3IURA

Appep_d266nx+h2h3 opened state
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
684
structure length
668
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
molecule keywords Prolyl Endopeptidase
total genus 211
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iurA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iurA01
3D2BA 1LPNA 5E4JA 2BGRA 1JMKC 1GZ7A 3TJMA 2V97A 5CTAA 1LPOA 4FWBA 3LLCA 3WA7A 5C8ZA 4AZ3A 1TKRA 4BB0A 4BAUA 1SCQA 4EB0A 1EDDA 1R4ZA 2FX5A 4WJLA 3E3AA 1DT5A 4QDUA 2DHCA 4FBLA 5KWJA 5ALVA 3DEAA 4YX9A 1ZGBA 1NU6A 4KAAA 2QR5A 4QLAA 2ZVDA 5AOCA 1MX5A 3VJKA 4C89A 3PICA 5K3AA 3H2JA 3I6ZA 4Q34A 1AGYA 2AJBA 3WWEA 4AQDA 1W6RA 4Q82A 4U2DA 1QIKA 4G8DA 5E4YA 4F21A 4UFNA 3G7NA 3G0CA 3DL4A 2HA2A 1CQZA 5AIAA 1HDEA 3SK0A 5CT5A 4B80A 4X93A 4I19A 1JJBA 1E8MA 1QIMA 4H7IA 5ALQA 3FYUC 1JT2A 4BDTA 2HDWA 4Y2RA 4BCBA 1CIJA 1XZEA 5K5EA 2FJPA 5AI6A 3HEAA 1J06A 5CH3A 1VE7A 4LHEA 3WL7A 2HRRA 3MVEA 1C4XA 1ZI6A 5JAOA 4A23A 3UUEA 5ALJA 4QZVA 4GHWA 1IZ8A 2CZQA 3VXKA 1A7UA 2R11A 3AIKA 2AJCA 3LP5A 3O0DA 4GBGA 3QBJA 2XUHA 3I6MA 4PW0A 5FUMA 2WIGA 2BGNA 3QMWA 2R8BA 4KACA 4J0HA 2WFLA 2J3QA 3C8HA 2C5GA 2HA3A 5DYYA 4Z49A 1ZJ4A 1CUSA 3K2IA 3C5WP 4KYVA 4B0PA 1GGVA 4AMYA 4PSDA 3HLKA 3I6YA 1CUJA 4BZZA 4UHHA 1VZ2A 3WWPA 1XLWA 2RGUA 3FCYA 5EIEA 3W9BA 1TRHA 4XWGA 2XMQA 3S8YA 3HXKA 5CT4A 4MYDA 4OCZA 4GECA 4B7ZA 2QMQA 1ISPA 2PVSA 3NOXA 1QIIA 1VA4A 4ZI5A 1R9MA 2H1IA 2QXUA 4L72A 4HXEB 4Y2UA 5ALKA 4GWLA 1QFMA 2IX9A 3EF3A 1XZGA 4AN1A 1YS1X 4DIUA 3IUQA 1JU4A 2GBGA 4UBNA 3QZUA 3Q0TA 1E66A 3VDXA 2XI4A 5FV4A 3BE8A 2BUCA 3IULA 5ALHA 1FFCA 3ESCA 2Z3WA 4PNZA 1IZ7A 1W76A 4BE4A 2ONCA 3JYHA 1QO7A 3WJ2A 1BRTA 1B41A 4BAZA 4GLBA 5EIHA 4G9EA 5JD5A 2XMBA 1QJ4A 1TIBA 4WFJA 4K6HA 2O2GA 2RONA 4AO7A 1FFDA 4XJVA 4Y2SA 2RIPA 2OG1A 4MWSA 5FDFA 3QVMA 3PF9A 1HLGA 2OGTA 2HA0A 1MNAA 2WG2A 4H0CA 4DGQA 3BWXA 2XQGA 3I2KA 3BDVA 2J4CA 1GPNA 3ESDA 3H2HA 3LCRA 3N2ZB 5EI5A 4EY7A 5LLSA 4CI9A 5AKYA 2GYWA 4G4JA 3BDIA 3FNBA 3R0VA 2BCEA 4Y2JA 2PSHA 2HL6A 2O2IA 3DD5A 4UBJA 3PUHA 5ALDA 3CCCA 4JH0A 4C4YA 5CXXA 1NU8A 5HQ3B 1XKLA 1WB6A 3QMMA 5JD4A 3G0BA 3ICVA 3NUZA 3HACA 1H2XA 1N8SA 3WJ1A 4HXFB 1C7IA 4PF1A 4G1FA 3EBLA 4RPCA 1XZCA 2K2QB 4N8SA 4B0OA 5J3JA 4G8CA 1EB8A 1XLVA 4JNCA 3FVRA 2RHWA 1LGYA 4WY5A 4X95A 1H22A 3GUUA 5LZ5A 1PFQA 4PSCA 4O08A 1CUZA 4M0FA 3H04A 3ZLTA 5AM2A 1AUOA 2VTVA 2X76A 2ZYIA 3R3ZA 1FFAA 3BF8A 1LZKA 4FOLA 4C4ZA 1WCYA 3DJYA 2WHRA 3ESBA 1BN7A 1B6GA 4J0GA 2JBWA 2OCLA 3DOIA 4IH4A 5EGNA 1UZAA 1P0MA 1Q0RA 5F4ZA 5AK5A 2DQZA 3AZPA 1KU6A 1DTEA 4Y7DA 4AO8A 3WIBA 5DTIA 1XZBA 5E4TA 1YA8A 1X2BA 4DSZA 5DYWA 1TCCA 2VJAA 1H2WA 5FOQA 2VA9A 1L7QA 3CN9A 2QM0A 5JYCA 5DTJA 2YH2A 4KEAA 4YK7A 4RE6A 2GBFA 1ZD4A 1VLQA 5AM4A 5DNUA 5LZ4A 1EVQA 4U2EA 1T2NA 2VT6A 2XUJA 2BUAA 2W6CX 5AIBA 4DLNA 5JATA 2WIFA 3QYJA 2RHTA 4F0JA 4NZZA 1EINA 2PUHA 3L1JA 2OQVA 1QIDA 2QUBA 4RNCA 4EA6A 3QITA 4FKBA 1Y7IA 1ZGCA 5AOBA 1Y7HA 5IH7A 1CLEA 3JW8A 2AJ8A 1ZD5A 1ZIYA 3RARA 1Q0ZA 2VJDA 4P92A 5ALRA 1P0QA 3F96A 4IQ4A 2CEKA 4TVKA 1OCEA 4EY6A 5JIBA 1CEXA 1CVLA 4FLEA 3FAKA 4DTCA 5AI5A 3W05A 2PL5A 4OD0A 1JKMA 2HU7A 5EHQA 1BS9A 2C4HA 3M83A 5D6OA 1CUFA 5IVDA 3H19A 3A2NA 3ED1A 1LPMA 3H0CA 1M33A 1TAHA 2VATA 4LYDA 4D9JA 5EHZA 5FKJA 4GEGA 3WL8A 1ACJA 3H1AA 5LIPA 4G4GA 2GYUA 3WKEA 3O4GA 4WCVA 1AX9A 1SC9A 3FLBA 4K6KA 2XMGA 1IVYA 1XRQA 3LIPA 3C8DA 3WKCA 3D4LA 1QLWA 2C58A 1MAAA 2BAGA 2UZ0A 1EB9A 1BU8A 2HA7A 2QOEA 1MNQA 1E8DA 2OCIA 1MTZA 3F8SA 2DCMA 2D0DA 2Z8ZA 2JGFA 2QUAA 4AB1A 2WQZA 2Y1KA 2OCGA 3O4IA 3C87A 4H7DA 2HRQA 1ETHA 2Y6UA 1MO2A 3SC2A 3WZLA 5E2IA 1MU0A 1TQHA 4MWTA 3PFBA 4B83A 5AP9A 1E8NA 1P0IA 1ODCA 4FHZA 1LPAB 1XRLA 2QS9A 3HRHA 3K6KA 4CG2A 2WG1A 2WIDA 1BROA 3FBWA 3PI6A 2WG0A 2E3JA 5ALLA 5FPPA 1RP1A 2JGIA 2XUGA 3WYDA 1K6EA 3VKFA 4Y2TA 2HFKA 4A5SA 4GDMA 2WUGA 5EIAA 3FLEA 3ANTA 1X70A 4JYPA 2CUTA 3U1TA 1KU0A 7YASA 3C70A 1QTRA 1KEZA 6YASA 5CURA 3RK4A 2EDAA 4AZ0A 4B9AA 3C45A 2ZJ6A 2XUPA 2WFMA 2XQFA 1H23A 4BAGA 3OTQA 3V1MA 4EY5A 4N5HX 1CUYA 4KE8A 4OYLA 4IHAA 5LZ9A 5IKXA 5AM1A 1XQVA 1CUHA 2XUFA 1YA4A 4KE6A 3RM3A 5ALXA 4X71A 5AI8A 1WB5A 4H7FA 3N0TA 3IB3A 2Y6VA 4W1QA 2Q0XA 4FLFA 3GROA 3EQ8A 1EK2A 1XZHA 1BEEA 1MT3A 2HU8A 3KDAA 4W1PA 4JUIA 3YASA 2HU5A 1QO9A 1CUCA 3BJMA 4L3WA 1QIGA 2BFNA 2DSNA 1GPKA 4C88A 2GBCA 2X8BA 1CPYA 2ECFA 1WPXA 1G4HA 1UOQA 4UBOA 2VQ6A 4G8BA 5T4BA 2VJBA 4BC0A 3IURA 3U0VA 4H77A 3D0KA 3FYUB 3WK4A 3DKKA 3F9CA 3M82A 4A16A 4RGYA 5AM0A 1Y37A 2XLBA 3I28A 2I03A 3LS2A 4HTAA 3WK8A 3FOBA 4GXNA 5CXUA 2QJRA 2W22A 1D07A 1CUAA 2IITA 3W2TA 1ACLA 1U65A 5DNWA 4QWWA 1XZKA 3QPCA 1ORWA 4S0XA 2WHPB 1WHTA 2GZRA 5A71A 1A8SA 3D3NA 1EXWA 3I2FA 4J0CA 4BYMA 4DNQA 3R3XA 2V9ZA 5JASA 1Q83A 2GZSA 3FSGA 5LP1A 2XUIA 1XLUA 5FPQA 3TEJA 3WK7A 3QMVA 5ALTA 4CCYB 3KWFA 1CV2A 3MGAA 2XQIA 1YB7A 1MN6A 4N5IX 1RWQA 1GQSA 2XMZA 5I7UA 3IDAA 2XMSA 4UBKA 1AZWA 3DDUA 1IUOA 1K5PA 1TCBA 1Z68A 4P9NA 3G9ZA 1LNSA 5AK6A 3WWDA 2XLCA 3W04A 5JD6A 3WL6A 5H3HA 4QDZA 2PSEA 3KOOA 4RE5A 4B85A 3ANSA 3GELA 3VVLA 1EDEA 3BL8A 1EX9A 4J3JA 3VJLA 5ALZA 3T4UA 1EDBA 2JGLA 