3IURA

Appep_d266nx+h2h3 opened state
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
684
structure length
668
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHNDRVVPAHSFKFAATLQADNAGPHPQLIRIETPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl Endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 211
structure length 668
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iurA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iurA01
2H7CA 4CG2A 1QLWA 4N5IX 1J1IA 5C7YA 1UK7A 2I3DA 1IUNA 4BDSA 1G66A 1K8QA 4G4IA 1HPLA 5JANA 1IZ8A 4JH0A 2PVSA 3C5VA 3W2TA 3D4LA 1AURA 3LS2A 1U4NA 1W76A 2JF0A 4L72A 4PV7A 3ANTA 1UOOA 1SCIA 1CLEA 3FLAA 2DQZA 4QLOA 4BCBA 3R3YA 2OCGA 3O9MA 4WFJA 5FP0A 4GLBA 5C81A 2CBGA 4Y2QA 4RE5A 4UBOA 2AJBA 3FNBA 1XRMA 4UHFA 3TGLA 3M81A 4PF1A 2XMRA 5ALSA 3TJMA 3RM3A 4JYMA 3I2HA 2GZSA 2RONA 5AP9A 2WUEA 3FWHA 4A5SA 4BBZA 2QKYA 2OQIA 1P0QA 4UHBA 3W05A 5BOVA 1DQYA 1HQDA 4Q3KA 1X2BA 3DLTA 5AI0A 4U2GA 1QIEA 1GZ7A 3QMVA 2C58A 1XQXA 2H7YA 1B41A 3HXKA 1GKLA 2VSQA 4YK7A 1DINA 3H19A 5HKAA 1Q0RA 5ALIA 3U0VA 1CUCA 3B12A 4BC1A 2XMSA 1HDEA 4BTVA 5ALXA 2H7XA 5K5EA 1EA5A 4QWMA 1BU8A 1VLQA 1XZBA 2AJCA 3FSGA 5CT4A 3WWPA 1GQRA 3ICWA 1CUIA 3VDXA 3VVLA 3WIOA 1VXOA 1ZOIA 1W4LA 4OD0A 5I9IA 5CH8A 5AKEA 2HU7A 1QIDA 1MX1A 5JAOA 4H0CA 3AIMA 5BWCA 1WPRA 1WB4A 5AI4A 5JAPA 3RKSA 4F60A 4B7ZA 4QDTA 2Z8XA 2OGZA 1YSCA 5AKKA 2R8BA 3K2IA 4ZV7A 4DMFA 1DWOA 3WK4A 3D2AA 5SYNA 2XUAA 1GXSA 2Y2UA 3O95A 2RHWA 1H2WA 2BGRA 3I6ZA 4LHEA 5D3ZA 4AO8A 2Y6UA 4U2FA 2BFNA 4KE8A 1XZCA 2V98A 1DT5A 3RK4A 5CT6A 3WZLA 4AB1A 1CFJA 1CUEA 3DOIA 2AJDA 5AKZA 4C89A 3U1TA 4J7AA 2HA5A 3WJ1A 4IH9A 1F8UA 1XKTA 3IBTA 4Y2XA 2XUFA 1KU6A 1QTRA 2B4KA 1DX6A 2VATA 3MGAA 1SC9A 1G4HA 5A71A 5KBYA 3PFBA 2QRUA 1TAHA 2I78A 4Q05A 3SC2A 1QONA 4M0FA 4X71A 2C0PA 4FLEA 3GROA 3HC7A 4Q34A 5CH5A 1CR6A 3NWOA 1MX5A 2WHPB 3BIWA 1YS2X 2RIPA 4HAIA 2QXUA 4OU4A 1LBSA 1CUGA 2VQ6A 1LZLA 3STVA 4A23A 4U2DA 4JNCA 4G9EA 2G5PA 2GBIA 2PM8A 2QJRA 2Q0XA 3WK6A 2DFPA 1LPNA 3DJYA 3G0DA 4LYEA 1QIIA 3BDVA 1LPMA 1WM1A 1PJAA 5AKYA 1R50A 4DTCA 1THTA 4UHHA 3Q8WA 4W63A 5DNUA 4HRXA 4CG3A 3H18A 1ORWA 4NMWA 3EQ7A 1CUDA 5A7GA 1EX9A 4B9EA 4XIIA 5A7FA 1XZGA 4F21A 3HJUA 1U2EA 2H9YA 1XQVA 1VKHA 3E0XA 4DLNA 1AQLA 4ARBA 5FKJA 5JZSA 2XUQA 4XWGA 2XMDA 1Q83A 1YCDA 2VAXA 2HL6A 3WK7A 3I2IA 4AZ0A 1L7RA 4Q1VA 4PSCA 4K5QA 3PFCA 5ISMA 4WY8A 1K6EA 3WL7A 4TGLA 2ZYSA 4N5HX 3C6ZA 1JJFA 4WJLA 1ZGBA 4M0EA 3BDIA 3F98A 5AOBA 2Z8ZA 1MPXA 3FBWA 3BL8A 2WHPA 4FBLA 4PO3X 1EVEA 1DQZA 5FPPA 3ZI7A 5EHQA 2Z5GA 3AJAA 4Q82A 3HSSA 4J03A 2Z3WA 1XFDA 2OCKA 2OAGA 1VE7A 3WL6A 2YYSA 4C01A 4IO0A 4L9AA 3QZUA 3V1KA 2IIVA 1ZI8A 5FPQA 4E14A 3S8YA 4HRYA 2V97A 2CMFA 1MJ5A 1XRQA 4G8CA 5K3AA 4KAFA 2PL5A 5CW2A 5LIPA 1R3DA 3S2ZA 2AJ8A 3NGMA 1XKLA 4B82A 1CVLA 3M82A 4RGYA 4Y2JA 5HF5A 1CUUA 4AX4A 5AK3A 3FAKA 4FNGA 3NUZA 3N0TA 5DNVA 1LNSA 1XZAA 4UBJA 2QXTA 4B9AA 2XMZA 1CUXA 5K3CA 4G1FA 2PKYX 3STXA 3QITA 1QIHA 5LZ5A 3H2KA 3TRDA 4B80A 2PUJA 2FX5A 3G9ZA 2HRQA 3HEAA 5HFAA 2HIHA 2GYWA 5ALKA 1HL7A 1EI9A 4N8DA 2XUKA 1C7JA 2OAEA 5AKHA 5HCUA 4W9RA 2HA3A 4AQDA 1T2NA 4ITVA 1AC5A 3LCRA 4QWWA 1YAHA 3JYHA 3UUEA 1CQZA 4BZWA 4B0OA 3H2HA 3ZV7A 4D9JA 4KE7A 2W6CX 4G9GA 1ZIYA 1ZI9A 3TEJA 4CCYB 3AUKA 4X7BA 3WWOA 3DDUA 4C4XA 5AI9A 5ALGA 1TCCA 3AZQA 4QA9A 5CMLA 3KXPA 3F96A 3R3UA 4O08A 4AO6A 1RYYA 4BVJA 1IUOA 2WTMA 4MQMA 1FFAA 1CUJA 5CTAA 5KWJA 4BE4A 4HXGA 5CRIA 2PPLA 2JGIA 4W1QA 4C88A 1YASA 1HLGA 4KJXA 1QIKA 1I6WA 2CB9A 2XMQA 4OYYA 2WM2A 4CFSA 1MTZA 3IUNA 2FJPA 3WQHA 1MNQA 1UK6A 3AZPA 5HFNA 1BE0A 5AKXA 1EVQA 3GFFA 2YXPX 3V48A 4FHZA 4P08A 3CCBA 3WK9A 5FDFA 4LXGA 2QOEA 4X90A 2QM0A 3D59A 4XVCA 5C8VA 3T4UA 4DMCA 1XLUA 3EBLA 1CUWA 1ZJ5A 4IH4A 4G5XA 3AIKA 3A70A 4LXHA 3AFIA 3WYDA 2O2IA 2CEKA 3C6XA 5FLKA 5LZ9A 3PF8A 3D2BA 5HK9A 3ZWQA 3KWJA 2BJHA 5ALTA 5JASA 4NVRA 3G7NA 4UHCA 1XZKA 2GYUA 2BKLA 4J0JA 2H1IA 4UFNA 1ODTC 5ALDA 1UOPA 3H2JA 3WWCA 1AZWA 4JYPA 2D5LA 4Q3LA 2DSNA 4EHBA 3I1YA 3WMRA 2OGSA 4H77A 3OOSA 1VXRA 5ALOA 4QZVA 4GEGA 1CRLA 2Z3ZA 1H23A 4ZV9A 3K6KA 5JAUA 3A2NA 3F67A 3F9CA 1OXMA 2YH2A 5AI5A 5ALVA 3DEAA 1CUYA 3A6ZA 1TRHA 4MYSA 4PNZA 5LKRA 1QTIA 1VZ3A 2GYVA 1GPLA 1Y7HA 5AKJA 1TK3A 1TCAA 4KACA 1X70A 2WUDA 1FFBA 2HRRA 1E8DA 1YS1X 4LYDA 2XB6A 1EB8A 3LIIA 2OCIA 4WY5A 4OB7A 6YASA 1VOTA 2Y2VA 4FBMA 4KR0A 5EHZA 3L1JA 2BAGA 4HXEB 2QZPA 5DJ5A 1YR2A 3R0VA 1XRLA 3ESDA 1R9MA 1EH5A 3IA2A 2XUIA 3ESAA 2XQFA 5IVDA 3I1IA 1GKKA 5FRDA 3H2GA 5FV4A 1QIMA 3QBJA 3G9TA 4GHWA 3CN7A 4OUKX 5AIBA 4BAUA 3WKBA 2B9VA 4Y2TA 4PSDA 3JW8A 1QIGA 1AGYA 4GWLA 3ZLTA 4Y2SA 1SOMA 2QUBA 5IH7A 5T4HA 3FCYA 2GBFA 1N5RA 4AMYA 5AJHA 1U65A 3IUMA 4QLAA 1PFQA 1P0MA 4ZI5A 2C5GA 2J4CA 5CXUA 2WIKA 3H1AA 2V96A 4I19A 5HF6A 1Y7IA 4C4ZA 2OG1A 1QE3A 4EZIA 2QT9A 2OXEA 4IH1A 1LPBB 2DQYA 1AX9A 3ZLVA 1WHSA 1YB6A 3WKEA 1EDDA 3FVRA 5HZGA 4HS9A 4DM7A 1QGED 2VT7A 1EK2A 3GUUA 4CG1A 5HQ3A 1BROA 4I3FA 3G9XA 3WKDA 3MVEA 1ACJA 5D3KA 3C87A 3GA7A 2ZJFA 3EQ9A 4FFVA 5E2IA 4BB0A 1MO2A 3L1IA 4OYLA 5LZ4A 2WFLA 3V1LA 1YA8A 5JZBA 4FNMA 5LYYA 5JZ9A 2XLBA 3BXPA 4BZZA 2ZJ7A 