A 4MI1A 2ZPUA 3AHGA 4BYGA 2CHUA 2I78A 1RQRA 4Q3NA 3PXAA 3N6XA 1H1DA 5JPCA 4LN1A 4BTVA 1E98A 2CLKB 4UASA 1RRFA 5BRNA 1LNZA 1Z62A 3K9BA 2FJ0A 5JNVA 4H4EA 2LP4Y 1T9HA 2DETA 1WF3A 4MV7A 3S8MA 1USIA 2JGRA 3PPWA 3FMIA 3QOYA 3ZNPA 4RLFA 3HXTA 1T1EA 1I0LA 2RHOA 1VZ3A 5EESA 3EH2A 3F6EX 4AQ7A 3T3PA 4O4JA 4X8LA 3V4FA 4CV1A 4EO4A 5L51A 2NVWA 1QFXA 2IK8A 1HFJA 5I48A 2OD2A 2JEZA 5TVGA 5JVDF 1SCJA 2ZUCA 4C0QC 1ZQ1A 2X4IA 5A71A 1J2EA 4G8DA 3K71B 3SBRA 3WI7A 4ACAA 2Q45A 1ZYUA 4ZRNA 3MQFA 3R09A 5DHRA 4V0QA 3MLBA 1SUWA 2P62A 3QJGA 3WL4A 4PX3A 4BMZA 3AK4A 2VZ9A 3W1VA 2Z2JA 1RCUA 2D0DA 1R27A 3FKSD 3ML1A 1CY8A 1HWYA 3FOAA 3PVCA 1RFGE 3OCYA 1XEWX 1V4VA 3AEQA 1E9FA 5E7JA 1ZPDA 2DOKA 4TTTS 4FBGA 1JZQA 3OO1A 1WTAA 4I8XA 2OAGA 3X44A 3K09A 4ZAVA 1PV1A 1M8GA 2EBWA 1O89A 3R3JA 5K1CC 2ZOSA 5K6RA 3QK7A 2OXEA 3LT4A 4M6WB 4R16A 5KU7A 1N5KA 4OLFA 3PDHA 3DKRA 4R1PA 5AI5A 4B3BA 1MQ9A 1RC1A 3CW8X 3PNSA 3NJ8A 4BP8A 2MYUA 5LQAA 4YPVA 1LRLA 3IAS1 4BWGA 5EINA 3R7WA 3UWDA 2ZDHA 3AESA 4AG3A 5ERYA 3QVOA 2QE7A 3BGSA 4D4IA 1PQWA 5IT5A 2OAEA 1P5HA 1S4QA 1T5BA 5EMHA 4PRKA 1VSUA 2R6AA 3TX6A 1V8OA 2IF2A 4YCAA 3MVEA 3NBYC 2PVPA 4QJBA 1LX6A 1R3DA </