2YASA 3P2MA 1GKKA 1XRMA 1J2EA 1C7JA 3WLAA 1ODSA 3CXUA 1ZD3A 1VE6A 5ALUA 4KJXA 5HKBA 4AO6A 5JALA 1MX1A 1WM1A 1P0PA 4J0IA 3O9MA 4UHFA 4BC1A 3ILSA 4H7JA 1DQZA 2PUJA 1CUGA 3BIWA 4NMWA 2B4KA 4KAFA 2X5XA 3A2LA 1WOMA 1GKLA 2OAGA 1LBTA 4N8DA 3GA7A 1QGED 4HVTA 1K8QA 2ZYHA 3WK5A 2HA5A 3I1YA 4ZXFA 3EIOA 3O4HA 3DCNA 2BJHA 3A70A 3H2KA 1DQYA 3SX4A 4FBMA 3RLIA 4IH1A 5JANA 3V1NA 1MPXA 4FTWA 5FLKA 3G9UA 1R1DA 1UK9A 4X91A 5IVIA 2H7CA 1DU4A 1TK3A 1ZIXA 4DNOA 1QONA 1SOMA 5K3EA 4CIBA 1MAHA 2GBIA 4NS4A 3QPAA 5BV7A 1QE3A 2ROQA 3F67A 3FSGD 3QH4A 1XQWA 1CUDA 4BRZA 5IVHA 1A88A 2CJPA 2FJ0A 3F97A 4PO3X 4ZGBA 4J7AA 4Y2VA 5KREA 3STXA 5LKRA 3X3HA 4YPVA 1EA5A 2WSLA 1XZLA 4B9EA 4KRYA 3FLAA 2B61A 3NWOA 1U8EA 4QE3A 1LPPA 3KD2A 1ZI9A 1BCSA 2FUKA 5SYMA 1SCKA 2PKYX 3G9TA 1USWA 2ACEA 4Q05A 1VJ5A 4C6HA 1VXOA 2WUFA 5FP0A 4B82A 1BE0A 2XUAA 1JMYA 3DKRA 3AIMA 1XRPA 4IH9A 1VXRA 3WI7A 2C0QA 3BF7A 4X90A 1XFDA 5BWCA 1QIEA 5AHXA 2VT7A 1F6WA 1ZI8A 4ZWNA 1N5RA 1DWPA 3R40A 2XT0A 1XRRA 3AUKA 3WQHA 3E4DA 3WIOA 2J4FA 3D5EA 3L1HA 4AXBA 3BXPA 5DJ5A 3FVTA 5A7FA 4MEAA 4Y2YA 1OXMA 4I4CA 3A2MA 1GXSA 3WK9A 2QVBA 1N1MA 3H2IA 4Q3KA 3EQ7A 1AMNA 1G42A 2JGKA 3R3YA 2QRUA 3BJRA 2WM2A 2PU7A 4BCCA 3WKAA 4H7HA 2PBLA 4X92A 4AN0A 5JADA 1ZICA 1YSCA 4OB8A 1SCIA 3H2GA 2JIDA 4MEBA 1HKHA 4MQLA 2YXPX 3W06A 2XDWA 3PF8A 5HF8A 1R3DA 4LXIA 3FYUA 5DWDA 5AK3A 4OU5A 3C5VA 3VVMA 1QIJA 3CN7A 1XZAA 2O7VA 2O7RA 4WFKA 5FXMA 1YAHA 2AJDA 2WTNA 2Z8XA 5AI0A 3I2GA 3QPDA 3DQZA 1XZJA 3EQ9A 5AKJA 5HF9A 4HRXA 2VAVA 5AOAA 4WY8A 1YR2A 4AMZA 3DLTA 2QT9A 1EK1A 3VJMA 4G5XA 4KAJA 4FDMA 5CBKA 2XUOA 4M0EA 2PSJA 4TGLA 5ALWA 2Z3ZA 1BCRA 3GZJA 2ACKA 3ZI7A 5KWIA 3RKSA 1R88A 2WFZA 1CUUA 1XKTA 3STUA 2CKMA 4OPMA 2OXEA 3PDCA 2QZPA 4CFSA 1VOTA 4B84A 1IUNA 1I6WA 4L0CA 2XMCA 2RI6A 1HPLA 1DINA 5AJHA 2ZJFA 2WJ4A 4QNNA 1UKAA 4P08A 1L7AA 4UFPA 2I3ZA 1DWOA 1DWQA 3R41A 2WUEA 1O6FA 1ZOIA 4X6XA 4W1SA 2J3DA 4U2FA 4FNGA 2WKWA 3O9VA 3IUJA 1K63A 1WHSA 4ZREA 2JEZA 2WJ6A 3STTA 1XZIA 2WJ3A 5AKIA 1OILA 4I3FA 4HS9A 4BE9A 1F0PA 4BVKA 1E89A 3V1KA 5AK4A 4ZV7A 1W75A 3C6XA 5JZ9A 4Y2XA 2C7BA 1XQYA 1SFRA 4QA9A 3W9UA 1UFOA 4X6YA 1CUEA 2EEPA 2OGZA 4GI1A 5ALYA 1ODTC 4KR0A 4C4XA 5ESRA 3OOSA 4P93A 4K2AA 4CG3A 4C87A 5T4EA 4H7KA 5HF5A 1CQWA 4J0JA 2OQIA 5HKAA 4ETWA 4N8EA 4B81A 4MQMA 3M3DA 5JZSA 2PM8A 1EI9A 5EHNA 1XQXA 1AURA 5HF6A 3STYA 1CUWA 2QKYA 1BN6A 5HQ3A 5ALPA 4XVCA 3IBTA 1S8OA 1AC5A 2BKLA 2NW6A 3G0DA 4FLMA 5CT6A 5FRDA 4UHCA 4W1RA 4NVRA 5ALGA 3G0GA 4QLOA 2DHEA 1UOPA 2HHAA 2OGSA 5AM3A 3D2AA 4G4IA 3MUNA 3B3QA 1UKBA 2HIHA 1RYYA 3OURA 3WWOA 3GFFA 5A7HA 1PV1A 1EH5A 3H17A 3ZWQA 4ZV9A 3ESAA 2JF0A 1PJAA 4BRSA 1J1IA 4X00A 4INZA 2B20A 3V9AA 1K4YA 5ALFA 4EBBA 3OG9A 3R3VA 3AJAA 2XE4A 5SYNA 4MXDA 2WIKA 3B5EA 4IO0A 1F8UA 1CR6A 2AXEA 5LYYA 2HADA 4BVJA 4KRXA 1E5TA 1ZD2P 1U2EA 1GPLA 3G8YA 3IIIA 4F60A 4CCWA 5DNVA 4X6UA 4QWMA 4YASA 2ZYRA 2D5LA 1WB4A 3D7RA 4PQEA 4FMPA 4X94A 1XZDA 5CT9A 2DFPA 2AJLI 5JARA 1LBSA 1FSSA 1NX9A 1UK6A 1H2ZA 4OU4A 1GQRA 2H7YA 4DMKA 3C43A 5ALNA 1HL7A 2CB9A 3HZOA 2CBGA 1QOZA 2I3DA 3ICWA 5AI9A 4X3CA 3WK6A 1G5FA 2HA4A 2IIVA 4FFWA 5JZBA 1HBJA 5A6VA 3MUOA 5AO9A 2VJCA 4UHBA 2OCKA 1VKHA 2V98A 1FFBA 5CMLA 4DSAA 4EUSA 2QJWA 3FYTA 5JAUA 1U4NA 4HRYA 4KE7A 2BUBA 5ALSA 3V48A 3VISA 4MJ3A 2P8SA 3QM1A 3GBSA 5AKKA 2OPHA 5I8PA 5K3DA 3HYSA 4Y9SA 4OB7A 3D2CA 1O6GA 4W9RA 1CUIA 4E15A 3AINA 4PSUA 1VZ3A 5AKEA 5K3BA 4J0KA 1MJ5A 5AKLA 3DL7A 4GW3A 5HCUA 4WDRA 5K3CA 3D59A 3WMRA 4WFIA 4G9GA 5CW2A 4H35A 1XROA 4HAIA 4AX4A 1E3QA 4ZRDA 1QTIA 4U2GA 4DM7A 3WL5A 2YYSA 5CRIA 2OAEA 1IMJA 4J0DA 5HFAA 2PSFA 1THTA 2WHPA 1YCDA 4ARAA 3AZQA 5C8VA 3ZV7A 2VSQA 4TPKA 3C6BA 2Y2VA 4L9AA 1R50A 2OLEA 2XUKA 1YAJA 2VAXA 3I2JA 1L7RA 2C5FA 1YS2X 4E11A 5AKGA 4DMFA 1X2EA 4ROTA 1T4MA 3UUFA 4BCDA 4Q3OA 1UT6A 5ISMA 1QFSA 2B9VA 3PUIA 5CT8A 3E0XA 1CUXA 2XQJA 2C0PA 1JU3A 2WILA 4V2IA 4LXHA 2WU3A 1IUPA 3HSSA 1CUBA 1QIHA 2QXTA 4UBMA 1WPRA 3WZMA 2WFLB 5LZ7A 3LIIA 4HZGA 4BDSA 4H7EA 2LIPA 1JJIA 5AKHA 2JGJA 5BOVA 2Z5GA 4Q1VA 4DMCA 2DHDA 3R3WA 5AI4A 4KE9A 4H18A 3ZPXA 1UK7A 1XRNA 3K9BA 4UBLA 1G66A 4K6GA 5T4FA 3ZLUA 1HQDA 4Y2QA 1THGA 5D3ZA 5D7BA 3DOHA 3PFCA 4OB6A 5AICA 3KSRA 4CG1A 3WYNA 1EHYA 1JFRA 4DNFA 2HA6A 1FJ2A 5ALOA 2XUDA 5AKZA 2EDCA 5C8XA 3STVA 2HM7A 3UMJA 1BEZA 5T4HA 5CH5A 3B12A 2PPLA 2WHQA 1XZMA 5AM5A 3O95A 1A8QA 3HC7A 4LIPD 4UFOA 4Y2PA 2JGEA 2O2HA 5HK9A 3KXPA 3G0IA 5AKXA 5JAPA 4QDXA 4DNPA 5C81A 1YB6A 3FWHA 5CH8A 4ARBA 4UBIA 4X85A 2VF2A 4U2CA 3OM8A 3G02A 3AILA 3E1GA 1DX6A 3WWCA 5JAHA 3IUMA 1CUVA 4OUKX 1LPBB 4CCYA 5HZGA 4BP9A 3PE6A 3WKDA 4LYEA 1A8UA 1CRLA 1DT3A 1W1IA 2HFJA 1W4LA 4PV7A 4F5ZA 1N5MA 3IUNA 1UWCA 2G4LA 4K5QA 1AQLA 4OYYA 4BZWA 4LXGA 4XIIA 4BVLA 3IA2A 3HI4A 4J03A 3ZLVA 1AKNA 2DR0A 5HFNA 4HXGA 2XQKA 4U2BA 2G63A 2ZYSA 1J07A 2WTMA 1H2YA 5LZ2A 4LKOA 3I2IA 1GT6A 1DX4A 4W63A 4BTVA 4ITVA 2QTBA 4BP8A 1ZJ5A 3OPMA 4JYMA 2WIJA 4UUQA 4UHDA 4M0MA 3KWJA 3AIOA 5DYTA 3OC0A 4X97A 3H18A 2ZJ7A 3O4JA 4QEKA 1YASA 2JGMA 3F98A 2CMFA 4WDQA 3AZOA 5IVKA 2PU5A 2XUQA 5HK8A 2H9YA 2WLSA 4EY8A 4FFVA 2XMDA 4EHBA 3DYIA 1LLFA 1W52X 5EHXA 5DLPA 1UOOA 5K3FB 3TGLA 5D3KA 4EZIA 2VEOA 2WU4A 3S2ZA 2V96A 5YASA 2PSDA 2G5TA 5BWBA 4UPDA 2RAUA 1MX9A 4BBZA 2Y2UA 3HABA 1UXOA 3AFIA 4FNMA 3M81A 4B6GA 3I2HA 1R9NA 2ORYA 4JEIA 3I1IA 2ES4A 4UHEA 1UK8A 3FCXA 3HJUA 2WUDA 5LKAA 1XZFA 5ALEA 1ORVA 4OSEA 5LZ8A 1LPSA 2H7XA 1LZLA 3H1BA 5ALIA 2JEYA 4E46A 4BTLA 4MYSA 4DMHA 5I9IA 1EVEA 1JJFA 3A6ZA 3L1IA 4CIAA 2XB6A 3R3UA 4EY4A 4E14A 4C01A 2GYVA 1FFEA 5EFZA 5A7GA 3CCBA 3Q8WA 3TRDA 4BATA 1UKCA 5K3FA 4QDTA 3BIXA 1CFJA 3C6YA 5AH0A 1VA5A 3C6ZA 5A62A 2ZSIA 3V1LA 1QIFA 1QZ3A 5ALMA 3SWWA 3STWA 1JI3A 4Q3LA 3WA6A 3T52A 2ZSHA 5KBYA 3G9XA 2DQYA 3IVMA 2I78A 4X7BA 4XX1A 3DNMA 2XMRA 5C7YA 1F0NA 4QDOA 2G5PA 5A2GA 3NGMA 3JWEA 1TCAA 3DYVA 2PX6A 4DYHA 1Q84A 3DS8A 3WKBA