1NU6A 5T4FA 5A2GA 3VISA 1TKRA 5D6OA 4WCVA 1CEXA 2JGEA 1JT2A 4HTAA 4N8SA 4KYVA 3VKFA 2QTBA 4DNOA 1F0NA 2ORYA 1C4XA 3ANSA 4B85A 2DHCA 3BJMA 4MYDA 4DNPA 4UBIA 1MT3A 1IMJA 2IITA 2PSHA 4EY8A 4B81A 3GZJA 5JYCA 2GZRA 3PF9A 5LZ2A 2P8SA 5EIHA 4A16A 5CH3A 4MEBA 3MUOA 4Y2VA 1XRPA 1WPXA 1P0PA 3MUNA 2C7BA 3H17A 1PV1A 4X00A 5ALWA 4CI9A 3EIOA 4DGQA 5T4BA 4GDMA 2JBWA 3WI7A 2WIJA 2O2GA 3B5EA 3OC0A 1JKMA 3ESCA 4N8EA 2VEOA 5AKIA 4PW0A 5ALZA 4HXFB 1CUHA 1MN6A 1M33A 3WK8A 1ODCA 2EDAA 4FMPA 1WCYA 5HF8A 3OTQA 5CXXA 3F97A 1G42A 4KAAA 2PSJA 3WYNA 2BUAA 4FOLA 3DD5A 5K3EA 2ECFA 1QO9A 2XUPA 3FVTA 4U2EA 5LKAA 3FSGD 5ALPA 2WFMA 1JMYA 4BRSA 3C70A 5LZ7A 3EF3A 5H3HA 4EUSA 3IUQA 1S8OA 4W1SA 2QR5A 4X92A 4X6XA 2J3DA 2AXEA 5DNWA 3X3HA 5LLSA 1JI3A 5CT5A 4DNFA 2VAVA 3IB3A 1QIFA 4J0GA 3H04A 1ORVA 2JGKA 1UOQA 1YA4A 3G0CA 2PBLA 4F0JA 5EI5A 1ZJ4A 1EINA 1UK9A 1U8EA 2X8BA 2PU7A 4X94A 4RNCA 5ALHA 2VJAA 2WIGA 3H2IA 4FDMA 3C43A 5ALQA 1L7QA 1QIJA 3KDAA 5CBKA 2XUDA 5ALEA 1UKAA 4FKBA 1JFRA 4X91A 2X5XA 2PSDA 5E4YA 2HDWA 3NOXA 1O6FA 2AJLI 2G5TA 1ISPA 2XI4A 3HABA 5DYTA 2VJBA 5AH0A 3IDAA 5CT9A 2E3JA 2VT6A 4BYMA 4EY5A 5HKBA 4FWBA 3O9VA 4GBGA 4LXIA 1A88A 2HA0A 4OCZA 2XQJA 2BCEA 3RARA 5IVHA 1E3QA 3G02A 1ZICA 5C8ZA 3QM1A 2OGTA 3WIBA 2LIPA 1W6RA 5LZ8A 3I28A 5AM2A 4W1RA 2XMCA 3T52A 1SFRA 2ZSHA 4YX9A 5AO9A 4UHDA 5A62A 1JMKC 2WHRA 4QDXA 2UZ0A 4X6YA 1BCRA 5EIAA 4ZREA 2ZYHA 4C4YA 3DQZA 4FFWA 5YASA 2WJ6A 4ZXFA 4AN1A 5HF9A 2YASA 4LIPD 4BP8A 2DHDA 1DU4A 4UBMA 2CKMA 4G4JA 5DTJA 1KEZA 1F0PA 1UT6A 1GPNA 4J0IA 1XZFA 4K6HA 4FLFA 5JD4A 1ZGCA 3STYA 3F8SA 2XQIA 2CZQA 1N8SA 2DCMA 3STUA 4Y9SA 3R41A 1CUAA 5EFZA 2WIDA 5DLPA 2WQZA 3EQ8A 3OG9A 2EDCA 4EA6A 3R3VA 2CJPA 3DS8A 5DWDA 5EHNA 2Y1KA 3FLBA 4Y7DA 2OPHA 1J07A 3OM8A 4FLMA 3WA6A 3PI6A 1BN7A 5JD6A 4BVKA 1ETHA 1W75A 4B0PA 3C45A 5FOQA 4BDTA 4EB0A 1SCQA 3D3NA 1BN6A 4EBBA 3IUJA 1QJ4A 4WFIA 5I8PA 1MNAA 3C6YA 5JIBA 4X93A 4PSUA 1UZAA 2DHEA 3BJRA 4MQLA 1LPOA 1VA5A 1XLWA 2QJWA 3H1BA 1X2EA 3IULA 1GT6A 4DMKA 2XE4A 3QPAA 4P93A 5ALUA 2C4HA 2O7VA 1WOMA 1CIJA 2V9ZA 1CUVA 4OU5A 1BEEA 1R4ZA 3FCXA 3DL7A 3E1GA 2VTVA 3ICVA 3DYVA 3PE6A 3QMMA 4H7DA 4MEAA 4G8DA 5ALJA 1J2EA 2XUJA 3R3XA 3C5WP 4BP9A 3AILA 3M83A 3SWWA 1XRNA 3KWFA 3WWEA 1JU4A 5EGNA 1L7AA 4RE6A 1QO7A 3R3WA 5AK5A 5KWIA 4OB6A 4BE9A 4KAJA 5E4TA 1AMNA 3I6YA 4U2CA 2VJCA 3O4HA 4UUQA 3DCNA 2CUTA 4KE6A 4TVKA 4Y2YA 2R11A 1UKCA 4NZZA 2C0QA 2GBCA 3QYJA 4UBKA 3HI4A 1ZIXA 1VA4A 3CCCA 4K6KA 5F4ZA 3G0IA 1H2ZA 4W1PA 2WHQA 4YASA 4BTLA 1FFDA 4X6UA 5AIAA 5K3FB 3STWA 4AXBA 3AZOA 4E15A 4H7HA 1ODSA 2WTNA 3KOOA 2JGLA 1CV2A 4G4GA 5AKLA 5HQ3B 1ACLA 1R9NA 2GBGA 3E3AA 3I2GA 3HRHA 4CIBA 4GECA 2HA4A 2WKWA 4G8BA 1TCBA 2G63A 3ZPXA 1IVYA 3A2MA 5JALA 1DWPA 3A2LA 4XX1A 4FTWA 3VXKA 5T4EA 1JU3A 4Y2RA 1RP1A 2WFLB 1D07A 3BWXA 1A8SA 1LZKA 1G5FA 4QDUA 2HADA 1JJIA 2O7RA 5AI8A 3M3DA 3I2FA 3I6MA 3W06A 1LPAB 1A7UA 1CQWA 4U2BA 3W9BA 2WUFA 5ESRA 1ZI6A 4EY4A 5IVKA 2B61A 2ACKA 2BGNA 4UHEA 4K6GA 4ETWA 1EHYA 1H22A 1P0IA 1H2XA 4F5ZA 1RWQA 2FJ0A 2HM7A 2WU4A 2PU5A 3R3ZA 4KE9A 1E5TA 1N1MA 5JARA 1UWCA 1DT3A 1Z68A 5AKGA 1JJBA 2WIFA 5K3FA 4YPVA 2ACEA 5JADA 2XUOA 3DKKA 3YASA 2X76A 4BAGA 1LBTA 3V1MA 1MU0A 2VF2A 4P92A 3WWDA 1TIBA 1DTEA 1K4YA 4Y2UA 1XQWA 3BIXA 3KSRA 3AIOA 5JAHA 3P2MA 1CUBA 2HA2A 1IZ7A 1CUFA 1EK1A 3DL4A 2WFZA 4KRYA 2QMQA 5ALMA 2PSEA 4WDQA 1UKBA 4TPKA 3D7RA 3DKRA 3ED1A 3C8HA 2HU8A 4NS4A 2JIDA 1AKNA 1Y37A 1T4MA 1KU0A 1FJ2A 3C8DA 4J3JA 5IVIA 4GW3A 2OLEA 2HFJA 5ALYA 1BEZA 3FYTA 5ALFA 1XZLA 3AINA 1K63A 1E8MA 2VA9A 3W04A 2XUGA 4X95A 4CIAA 3N2ZB 1XZDA 2JGMA 2WJ4A 1WHTA 1ZD4A 2ES4A 4J0KA 4MWSA 2WG0A 1CUSA 3G0BA 3O4GA 3IVMA 1K5PA 3E4DA 5EIEA 1DWQA 1HBJA 2PSFA 3PDCA 1QFSA 3H0CA 4Y2PA 2XMBA 2W22A 1EXWA 4BCCA 3K9BA 5AOCA 1YB7A 2FUKA 3LP5A 4DMHA 1R88A 4H7IA 3WZMA 1GPKA 1ZD5A 4H7FA 1EDEA 4OB8A 2C5FA 2WILA 2VJDA 4MJ3A 5J3JA 4J0DA 2WU3A 2XQKA 1Q0ZA 5IKXA 1LLFA 3ILSA 2PX6A 1GGVA 4Z49A 1THGA 5ALLA 5BV7A 3I2JA 3FYUC 5AM4A 4X3CA 1A8UA 1FFCA 1XROA 1BCSA 2XDWA 3UMJA 1XZEA 1O6GA 4LKOA 4PQEA 4BC0A 1BRTA 5AI6A 3G8YA 1GQSA 4J0CA 4ZWNA 4BVLA 2D0DA 3O4IA 4C6HA 3DNMA 1R1DA 4KRXA 5K3BA 4CCWA 2WLSA 3V9AA 3D5EA 1NX9A 1AUOA 3PICA 3PUHA 4MWTA 5HK8A 1B6GA 1VJ5A 4AMZA 4M0MA 5DYYA 5DTIA 3CXUA 4BATA 3WKAA 2Y6VA 3KD2A 5I7UA 1XRRA 4ROTA 3WKCA 4EY6A 3BF8A 3R40A 3CN9A 3D2CA 1IUPA 5JATA 1VZ2A 3O0DA 4ZGBA 2PUHA 4INZA 3WK5A 3OURA 1A8QA 4S0XA 5AM0A 2ZSIA 3FYUB 1E66A 3G0GA 3FOBA 5A6VA 4AO7A 1LGYA 2RHTA 5ALNA 3W9UA 3QPCA 4L3WA 1DX4A 2ROQA 1FFEA 3L1HA 1E8NA 1MAAA 3WLAA 4H7EA 2XMGA 2QVBA 1OILA 1ZD3A 1YAJA 4B6GA 4X85A 3QH4A 2ZVDA 4QEKA 4QDOA 3IURA 4QE3A 4XJVA 1EDBA 4OPMA 4DSZA 3GELA 4QNNA 1C7IA 1MX9A 4IHAA 4H7JA 3WA7A 4JEIA 4HZGA 5JD5A 3WL5A 3QVMA 4H35A 2WUGA 2XQGA 1EB9A 2XUHA 3VJKA 2ZJ6A 2WSLA 2DR0A 2BUCA 4DNQA 2RAUA 4WFKA 3PUIA 2WG2A 1XZJA 2J3QA 5AOAA 2XLCA 1UK8A 1QFMA 1J06A 4DSAA 2JGJA 2K2QB 4C87A 5EHXA 1BS9A 3HLKA 2EEPA 5AK6A 4RPCA 4HVTA 4UFOA 3RLIA 4QDZA 5FXMA 2O2HA 1TQHA 3ZLUA 1LPPA 1HKHA 4OSEA 3B3QA 4DIUA 5AM1A 1N5MA 4E11A 1Q84A 2QUAA 3FYUA 2G4LA 3QMWA 3VJMA 3DYIA 2OCLA 4MXDA 3D0KA 4E46A 3VVMA 3FLEA 