3IUWA

Crystal structure of activating signal cointegrator (np_814290.1) from enterococcus faecalis v583 at 1.58 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
QHPTIHTLKIETEFFKAVKERRKTFEIRKNDRNFQVGDILILEEYMNGMYLDDECEAEVIYITDYAQREGYVVLGIELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activating signal cointegrator
publication title Crystal structure of Activating signal cointegrator (NP_814290.1) from ENTEROCOCCUS FAECALIS V583 at 1.58 A resolution
rcsb
source organism Enterococcus faecalis v583
molecule tags Rna binding protein
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12961 DUF3850 Domain of unknown function (DUF3850)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 3iuwA00
1XNEA 2Z0TA 2KKUA 1TE7A 2DP9A 1S04A 1WK2A 2E5OA 3IUWA
chains in the Genus database with same CATH superfamily
1IT8A 1XNEA 1R3FA 3LJCA 1UOYA 1IQ8A 1S04A 1TE7A 1WK2A 1WXXA 2B78A 4CI1B 2RFKA 4CI2B 3M4XA 1ZL3A 3LWRA 1ZBOA 1SQWA 2AB4A 3LWQA 3HJYA 2KKUA 2CX0A 3M6WA 3UAIA 3LDFA 2CX1A 1ZE2A 3M6XA 1R3EA 1Q7HA 1SGVA 3ZV0C 3LWPA 3MQKA 2ANEA 1T5YA 1WXWA 2P38A 2AS0A 3D79A 1K8WA 4TZ4C 1IT7A 2Q07A 1ZE1A 2J5VA 3VSEA 2APOA 4DMGA 2J5TA 3IUWA 2FRXA 3LWVA 3LWOA 1ZS7A 1J2BA 2Z0TA 3U28A 3HJWA 2DP9A 2EY4A 3M6UA 4CI3B 2HVYA 4Q1TA 3M65A 2CWWA 3HAXA 3M6VA 2E5OA 3C0KA 2AUSA
chains in the Genus database with same CATH topology
1XNEA 2Z0TA 2KKUA 1TE7A 1S04A 1WK2A 2DP9A 4C26A 1WHZA 2E5OA 3IUWA 4P78C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNE A;  2Z0T A;  2KKU A;  1TE7 A;  2DP9 A;  1S04 A;  1WK2 A;  2E5O A;  3IUW A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  1XNE A;  1R3F A;  3LJC A;  1UOY A;  1IQ8 A;  1S04 A;  1TE7 A;  1WK2 A;  1WXX A;  2B78 A;  4CI1 B;  2RFK A;  4CI2 B;  3M4X A;  1ZL3 A;  3LWR A;  1ZBO A;  1SQW A;  2AB4 A;  3LWQ A;  3HJY A;  2KKU A;  2CX0 A;  3M6W A;  3UAI A;  3LDF A;  2CX1 A;  1ZE2 A;  3M6X A;  1R3E A;  1Q7H A;  1SGV A;  3ZV0 C;  3LWP A;  3MQK A;  2ANE A;  1T5Y A;  1WXW A;  2P38 A;  2AS0 A;  3D79 A;  1K8W A;  4TZ4 C;  1IT7 A;  2Q07 A;  1ZE1 A;  2J5V A;  3VSE A;  2APO A;  4DMG A;  2J5T A;  3IUW A;  2FRX A;  3LWV A;  3LWO A;  1ZS7 A;  1J2B A;  2Z0T A;  3U28 A;  3HJW A;  2DP9 A;  2EY4 A;  3M6U A;  4CI3 B;  2HVY A;  4Q1T A;  3M65 A;  2CWW A;  3HAX A;  3M6V A;  2E5O A;  3C0K A;  2AUS A; 
#chains in the Genus database with same CATH homology
 1XNE A;  2Z0T A;  2KKU A;  1TE7 A;  1S04 A;  1WK2 A;  2DP9 A;  4C26 A;  1WHZ A;  2E5O A;  3IUW A;  4P78 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...