chains in the Genus database with same CATH superfamily
2G67A 1M8KA 2P9EA 4R3WA 4BX0A 2A9VA 1C3JA 4XYIA 4ZVOA 3PDIB 1JMKC 1GZ7A 2H1SA 2PV7A 3U3RA 3RRNA 2N42A 1Z4MA 4II2A 3TJMA 4AJKA 3EUEA 4NAVA 2O8NA 4X6LA 5DCYA 1IN8A 4FWBA 3I05A 3T1YB 1OI2A 2ZBQA 4A2CA 4BB5A 4DIOA 4DJEC 2EHJA 2QN1A 3EGIA 2OV8A 1Q7GA 3Q5EA 4KUEA 3C74A 1Z4LA 3QJ5A 1K08A 2K87A 1SCQA 2JLYA 4HMQA 2CLOB 4MGHA 3GVCA 3B2QA 1IB6A 2BY4A 5G4KA 1FUIA 3M6XA 1V6CA 2OHHA 4GLOA 3DZKA 3ZQUA 5JCJD 1I2BA 2C5LA 3OQIB 4QU9A 3PX7A 1DELA 1JHAA 1ZCJA 2R97A 3CH5A 4WJLA 2JA2A 2DHCA 3HN7A 5I7WA 4ZOXA 1S89A 2N75A 1C9LA 2W2TA 3B6MA 4QRHA 4TTPA 3EW9A 1WSWA 2BRUA 3NWBA 4F04A 2HZ7A 4KAAA 1YZNA 4ZCLA 2AN1A 4OQEA 3MTBA 5FTKA 2ZTUA 4L75A 4JI5B 5GINE 1BCSB 2BTQA 3FR7A 3MT9A 4G63A 1IZYA 4JOQA 4KMRA 1YS4A 2AH0A 1MX5A 2GOYA 3T0GA 3VJKA 3VU9A 1N32B 1FTYA 1LUAA 1U4CA 3EXEA 3HVRA 1TW2A 3DWIA 3I6ZA 3ELDA 2C5SA 1FZTA 4GP9A 5KKAA 1TLFA 3D5QA 2ID9A 4NARA 1P9LA 3GBVA 1EK5A 3I0MA 3NHYA 4FYXA 4G8DA 5CIYA 2UUCB 3M9WA 2A1TR 2Z2IA 4PNPA 4QUKA 1LLCA 2EJBA 2WRZA 3G7NA 4RA6A 1KKUA 5EKXA 3W2EA 4AZSA 3QJYA 2ORIA 3DL4A 4D6XA 5I7FA 3MYYA 3GGPA 4FWIB 1I1OA 2IFTA 3AL3A 1NYQA 3CF0A 2NVUB 1T4CB 1WSBA 4AF7A 3S8MA 4B80A 3JVUA 2W6ID 3N07A 4LJKA 1V1MA 4JIMA 1FMJA 2JHPA 3T4EA 3T7RA 2HYDA 3T8YA 3R7NA 3IHKA 1DFHA 4A2LA 1NT4A 1QK4A 4H7IA 1AXRA 3FYUC 4UAJA 3RUHA 3W5BA 2YZNA 5JO9A 3C4QA 3PNSA 1GOFA 5T6MA 3SLRA 1QZZA 3EIHA 3NORA 3KR1A 4I8IA 3MMNA 1G55A 1AS2A 1Y42X 2K6GA 3PWTA 3LLVA 3R5TA 4UAUA 1UJBA 4Y2RA 4BCBA 2D74A 5EIOA 2WWTA 1UM8A 3N75A 4YR9A 3PQ2A 4B4KA 2QQFA 4TMZA 3OKYA 2WUWE 3BK1A 3EZYA 3AP2A 2BTOA 4JOCA 2OBLA 4OQMA 2MT9A 3SSMA 5K5EA 4QBGB 1XDZA 3N2NA 3TR5A 4ZZ0A 1RRPA 2PLNA 4E54B 3L05A 4AMGA 4KL8S 1MPTA 521PA 3UT5A 1NF8A 3ND7A 4HGRA 2PEZA 1JIXA 4U02A 3GFTA 3GH3A 1VE7A 2LCQA 4LHEA 4LISA 3AY0A 3GRVA 1KAEA 1TQDA 3MVEA 3JQFC 2YXNA 3TPCA 1NLZA 2C54A 5JBIA 3DLBA 1O5OA 1CP3A 1DRKA 4PHCA 1CRWG 3OX1A 3V3TA 3L6CA 1ZI6A 2J8ZA 4C0KA 1DEHA 3W1WA 1GYRA 2HXSA 3QU7A 1R64A 1R4NB 2MSNA 3I8CA 1PR2A 3WQBA 1J2JA 3NYIA 2ZIXA 4KRGA 4BFTA 4BH6A 5BY2A 1ZUNA 4GHWA 5HM6A 1PVOA 2OCXA 2M6SA 1IJKA 5C4IA 4UUAA 2HJWA 3ZE1A 3O94A 2AJCA 2VKQA 5CVUA 2MYTA 1OFTA 2CSUA 5CCDA 1THMA 5B37A 5D01A 1L7XA 2KBFA 3QBJA 1E77A 2J7PA 3LY9A 3R8CA 3T5CA 2BMWA 3ETCA 4XW2A 4AZVA 3LPDA 5FUMA 2XTNA 4U7WA 3A4YA 1PWYE 3C3PA 4HRVA 2QG6A 1ONOA 2BZ0A 5IVPA 5BN4A 1NQXA 1J90A 2ST1A 3FMGA 3FVQA 4AFNA 4WERA 2RAFA 1LTQA 2PTHA 3FCSA 4N14A 1KJ8A 2WFLA 4JK3A 3ZE8A 3H42B 3K09A 3KYBA 3A3YA 1OLXA 1B8NA 1FFYA 4R98A 4S1WA 1XTKA 2POCA 3JASA 3PS9A 1YNOA 1GTG1 1L1FA 3S70A 1L6IA 3C8HA 5TS2A 2DY1A 2PGXA 1NHWA 2C5GA 2NU7A 3I52A 1X7WA 3B6IA 1DC4A 1EGVB 3X1XA 2WINI 5BMVF 3MT0A 3B9QA 3C5WP 1RYFA 4JOSA 5DBFA 2FE4A 3CLVA 3VDMA 4E5YA 1NXWA 3CZ5A 4Y7CA 1GGVA 3HB1A 4MUYA 3AUJB 4OA5A 1KAHA 1IY9A 2P9ZA 4AMYA 2QX7A 4U6QA 3U3DA 3W8EA 1WP9A 4TRMA 2BSQA 1UDXA 3GEHA 4LQDA 5B1HA 3BXHA 3AEKA 3I6YA 5K4HA 2ZR8A 4LF7B 1S2OA 5F98A 3N0XA 1VZ2A 1NUHA 2IYYA 3WWPA 3EZXA 4CBVA 1XLWA 1G7CA 1NUUA 1YVDA 3EEYA 3L06A 4OLBA 3FSEA 7ABPA 4D96A 2HDHA 1E0JA 3A0RB 3MPUA 4OQZA 2ZYUX 2KMLA 3OX3A 3ZQ6A 3LHDA 1NN0A 4D2IA 1UPCA 2VUHB 5EMKA 3GAZA 5LL6P 4A7PA 3K15A 4PSAA 3H5IA 4KVGA 3JQQA 4HS4A 2E5WA 1TE2A 3SWSD 1V8PA 2ASEA 4B7ZA 4E1AA 3NOXA 3WO1A 3S0JA 4DCNA 4K6FA 5B7PA 2JDIA 4K9LA 1OI4A 2NV6A 2NUAB 1UDCA 1YKFA 4FNAA 3FFWA 3ONFA 4YLGA 5IARA 3P96A 3QWIA 1Q7EA 1SA0A 4WA8A 5LZ7A 4ZAFA 5ECYA 3TD2A 3SVTA 4DSOA 3I09A 1IN6A 4D9KA 1EFVB 4OY3A 1ULTA 2DTEA 2RGAA 3NYQA 4UHJA 3WFJA 5FOXA 4ALKA 1PZGA 1II8A 1Z47A 2ZR0A 3PXUA 4BMCA 3TLGB 1AVTA 2FHSA 2C98A 2OZPA 3O4RA 3QX9A 2A9FA 3ZDZB 2ZRPA 3PE7A 2VOEA 4D82A 2DWUA 2WB4A 3KUDA 1IQPA 4XJXA 2Q6KA 5FWXB 1S2GA 1CU1A 1OC4A 1ORRA 1YS7A 3FPEA 3FLMA 4G0VA 4NDAA 4Z0HO 2JEOA 1WIWA 2GBGA 3AJDA 2I22A 2YR0A 4R2KA 4UBNA 1TJNA 3Q0TA 5JS8A 1QSGA 2ZXFA 4ITRC 3GC3B 3JWJA 2OXIA 2ZW9A 3W9YA 4ENTA 5ITVA 2EJTA 3OZBA 4HNAB 2XI4A 4HHEA 4B3GA 1R5OA 1SQ0A 3BE8A 4NE9A 5F2EA 3UHPA 4B4WA 4D4IA 2C9CA 3IULA 1WXWA 4XYGA 2IUPA 4HN2A 1A9PA 4JL8A 2AD5A 5E3JA 4AF6A 5EM2B 1NPTO 3LC7O 4W8HA 2PO5A 2V6BA 4KWTA 2I66A 3NV7A 3FPJA 3LQYA 5FUYA 1EE1A 5T3UA 3RDPA 4I81A 3U3XA 4BE4A 4PHTA 1FFGA 3PQ4A 4YJ2A 4LF8B 3JYHA 4V0RA 4ES0A 1LQ2A 4JU9A 4M60A 4R0NA 3LHIA 4GLBA 1CK4A 2CN1A 5EIHA 5FT9A 4WBNB 4PYQA 3EAFA 5PGMA 3Q5DA 1E2QA 1CY8A 3I7PA 1E3WB 3TL2A 2I3TA 1LX7A 