2HA7A 4H7KA 4K2AA 4I4CA 3V1NA 3UUFA 5D7BA 4B84A 1F6WA 2BUBA 5ALRA 4ZRDA 3HZOA 3QPDA 2J4FA 2ONCA 1WB6A 3HACA 7YASA 5C8XA 1W52X 4Q3OA 1FSSA 1W1IA 2HA6A 5DYWA 3G9UA 2HHAA 4IQ4A 4JUIA 5SYMA 5A7HA 4AZ3A 3WJ2A 2ZYIA 5BWBA 4H18A 4KEAA 1OCEA 1XZHA 1CPYA 1XLVA 5AICA 5KREA 2ZYRA 2I03A 5AK4A 1UFOA 2JEZA 4DYHA 3OPMA 1UXOA 1USWA 3WL8A 3I2KA 1XZIA 2HU5A 2XT0A 3SX4A 4BAZA 3C6BA 1QOZA 5FUMA 4EY7A 3STTA 1VE6A 2RI6A 3HYSA 2OQVA 3VJLA 3Q0TA 4L0CA 4GI1A 1E89A 2I3ZA 3O4JA 4B83A 4BRZA 1WB5A 1LPSA 4ARAA 3SK0A 2WG1A 5K3DA 2IX9A 5CT8A 3LIPA 4J0HA 3DOHA 4AN0A 2WJ3A 1ZD2P 2RGUA 1SCKA 4X97A 2QS9A 2JEYA 5LP1A 1XZMA 5CURA 5AHXA 2B20A 3IIIA 4BCDA 1CUZA 2HFKA 4P9NA 4GXNA 2JGFA 1XQYA 3ESBA 3BF7A 1QZ3A 3GBSA 4CCYA 4UBNA 4WDRA 2NW6A 3JWEA 4V2IA 1MAHA 5AM3A 4UFPA 4UBLA 1H2YA 3LLCA 5AM5A 1NU8A 3BE8A 4UPDA 5E4JA
chains in the Genus database with same CATH superfamily
2LIVA 4BBJA 5J47A 1EX1A 4N5IX 4PYMA 3A9UA 1VCHA 3O47A 2HF7A 3MRSA 1DC4A 2A9VA 1FQWA 4Z9BA 1L5FA 4II3A 3P2JA 2BDTA 3BB3A 5FTWA 3CWZA 4ZZ0A 4C30A 1PJ3A 1YMVA 2P40A 4G81A 1XIPA 1Z8FA 2QWXA 4NYIR 3WXBA 1OIWA 5LP6C 2WMYA 1I2MB 4IYJA 5EY5B 4MQEA 1GPH1 1MVOA 2AHOA 1RRFA 5DBHX 3FKJA 4MUYA 2O8EB 3AKEA 2IEZA 4HFNA 4UHBA 4URWR 4ZQFA 3ETEA 4Q3KA 3T3PB 5GJCA 1OXUA 3FXAA 3DLTA 4JOBA 4DLPA 3LP6A 2YW9A 1HEIA 4MHTA 4G26A 1HTTA 4ZOEA 1TM7E 1Y7TA 1G20E 4Q3NA 4F9FA 1LI4A 1JLLA 9ATCA 1MQ9A 3WP0A 1ZCBA 3RVNA 1W5TA 2GFQA 3KFLA 3I7KA 2FWPA 1NVVR 3R9IA 2ZB2A 4LSWA 4R9RA 1XZBA 3LY8A 1GQRA 4U02A 3AU8A 4HB4A 4Z53A 2B1JA 1G8GA 1Q19A 3K5IA 3GLTA 2FSIA 3HO6A 4RL4A 5B4WA 3GJ6A 4LWZA 5BNWA 1E1RA 3KXLA 4J73A 3TJZA 2CBZA 4ZCLA 3RKSA 2PBZA 3AV3A 4CQLB 2OGZA 4A6EA 3L7YA 4A2QA 2J9ZB 5J4VA 3K2IA 5TQ0B 2FV8A 4TSFD 4J82A 2XUAA 5T8KC 1VP9A 2FN7A 5KEIA 1KY5A 1L5HB 2BM9A 2YIMA 3ZGLA 1NVKA 3C8UA 5EJGA 4AB1A 2HWUA 2VBGA 3W6OA 3PHLA 2J5RA 1QMPA 1WZUA 4HNAB 3TG2A 3NBQA 3QTTA 4PWZA 2NSJA 1LTHR 4Q9IA 3JASA 3GL9A 3VC7A 4UD2A 2BSQA 1XL0A 1XK6A 1K97A 4IQ0A 3DTVA 4RKEA 1C9KA 2FE1A 2J0EA 1TAHA 2I2AA 2CJWB 5EWLA 4QECA 1KYXA 4LPSA 5CHEA 5C5EA 3FWZA 4IZ6A 1SUBA 2VYCA 3BD6A 3SLKA 1PL0A 5FPYA 1DDIA 2GBIA 3UCXA 4QULA 4J0FA 1Y4AE 3IQWA 2OEPA 4RVNA 2HV8A 3HKBB 3C98A 5CHYA 3CNBA 3HKDA 3RT9A 2OAQ1 3BMCB 5L9AA 1T5IA 3ZU3A 4HRXA 3OCUA 4V0KA 1UJMA 1E2HA 3KSAC 2BBSA 2JLUA 3EIXA 1XQVA 3WOHA 3E0XA 4IIJA 3LPAA 4PC1A 4JU9A 4Q1VA 1J00A 4QPNA 4DJFC 2QT0A 3S1AA 5KU1A 3OX3A 5E9AA 4WY8A 1SVLA 3PXEA 5DMXA 1PJ2A 2I2WA 1II9A 3EWIA 4N5HX 1ZOSA 1ZGBA 3DXFA 1N6DA 4K88A 5AOBA 3ZX4A 3FCSB 4N3AA 3HA3A 3JQGA 3BL8A 1SUIA 5H9WA 3PC2A 4OA5A 3MZLA 5MF6A 4S2UA 5D85A 2RGBA 4RPKA 3PJDA 4CR8A 1YCFA 5F3DA 2IP2A 3GA0A 4XYBA 1P1IA 4IV8A 1R3DA 3HHPA 1EUDA 1W93A 4PX5A 1JAIA 4EHJA 2D7DA 4A7JA 3IUEA 4NBTA 1EK5A 1XZAA 4UBJA 4YI5A 5B6PA 3CWQA 3TRDA 3MTQA 3V80A 3UICA 1RWOA 3UKOA 3G9ZA 3S8EA 2AK3A 3ZE2A 2WI8A 2WEKA 1M73E 2Q1XA 3TINA 3K9FC 2FVXA 1GUBA 3L4OD 1E2IA 2HMSA 4KB5A 1N2ZA 5EJ6A 3PLAE 3L7DA 5H0IA 1YAHA 3B1ZA 4O4HF 1GYRA 2OFOA 1R8YA 4OJMX 1QHSA 1ZI9A 5LOVA 1VIAA 2ZSBA 4MGHA 2D0PB 4JR0A 3H8WA 4LTDA 3SI7A 4IGFA 5LLTA 3GLGB 1Y3BE 4HDOB 3GLQA 4EFLA 2JGIA 1DG3A 3DAHA 5DBGA 4RC9A 3BE4A 2RFLA 1VHDA 1BDHA 3SF0A 4YGYA 3RFXA 3ODPA 3DVAB 3QY9A 1U7XA 1NW6A 4KGZA 2P1DA 3D31A 1QFZA 5IRCD 1PO7A 1VKOA 2A9RA 2YXPX 3EI1B 4KTVE 3CCBA 4WNAA 3X1KA 4X90A 3BWEA 4RV9A 1P7CA 4HAVA 5G4KA 4KLAA 2PLRA 1Q7CA 2HCJB 1Q22A 3NUQA 1NQUA 2B1RA 2OO7A 3F4BA 4YJ3A 5ALTA 3P2OA 4DL9A 5EJIA 4EHNA 1T3GA 4FA9D 2F8LA 5DH9A 3TLZA 2E55A 1EFHA 1OYWA 4AF6A 3H5AA 4HYEA 3QTLA 1BKYA 3IVAA 2B7LA 1N4AA 2F90A 3M34A 1OX5A 2HKRA 4XA8A 1BHQ1 3K72A 4QELA 2VDRA 3ZE1B 2AEEA 1H23A 4WZBE 4I9GA 1R0CA 5FUXA 3AGQA 4XI9A 3EULA 2IC5A 4I6JA 4ZOLF 4PRKA 3U61B 5E1OA 1I01A 4OFXA 2DXIA 5G1PA 5CB0A 3IPCA 5EHZA 4NK5A 3GCZA 4XCVA 3RABA 2H06A 1IZ0A 5IFKA 2XE7A 2PH7A 4LOAA 3MTEA 4TS3A 5IVDA 5A9TA 4D92A 4C5CA 2C7OA 3E5MA 4GHWA 4E94A 1GUFA 3BH7A 4W9NC 2N1BA 4NJEA 3ZWKA 2A9FA 4CEHA 1JXOA 1WG8A 5AJHA 4O45A 3A11A 2JGAA 3EPLA 2C83A 5D86A 3AK4A 1QE3A 1Y7LA 4C4RA 2EFGA 1A77A 3J7TA 1LPBB 2D54A 1A8PA 1WV0A 1YC5A 4V2UA 5IT4A 3TZCA 3KAKA 2H5JA 4FFMA 3UF0A 4EL0A 2AN3A 3NJ8A 3MA0A 1T8WA 1EUYA 3SYMA 3ABSB 4BB0A 2V7EA 3QVXA 4NXMB 2ZKLA 4N03A 4EJFA 2IPXA 5LYYA 5BWMA 3HB0A 3AI3A 3WNVA 2VO1A 5K3OA 4FK8A 3EISA 1UAAA 3L8FA 2QVZX 5TMBA 2DHCA 1G55A 1B1CA 4N7MA 4XUCA 3ST7A 1ZCJA 5JYCA 1N36B 3ZWDA 3VYWA 4GZ3A 5JZMA 1MIOB 4S1OA 4JQCA 4EW2A 5A5DA 3H9JA 5JYDA 1T9GR 1R15A 3K9HA 5AJZA 3NC0C 2XYIA 1E7QA 2IPMA 3GPBA 5C86A 3TVYA 3MTBA 3KU4A 2R62A 5EIFA 1KEVA 5M04A 3FETA 1W1WA 5BUZA 4FEGA 1J8DA 3W2GA 1UP4A 2ECFA 4HRAA 4U2EA 3QKRB 3PXGA 3I01M 4BO4A 4FFRA 2AN9A 5DCUA 3IRVA 1T8UA 3LDUA 1Z38A 4C7OB 2H4XA 2YHBA 4ZI7A 2DG2A 3IJCA 4WJKA 4EMSA 5B30A 1Y8QA 4L0QA 1OV4A 2XTNA 3UV7A 3TNFA 2N46A 2NLOA 4L50A 1Z2EA 4GM4A 4CZXA 2SKDA 1IWPB 5KQRA 3WLLA 4ZEWA 1HDCA 1T3HA 5HFJA 4BMNA 2BRUC 2SHKA 4FDMA 1QIJA 4MMZA 5CBKA 2J6CA 3BWCA 2C5EA 4BFXA 4BJ5A 4X91A 1PVVA 4AF8A 5G3YA 2AW5A 1HURA 4GWKA 1L5OA 1HM5A 2EJTA 3RFUA 4KLCA 3E7XA 2EP7A 4J6EA 3KALA 3QVLA 3G2JA 1RWPA 2EGUA 4KWIA 2GBPA 1BQ3A 3GAFA 3PE7A 4DLZA 1BFDA 1F17A 2SKEA 2HA0A 3NIDB 