1TIBA 5IK2D 2ODQA 3C6QA 1Q12A 4RGQA 2YV5A 4G4SO 3WL3A 5SZKB 5BWNA 1RWVA 3LAWA 2M1XA 3FTEA 3H16A 3VOSA 1FVFA 1E7SA 1FFDA 1U3FA 2QV0A 1X77A 4GMDA 4XJVA 4Y2SA 4OXRA 3RW9A 3WSWA 5A5DA 4U7TB 4AP6A 3FKQA 1RJ9A 1PYDA 3L7JA 2NX2A 4E6EA 1CIVA 1BS1A 2BFPA 3CO0S 3PF9A 3HNRA 2OXCA 4DXHA 3OQBA 4A73A 5JISA 2JA1A 3HCNA 4F4FA 3A14A 2HA0A 1MNAA 4H15A 3WGHA 4H0CA 2J0UB 1Q47A 1PEVA 1HT2E 3KNZA 2ZB3A 2PZJA 2WW8A 4PLVA 5J40A 4PONA 4F71A 2H9NA 1SKBA 1QAQA 3PLNA 4XUCA 4W5QA 3PLAE 3H05A 1T4GA 1LRLA 2GCNA 3EVCA 3FPGA 3TIVA 4C3UA 1ATZA 4AQYB 3A1UA 3WX0A 4C03A 4G5GA 4G24A 3UKJA 2P6UA 2B1GA 1CE8A 2XU7A 3IALA 4R8KA 2AXNA 4YCMA 4NBTA 2RD2A 2HJGA 1ZJWA 4JI8B 3MXXA 4QFCA 4G0PA 3OZRA 2XNKA 4YUZA 4ZTZB 2QZ9A 3DZHA 5L3RA 5JCPA 2YNMC 3AI1A 3T9EA 4EITA 4N48A 5C1DA 1WXFA 4YO7A 3WGIA 2OBMA 2ZUUA 3ORRA 3QWHA 1ND6A 2VJOA 4CI9A 4JJ7A 3I8SA 3SS8A 2Q5HA 1VPWA 1KY2A 2AA3A 3LY7A 3URMA 1PSZA 1T9CA 1KDOA 2GYWA 2EZTA 1UZMA 2FPWA 4NJMA 4RNDB 1WDLA 3NLLA 1E3JA 4CMHA 2XGSA 3NHZA 1KI8A 2HL6A 2PSHA 2QRQA 4OXQA 4W9NC 1QZUA 2BGTA 4LJ8A 5H02A 1H4VB 4XPZA 5TPZA 5I5EA 1J1UA 2FPXA 5BNTA 5JJBA 5JSHA 4JV5B 3CCCA 1QB8A 4JH0A 5DWVA 4M9XA 2EKPA 4UTNA 3AFHA 1HH4A 1NU8A 1RFLA 3J7AC 3E5HA 1KE1A 3W4IA 3TJRA 3I45A 3WRXA 2JAUA 2H5IA 1V4NA 3QMMA 2D54A 4BNKA 5CA0F 1SXQA 3UYKA 3G0BA 3OQVA 4YHHB 4BO4A 4WY2A 2OBBA 3BKWA 1E1NA 1WL8A 2DQSA 1N8SA 1KORA 1AK9A 5K03A 2AN5A 3HXPA 3JVVA 4HH0A 1LFAA 2J3KA 4C06A 4ZN6A 1NJGA 4OMDA 1QK3A 3FB4A 4NCIA 4TXMA 4EI2A 1Q50A 1ZFNA 2ODPA 3HZHA 1C7IA 5IXSA 5DM1A 3FOWA 4L57A 4M7OA 4BTEA 5IU6A 1N6FA 2H9LA 4JJEA 5L3SB 5F7OA 1QC5B 3J7TA 2R6DA 2ZCVA 2Y99A 3LFTA 2K2QB 3NXSA 5EQTA 5BT8A 5CB4A 1T6NA 2UVPB 1AGRA 3T1HB 1Y48E 4KOAA 1EB8A 3IERA 1AD2A 1LNQA 3DEYX 3VR5D 3F7OA 3NYRA 2B1RA 1CF2O 1D0IA 3D7LA 3ITNA 4I4TA 4JDUA 4JJAA 3ZE0A 4IDPA 4IQ8A 2W58A 5CUQA 2GESA 3MINA 2UYOA 3NJRA 1GPMA 1XAJA 2YMPA 3LL7A 4LWPA 5TRTA 1V8BA 2UZYB 1XAIA 2J9XB 4XM1A 3W3AD 5DM60 3RC9A 2WJGA 1JDPA 2E49A 3FZGA 2QQGA 1JAXA 3TTWA 4R7AB 3RKRA 2GPNA 4Q7QA 3H84A 3T54A 1JUDA 4GFDA 4O08A 4OK5A 3KT0A 4L5BA 2OKCA 1TCUA 4LDJA 1UM9B 1AXEA 2BCGY 2J0VA 1GP2A 3ZLTA 1QRUA 3NYWA 2B5LA 4GOJA 3ZVLA 5AESA 5AVZA 4J29A 4TXJA 4RORA 3FUVA 1FFAA 6Q21A 1NW7A 4ND3A 4URFA 2PCJA 2AN3A 4Q4HA 1NLUA 2Q3EA 4PCLA 2AR0A 4H3HB 4AJEA 1Y9JA 2O9KA 2D7JA 1Y6ZA 3H2BA 1UEJA 3OF3A 3ESBA 5D86A 3MK31 5A5VA 2QPOA 1RNLA 2JBWA 1XZNA 2C5BA 2OCLA 1NPDA 4GPEA 4B4UA 1SQJA 3KHKA 2A14A 3NRJA 4BO0A 4FB4A 5HQTA 5JNUA 1JLKA 3BMXA 1OH5A 1XL1A 1XMJA 4XVRA 4MPDA 4CHGA 4YXWA 1B43A 5F4ZA 2ZZMA 4LE1A 1Y33E 4M88A 4ZAYA 1CQJA 4J7XA 2PT7A 2ZB7A 3OCVA 4R9VA 5F3RA 2Q2NA 3SZOA 4DARA 5CEFA 1URPA 3AU9A 1FDVA 4Y7DA 2IIPA 4AO8A 2BFFB 3CUSA 4FE4A 4BNNA 4D8TA 2VNHA 5ENDA 4I1UA 2QBYA 3VNUA 3L77A 1XZBA 2CF5A 5E4TA 1D9ZA 2GARA 4RPJA 4BWFB 2P9JA 4AJIA 3R74A 2C7RA 1ZUIA 5TARA 1WDKA 2DLDA 5HE8A 4WCDA 2XNCA 1TCCA 2OV6A 2PGDA 5DYWA 3UKUC 3U9SA 4EECA 5CCXA 5FOQA 2XHZA 4X1KA 3NDPA 2HXGA 4BMVA 2V7BA 3OIUA 1L7QA 4ND7A 3DF7A 4E08A 4EENA 3A6GA 2IBSA 4EW2A 1ILEA 2EX4A 2FY8A 1HY3A 4YK7A 4IBOA 3UBTA 3DAHA 5EALA 4JB2A 4O4JA 3ZYCA 3DQQA 1WBDA 1Z22A 3PQ7A 5DW3A 3FFBA 3MB5A 1T2NA 3KOYA 1XTUA 4KX5A 3UJPA 4RH3A 2ATCA 4EG6A 2QUIA 4NJEB 4IZIA 3IV7A 5F35A 4WTOA 1N8TA 2FMFA 4IAOA 3B9RA 4EY3A 5G02A 3JVDA 4UTOA 5C8YB 3GEGA 1JV2A 3AB3A 1E9FA 1U2GC 2RHTA 4CM5A 4F0JA 1NUPA 5JATA 4NZZA 4G0WA 3UW1A 3R0IA 3OUZA 4WNYA 3U13A 2OECA 1O03A 1XXHA 4CT5A 1NMZA 2RG7A 5IGQA 2CF6A 2FR8C 2QUBA 4J4HA 1NVVR 3EJ6A 5C5EA 1G60A 4Q3BA 1TUBB 3SCYA 4XQEA 3AY3A 1L5QA 2AN9A 4BASA 5BYJA 4UDOA 4RESA 3P2OA 4Q02A 3BWEA 4WZAB 1D6SA 1KAOA 2DPXA 4TTAA 1CJVC 3DM9B 4YI3A 5E0OA 3ZLUA 4EGJA 1Y7LA 1WW2A 1SUIA 4PBTA 3LDUA 4RVSA 3RTBA 3U39A 1K68A 3B7GA 1F38A 1A12A 1X1CA 2SICE 2ZDHA 4C2UA 2M6KA 4LSWA 4CLEA 4L7QA 1W49A 1ZD5A 1C0PA 3DB2A 2A35A 3IP7A 3LHSA 3QLVA 4FILA 4OBBA 1IN7A 1KJZA 2GPAA 2YWXA 4RZ3A 4B33A 1C9DB 2Q4BA 1Q0ZA 1BOFA 2FUG1 3COPA 4GWGA 1UEXC 4CE6A 4E13A 5IF9A 3Q7PA 3ZTWA 4ZZ1A 2W48A 1P0QA 3E7FA 3GEEA 1JQKA 1NIPA 1KSHA 2H2IA 3DDHA 2RGYA 3OWOA 1LDGA 2GK4A 1QP4A 3F96A 4ZOLF 2XB9A 1DJNA 4TVKA 5CXBB 1OCEA 4BGIA 1C8KA 5JYEA 4K3UA 1RACA 3NM4A 1XN4A 3T41A 4J1QA 1PJTA 5JIBA 2BMDA 3NAMA 1B2LA 4JLVA 3KZCA 3P9CA 3LJKA 3Q3HA 4YAWA 1E2KA 5H17A 3E82A 3OE4A 4ZPJA 2GM9A 2PL5A 4L2IA 4ALNA 2MJLA 4RIIA 5CYOA 4ZOVA 2XRZA 1KBQA 2J85A 5EWLB 3KVVA 5HX7A 1LKZA 4LDQA 3CY6A 4PLTA 4V02A 3Q88A 5HRAA 1AIPA 3K3PA 3ISTA 1VKOA 4G0YA 5IVDA 3W5VA 3ZXYA 3COVA 2X14A 3H19A 1QHSA 1XA4A 4JA0A 1DKUA 1M33A 3EMDA 3H0CA 1M83A 1TAHA 1A7KA 1FLNA 1Z0FA 5EXXA 2G17A 2VAPA 5E2BA 4KTVE 2ZCUA 4KQGA 4LYDA 5IDQA 1GYPA 1XV5A 2GEFA 2WVHA 4FC6A 1Z4JA 2QRVA 1FNCA 4IWYA 4M1QA 5J9FA 3KVNA 1M0WA 3I9MA 3K70D 5LIRA 4QTXA 5HYVA 1ACJA 3LZCA 4U7HA 3TUIC 4AZWA 4G4GA 1B93A 3ZDCA 3O8OA 3O4GA 5CA1F 3KFVA 2VYND 2OK6A 1IY1A 6REQA 4NYIQ 1SK9A 4O9DA 5K0EA 4MVJF 2AH5A 5CVDA 2UZXB 3SSAA 4EFKA 3HJBA 3PR3A 1RQ7A 3SN6B 4Y6SA 3NPMA 3C8DA 4DUGA 3HDTA 3TKYA 4MP6A 2EX1A 3A06A 5DULA 5K0GA 4NG5A 4YRCA 1TVKA 3D4LA 3KM0A 4ZT4A 3U7QB 1A9YA 1QLWA 2C58A 3FA2A 2PM9B 5HE9A 1UBNA 5LBTA 3KOXA 3D8UA 4GD3Q 1U2RA 3S27A 1B6RA 4UTPA 2UZ0A 4B1FA 3FM0A 2FSFA 3RS7A 4CTKA 2XL2A 2W5UA 3GJ5A 1UJMA 1V6AA 2QOEA 1R2QA 1MNQA 3PC7A 4L8GA 4QOHA 1U2TA 3AGPA 3QG5A 4LN1A 3FWKA 3KU4A 1AZSC 4MQEB 4BO1A 5KTYA 3NBZC 4J1TC 2CLEB 2DCMA 3SC2B 1V96A 2C3UA 2AZ4A 3UV3A 2JGFA 3TTTA 2QUAA 2H00A 3EA4A 4B6QA 5DYNA 3BZWA 3KQKA 1NQ5A 2PH7A 3HU3A 4BQIA 4EGQA 1EG2A 3GLHE 5SICE 1JDBC 4H7DA 3OQIA 4TSRA 1LDYA 1MO2A 4O4JB 2FZWA 4JXJA 4RF2A 1VM6A 4B7CA 1QYIA 2Q6LA 3ET5A 3SC2A 5LQRA 3RADC 3FPLA 3RYFB 1MU0A 1BA3A 3PQEA 3W2GA 3MOSA 4LVUA 2I6UA 3CZQA 4YC7A 3TNJA 3X44A 2VHXA 2AF4C 4NL4H 4EVRA 4XWOA 3X1KA 5BN3A 5LYJB 3R9KA 3HA5A 3PNQA 4MWTA 3TFOA 1ZD8A 2C3YA 4L3OA 5MHTA 5E6UA 1VPTA 1T2AA 3PCXA 2JJ1A 2I0RA 1E2MA 2RJNA 4IOMA 4ALLA 1U0JA 1ODCA 4LTMA 1M5TA 5EUBA 1U11A 1FRFS 2FRXA 4FHZA 5G4LA 5LB4A 2VJNA 4EG7A 1ZR2A 1ZCFA 1BRMA 1N6LA 3RNOA 1SXJB 3T99A 3IBFA 4D6PA 3KKPA 3CPSA 1T34A 3FPAA 3HRHA 3FR8A 1Y4SA 4CW7A 3FYCA 4EW1A 1P33A 1B0AA 1ZMOA 1YD7A 3H5LA 5KVAA 1CULC 3QF4A 3QNWA 4D3DA 2ZAOA 4O29A 3HVUA 2VPWA 3LC2O 5FPPA 2KE5A 4ZCQA 2CN2A 3ZUPA 1I3MA 2ZUEA 1CP2A 2J7PD 2JGIA 1K4MA 2JCVA 2ODAA 4RTMA 4N41A 3UTDA 3OKPA 4P38A 1DARA 5CNJA 5KSZA 1YJXA 2Z5VA 2X8LA 2EQBA 3FLEA 3V2IA 5BQFA 1BXRA 1H42A 4R2IA 1TM3E 1X70A 3K96A 3GLUA 3TZLA 3V4SA 3LXXA 4WZBE 1GOHA 2WJWA 4RHCA 4V0KA 4G5HA 5K6TA 3U1TA 5E6RB 1KU0A 3T9DA 5FO1A 4BMYA 2FPGA 3EZ9A 4DUPA 3KUKA 4IJKA 4KIJA 5G53C 1DCTA 3RBVA 1QTRA 4B45A 1KEZA 1SIBE 3JXEA 1Z5OA 2H1WA 3VKVA 2Q1SA 6YASA 1T0PA 1T4DA 4DT1A 2OD2A 3IV6A 3EWIA 3UKDA 4O3MA 3S2SA 1FDWA 1QNIA 2QT0A 3C97A 3MA0A 1BD3A 2GCEA 4RLHA 3GT3A 1YR3A 3AH8B 2CYAA 3CUWA 4EG3A 1AHPA 2C83A 2O5EA 2AGLA 3FUUA 1PGPA 1HG1A 4ENPA 4CL2A 3EZ6A 4J1TA 3GW8A 4JLKA 5BWMA 4QEZA 2H52A 2WIAA 5JVDA 4K8RB 3QOYA 4EHNA 1MA3A 2C1EA 1ELOA 1J2UA 1KDYA 1QBKC 5DNEA 3EWSA 3DKVA 3R3JA 4M49A 4CEHB 3GU3A 1NWCA 1JQDA 1SHZA 1Q21A 2AV6A 1OPXA 5BSTA 2XWQA 1GZ3A 3TGWA 4ZVNA 4HTFA 3V1MA 5I5JA 4BY9E 4IZ6A 3ZWNA 1HZZA 4R9UC 3UC5A 1XCMA 2NWQA 3G7SA 4CY3A 3NALA 3PNMA 1EFTA 3E03A 4JLAA 4IHAA 3SR3A 1RXVA 1KVTA 1WMFA 3P2EA 5TB5A 1HXHA 1L5YA 2H48A 1KEEA 2VWGA 3GRAA 5KYGA 2FXVA 3EH2A 4Z4FA 2VXBA 3QY9A 4FXPA 2RGCA 2XUFA 4DEVA 5J58A 3NVAA 3SDSA 4EVIA 3RM3A 1TUIA 1FL9A 5ALXA 4CDGA 4HUTA 5LDDC 3DMHA 1XKSA 2R44A 4UTXA 5H4HA 3II6X 1YMQA 2FE1A 2O2SA 3OCZA 1JEYA 1ECLA 1KZGB 3ZG6A 2JAXA 3SIPA 3WGKA 5EHZA 1VE5A 1DC3A 4GL4A 3ZX5A 3GROA 5HFJA 5CB6A 5IEJA 3EQ8A 3DWEX 4OGWA 1XZHA 5EKDA 4Y0NA 2GKGA 1H2AS 3OZAA 4KIUA 3PGKA 1JHUA 2FUEA 3EXFA 4OZUA 2P9KC 3U1VA 3KDAA 1E6UA 3AL8B 1ZLXA 5LU9A 2C7QA 4HNSA 4AG6A 1CF4A 1TMYA 2Y92A 5SZIA 2HU5A 2XXAB 4HGPA 3NCHA 3KSZO 3IJ5A 1BH2A 1FVXA 1KR2A 2CD7A 4CY5A 1CUCA 1JI0A 1GGMA 1C1DB 1NMYA 4UI9R 1SXIA 3GK3A 4MYRA 4ZAGA 1SUBA 3E6AA 2X7HA 4IGIA 3EFOA 5FTWA 4BHTA 2EP7A 1X7XA 3FF1A 2ANBA 3EDYA 1P7PA 1W88A 4YJ3B 4C88A 2QBYB 2VK8A 1HYQA 2RAVA 5TS3A 1PR5A 3TINA 1YDHA 5BW8A 2QJFA 3ZHOA 4CTJA 3EGXA 3L8MA 5B6PA 3HJHA 3G8CA 1T9DA 1UOQA 3CLUD 1Y4AE 2RSLA 3H4VA 4UBOA 621PA 5KHLB 4BUZA 1WCXA 3QX3A 3TECE 4K6OA 3HCRA 3IQWA 1P2GA 4ZO4A 1TB4A 1UCFA 1Y3DE 4MVJH 5DK6A 1GG8A 4BFVA 2EYQA 2NTNA 2Q3FA 2Q4TA 3IBCA 2EXXA 1CZNA 5HIAA 3T9FA 2A9RA 1CNEA 1L0BA 1YOVB 1Z0KA 3M70A 1RP7A 3N2GA 4TTIA 3LK7A 5ER6A 2AFHA 3DKKA 3KT8A 4GPIB 5DEIA 4F8YA 4OJTA 2C97A 3HYRA 1K75A 1ZSYA 4PEVA 1ULBA 4RGYA 1X3SA 3ZQ4A 2G28A 4JVOA 1Z12A 2VZLA 3Q4GA 5JOQA 1ESDA 1XLTA 1R9GA 3LS2A 3WGOA 1GTVA 5JS1A 1MJFA 1QG0A 3PIDA 4L50A 1EA7A 3A6LA 5LBUA 3ACDA 2V6JA 2YMMA 1FU7A 3OPVA 1JG4A 3USZA 4B5KA 4CV2A 5D00A 1GV0A 3IVGA 3V4PA 4ER6A 3W2TA 2OD9A 3ZWPA 4CZXA 1Z6YA 2HMTA 1ACLA 3GFOA 4OHMA 1U65A 3PVCA 4RQUA 3RT9A 4RULA 4HLUA 1T3SA 2CNWA 2PS3A 3AUTA 4M89A 1G18A 5DNWA 5AVQA 4B8WA 3DXMC 3RVPA 4LSZA 2NADA 3NAZA 2NU8A 5KTTA 2NVWA 2VZ9A 4PC0A 4QWWA 3ZHYA 3ZK9A 3QPCA 2J07A 1ORWA 1SCJA 1EFPA 4WNIA 4LCJA 1C30B 4UZEA 1JQLB 3KK0A 2WHPB 4M87A 1U2DC 2V4ZA 3CKMA 3ER6A 4HNTA 1RYBA 3CLRD 3PEVA 1GLVA 1QH8A 3PHJA 2Y4NA 3TG8A 2CNOA 1JXAA 4J0CA 3NETA 4ENUA 4O1MA 4K9PA 4R5HA 3F74A 3ISVA 1I3NA 1R6UA 5KDDA 3FSGA 1ZU5A 2Y66A 4N65A 3QVWA 5DO9A 4BIIA 5LP1A 4PCVA 2XUIA 3WV4A 4BMOB 5FPQA 5DHTA 3AETB 3JQPA 4M1SA 1VHWA 5DN6A 3F6SA 4ZODA 3KKKA 1IY8A 2VHZA 3DP9A 1MV5A 3LM8A 4LBWA 1I3LA 3UA3A 4Z7OB 2CHVA 3BFJA 4OHVA 2IGBA 2RAPA 4TLDA 4EWLA 5LLDA 4D42A 1YB7A 5JXWA 2OZEA 4N5IX 2ZBFA 2QRLA 1U0GA 4S12A 4M2LA 3ZV5A 1V16B 4LRXA 1XMVA 3IDAA 2FDCA 5D5PA 4B3SB 4OOFA 1AZWA 3FDFA 4YUYA 2BFOA 3BCRA 3UJCA 1YCHA 2K7ZA 4RK7A 4DDKA 4RLQA 4LZOA 2N9UA 1MQSA 1PS0A 4LFCB 1TCBA 1FJGB 2B6NA 2CHFA 4GM3A 2RHRA 3WO0A 3SBQA 4TLBA 1OX4A 1WO8A 3P5BA 2Q4OA 3ORSA 4RDCA 4EARA 5BN5B 1XEXA 2QTNA 2XLCA 3W04A 1DLJA 5JD6A 2B5WA 4QDZA 2H65A 3KDSE 4PANA 3REQA 1HEUA 2PKWA 2GN9A 5DBGA 3P9ZA 1O95D 1XJWA 3CRZA 3HDGA 4LX0A 4MJLA 1J8QA 1ZIPA 1I1NA 2HGSA 3FUXA 1UINA 5FCDA 1E1QA 1TO6A 3ZYZA 1E3MA 1E9VA 3HB0A 2RDMA 5CA1A 3MLEA 3N39C 4Q47A 5A1JA 4S1TA 3P19A 1EX9A 2ZUWA 4JELA 4UVEA 2WPDD 4LJ9A 5DIZA 4PRYA 5K4GA 1ZPDA 1EDBA 1XJ5A 3QEJA 1ZM7A 1N5KA 2PQ2A 1NBEA 4OF4A 3UZUA 3OZCA 2ZSAA 3M6FA 4KU4A 3WLAA 3S8EA 1P2TA 3BIFA 3EGCA 2LCFA 2R9VA 2B3TA 4P22A 1Q91A 3CRVA 4GOXA 