1HFWA 4BP1A 3DEZA 1HTWA 3WIBA 4DCUA 3MJDA 4AK9A 3IQXA 4C76A 4RTQA 5LZ8A 2PZLA 2ZSUA 2CZGA 3CZMA 4F4DA 1MP0A 3DLAA 2J3HA 5KQSA 1N78A 2EKQA 1AS2A 1J20A 1JMKC 2GCIA 1NFQA 2ZB4A 2D8MA 4N76A 4CN9A 4R7TA 2HLPA 3QX8A 3C3EA 3PCXA 4ZXFA 2YASA 3EQZA 2CLMB 3JQFA 2MTBA 3UGQA 1EFPA 1GOFA 4ZZ3A 4G1MA 3I0ZA 2IY7A 1FNNA 5CK5A 4MR9B 4ZO4A 2C2WA 1KDPA 1HDYA 5C92A 2WQZA 3EQ8A 4DZRA 3PNYA 3ZEAA 1JW9B 3DL2A 2Y1KA 1T2CA 4HEA6 2WWGA 3AEKB 4TSKA 3KL4A 2Z8YA 1TMYA 5KKNB 4BVKA 1W47A 3ND8A 1U7HA 3C45A 3RVLA 2RG7A 3OOWA 5M5TA 2AI1A 2VDOB 5IM4F 2I8CA 3L77A 2HGSA 1YL7A 1UODA 4FDUA 3PPXA 3C3KA 4DQDA 2NU8A 4G5SA 2LGJA 4I1IA 1J5PA 2QE7D 5IDVA 4FDTA 4P93A 1TA4A 4N01A 3ZV4A 3QF4B 3A05A 1CIJA 5KMGA 1Z25A 2GM9A 5LXTB 5FPSA 1EHCA 4DA7A 2B2XA 2XV1A 3M1LA 1RAEA 4XRRA 5HKKD 3W5HA 1P5RA 3MIZA 4Q48A 3MB8A 1E9EA 4HGOA 3OIYA 2J4DA 2CNDA 1VPWA 5FF9A 2D5IA 4A73A 2C20A 1U2VC 3SQNA 1E9SA 5PNTA 3VH3A 4PO8A 5CDSA 4EHLA 5F4ZA 4EUHA 2CJXA 1VC2A 1BTOA 5K3FB 1GTRA 4E5NA 3KSZO 3ZY4A 4JJEA 4CMHA 1E98A 2JGLA 5DVZA 2H08A 4XOUA 4NC9A 5C1DA 4AG5A 1QHFA 3E3AA 4EPYA 2R96A 3S7ZA 2HA4A 2ZIFA 4ZQIA 3KQOA 3CH4B 2OLJA 5CDTA 3NLLA 4HGQA 2WFLB 1A7AA 5I9SA 3AB7A 3FW1A 1KZHA 3ETDA 4EO4A 1RYMA 1H05A 3JVVA 4INPA 1HEYA 3ZU2A 1SXIA 3I2FA 3OLVA 3R0QA 2QBYA 4IV5A 3EARA 1EPUA 1X1QA 1S5PA 2OK8A 1KYZA 1ZI6A 4BVGA 3W5DA 4EA9A 1AA6A 1URPA 4ZYUA 4ETWA 3VR3A 1GEEA 3HJCA 2QPAA 2ZCJA 1Z0UA 1BA2A 4G9BA 4UW9A 1NQXA 1E1LA 4RFVA 4Q02A 2HM7A 3CFSB 1I4TD 4X20A 5ESDA 3GN2A 4GR4A 4KE9A 2HR1A 3ZLJA 1QG6A 4FD2A 1N1MA 1JHAA 4F5YA 1T5TA 4DDWA 2FG6C 4JEHA 5IT5A 3KOUA 4AMBA 1JDTA 4BMVA 2Z0MA 1F06A 4BAGA 1LBTA 1KOJA 2Q41A 3L04A 4C0HA 1FNDA 3QPBA 4IGEA 2JHGA 1XQWA 3FWPA 4ZEVA 2CVHA 2RIRA 1DEXA 1SQGA 2PD6A 2WFZA 1Z0FA 4AJ1A 3P52A 2QRMA 1Z6YA 4LW8A 2XXJA 3AFCA 2UUOA 4RY8A 2II6A 1GJRA 4F97A 3UCEA 3ED1A 4A03A 5M5VA 2HU8A 2HUNA 4B09A 4JI6B 4XVQA 4BN5A 4B32A 4E03A 4PLCA 5IG2A 3B78A 4AF7A 3SMVA 3FSRA 3SM3A 5JFTA 1UPUA 5EG5A 1ARZA 3C8DA 3AU9A 2HFJA 4PLWA 3AINA 1E8MA 1EJ6A 2QTVA 3OIDA 2FPUA 2PWPA 621PA 2ES4A 2QMOA 4QPPA 1RRKA 4XDGA 1WLYA 3MT8A 2W22A 1UJNA 3O3CA 4KQGA 2BYTA 1R88A 4L9SA 3F5MA 1A2OA 5H68A 5DB4A 4MEJA 1G60A 5AFSA 5IKXA 4J94A 1ZH8A 1FTNA 2OHXA 4DM3A 1JSRA 5IWCA 1YIOA 5ECWA 2Z2NA 1V1RA 3OWXA 2CNWD 5BV7A 4AKSA 1HLPA 4NULA 3Q2KA 4M0UA 3TUJC 1L7PA 3AB8A 3HH8A 4WXRA 4AJLA 5K3BA 4K3VA 1XSEA 3WLNA 4RVUA 1DE0A 3OWOA 5DTIA 5BW5A 1UDXA 2KPOA 4Z1MA 3OZGA 4LXXA 4B76A 5CAEA 1S1MA 4JSRA 1XRRA 3ASZA 4ARCA 4DV2B 1VB3A 3WQQA 2I4RA 3CN9A 4B31A 3VX4A 1EQAA 3FKSA 4JVMA 4ZGBA 3RBXA 3T4PA 3TI7A 4S0XA 2FQYA 5AM0A 2PKRA 1GY8A 2P9UC 2W6OA 4J90A 3FOBA 1K6IA 4A2CA 1VI5A 2H1HA 1DX4A 3GWGA 5TEFA 5FA5A 4JODA 1UFKA 2XMGA 3DFIA 2YFHA 4K7JA 2PXXA 5GWXA 3TTXA 5IUKC 5AR1A 1UFRA 4PPQA 3AJ9A 4MQFA 4IHAA 3LJKA 4WXPA 4K8OA 2GPSA 4LNAA 1JB9A 3ZE0B 4ILEA 2JGRA 1H8ED 1MG0A 3PQ6A 5CVEA 1AVTA 2JGDB 1LJ8A 3VI3B 3SICE 4EEZA 3RSSA 1HDOA 4N5LA 4YROA 5LSAA 2EGHA 3MSXA 1WW3A 1KR2A 1E64A 3A1UA 4CR7A 1TYEB 3UHAA 3VU9A 4YV2A 1IG3A 3HFQA 2PT5A 5BYAA 4IKOA 4QDZA 3HWWA 1GG5A 1Z15A 2WJVA 5EJFA 1GVNB 3NVNA 4DIUA 3EG9A 2JGNA 1QS0B 1SULA 2R1TA 4DS3A 1UBCA 1K6XA 1WX1A 1ZQ9A 1F38A 1ZJZA 5LU8A 3V1NA 3UUFA 3ZVMA 1ZN2A 3G2QA 4ZZ2A 2WSIA 3GRCA 2L82A 4JR2A 3W3AD 1W1IA 1LRJA 2E5LB 3HVKA 3WFJA 3NXKA 4OGKA 4BQSA 2F8MA 1YZNA 3L06A 3CISA 4XEUA 3D4OA 1UXOA 3WL8A 3BK2A 4R9VA 3KXDA 1IHYA 4BAZA 2HTFA 3IP1A 5E0OA 3S0JA 4DILA 2IYQA 2OBYA 3D7LA 3FGBA 3O4JA 1TUGA 4OJKA 4F85A 1E2DA 2V54A 1WB5A 4MLCA 1G6KA 3LQ4A 2OT3B 1F14A 5KNBD 4PN3A 2C8VA 1SC1A 3KKPA 4U6SA 1OROA 3ESZA 1Z0KA 1CIPA 1WMSA 1L5YA 5CDYA 2PGAA 4M1QA 5CYPA 4FUTA 4US2R 4OHWA 1KJJA 2NW6A 2GJ9A 4DJEC 3EXHA 4B7UA 1WCV1 2BBKH 1G5HA 3DQPA 5JXGA 1Q1GA 4CIDA 4L0MA 4FT2A 1V8ZA 4YJ2A 3N7UA 1UK7A 4RZQA 2PEZA 1JHVA 1NSYA 4EUKA 3WAJA 1PGOA 2RBEA 1YR8A 3HYTA 2O59A 4Q7LA 4EB6B 3SXPA 3Q5GA 1J22A 2ZRQA 3THXB 4M60A 2XDAA 3FLAA 2WKSA 2ZUSA 4BCBA 2I65A 2CN1A 3GBPA 2VKTA 5C81A 4KIWA 4HLUA 2BR3A 2JI6A 1LI7A 4ZQBA 3TLKA 2XMRA 3FOFC 3RM3A 4XQEA 2ZT5A 1JJUB 5EMLB 3Q2IA 3MJCA 3R20A 4BE7B 2F3RA 5EXEA 4HNTA 2ZYGA 1ULBA 3UQYS 4KO3S 5HJ2A 2IGTA 3F3KA 1U8FO 5F35A 4TL9A 3RVBA 2W9XA 5EQDA 1FDUA 4W8OA 4XYLA 1GTMA 2VBIA 2ZS9A 3LUHA 3SMRA 1KK0A 2XOEA 1X2BA 5AI0A 4MV9A 5BRAA 3DDWA 2H1WA 2OG2A 1EQ2A 5LVAA 4MKZA 1B41A 4J1NA 3KAPA 1GG9A 3TO5A 4D0SA 1JALA 1VYHA 4GM1A 2GEJA 3D4NA 4EI2A 1TAUA 1RBZA 4DHEA 3PQ2A 4QXMA 3CH5A 4ZAZA 1Z62A 4IMIB 4NOLA 5KB3A 1M6VA 4YRMA 3V4OA 1RYFA 3MSCA 2BZ1A 1F6BA 1KKUA 2FLVA 2IHKA 3GLIA 4H4DA 1DO8A 1T8RA 5DULA 1SCDA 5I47A 4ZVPA 2ZQYA 1Z0DA 4PVDA 2CCJA 4EY3A 4FKMA 3KDPA 4ZV7A 2QTMA 1QPZA 3I6ZA 3PJFA 3KLPX 5JSZA 4I36A 3RGWS 4D5EA 1NG9A 4JZYA 4S1PA 2Y1EA 1CUEA 3DE4X 1OMOA 1PEYA 2GF9A 3RVMA 2NWQA 1KF0A 1V43A 3VH0A 3NBUA 1YBAA 3WJ1A 5GIOE 3TOVA 3NVKI 1YHYA 2EW8A 1U8UA 5AUOB 3BMOB 2P2LA 5KYXA 5A71A 5LD2B 1WS6A 1YVPA 3PFBA 2AXPA 3PX2A 3UK0A 1OGIA 5ERYA 2HI0A 4RHUA 1QONA 3I83A 3NDBB 2V55B 4PZYA 4KSBA 1PR0A 5CH5A 1WXDA 4Q1FA 4YT5A 1R5NA 5CM9C 2WK1A 2QPTA 3AL8A 2BMJA 3RC1A 4FHLA 2ZTMA 1BMDA 4YBRA 3STVA 5K8CA 2YNMA 3OW8A 2BKAA 2D2XA 2X5KO 1A3CA 3J80g 2VOJA 2BF4A 2TRSB 5JQGB 4CLEA 2OVQB 1EFLA 1L5GB 1Y8RB 1RU3A 2ODEA 1PR2A 3IT1A 1JIIA 1ORWA 2YWJA 1ENZA 1CUDA 3BA6A 2XSZA 4XIIA 3GZNA 2WPDA 4JGBA 5H5JA 3R5SA 2H9YA 4C08A 2DOKA 4ARBA 2OZLB 2XUQA 4D9EA 1XD9A 2QN3A 5B53A 4A3SA 4HH3C 4TTVA 3V7FA 4D8TA 1UADA 4HDRA 4X1YB 1GZDA 3UH0A 1RADA 4HMPA 3ESXA 3KTFA 4RY9A 1H9BA 3JVEA 2CUKA 4R2WA 3JQCA 1WO8A 3R7AA 3PNVA 3PI7A 5EQJB 3BA1A 1K5DA 1SK8A 3PQEA 1EVEA 3QJGA 3JD2A 5ICFA 5G4LA 2Z58A 2Z5GA 3OHPA 1GYQA 5GPBA 2Z3WA 3LPDA 4AUEA 1OWMA 2OCKA 3E82A 3ZWWA 2Q3LA 1GA4A 3NBXX 4FI3F 4L4ZA 1CW2B 2IIVA 2A0WA 4O02B 4JB2A 2ASVA 4MGEA 3JZFA 4J4HA 4CTMA 4BB6A 2VP0A 4HN2A 1I0LA 3FOZA 1JZQA 5DNVA 3T7CA 5KVVA 5TF2A 1XXHA 1CY2A 4QJ5A 2W42A 4QUIA 2ZUFA 3GFCA 2JAXA 3HSKA 2FQQA 1C30A 3PUVA 1ISFA 3K0SA 2HIHA 5HW0A 2G07A 3NH9A 3SVZA 4F4JA 1K7XB 2R2GA 5CXBB 3RU3A 2YINC 2OAEA 4E5KA 4HJRA 2PQMA 4TSRA 4AQDA 3N2KA 1BXGB 2H7VA 4TTJA 1DBPA 1EA7A 4IDHA 4RTMA 3HZZA 4GBMA 2ZJYA 4AEZA 3SEAA 3ECSA 3AW8A 2BMAA 1XD2A 5BXYA 5EMHA 1II8A 5B3JA 3VNQA 4TOIA 2W4IA 4CZVA 2FSPA 3ZKWA 1FFXA 1HETA 2PR7A 1W88A 4ZIRA 4A8JC 5THKA 4DKJA 1G19A 5AW1A 2ZSFA 4BVJA 3ROQA 2J31A 4KI0A 3UQZA 3ILVA 5A4FS 5A1JA 4OYRA 1M1XB 1LW7A 2RGDA 4DEVA 1Y9AA 1ZMXA 1V5EA 2XRZA 1MNQA 3QA9A 4RD1A 1QH0A 3P0HA 3W77A 4HC4A 1T10A 1TD9A 3FNRA 4BUCA 1JECA 1P29A 2PANA 1UDBA 4ZT3A 4LXHA 3QKUA 1UZUA 1QVRA 1Q77A 4UOZA 3GO4A 2R6DA 2WD7B 1ZRNA 2XDQA 5L95A 1JLKA 1G9XA 4M6WA 4M89A 5FOWA 4LI3X 1YA6A 4FHEA 3AEZA 2QM8A 3KQVA 4LZAA 1YZLA 3HL4A 5EUQB 4BNNA 3QFSA 4L8GA 4H77A 1NSTA 2OMEA 2XKJE 1FSGA 2C7RA 1VXRA 5ARDA 4YHHB 3IJ0A 4TLLB 1R7RA 5C37A 4F4IA 1XEWY 3S55A 1AKWA 1PT5A 2WUWE 4PG4A 3WBJA 2NU9B 5DKFA 4OHXA 4DMLA 4HDNA 2X1MA 3J81g 3C4VA 1K8YB 1IVSA 3KFXA 3IIWA 4RLFA 4L9WA 1W1UA 5TPWA 1DMRA 2K5UA 4U1EI 4Q4JB 3VO2A 2AYZA 3SJCA 1IBKB 2O2YA 4PX3A 3DBHB 2XE6A 4OQ4A 1E3IA 1J49A 3PT9A 4CM8B 1AIPA 1J90A 3AHIA 3CRRA 2GESA 3EY4A 2JJ2D 2YMPA 1L0QA 4OXIA 3UO8B 1JDVA 4ILKA 4CN8A 2GHQA 2ATIA 3LDGA 3PXXA 4I50B 3IBGA 2SCUA 4MR8A 1RKBA 4LHYA 4B40A 4I19A 4D4JA 3L9WA 4EQ6A 3B70A 2HNBA 5H1MA 1TQ2A 1HDZA 1TZKA 3MF4A 4CFZA 2CXQA 4CG1A 4H1WA 1QFYA 4LZPA 1EFVB 2DT8A 4PZDA 3C87A 3CR7A 5BR8B 1XD8A 2AN4A 3R7SA 1V25A 3RRYA 4F2PA 4CT0A 1Z8HA 4P86A 1UC9A 4A0RA 4LJ4A 2CWDA 4LUCA 1EJ2A 1D9ZA 1YZUA 1ADGA 3IOBA 4K3ID 1MPTA 2GEDA 1NW9B 2QTAA 4V3BA 2YV3A 4GMFA 3G1UA 3A06A 5LA6A 4KC0A 2IUVA 4FMDF 4MYDA 4H5JA 3ZVLA 4RAOA 1Q0TA 2IITA 1Y63A 6GPBA 3TM4A 2DTXA 2AKYA 1F8FA 4JX9A 2F8TA 1UPXA 4JP8A 2YWEA 4F2HA 1G2QA 1UJ2A 4CI9A 4F6LA 3V9PA 5CD9A 1THZA 4G41A 4FJ0A 1SXPA 3LYLA 4W5NA 1WP4A 4OXXA 4D8UA 3TWOA 1NWHA 3PTAA 3F0TA 3O3OB 5ER9A 1WL8A 2HWWA 3AOEC 1CJMA 5I7WA 2R1VB 3WGKA 3JATB 3K05A 2ZLBA 4B43A 3R6GA 3VV3A 4TVSA 3DD5A 4DYDA 1HZJA 1N25A 3FVTA 3FSGD 3CCFA 1VI6A 4IS3A 2CD9A 3LMKA 1Z5PA 2AR7A 3C70A 2J7PA 3E9CA 2HRDA 1KQNA 3SJUA 1M9NA 4UZSA 2XT9A 3NVXA 1OLUA 1Q44A 2VBCA 2AK2A 4CF4A 1L5SA 2XGJA 1JDBC 5FI1B 3OZUA 4O4LA 1FTSA 3ETHA 2GJKA 1RQPA 1UK9A 3FUTA 2PU7A 4MQBA 5ALHA 2WTXA 3OZFA 4BQRA 3KDAA 2Q3BA 3CY6A 2XUDA 2BEWB 1SXHA 4TM7A 3R09A 5TR9A 5JS2A 3ZZUA 3BEDA 3B7PA 4CODB 2J3MA 3V8QA 2D4AA 3SKXA 4ZOXA 1E0DA 3T4EA 1FDVA 4YALA 5AH0A 1A96A 4A2LA 5AD1A 4NEHB 1AQJA 5HKBA 4H4CA 4GBGA 4D82A 4RK1A 2BHLA 1O7JA 5EMNA 4L4YA 1FA9A 1HZZC 5KJFA 3C3WA 2VSYA 2I3SA 4YX9A 1GUYA 1NI5A 2GN0A 1V0JA 2PMEA 3R8CA 3U7FB 5F4BA 4KFSA 1NRJB 1E59A 1T15A 1QK4A 1SKUA 3EZ9A 2ZRMA 1KVQA 2VTEA 2BCGY 3JXEA 5DLPA 3G1TA 4W9MC 4ZK6A 3IJ5A 3ZY2A 3KKNA 2EU8A 3ZW9A 4D5GA 2BBWA 3ND5A 4DR1B 3DF7A 4O33A 3HVRA 1M1ZA 1ZIPA 2ZUDA 6CHYA 1RAAA 1XVIA 3EGWA 1T4GA 5ADWA 1LBIA 2Q4BA 2RAVA 4JHNA 4KR7A 5EMJA 4TRRA 3VKUA 1HE8B 5E9QA 3SBRA 4AC9A 3CB2A 1V7CA 4U7DA 3LWBA 4W4TA 3VUEA 3DVQX 1LLDA 3ZUPA 4OP1A 1E18A 1NDUA 4MV0A 4KYIB 2VP6A 4B47A 1D5WA 3QNUA 4PLFA 3EDQA 3AFOA 5M29A 4KN9S 1ZR2A 4OP2A 2J0SA 3I2YX 5J5CA 1V3VA 1XRNA 3WWEA 3IVRA 1NG1A 2G0TA 4N9WA 1U3GA 3WMEA 1VRCA 1PLLA 2HBQA 4UUQA 4Z7JA 4DHWA 3Q7SA 2C0QA 1E63A 1TQ8A 4DDVA 4C6SA 4QQFA 4UBKA 1N3LA 1VA4A 2PX2A 1HDIA 3OAAA 1TVMA 4HMQA 1DCKA 1UAGA 2AR9A 5AW8A 3G82C 3CLUC 1J0BA 4Z4EA 1MHTA 3I5UA 3B9QA 3D0QA 3NB0A 4G4GA 4O4IA 4N47A 3PR1A 2V03A 4MITA 1Y1TA 3VAAA 2F3SA 4MA0A 2WKWA 3QVOA 1G8FA 5KTSA 1CR4A 4J6FA 3ZXIA 3JQAA 2G6TA 1YZHA 1P1CA 1V8OA 3H8VA 5KDLA 3Q8XB 2IE0A 4O59O 3I8CA 4HO1X 3HO1A 4QXAA 2R47A 3C3DA 1LB1B 4L75A 2X0DA 5F77A 3NHYA 5JC8A 2O8CB 1WW8A 2BGNA 2OD7A 3E7PA 2C92A 1UKYA 4TWRA 1ZJWA 3LTNC 4RPJA 4B73A 1KMNA 4REQA 1HYEA 5E4FA 3OQMA 1KJYA 2XITA 3E3NA 5CB4F 4RJ2A 2OCYC 3I9LA 2VVTA 5EAMA 1DFHA 1I4OA 5F21A 2CLLB 1N32B 5FOXA 3AF2A 3AY6A 3OEHD 4EZBA 1D0VA 1ZZEA 3AH8A 4ADSG 4Y5RD 3ESQA 3P2MA 1YACA 5FO0A 4WZ6A 3EMKA 4JI5B 3U4MA 3CBGA 1UKBA 1X3LA 3DKRA 4F3RA 2IS4A 4PWYA 1BCSB 2N3ZA 1Y37A 2DP4E 4LF6B 5EXSA 2B0CA 2HSEA 1BDMA 1ELOA 5J58A 1XZDA 4Q19A 2WJ4A 4HQKA 2Y4NA 5DRTA 3C9CA 1MFZA 1AKRA 4X61A 3E4DA 4ALJA 1PR1A 2UXCB 4Y2PA 2F3PA 5AOCA 4GM9A 1ECFA 2Y4OA 2O4UX 4DLRA 4RKWA 4MJ3A 2WNIA 5J3JA 4J0DA 2WU3A 4HTFB 4QXQA 3UAZA 4L6CA 5CEJA 4KBGA 1GFWA 4JSVC 5B37A 5H8WA 2WPNA 4ZZIA 3QSGA 2WC1A 1XA4A 3FSEA 2BZGA 3Q9UA 2BKXA 2YXBA 3P1JA 1ITZA 1HFKA 2Z1NA 