3WNZA 1YQQA 4C7OB 4NCJA 1VE9A 4RHUA 4WXEA 5I9TA 3W4KA 1AS3A 2E4VA 1P0PA 4J0IA 1W59A 3T9BA 3K9HA 5GMOA 4TYQA 3HY3A 3ROPA 1GAEO 2ASVA 2GKOA 5FBKA 4UHFA 5B5SA 3JD4A 1U7ZA 1SBIA 1WD5A 5HW0A 3O3OB 3MWYW 4MV9A 1RBMA 4FYJA 1QYDA 1TJ5A 3L7NA 3FTQA 1NVAA 3OPYA 3DMGA 4RABA 4LFAB 4H7JA 1U8CB 2PUJA 2R87A 2IUYA 1WSDA 1JWLA 4RKWA 4MV3A 4NMWA 4U7JA 1UJ4A 4JLJA 4UVHA 4KAFA 1VB3A 2ZIUB 2HUNA 3EXHA 1WOMA 4P6VF 3U3JA 1G2PA 2FWNA 3THOA 4JSRA 4C5BA 5KJ1A 2Y4OA 1IY0A 1XMQB 1I7DA 3L43A 2VDUE 4BV2A 3L41A 1QGED 4G5FA 1TMOA 4ZQIA 4BGDA 1MW8X 2ZITA 4HVTA 3EH1A 1P80A 2LDBA 3RREA 2ZYHA 3QV2A 5LQDA 1F8FA 3HU5A 2VP6A 3EIOA 4AQ7A 3O4HA 3DCNA 3ZGXA 1QBGA 2IZZA 3D4BA 1ISSA 3VSCA 1XCLA 2X0KA 1H1DA 2JI9A 4O2BA 5DBOA 2ECKA 3GUVA 5LB2A 4KOEC 3W9SA 4F8EA 1DQYA 2NGRA 5EJ2A 1JEOA 3F3PA 1ABEA 4G1CA 4C76A 4KPGA 3A31A 1E1CA 1TAQA 5JANA 1Z6ZA 1XGKA 2X7JA 3V1NA 4L74A 1QRAA 4OX9B 3LHKA 1Q0LA 1TAGA 4EELA 4X54A 1R1DA 1Y4UA 4KFCA 3RC8A 1X0VA 4ME6A 5HR5A 2O3RA 4XCVA 5DOVA 5E3HA 1SWVA 2G9RA 5IVIA 2ETXA 4DHEA 3AHFA 1NW9B 1X8KA 2DULA 3GN2A 1XCBA 1ZIXA 1I36A 2D2EA 2G9ZA 3K16A 4IV8A 5E7IA 3MW8A 3KR0A 4FWWA 3ZDZA 1GNVA 3GJ6A 3NTVA 3AWDA 4U9IS 3SFTA 2XZOA 1SOMA 3GUCA 3K1YA 1YQWA 3ZV3A 1RMYA 3NP7A 1WMDA 3CF6R 4CIBA 1MAHA 2GBIA 2WWRA 4NS4A 4DCSA 4TMVA 3QPAA 3F67A 3K4QA 4LY6A 3K6JA 5HGJA 4RPGA 4HWTA 1UQRA 2JZNA 2Z6AA 3N2KB 1PU2A 2VZ8A 4K28A 4LY0A 5LDHA 1E0AA 3H5TA 2F9FA 1WS6A 2IU6A 2G06A 2W6PA 1SVKA 1W94A 5HIMA 2G1AA 4KB5A 3WRYA 3I9V6 3NTUA 4RXUA 1XHEA 5TXGA 3NHLA 4MV8A 4Q1AA 1TU3A 3A9RA 1HYBA 4JVNA 5KREA 1QKJA 3STXA 1N2JA 3MB8A 3X3HA 4XPIA 2VHWA 4JI4B 3BICA 5IWCA 3CWQA 1AKRA 4FINA 1N7IA 3CW2A 3JTEA 1G8GA 3RVSA 1ZN9A 1B3RA 2Y3IA 4L8LA 5EPEA 3SQXA 1S8NA 2IS1A 3VBCA 3LCJA 4HWSA 2YWFA 1TZKA 1RHMA 3QLUC 1ONSA 3NP9A 4FOSA 1ZS9A 4QE3A 4IGKA 2FZVA 4P84A 2GWHA 4MUNA 4HN9A 2FUKA 3SHVA 3DV0B 2C2HA 1SCKA 4QUAA 3ASZA 1ISMA 1USWA 3BFXA 1BXRB 2D5BA 3DDNA 5CNIA 2RGWA 2IELA 1ID8A 3EYAA 1VJ5A 2IUUA 3ESZA 4NNJA 2GZ1A 4GUDA 4PYNA 4RK4A 5JZVA 5L7TA 2R8EA 4ZVSA 2P9NC 3BCHA 4B82A 2OORC 1M2WA 3BWYA 3NATA 1E64A 2P2CA 4L76A 1ILWA 4PXYA 5KOJA 3DPUA 3L7OA 4CETA 2O8BB 1EFHA 4GL2A 1TMGE 2OESA 3TX6A 1CZUA 2HZBA 3AIMA 4IH9A 1IN1A 2BP7B 4RV5A 1VXRA 3WI7A 1AGNA 1MOZA 4DV7B 2XGMA 2CE7A 3P27A 1BW9A 2F7SA 4XCQA 2QSJA 3KWLA 4UMVA 3HA3A 2AH1A 1HO3A 3HXTA 4G1MA 3NTOA 3RTGA 1QIEA 2Q6OA 1L6RA 3PUYA 1HWYA 4UXHA 4W6QA 4W6ZA 2VT7A 3EF1A 4N5DA 3VC1A 5J1SB 3SY8A 2ZIGA 1ZI8A 3GRCA 4AK9A 3RQSA 1NQVA 5BVHA 1M67A 4M9CA 2EOAA 2CFSA 3R40A 4NONA 1XA0A 2Y1CA 4D9EA 3AUKA 1C8LA 4QFBA 3JTMA 3EPPA 3WQHA 1YIAA 3OP1A 2HMUA 3BMQA 5LMNB 5FQDA 4QSMA 3STHA 3D5EA 1ISRA 3CZ4A 4FFNA 4JJIA 5F5NA 5K8LA 2AC4A 2VHCA 3IHWA 3MT8A 1PJBA 3PNVA 4KYTA 4CQMD 3GN1A 1NLFA 1OXMA 2ERXA 1RJWA 4R2LA 4BLUA 5DLDA 4HY3A 2D7CA 2QL7A 1EWRA 3K6RA 3R23A 3DCIA 1K97A 2W2PA 3IUSA 2H1LA 2H4ZA 3KCNA 4BNLA 3CB2A 2O2DA 2BHRA 1N1MA 4MEJA 1TA0A 4ZYTA 2EBSA 3AOGA 2C9DA 4EG1A 3RC3A 3EMHA 1VKZA 4RK5A 3A3NA 4AJ4A 1SQ9A 5CEJA 4L3GD 2QUKA 1I9CA 4GM4A 2XJ4A 4ND2A 1WLYA 8ABPA 2FK7A 1JZTA 2GBLC 4F4CA 2C2ZA 3A37A 1T2CA 1QH1A 5JI2E 4GLFA 4Z4QA 4AY4A 2A0YA 3ORFA 3E9ZA 3WNBA 4S3MA 3R3YA 2GVNA 4DLBA 1X8XA 1MENA 1O94C 1DI0A 3KPVA 3N0VA 4K81B 4MS4A 1WNTA 4R9SA 4XQCA 3RCBA 3V8EA 3V2UA 2WM2A 3KQPA 2R6ZA 1BZYA 5I48A 4EPVA 2KLHA 1YB5A 3L18A 3QX7A 1TAUA 2FW0A 2MR6A 3ZY3A 4O3UB 4JLBA 5FTMA 4CQMB 3AUUA 4MW2A 4R0MA 1ZICA 4JP8A 3LUBA 5FNVA 3PSCB 3GUHA 4A91A 2ZBVA 3UMVA 4L1QD 5KUTA 2C1ZA 3I1FA 3VO2A 4B09A 1NN3A 2BC9A 3RI3A 5AVOA 3ROTA 1JKFA 1RYDA 3CX8A 5KTPA 4A11A 2H1FA 4EJ6A 1ECBA 5EE3A 1CY1A 1EFDN 1TGVA 2I9PA 4MEBA 1DUIA 2GZMA 4RF3A 2W2LD 4BPRA 4QIHA 1HKHA 1CIPA 4IXTA 4KMMA 2VZ0A 4GSKA 1XVAA 1V9SA 1SEVA 1YJ5A 4OVKA 2JFFA 1K9VF 4DABA 3NBYC 3JZNA 1J20A 3DUFB 5CTJA 3QW4B 1IQUA 4L5CA 3S40A 1GTRA 3JAKB 1ZNZA 4MV6A 5JCZA 1ZW6A 4DVGA 4A0FA 3N6RA 4YQYA 2QP3A 2EF1A 5HF8A 1IMOA 4EGCB 4J84A 3U4QA 2A5JA 2YYAA 3TIIA 5ES4B 1R74A 3C8MA 4D9IA 4DBLC 3VKUA 4F2DA 5AK3A 1XDSA 2Q21A 4OU5A 1EGAA 4TRNA 3P97A 3WLJA 5EJ7A 2JLVA 3B36A 3OL2A 2CXOA 3VVMA 1QIJA 1T26A 2WICA 3DE2X 3PUXA 1BAPA 4MVJP 4HUQB 1TKBA 1D2HA 2PAFA 4FE3A 1L5NA 3R75A 3SGLA 3U7RA 1TXGA 2VDKB 1FQWA 2FWPA 1Z17A 5FXMA 4INAA 2A0FA 1PFUA 3A11A 1KEWA 1EBFA 1JWBB 1JXMA 3K0CA 3MWDA 4QU8A 3WIDA 2BFCA 3GT7A 1K27A 2B2CA 4DYVA 1WULS 2Z8XA 3U62A 1OT5A 4TKVB 1PGNA 1X9HA 5IJZA 2J5RA 4HJXA 3CRNA 3DQPA 3W5AA 1T8WA 1OFGA 3GV0A 1PK9A 2QAGC 1ZVQA 3CNHA 2ZJ4A 3SU8A 3SXUB 3EY9A 2ICAA 2KLBA 2PXCA 4Z4HA 4HRXA 4NQZA 1D8TA 2GAFA 1YTLA 1B0ZA 1UPTA 2COUA 2QLJA 3VGPA 4QO8A 1KK2A 1R6VA 5LOVF 4DQXA 3RQIA 1WZIA 2B7LA 3RYFA 3RS4A 3GYGA 4OH7A 1BW9B 3PC8C 3KE9A 1E6LA 5C7OO 2VF7A 2ZRFA 1D4FA 3DLTA 1K8ZB 1JMVA 3I01A 4YI5A 1ZK2A 2V9CA 2CBZA 3MNFA 5NLLA 2GN2A 1H0HA 5EZ6B 3ZD7A 2HT1A 3SJLD 1J9EA 1GV1A 3N53A 5TJ9A 1FYVA 3JD3A 1KDRA 4MUBA 1F06A 3IAXA 4NC9A 5IEBA 1H3NA 5HKOA 3NUQA 1TO2E 1FLDA 2GM5A 2WV7A 2ZS7A 5F78A 1W6UA 3RIMA 4XQGA 3U4DA 1BCRA 4PY2A 3GZJA 4NF2A 2FW8A 3O8QB 2X1MA 3OLCX 2IZ1A 1ZOPA 5KWIA 1RRCA 1UL1X 1XQ6A 2LTAA 4UU7A 1WZNA 2AOTB 2X8JA 3NTRA 2XNJA 4OKNA 2Z2XA 2BFWA 3O5AA 1DOHA 