2QV0A 3N2GB 3T3OA 1TQ6A 4KCGA 4ALNA 1FBNA 1UKZA 4NCNA 1CY4A 1KQGA 4XWAA 1RW4A 2Z2KA 4M0MA 4W6QA 1ISSA 2VK1A 4BATA 2L18A 1M10A 3LP8A 4RZXA 3TCKA 3TLYA 3VSDA 4UTVA 4NOKA 2EKZA 3VA6A 2QX9A 3EH1A 1V41E 4AFNA 1FW6A 3OHSX 3FCUB 3OURA 4JKYA 3V46A 4G1EB 4KZPA 4NBSA 3SC4A 1FFEA 4FW9A 5HE8A 3IIEA 3F5DA 4FCWA 1NP3A 2XWSA 1YAJA 4GYKA 2R79A 3SQLA 3AKYA 3GELA 1C7IA 1ZD1A 3L7MA 3GGSA 4A8HA 5J1SB 4PGHA 4H7JA 1X1DA 2WUGA 4LYFA 1MJHA 5A2QA 1DKQA 4FNOA 1ZN8A 2ZRLA 1L4MA 4UAGA 1ODFA 1VJ0A 2B35A 4IHQA 5AK6A 5F76A 3AXSA 4UFOA 3WGNA 3RKRA 5AUQA 3COPA 2CSXA 4R7GA 1GZUA 3OOYA 3P9CA 4P83A 3L7AA 5BSFA 1NP7A 2AGYA 2X8AA 1OJ7A 3GYBA 4JVLA 3WJAA 1JQDA 3E0QA 3UWKA 1Z7EA 4A10A 2Q7DA 3IKVA 1KPIA 1Y5NA 1KEEB 2GJ4A 4CIWA 3JPXA 5DYWA 3FOAA 3PSAA 3DVSX 3OPXA 3CVXA 2DM6A 2HF8A 1I10A 2PJZA 1EGVB 3SJZA 1C5KA 4KQKA 4PQYA 5IC4A 3FI9A 2PKQO 4U7AA 1NN1A 1KYWA 2D74A 3P9YA 4NAHA 5FNVF 3N58A 4IWXA 5AMXA 1XN1A 1N3YA 4HDKB 2FRXA 5DV9A 1R0KA 3PHBE 3K1AB 1OU0A 3OICA 3OBBA 3BD9A 1PBYB 1FP7A 1IOZA 3MB5A 2ZOSA 1GAQA 2W2KB 1Z28A 2QVXX 3UK6A 3LBAA 3CUWA 4EJSB 1XTVA 5FWYA 2QGNA 3HBFA 5LP1A 4ND5A 5AHXA 1KTVA 2PLWA 3DC2A 5HUQA 1FVHA 3I39X 3OF5A 2NXEA 3OQIA 2CSUA 4E09A 1ZLYA 5IJWA 1MTOA 1N5OX 5FBVB 4JI0B 1A9QA 1SD1A 3GXOA 4NZNA 1C4OA 1T2DA 2A1UB 3KRTA 1HPLA 4NFYA 3UJHA 1W76A 1KSGA 1KSHA 5FFGA 4OQEA 1PZFA 4YYZA 2CO0C 2VJYA 3ZKAA 3WHIA 2YWFA 2VYNA 1F5NA 5KVSA 4OFWA 3FOWA 1W36C 4I1RA 4EA7A 3RJMA 2M2IA 2QLBA 4YLGA 5CCEA 5K0JA 1O77A 2A67A 1WUIS 3N07A 3K73O 2ZAYA 3V4FA 2OHHA 2PMDA 2O8FB 4I1YA 1TVKB 2PRZA 1Y1QA 4G0YA 4D3YA 3ONWA 4DWWA 1C3OA 5G0TA 4HBZA 3D6JA 4DQKA 4MULA 2DU8A 1E6EA 3F1KA 1TM1E 4Y6GB 5K99A 3B3AA 1SVIA 4WI1A 5EQFA 3NT5A 5F1YA 4OXNA 3EC7A 3NFYA 2CLOB 3D6AA 3C8ZA 5BVGB 2QSJA 1D1SA 2P5TB 2ACVA 1Q0RA 3RFCA 2YNPA 4N1AA 2W2VA 3LGXA 3HXTA 1XEWX 2BFEA 2KSQA 4D98A 1QH8A 2AJCA 4A0BB 4GOXA 3RVRA 2FW1A 3AM3A 3LXRA 3U7RA 4B4WA 4YUYA 5T64A 5JAOA 4H0CA 2VK2A 2Z04A 4TMVA 1USIA 5DGXA 3H9EO 2OXRA 3QX3A 1JTFA 3AEQA 4FVTA 3NHMA 1MENA 3PBKA 2JLXA 2BHRA 1DWOA 3QEMA 3RVSA 4EBFA 4CMCA 4QC2A 2C82A 4QTUB 1L8XA 1XOIA 4JVSB 4URZR 3NKVA 5F52A 3O3MB 3SVLA 3U56A 3DD1A 5L3SA 3HFRA 1JLRA 1FXWF 3K4HA 1RQLA 4KWCA 3NHWA 3ZDZB 4GE0A 4GX1A 3T6KA 3W15A 2FMHA 4GX0A 3U6KA 1P1JA 2AFIE 4TT3D 1RZRD 2QA5A 2I2XB 1DX6A 4J3FA 2F67A 2Y0PA 1QC5A 1OWNA 2C4MA 4X71A 4ISCA 3HC7A 3GRRA 3WRVA 4ZARA 2O07A 1ZW6A 1A7JA 2F3QA 3MWFA 2XPCA 3ZHCA 1F0YA 4X7RA 4TMFA 3DJYA 4PYRA 4H6PA 4FMCB 3WB2A 4ZCPA 3RRBA 5J59A 1XEXB 1P81A 5EE1A 5DNUA 5TDHA 4Z2AA 4YXWD 3H18A 1OPRA 3SEFA 4K1LA 1C1HA 1XZGA 3H65A 1NMZA 4F8JA 4R16A 5FKJA 1Y6QA 3E8MA 4R83A 5IAEA 1VL0A 2RKBA 1I7PA 4MUJA 4R51A 4KDRA 4OSOA 3WLOA 1A4IA 3TRFA 3EWNA 4EQZA 1DJPA 4YQEA 2VFAA 1AK2A 3IVCA 3JD3A 1FQJA 1XUOA 3SXTD 4BL5A 3F98A 3ZDYB 2J9FB 3KJXA 3T4XA 2QP3A 3AQIA 1THMA 3Q0IA 1T9BA 3ZI7A 5C53B 2R7LA 4NCHA 4M0CA 4M9XA 2BELA 5H02A 1OLXB 4EHDA 5IAOA 4CKXA 2QD4A 4QU9A 2V97A 4W5JA 2ADMA 4B2LA 4HQ6A 2W6ZA 2HZBA 1XRQA 5K3AA 1QCYA 2PWAA 4W5HA 3VKGA 3SC6A 1YUMA 2F55A 3GF4A 2VJKA 5DMHA 1NL3A 2FSVA 2C88A 3K6RA 2PKCA 3N0TA 4IVQA 5A5EA 1P1HA 3EYAA 1NP6A 4WXHA 3WQSB 4MUIA 4TV8F 3OTHA 1ZGAA 4XM0A 3HEAA 2X1LA 1XQ1A 5HFAA 5ALKA 1G4AE 4OY3A 1C7JA 1HYQA 4RVHA 3KOYA 3T3GA 4QWWA 1SXJC 5JG7A 5CCBA 1D6SA 3IILA 5LJLA 5KTPA 1E4EB 3VPFA 1U0NA 3PWSA 1TPZA 1V6CA 3ABRB 3PIRA 4C4XA 1I4DD 4J0WA 4XPZA 2Q5IA 4B7XA 3SZOA 5KCMA 1ZSYA 2JKXA 3GB9A 5HM8A 4IJMA 1E2MA 3V00A 2DC1A 3ENWA 1Q0PA 4OQQA 1U2DC 1GZ3A 4LQ4A 2PX8A 1O0BA 1YASA 4P2BA 4OIFA 4FA4D 1ZWLA 3OSZA 5FWDA 1OLZA 1U04A 4N3NA 5B3KA 1G8KA 5LBIA 3NHBA 3TEMA 3AERB 1YJCA 2B1IA 1DOZA 2I4NA 3U4QB 1EKXA 2B78A 3Q7PA 3VKVA 3KQQA 4KQJA 1D4ZA 2DFTA 2EQAA 1DQPA 5HK9A 3RS7A 4JJ7A 1NUPA 2OPBA 3NIFB 3CPSA 1K7YA 2FHPA 5U1PA 1INLA 4FIDA 1NYQA 4IDNA 1QR2A 1NM5A 4JBYA 5ADVA 3RUAA 1NNEA 1PZMA 2V7VA 4JYPA 5CU7A 2OFPA 4EHBA 1C2TA 1LV8A 4AVYA 4MVJH 3UAOA 1E60A 4UATA 1KSJA 4DC0A 2PNFA 4ZJZA 2DJ5A 1EK6A 4I3HA 3PHGA 5GXHA 3K6KA 3A2NA 1JHZA 4IM7A 2Y1WA 1QPBA 1CQIA 3QWAA 1SXJE 1JVNA 5FYQA 4K0RA 4ASUA 3HTXA 5A4AA 4OGGA 2BONA 1K0FA 3BUSA 2GYVA 1VE5A 1TCAA 5EWJB 3TQFA 1YS7A 1JIJA 3C7DB 1E8DA 3NTQA 3S28A 2ZCVA 1DC6A 4HXEB 3VNBA 2NADA 3MOIA 5DJ5A 4XYEA 2NO0A 1OHHD 3DGEC 3SY8A 5CX1B 1NI4A 4AUMA 3U17A 1FDWA 5FV4A 4B3MB 1AQYA 4Y2TA 4ZGGA 1W2WB 2J32A 1C1DB 1OVGA 3U7JA 1YJAA 1A27A 4MVJI 3KM0A 4H1TA 2WIKA 5HE3B 3IBYA 4UDOA 3GA5A 1PFUA 4XIYA 1UC8A 4LF8B 2WNSA 4Y1RB 2ZGVA 1WHSA 2OENG 3HY6A 1FDSA 3DPUA 5EE0A 4D9BA 3N39C 2IYVA 2R8OA 2FK8A 4EHKA 4DLUA 5LWQA 3G9XA 3WKDA 2ZUCA 4J75A 5BQPA 2JAHA 3DE2X 3EQ9A 4FFVA 3MTIA 5LQDA 1MO2A 4LISA 4RGVA 4WVLA 4GXTA 3FLMA 1Z56C 1KL7A 3H13A 4O63O 3KKKA 5T4FA 4M1EA 2PXAA 3FFTA 3T3MB 2YWGA 1CEXA 3RBVA 2IY9A 2GLUA 3A4NA 1M1YE 1VKRA 4RLQA 4EHIA 2IHJA 2PSHA 1YI0A 2Z43A 1OI7A 2I1LA 3BD8A 2AXNA 2GAJA 1IK6A 1ZYUA 1X94A 3DOOA 1ES9A 3RROA 5D00A 4JD5A 2OFWA 3S2YA 2KHZA 2HDOA 5AVZA 1AU9A 5EINA 3IHKA 5H59A 2P2GA 2D00A 3THYA 3ESCA 4D0NA 4D46A 5KSPA 1L5NA 3UBMA 1XX6A 3WK8A 4MRPA 3NBZC 4KFMB 4UM9D 4MINA 1I2ZA 3FD8A 1M0WA 3GU3A 4KN5A 2YBDA 4GPAA 5JYBA 2OHJA 5B1SA 1W34A 3U0BA 1JMYA 4A0SA 5IU6A 3HR4A 4C0BA 1E9BA 1O5TA 4EUSA 4Z9YA 3L4SO 3JAMA 4K6FA 5HCNA 4ARVA 4E6EA 3SZLA 2WWXA 3X3HA 1JI3A 3O92A 4DNFA 4A26A 1ZVVA 2Q5HA 2AN5A 3H04A 3LT4A 1IB0A 1KJNA 4PG5A 3KZVA 2VJAA 3L7OA 3IAHA 4G4SP 4C21A 1S01A 3OCXA 5ALEA 3T15A 1IIRA 3HFGA 5FBHA 4MW6A 2P6OA 3GLFE 2CY0A 2PSDA 4EJ2A 1HX7A 1JIXA 2CXUA 3NOXA 5JO9A 1U7WA 3NRBA 3UM9A 4P3NA 2XI4A 5H7XA 1M34A 2C2HA 1UFQA 5CT9A 1XDZA 2LRHA 2QK4A 3C3AA 3TRIA 4UTXA 2O06A 4LRWA 3IRUA 2F1JA 3U49A 4KDFA 4JLMA 5GQSA 3RH0A 3A4MA 1AT1A 3SHVA 2PGNA 4UULA 3I9KA 3IV7A 3OQVA 1CTQA 1GD1O 1X7WB 2P6MA 4DCGA 5HF9A 1RQRA 3MINA 3BJIC 1XP8A 1DKNA 1GUDA 2I7VA 4ZDIA 4DCVA 2HXSA 2BFBB 2HDHA 2RC5A 4F6CA 3P0RA 2PS0A 2OVRB 2H2GA 2FX2A 2RHCA 4WZAB 5CVJA 1SMKA 2IHUA 4NDAA 2D7CA 3K4PA 4Y7DA 4GZ5A 3DV0B 4D4LA 2M98A 5B58T 3HVHA 4LRYA 2QRJA 1CVRA 1RDFA 2BI7A 3A6HA 5TY0A 4DR3B 2QXYA 1U4OA 4WNIA 1NE7A 2IZZA 3LF2A 5ICCA 3T38A 1A71A 4QOGA 4CTNA 1SWVA 2IUFA 1UZAA 5EA2A 1I3OA 2DHEA 4TRJA 3N8NA 1G21A 3TW4A 3HB5X 2NUAA 1TI7A 2PL1A 1OPXA 1AHPA 3IQGX 1XMQB 2Q3DA 2GRAA 5LC1A 3KDSE 4LCBA 2AQ5A 2AI3A 2DBRA 4MI6A 2G88A 4G8DA 4R0NA 2WB4A 2GVNA 2VHZA 3M83A 1Y1LA 3DDCA 2VJQA 5HJEA 2EHJA 3Q9SA 1MG3A 2IYRA 4ZO6A 1FMJA 4ANFA 1LWNA 2GBCA 3DJFA 2MINB 3RIMA 4W5QA 3R5KA 3LHFA 4JNKA 3E7DA 2XCUA 4X6UA 4MUBA 4YECA 4C7BA 1U1CA 4K6OA 1L5KA 1R9NA 3PVUB 1TCBA 1HYGA 2OBFA 1NLUA 3D3WA 5T4EA 1JU3A 4FJ1A 5JECA 1FF9A 3JRWA 1UH5A 4GOLD 1C29B 4KO2S 3P9QA 1FNCA 5A4IS 2Q4EA 2IV3A 4GOJA 1BD4A 2WQ6A 4Z0NA 5FI0B 3P45A 3HBJA 5AOVA 1L2TA 4ZO8A 3IXLA 4RTKA 3PVSA 1CQJA 2WSYB 1QP8A 4J76A 4DJ5X 1H2XA 2WIBA 1CT9A 2GUGA 4GRIA 2YVKA 3JQQA 1BMTA 4PAOA 3K0KA 1JJBA 2BISA 1GU0A 1OMWB 4FFPA 2D5CA 2COUA 2NO6A 4CHTA 3LY9A 1XU4A 3GFQA 3TUIC 4D96A 1N1DA 1DDOA 3BIXA 4S2EA 1KI6B 2P5YA 2C00A 1KH3A 1VJCA 3OLCX 4KPUB 5ALMA 1PZNA 5DTMA 1GPDG 1YBMA 3EC1A 4Q9KA 4BNTA 2WINI 4KX5A 3U4CA 4RXTA 4N40A 1AKNA 3M9XA 1NVUQ 3A10A 1CDEA 1OF1A 3ULEC 5M61A 3VR5H 4I46A 3U62A 1XTUA 2DKOA 5DIZA 5C4IA 1L4EA 4IHKA 2JKVA 1WTCA 2JGMA 4LV8B 4MWSA 1XT6A 1SZCA 3G0BA 1VJ1A 3HADA 1G291 1QKIA 4GU5A 1R4NB 4B44A 2DH5A 5A0FA 3NONA 3EVZA 1MB3A 1CIVA 1P5ZB 4ENVA 2B5LA 1NN0A 3FPLA 1W6UA 1ZUNB 2QVLA 4I55B 4JSXC 1U3VA 4BNVA 3UK1A 5IBRA 4Z9FA 1V2GA 4LJRA 5TF0A 2NPOA 1W4ZA 4FAVD 5L3RA 4RQAA 4RUKA 4ZO9A 2OXTA 4GMDA 1THGA 1X42A 3M2TA 2LPMA 4FZJA 1Z75A 1RYDA 3EWAA 2WHEA 4A7PA 1EQUA 1C1YA 1NBME 3W1VA 2Z6VA 1UJ6A 1U2GA 3Q41A 4LKOA 4BC0A 4TTRA 4TQAA 3JQ7A 1RQXA 2VDWA 4DR2B 1U2RA 2GCPA 3DNMA 1JXAA 2A2ZA 4P8RA 4C9BA 4FYYA 1JFSA 3VO9A 5HR5A 2PRSA 1P7YA 4AMZA 3VKHA 3KD2A 4E5YA 1SCUB 2ZBUA 4ZPJA 5HXAA 1G8HA 1GA1A 3BK7A 1TTPB 3AVVA 3VR4A 3GFGA 2I7DA 4BMSA 1T1RA 5A6VA 3FAZA 4AO7A 3LXUX 1LGYA 1GRVA 2EZ9A 4L3WA 2B4EA 3UVMA 1MAAA 3BPSA 2YYAA 5B4TA 2P3LA 2O0JA 4DR7B 3K9GA 4B6GA 3TMYA 4B35A 4Z7OB 4C5BA 4XJVA 3F90A 1ATZA 4RX1A 4OREX 4JEIA 3RJZA 2PQ2A 2XQGA 1U4SA 4NU6A 3E35A 4RF4A 4RXMA 5JT1A 4R8KA 5A3JA 2QIPA 2PCLA 1JG1A 1XLTA 3B2EA 4RMIA 2PQ0A 2ZSDA 4RPCA 1T9HA 2ZVQX 4IRUB 2BTOA 1QG2A 3PFGA 2IYPA 4FOTA 2IEGA 3EIHA 3KVNA 2UYYA 1RJEA 5HDBB 4B3DA 1ULHA 4LFBB 1OVMA 3WFZA 3RHTA 3ZCRA 3ORSA 2J0QA 4P84A 4PXSA 2IIPA 2E5FA 2NO5A 4XQCA 3WYCA 3ENZA 1JHYA 3QPDA 1XAHA 2J4FA 2ZWIA 5EHGA 4FE3A 3QYAA 4CKBA 2B4QA 5CVUA 1M2JA 1MOPA 3EFBA 2NMVA 1BXZA 2JHAA 3EXG2 4IQ4A 4DT1B 3IJPA 4E6PA 2RGEA 1G6OA 4CLOA 1QRDA 3N2NA 3SE0A 3D8TA 2VDNA 4JX8A 1M67A 4JT5C 1DC8A 4YCLA 3E53A 3VO1A 4CMKA 1G8SA 3DEIA 3Q4GA 4F2GA 3BBLA 2ZE7A 1ECCA 3HDYA 4RA6B 2Y27A 3SR3A 4FWTA 3N2YA 2ASEA 3GIWA 4Q93A 4FB4A 5K3DA 1T8TA 2LR0A 2GCEA 4HEJA 4QVGA 5B5SA 2A6PA 4WBSA 2HW8A 3E9NA 1OAOC 4FPXA 4R69A 1WKBA 4WDRA 4NAUA 1TW2A 3TKAA 4UFPA 3EUAA 4YP6A 2WT9A 2X3UA 4YRGA 3WLFA 4IMRA 3TOZA 1NVAA 4DBZA 3C8MA 2DETA 3PGA1 3MCZA 5HZHA 2WYVA 4UM9B 2PMCA 2QDXA 3SMQA 1WU7A 3ZHSA 1XHEA 1NW4A 3N6VA 2DY0A 4XE5A 4GSLA 4PV7A 4ZU6X 3BFJA 2ADOA 3TAUA 4YRIA 3C6MA 4OHUA 2XHEA 4PN7A 5KVAA 1W25A 3LQRA 2XCSB 4U7HA 2GN2A 4RVFA 2B5WA 5EWMB 2RHBA 3CE9A 4YT2A 2V9CA 3RSFA 1CB7A 3IHWA 2B3DA 1J23A 5UKDA 3U80A 1NONA 2QTFA 1JDPA 1GRCA 3HGMA 2HO4A 3MEQA 4YCBA 1SHUX 3JD4A 2BGKA 1L4YA 3I7NA 2OQIA 2IFTA 3M5CA 1H4VB 4DVJA 4RABA 3ZHVA 3W05A 4IXMA 3AY7A 3KT3A 3K5PA 5TQVA 4OV6B 3W9YA 5JH7F 5F5LA 4QXPA 4ZI2A 3KX2A 3GG9A 3N5CA 2VSQA 1I36A 1JG6A 2BGTA 4RGBA 4YK7A 3H19A 5DM4A 4V24A 1YNSA 4U8HA 1VCNA 3PD7A 4BHTA 1AE1A 2IXTA 1LW6E 1SNYA 5AJAA 5FULA 4YFYA 1FQOA 5CT4A 2Z08A 3L5KA 2AFHE 3HCRA 3TPZA 3HL0A 1XF9A 4OQMA 4YJFB 3TIFA 5D5PA 2FW9A 4BEVA 3P9PA 4LVCA 2H2DA 1SHYB 5FTMA 4FEEA 1EFCA 5T57A 3GJZA 1I2MA 3GLRA 5I9TA 4FMBB 5ARBA 4QGSA 4ZOAA 2HMVA 1R6VA 4L2IB 1TA0A 5D5QA 1V1MB 1BNCA 2O8EA 1CC1S 4L74A 3RN0D 3O95A 4JI1B 1QQTA 1RZUA 5D3ZA 2CFOA 2Y6UA 4KE8A 4QTTB 1H3FA 4XTCS 1Z8DA 1RWXA 1KK2A 2Q2OA 5IUNC 5I01A 2XGSA 3OFKA 1KI2A 1LSOA 1BWQA 4OWRA 3EA0A 4FT4A 1XN4A 5HX7A 1F8UA 4AURA 2XUFA 4B71A 3IVXA 2WZQA 3F7NA 4KNYA 3U37A 5SY6A 3LH5A 5FORA 1RWVA 1C3JA 4LA4A 4C0SA 5DLDA 3NALA 3AEUB 1SVUA 1YJ5A 4KMSA 4HWTA 1YE5A 1ZNXA 4NENA 3AF0A 4AI6A 4JNCA 4G9EA 3KCNA 4CQLA 4GQ2P 5BQXA 3IAM1 3B48A 1P75A 4H1HA 4IDQA 4U8GA 5TQ0A 4QARA 3RJ5A 3EI3B 4R81A 2D2VA 3G5MA 5BVHB 3PENA 