1TD1A 4OQXA 1XN1A 4EB8A 4PN3A 5EWMA 2WAYA 4NENA 5JSKA 2YDXA 4URWR 1G7TA 3OOJA 4URXR 1IQ0A 1Z6XA 3WXMA 4ZTUB 1M2FA 4O59O 2OXEA 1JQJC 3DSRA 1WX1A 4WJKA 4O4LB 4KSCA 4B6SA 4DB2A 1E9SA 3RK1A 4B84A 2V7VA 5AVXA 4MS3A 1ZM9A 4JQYA 1ZLYA 4WH0A 4WRRA 4EF6A 2H68A 4KTTE 4L0CA 3T06B 3DO8A 2REOA 4C2BA 1T5SA 4BL5A 4Z7NB 3CONA 5FPKA 4O1HA 1GR0A 1HYGA 2IKQA 4JVLA 4RL6A 3GLKA 3GJTA 1PJQA 3DZCA 4MKXA 2QLTA 5L7YA 2QEQA 2ZPTX 3BFKA 4U7GA 5HYNB 3GP3A 3FUWA 1RSZA 2OUKA 4YUVA 4GMXA 2WJ4A 3VNRA 4DA9A 3KQUA 1K86A 4FUQA 2NYRA 3DXFA 4BQQA 5IM4A 4UNQA 1RM3A 3AJ8A 2IYRA 3IAS1 4MRRA 3U4MA 3IOCA 3ROFA 4HLCA 4B2LA 3URKA 2VNKA 1DWQA 3ONWA 1NUTA 2IYEA 4QSHA 1O6FA 1KH3A 1VDZA 2GN0A 5J2UB 4BX8A 5AW2A 4IQFA 2J3DA 4FNGA 3EXG2 5DK4A 2WKWA 1G2QA 1PGJA 3IUJA 1K63A 1WHSA 2P2ZA 3ABSB 2ACVA 4MW9A 1XP5A 1V39A 3D31A 4IUYA 5FTLA 4PXAA 2B9EA 2WJ6A 4DDVA 4GR9A 1NBAA 1VP3A 2F1IA 3OT1B 4CC9A 3NJ8A 3DOJA 3PI7A 4V3CA 3H2SA 2VT3A 3R4VA 5I9NA 3EDQA 3E9CA 3P4YA 1GUBA 4YACA 1C3EA 2H6EA 4L2IB 1PGOA 2EFDB 3QVXA 4JT8A 2W37A 5G0TA 1E89A 2ENWA 1SNYA 2J87A 3DVLA 3CCFA 1VQ1A 3HDVA 2C00A 5AK4A 1PE0A 2D06A 4ZV7A 1I4TD 2HRZA 2OMEA 4LJAA 1OY1A 2IOQA 4EFDA 5CFOA 2BR3A 1ZITA 5K05A 4CKWA 5FUQA 1ISGA 3PQ8A 2ZANA 4DG8A 5DHRA 1N1GA 2NV2B 3E53A 3OZFA 4CM6A 4CR8A 4POOA 1ECGA 4ZOLB 2OGZA 2XNSA 3P0HA 4ERNA 3KL2A 3U09A 1BPOA 4ZDWA 1ONNA 1KHHA 4GI1A 2R4UA 2RBKA 3B3JA 1MC8A 4NTZA 5ALYA 2VK1A 3FTCA 4PZAA 1H66A 1DEAA 4KR0A 5SZHB 3BDAA 4IIUA 2AEFA 5ESRA 1JDZA 1M34E 4C4XA 4DLKA 3BWMA 1MB9A 1GOTB 4K2AA 2JFHA 2ZYGA 4QXMA 4CG3A 4C87A 3H1PA 5ABPA 3HBAA 4TYNA 1WR8A 2H54A 1WETA 3A8TA 1SVLA 1CQWA 3BGWA 3M6MD 3PFFA 1EE2A 4LJRA 3LVBA 1G3UA 1G5RA 4WK2B 5HKAA 4PLGA 4GOOD 5A0VA 3A4MA 3F78A 4Z8LA 1NW4A 3L93A 1OBVA 2FN3A 5C5DA 4OWRA 2JFUA 1VHJA 3TSAA 5EHNA 3RIEA 2FVXA 4E12A 1XQXA 3E22A 2PZEA 1TJ4A 3QXXA 5HF6A 4HMPA 3UAVA 2DC1A 2DUMA 3LBFA 4BKRA 1VCIA 1D9XA 5ILQA 2OVFA 2R6GA 4MRMA 4XD7A 1XZQA 1RC8A 2AWNA 4LUCA 4B3TB 3PVUB 2WTEA 1S8OA 1AC5A 3ZE2A 4IICA 3Q3VA 3UXYA 2J9YB 2NW6A 4NJOA 2X5OA 1U1DA 4UHCA 2PMEA 1NG1A 1XMXA 2IHBA 3AT1A 3KOUA 4NZNA 1Z5NA 4BLQA 2B1IA 4QM7A 4KGVA 3EPKA 3LPAA 3HJCA 3GI1A 4GQ1A 1C0IA 2WJZB 1DKLA 2IYTA 3G0GA 4JSTA 2PS9A 4QLOA 2O59A 1MDFA 5GJWC 1JQBA 3B8HA 1DRVA 5IM4F 4RHFA 5CITA 4BJ5A 5AW6A 3UJ8A 1ISHA 5DSZA 1UOPA 2PLAA 4KYUA 3DE7X 4DR6B 1E3DA 2F9MA 2P1DA 1RQXA 3REQB 2QN2A 3N74A 2JAWA 3ZK8A 2HTEA 3M9LA 4QXOA 5HVNA 1T1RA 2P5TB 5EJMA 4F9EA 3K6SB 3ER8A 4Z8XA 4G4IA 1FEZA 2H11A 1JG7A 2I0FA 4MPJA 1U02A 2HIHA 4II7A 4CI0B 3EOZA 1TTHA 1EVYA 4ZVVA 4M1MA 4HB2A 4A0BA 3OURA 4BFSA 4AS2A 3NVQA 2HHLA 2X0NA 3LYAA 4KCGA 3WNVA 5A7HA 1PV1A 4EW3A 2X5NA 1NXXA 5KHOC 3CMCO 5JYBA 1PJAA 3GMIA 3WDSA 1XQ9A 4YJ3F 3W5JA 3ECCA 1E92A 3TE6A 2XQVA 3V7UA 1RXIA 4NV1A 1DOZA 3OG9A 3T95A 3T1OA 4CT4B 1KKLA 3SM9A 5BR1A 1JH8A 5G1OA 2J08A 1PQUA 3IUPA 4A36A 4IO0A 4UJ3A 3K27A 1DX9A 1F8UA 5IM5A 2MDTA 1ZRNA 3L6EA 3BD9A 1WCIB 1XI2A 3OC6A 1O0BA 2ZYTX 4YMSA 1UZNA 4ND4A 4WOBA 1L5SA 2YNPA 1G5IA 3QU2A 4GX1A 4OFXA 4U3JB 4RTPA 1P5ZB 2B78A 4LNHA 3TKLA 2HCRA 5HE3B 1XIPA 1ANKA 4HN4B 3MILA 3V4VB 3VV3A 5IFKA 1WB4A 3AI2A 3D7RA 1PZFA 3OCXA 5ICEA 3CVOA 1PD0A 1Q22A 1TIPA 3KJIA 4TTVA 1ZBDA 3KT6A 3OIWA 4ALMA 1BVRA 4RUKA 3KX2A 3UJ9A 5BMVB 2AJLI 1SUCA 2JLSA 2PZMA 2RHDA 2GZAA 1QKIA 1UK6A 2GPYA 4Z9XA 5ENVA 3L4JA 3RAFC 1H2ZA 2ACWA 1H85A 4W5JA 2F59A 4MW6A 2O3JA 1JAHA 3EAQA 1DG3A 3DOOA 2BELA 4KXXA 3PP8A 1PJ4A 4OBWA 3VR1A 1GRCA 3K1AB 3H9EO 3F71A 3MM4A 5BW4A 3UKRC 5HQJA 1JJVA 4J7UA 1EYZA 1Q1EA 3DFKA 4IW3B 1VHDA 3RSZA 2CUZA 3WYFA 3A1DA 2KYRA 3GLQA 3NIDB 2KM1A 4FW8A 4JLNA 5ARCA 2QX4A 1G7RA 5AI9A 4E5PA 5LQCA 2B0CA 5EVCA 4FYIA 1G17A 3IR5A 1ZHOA 2MSLA 2IIVA 2GXSA 4G0OA 4CQJA 1RZUA 1EQ2A 1O95A 3U4IA 2EP5A 5DWQA 4B74A 1PR3A 3FBGA 2QG4A 1E96A 3IGFA 4YTEA 2I91A 4QPJC 3HYCA 2V03A 4JLWA 3D7MA 1TQ2A 4XWYA 2Y05A 5FPYA 3GP8A 3HH8A 2WM9B 4DSAA 4C1NA 4I2NA 2AFVA 4OUDB 2QJWA 4CKCA 1G3IA 1U2SA 2NO4A 3ESXA 1Y1QA 3WLEA 3TTXA 4EKIA 1G63A 4AY3A 5DM70 3A7DA 3QOFA 5TPWB 2ZU0C 4INPA 1Q57A 5ALSA 4EFMA 4M8IA 2DQ4A 1JSZA 1X9IA 1ZO8A 2VYCA 3QE4A 3X1MA 4AUMA 2BHSA 2BPOA 4LMAA 2ENUA 1Y5LA 3VH0A 2PUVA 2JCXA 2FSIA 2PXAA 1BX1A 3NFYA 3GC6A 3LUJA 4PWYA 5K2MA 1N3LA 2E18A 1V3VA 3ITKA 1KC3A 4FS8A 2IZ7A 2NU6A 2WJHA 1VIYA 4JIGA 2V55B 2X5KO 4R6XA 1D03A 4WD3A 5FIUA 4YAEA 2ZUBA 4M9SA 5HTKA 3ZU4A 4QUDA 3MJDA 4QQRA 4L85A 5TQ2A 1SURA 3K20A 1GL9B 3D2CA 4EUKA 1O6GA 1UFVA 3M89A 4BRUA 3GYBA 4HB4A 3LI2A 4PNHA 3AINA 2J5XA 1YQXA 2PRKA 4KXYA 2FEPA 4A0QA 4DLWA 1THZA 1VL2A 1NMXA 1A9XA 2IH5A 3KZVA 3S2IA 3REOA 3CFSB 1EM6A 2D0IA 3KZXA 3SJBA 2MYUA 3W7AA 1USVA 4RZQA 6PFKA 5IUNC 3LT0A 3JAWB 4R01A 5I7EA 3ZE7A 1U1CA 3BZUA 3ASVA 4IWXA 2IHUA 2X40A 3HQ4O 4J0KA 5J2TB 4Q3NA 3QU9A 3AQ4A 2R751 5F12A 5HZHA 1QMGA 4GW3A 4QXAA 5K3OA 4PQRA 3D8SA 3GPCA 4WDRA 4D9BA 3HV2A 3UMMA 3C3EA 1MABA 2CMKA 1PF7E 2HPAA 1BMFD 1ESMA 4G9GA 4H35A 4PVCA 2DECA 2I7DA 4WWHA 5CW2A 3RAJA 1L5MA 5MN5A 2HDNB 1DO8A 3RF7A 5I9SA 4UATA 4JKOA 2AMFA 4Z86A 3GH1A 5EZQA 3IIYA 2H5JA 4MKGA 4ETNA 1DZIA 1VBMA 2QTFA 3HFJA 2PRYA 2P0YA 1IMJA 1VYTA 2ZSEA 4J0DA 3TO5A 1JIVA 5HFAA 2FGJA 