1L5HA 2NV0A 3HP4A 2IWKA 1UJBA 4NMWA 5CD1A 4D9IA 3E22B 3O6VA 4BO2A 4B9EA 3ZZMA 1TC2A 4HNAA 3CTMA 1VKHA 2CLCX 4DADA 1AQLA 1TKAA 3GIDA 4FB5A 1YCDA 3O4VA 2VAXA 2ZREA 3WK7A 3K3PA 2OAP1 4HB0A 2P9FA 5HSGA 2J87A 4NJMB 1RXCA 2OECA 4D79A 4LRXA 4NE2A 1DRVA 1Z5VA 1V71A 1YONA 3GT0A 3QI0A 1MDBA 2O23A 3QI2A 1JXQA 1CNEA 1VHTA 2PT9A 4M86A 4KH1A 5KNCH 4E14A 2OFFA 1ICIA 3QKTA 1ZGJA 3RANA 2Y1DA 1WUTA 2PKXA 3BMCA 1XTIA 4G2NA 4XUEA 1UMDB 4ENTA 5LIPA 3S2ZA 4I4NA 1NQAO 3G2PA 2NUTA 1CUUA 3MWEB 1WF6A 1U2PA 4E3ZA 3GAZA 3N05A 1GZ5A 2PXHA 4ZVKA 1KI9A 1MW9X 2HRQA 1WQ4A 3I37X 5DYIA 1WBDA 4PZAA 4XOIA 1O57A 2W48A 1ODJA 2RCNA 1ZHHA 5HCUA 4AQ7A 2P3OA 4IZOA 1AC5A 5DDIP 1S2MA 3IX7A 2V1UA 1T24A 1VL5A 1SU7A 1VJTA 3FCSA 3RUDA 2YQZA 3GP8A 1HFJA 2J5XA 3TEJA 5CG1A 2CLKB 5BO5A 4X7BA 2B25A 1Y9EA 2A14A 5LP6F 1JPJA 5DLQC 3M5DA 3ZQKA 3AFNA 1P60A 3B6KA 5ITZB 5EIXA 1RMQA 4C88A 5TQ2A 3QPUA 3CNEA 4XVHA 4JC0A 4BLUA 4OQNA 4AMUA 4BEBA 1SA0B 4LFAB 2OB1A 1M8KA 2V6BA 3HU5A 5JY1A 2BGJA 4HQNA 5IM5A 2H3EA 3VDMA 4MV5A 4P33A 2GZMA 3IERA 4BBAA 4IIBA 4ARIA 3B53X 2B37A 2RK3A 2DUMA 1L4FA 3A4TA 2FMTA 1LQTA 5JNSA 2BEJA 5HWSA 2H1CA 3KEGA 4PHFA 1IM5A 5JFOA 4UXIA 4JS0A 4YBZA 5FLKA 4KXVA 3G59A 3LG2A 1IJKA 2QU7A 3PDJA 2JAOA 5SXMA 2XYQA 1E3LA 4J1TA 4ZA2A 2X8JB 3R2JA 5F5XA 4EEKA 2W6NA 5DO9A 3WGUA 1YKGA 2QG4A 1SXQA 3VNAA 2WWWA 4RTRA 1T13A 2DTEA 4L8LA 3ZK7A 4Q3LA 2DSNA 2WA2A 3GLGA 3U3OA 3AONB 1OFTA 1Q3KA 3D0OA 1OAKA 1V7ZA 1T8PA 3GCXA 2PDAA 4CW7A 4J91A 5EMMB 5FLXg 1RCUA 2IPLA 3F67A 3EZLA 4EB8A 4AY2A 3RSHA 3UAVA 4WNCA 4EARA 3TR6A 2XWJI 3KOWA 1ULUA 4XR9A 3O94A 4U6QA 2R6FA 2P7HA 4RWEA 3EI1A 1P4GA 1L4BA 2GAAA 1IIBA 1XTTA 3PHJA 1JTVA 2NTVA 3G7SA 2Q5FA 2XB6A 3B9PA 3GLVA 5F33A 4FBMA 3L1JA 3FTCA 2CJYA 2BTQA 1QTQA 3AXTA 3JPWA 3EGCA 1POXA 1SGWA 3W6NA 4KR2A 5K0GA 4HWKA 4LNHA 4TTSA 4B5LA 4TUYF 1G4UR 2QX8A 5JJLA 2Z3VA 3M6VA 1DKRA 3QA3E 1JH8A 3H6HA 4L4XA 4GWLA 4TXMA 4GX5A 1FJXA 3KBOA 1XHMA 1W0KD 3RPEA 3F47A 3NETA 4NU5A 3DDZX 1JQKA 2B1GA 2I9KA 2V96A 3AKDA 1BVUA 1WE2A 3PA8A 3ITKA 3KSMA 3T34A 1TCUA 1I5EA 1H0SA 1RYHA 2PX3A 1JSLA 1V1JA 2QRHA 4J7UA 2Y1LA 3QG1A 4KV7A 4D3ZA 1SPXA 3EYWA 1U6IA 3U09A 3LPLA 1IQUA 3N3AC 1U1DA 4GI3A 4M0LA 3A1TA 2BL4A 4ER7A 1R9GA 2DWPA 2EIEA 2G4VA 2XLBA 1JA0A 2HNKA 4JUAA 2YJTD 2FSFA 4DN6A 5THAA 1MAWA 2QRNA 2RB4A 4CNQA 3A37A 2C4KA 1M7BA 7AT1A 3ROFA 4BO3A 4B81A 2FZGA 1KS9A 2IRWA 2WMDA 5EIHA 5CH3A 4DR4B 4GICA 3Q5DA 5I45A 5JRZA 5BURA 4DGQA 3PFWO 2OHFA 5IT9A 1MJGA 4QTXA 2YV4A 1XTSA 5BQOA 4HK4A 3C74A 2RAFA 4B6FA 4N3CA 4BIMA 3K94A 2CHGA 1E5DA 1CU1A 3K15A 3MMXA 1RFGE 2GPYA 3PYXA 3ZXUB 1WCYA 2EGGA 3BBPA 3W6ZA 4IXDA 3I23A 3WYNA 2V7TA 3Q6IA 1V39A 1U7OA 2A9JA 2JCSA 4MNTA 1I5RA 2B3TA 3FNEA 5A6SA 3IIYA 1RC0A 3JQ9C 4L5BA 1GQOA 1NJGA 3OLYA 3CJTA 1S2OA 3ZWOA 1MC5A 1EXVA 2MCFA 5DNWA 3ZWMA 2XJ9A 2Y9PB 3KE9A 2DQKA 1DXHA 4GKAA 4ND8B 2A86A 1DCTA 3TLAA 2X22A 2J9XB 5IKOA 1MIOA 3DEHA 2JA1A 4OGLA 4GMGA 5A02A 1S6YA 3THRA 4E1VA 4HAZA 4DIKA 1W4BA 2XF2A 3C1OA 3T1NA 4YCNA 5JWHA 2A3RA 3KJEA 4HXYA 5L7WA 2HDWA 1O6FA 3P9IA 5K3SA 1ISPA 4II7A 1UMCA 4EATA 2WT4A 4HDMB 3DCJA 1U3WA 4L7QA 2DLDA 3EODA 5P21A 1JQBA 1O5IA 4EFNA 3FM0A 3FVVA 3C15C 2IXEA 3OPYB 3ZGXA 4W1RA 3VPSA 4NX2A 7MDHA 5JMPA 3FTFA 4S1TA 4LBYA 1EX6A 5MGBA 4I4TF 3R75A 4C4YA 1KOGA 3KKLA 1IY2A 4JUCA 1KXZA 1DU4A 1BE8A 2CKMA 2PRJA 5KWEA 1XTKA 4P7BA 4G5GA 4CKZA 3STYA 4RETA 1ZM4A 3T9FA 1YB5A 4UARA 1U8YA 4G5HA 5KQLA 5A9SB 2GX6A 4WN9B 4P3PA 1EWRA 1N9GB 1XCLA 4JT6C 3SJAA 1FUEA 2AYYA 4UREA 3SX2A 1HI9A 1X92A 3D3NA 5H81A 2WF5A 5I51A 3IUJA 3DAOA 1D3AA 4RIEA 1K4MA 2XZOA 5BMVF 2H47A 3WRYC 3BJRA 3RUPA 4V1CB 1QNIA 2QX6A 3W7AA 2QJWA 5AVVA 1ZEMA 4YMVA 2OBMA 1WOMA 3NFRA 3D43A 3B6ZA 4U3JB 2H6KA 5JMWA 2QZZA 3W5JA 3QMMA 3UMMA 2AOUB 2KX7A 4DNWA 5ANRB 3LNCA 4MYUA 3WV4A 3AILA 3L8CA 2P9LC 3V7WA 5FQDA 4JEUA 3TSCA 2VTBB 3R3WA 1X7YB 3RIEA 5CIQA 3ZR4B 3GREA 2FPIB 1UWKA 4FFLA 1O9GA 3IQIX 4YMSA 2JDID 3W8RA 1P3DA 3D8UA 2FF7A 3H5IA 1M1NB 3CCCA 3TG8A 3RTDA 4DXHA 4HWGA 3GVIA 3L6BA 4GOOD 5AVWA 3H1EA 3OT4A 4DGSA 4YRBA 5IJ0B 1EDZA 4TSFA 1K68A 1DQSA 1QHYA 2QTWB 1C1XB 1JSXA 4PPNA 4G8BA 3I0MA 3MGGA 1GRQA 4Q9DA 2C2MA 3ADPA 2FZKA 1ZUWA 1TYQC 5ELXA 3ES9A 3IFSA 1DIGA 1RP1A 1JQLB 4BOYA 3CEAA 1F2VA 4XARA 3TSOA 5LXTA 3EI2B 4UCWA 1KMHA 4DCTA 1TAQA 1A7UA 3U3ZA 2GXSA 3HS3A 4O6VA 4OBXA 2P9YA 3LUPA 2CGEA 4UHEA 4YN3A 4MPDA 4BO9A 1H22A 4P22A 1RTKA 1FU4A 4L9RA 3ZZNA 4LMBA 4KVZA 5C4GB 1C0IA 1NUQA 3GGJA 2F1RA 5C1IA 3R3SA 1R10A 4RM2A 3VMMA 3L0SA 5K3FA 3NPAA 2H52A 3KUXA 3UN1A 2PG3A 2AUTA 4X44A 4CU2A 2ZI7A 1CZUA 3ITNA 2Y0CA 3N8KA 5A5GA 2KLBA 3UKRC 2GN8A 3DL4A 3T7IA 1N2CB 1BHSA 1V6SA 3OL2B 4JXMA 1RWNA 3KLMX 4LJLA 4MHSA 4WDQA 4TV9F 2VDKB 4TLEA 4C6TA 2ZE8A 1C3LA 3DUWA 1EWVA 3RUEA 3EMVA 3W7BA 1FJ2A 3D5QA 3ER6A 1WQ3A 1NLZA 1T35A 3H5OA 1I0IA 1RD4A 4ZPXA 4X95A 4EUNA 5BPFA 1P45A 1W8IA 4BMXA 5KYYB 4V02A 3O4GA 2Q0HA 3HCNA 1DWQA 2BBOA 3FZQA 5FKRA 3WGYA 1OAAA 2UVPB 1VL2A 4DY6A 3BZUA 3X44A 3MT9A 4OJYA 4QNMA 4J8PA 2QZSA 3OT5A 1VSBA 2ANBA 2O2CA 3VAZA 4DMHA 3AVOA 4KDEA 3GDHA 5LR6A 5B6IA 1IAVA 2C5FA 3E5HA 5EP1A 5LMCA 2PX6A 1GGVA 5KS2A 3PPVA 4CT4B 3O1JC 5ES3