3DBVO 1VDMA 1VCMA 1T3GA 1F17A 1UP4A 2WHPA 2Y27A 4WBNA 4GQAA 1JA9A 5ANRB 2P35A 1C4WA 5TT0A 4GKBA 1E3WA 3ZOZA 2Q0SA 4MUGA 1PWHA 3KPYA 2XYPA 1R50A 2IE8A 5FBVB 1W19A 1QRTA 3O1IC 3OI7A 4KDCA 4ZT3A 3EULA 2XUKA 4C0JA 1DAGA 4Q9KA 4R84A 1NAHA 3HR8A 3HGMA 3LWNA 3OCYA 2H3EA 4BO2A 1OWMA 5M5UA 3U6BA 1L7RA 1P73A 1R4NA 2P41A 4NU5A 4PYLA 4YVFA 4L9SA 1E4VA 1A98A 1YS2X 1XXHE 4RHXA 5FPTA 2XCRB 1MZVA 3OHSX 1QTQA 4QXPA 5MFPA 2DH5A 5EWMB 3RFCA 1C3VA 5HG0A 1XEAA 2IY8A 4URYR 4BCDA 3ND5A 3SZMA 1DE0A 4D3XA 4V03A 2D00A 3FCOA 1GQYA 3RVJA 4FOOA 1L2TA 2X8AA 2IUSA 5TV2A 3C4VA 2RBEA 5I3ZA 1X87A 3RAEC 3OZGA 4M6WA 3MJCA 2XADA 4P3NA 1X8JA 1VKRA 1IBMB 1JU3A 4MIKA 1NMQA 4RLSA 5JXGA 2XVYA 3C8UA 4XDZA 1TOAA 2HKIA 4CODB 2BEVA 3A1VA 3HSSA 4RVFA 2OK4A 4WX2B 5H83A 5KU7A 1TK9A 2GZHA 4LXXA 1PT8A 1WD7A 2QXTA 3TR0A 4A6XA 1V8ZA 5TEEA 3GRPA 3JASB 2Z2YA 2D3TA 2XMPA 3EW7A 4WSOA 3BSSA 4OXYA 1X7GA 2WFLB 3FCSB 4C7BA 2IY7A 3NDRA 1EWKA 1W2HA 2H0AA 3NI2A 3WGQA 5KWSA 4NABA 3JPWA 5JAQA 2HLDD 3E15A 4G5OA 3TAUA 3C6KA 1K5GA 2CLLB 2WYOA 4HFNA 4IVQA 2GI4A 1J8MF 2R96A 3JWGA 2GPWA 3M3HA 4GRAA 3ADKA 4HZGA 4UULA 3TSZA 5DFAA 3AM5A 3QE2A 3KJQA 3UWKA 3BQNB 1SKYB 3B53X 3OZIA 3A4LA 2W2NA 5IN5A 3LUKA 3RWOA 3DHYA 1TO1E 2F3TA 1H0KA 3TIFA 2D7DA 4LRSB 3AR8A 2VHUA 4EL0A 3WAGA 2L2QA 3QNMA 3RS0A 2WMNB 2I6QA 2CK3A 2IP1A 2Q1TA 3KDPA 3FYHA 3SE7A 2GUWA 3WGTA 5BURA 1OLUB 3R3WA 2XKJE 2VYFA 3EG9B 1Z26A 4FIDA 1U0NA 3GFCA 1NLMA 1MVOA 1KZ7B 2OQ2A 3K9GA 2G07A 3KZNA 4K26A 4WL0A 5FR1A 4BLSA 4FGZA 2WV9A 4IDFA 5JAPA 4PNKB 2PFKA 5NULA 1XRNA 4ZYXA 3O8QA 4KQMA 2XYHA 4UBLA 2G9NA 4K6GA 1HQDA 4EA8A 4Y2QA 1MAVA 2FN7A 4JBIA 2P6RA 1E59A 1P9OA 1UJCA 1THGA 1U8UA 1DOAA 5GV8A 3JQ9C 1RQNA 3NV9A 4BE7B 5JG7A 1R6TA 2W2LA 4C1BA 4M1EA 3KSRA 1KVQA 1RABA 4FGWA 4M53A 1J97A 4DQDA 2CFOA 2O07A 3JVIA 3CM0A 3E2IA 4F9FA 5LP6B 3EA5A 3UFBA 4CG1A 3QV1A 4CG0A 2HWUA 4HT3B 2HIMA 3OQ6A 1NYLA 3EGXB 2I9KA 4NAAA 2VP3A 3Q2IA 4G56A 1WMAA 4ZYYA 5JMOA 2C9BA 3FFAA 3GWGA 5BT9A 1G38A 4L0MA 1ORTA 1T25A 2P79A 3MCVA 1KJJA 5BN4B 1K0UA 4UMEA 5AKZA 1VIVA 1U2VC 4IS3A 4MH0R 1XYGA 4GQBA 2I54A 4LRUA 3BRQA 2AG5A 2YJ5A 3UPTA 1NVUQ 2Z1DA 3O8OB 2OVPB 4PAOA 3DTVD 1UBGA 4WCFA 1AN0A 1P81A 1YQTA 1U5CA 3NBKA 1AB5A 3PX2A 5T4HA 2EL9A 1O1YA 5DHAA 1TU4A 3B12A 5CH5A 2J0QA 5EPOA 3G88A 2NVUA 4MVJG 1F51E 2Q49A 3O4FA 1CVIA 3UENA 3HKBB 1Y7TA 2JGEA 3O4VA 1YJ8A 2D1QA 4MKHA 3X1DA 2WYUA 3V8QA 4MIEA 3FVWA 3KXPA 4BN0A 1FMFA 3B89A 2QRVB 3FMIA 1JEQB 2VYVA 5AKXA 1VMIA 2R86A 3W5HA 3KQHA 4TKMA 3EHEA 4RA9B 4V24A 3CFYA 5U9CA 3PXDA 1FTQA 3FWHA 2GM3A 3E9QA 1N7HA 1QOPB 4TMYA 3OLYA 3UY4A 5I4CA 2FDXA 4E54A 2J48A 2O2XA 2TMYA 3G02A 4GAEA 1P9NA 3QF7A 1SG9A 5TGDA 3IRVA 3WGNA 2PUDA 1FSZA 1CS4C 2B35A 1LS1A 1V11A 2O1EA 3H9CA 4JBHA 2DB3A 1CUVA 1O77A 2PUBA 4Z0TA 3PTZA 1G59A 2JS7A 4A08B 3IJRA 4P3XA 3WKDA 3DVAA 3SC6A 2Y1WA 3UWPA 4JC0A 1FOEB 5BW6B 2F9LA 2IOHA 4RJ2A 5L6MB 5E0KB 1CRLA 1LDBA 4E5VA 1NNLA 1W1IA 3I8XA 4I9FA 4BV3A 5DGTA 4W8GA 1CDEA 1G1MA 2BF4A 3AUXA 5CJJA 3IDOA 4EI7A 3A04A 5DGXA 3GNTA 3T3EA 2AMVA 5B57C 2A1UA 1NM5A 5KOYA 1HX7A 3PFIA 1RBQA 4Z0NA 4YV0A 1AQLA 3M8KA 4OYYA 1V3QE 5GJVC 4LXGA 4Z7JA 1E1YA 1GCGA 4NC4A 4MR8B 4PZCA 2PMWB 4YXWD 2W43A 4ANFA 4WE3A 5ELMA 2VDLB 5EWJA 2B8EA 1RMQA 2WAOA 1AKNA 3EEQA 3MMPA 1B3BA 1O9GA 1J4AA 5EY5B 4NZMA 2G63A 5CLGA 1Z82A 4H6XA 1TBGA 2ZVPX 3CTMA 4YCLA 4ILKA 4Z2AA 4YRIA 1Z33A 1GN8A 3GQVA 3OF2A 4GUAA 1MQ9A 3ZWBA 2I34A 3M49A 4R41A 3PX3A 3QVGA 4RJIA 2DWQA 5GZ6A 3I2IA 4MW5A 1GT6A 4RZSA 1FW6A 1NL3A 3S7TA 1DX4A 5E6RA 3PRYA 4FU0A 3WYBA 4RV9A 3K4HA 3MAJA 5ITZB 4D9FA 1TECE 1TT5A 2H9AA 4ZVMA 4BP8A 2SBTA 3OIDA 1PTJA 3IKJA 1GL6A 1F8GA 3SIXA 3NTQA 2AEMA 2WIJA 4UUQA 2CKDA 5AQEA 4A6PA 3R7AA 4BO8A 2L0XA 4MTCA 2IU0A 5DYTA 1Z36A 3OC0A 1W0KA 3IEXA 3QKRB 5KB3A 4X97A 1I7SB 1BE8A 1H8HA 3PFNA 3O4JA 1WVMA 2ZJ7A 5EJGA 3H4IA 4BTLA 1YASA 3C85A 4G8JA 5DBIA 5EIBC 4LK2A 4ZVLA 5JCJA 2JGMA 5KPJA 2FRDA 4C9BA 1YI1A 1Z3CA 2Y9MB 4M0LA 3G2MA 4RMIA 3SDBA 1A77A 3SM3A 2H9YA 4M0CA 3KOZA 5HDBA 1VLZA 4EY8A 1CG6A 1WPGA 3VSAA 3WLSA 1ND5A 4WZ6A 4EHBA 5HJEA 2JLZA 1W52X 3AUYA 1SC6A 5K3FB 1CHNA 4LOHA 1BO6A 4IMRA 3RS5A 2Q6TA 2F43B 5FFOA 2PS0A 2A3RA 1AOXA 2GSDA 3IEMA 4JGIA 4OP2A 1J21A 1TZJA 1W85B 2X9VA 2NNLD 2CDBA 1KI1A 5BWBA 2PX0A 1ZISA 3BQ9A 4OI0A 1J5XA 2WK1A 1STOA 1X14A 3A4VA 3CSSA 3GJZA 4CMEC 2ILTA 4QM6A 4COKA 2JAPA 3O75A 2JBAA 1O5TA 1MX9A 1G20E 2ZATA 4MWCA 3RTAA 3TEMA 3CGGA 3IQEA 5CYGA 1KFEB 1T5DX 2Q0QA 3AFIA 3FAZA 5AUOB 4HFJA 1QNLA 4AWAA 1YUMA 4B6GA 1QS0A 1L5KA 4S0ZA 3DTNA 1R9NA 2P6NA 1Z08A 5GV7A 3F6EX 2JHCA 1KH2A 1QG6A 2IHJA 3FCXA 2WUDA 3HJUA 3P1JA 4GBJA 4KHPB 2XEXA 1L8AA 2FRVA 1E2JA 1SHKA 4OX9Y 2F8SA 1R8XA 1Y5NA 1PJLA 2NIPA 2VHEA 2W8ZA 2CFTA 1JR3D 1OYYA 1N0WA 4KBYA 1NWHA 2AOWA 5ALEA 3RRBA 5JQWA 2ON6A 1E2GA 5JEDA 4MARA 3WGYA 2H7XA 4A15A 1LZLA 4F96A 3EI1B 4M36A 1OLZA 1V6SA 2OOKA 5ALIA 4F8JA 2WF5A 1TLLA 1UM9A 1LSOA 1ZHFA 3G8AA 1MJNA 3IE2A 4GC9A 5D51S 4B6EA 1T9KA 1ZVMA 3KAPA 1SQSA 5K0TA 1IPHA 2HI0A 2VDQA 3OESA 1VSUA 4KJZA 3RBXA 2ZOSA 1QVAA 3C3YA 2OYCA 2GD0A 3ZCUA 3EK2A 3MBKA 1SXJE 2QX6A 5FI5A 3U7QA 4DMUB 4LHVA 3R3UA