3IUYA

Crystal structure of ddx53 dead-box domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
213
Chain Sequence
MTCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX53
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 213
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iuyA00
1P2TA 1JXOA 1VG0B 3KKNA 2FSIA 1NRJB 3QXSA 1LW7A 5EJEA 2KSQA 3QF4B 2ZSFA 4LGMA 2CCGA 3JZMA 4US0R 2OG2A 2GJSA 2IYZA 1U81A 5EXPA 5FTKA 3I32A 4LV8B 4OK6A 1FP6A 2RGDA 2P3SA 1E79D 1S1CA 4O25A 1P9WA 2QY9A 4D0NA 2AKAB 1RW4A 3P26A 1OFUX 4B6FA 3TVDA 1ZW6A 3C4JA 3SZRA 1Z2AA 1N6IA 1UEIA 3GLHE 3BFKA 1SULA 5BWMA 2J41A 3OE7A 2LCFA 1Z28A 4P0TA 4B32A 2V8OA 3E2IA 1HY3A 4PPQA 4NL4H 1X3SA 1T91A 2IYWA 2VTKA 3AF3A 4OKSA 1EFTA 1JBKA 1YJ5A 1WDTA 4JSTA 3OFNA 3TSOA 3K1JA 3FKSA 3OIVA 3P4XA 3SE0A 4Q9JA 5JRJA 2H57A 2GZHA 1ZNYA 421PA 3FMOB 4TT3A 1M6NA 4UNRA 3V00A 4EJSC 1KZGB 1JEEA 2J7PA 4XOIA 2BMFA 3QUSA 2R9VA 3WYGA 3VNUA 4QXAA 1PUIA 5DHFA 1NP6A 4A0FA 4EPYA 5TB5A 2NO7A 2C96A 3OIWA 2CJWB 1D6JA 1XNJA 2FGJA 1J8YF 5CB8A 1CF4A 5SZHB 2HEIA 2QM8A 2IK8A 1Z6GA 1E69A 1UF9A 4E22A 1R5OA 4TSFD 3A37A 1Q1QA 4Q7KA 3AF1A 4JKYA 1ZJ6A 5L3SA 4I1OA 2G6BA 5JI3E 2FPKA 2JDIA 4M9SA 4IW3B 1K5GA 1DAGA 3VHLB 1IOZA 2QPAA 2XZLA 3NH9A 2GXSA 4H1UA 4UNPA 1GNQA 1W4BA 3ZD6A 1KI2A 4LJ7A 3NBZC 3CRW1 1GKUB 4BRUA 1VKJA 3L43A 3B6EA 5DN6A 1S8FA 2OLJA 3AVTA 4DT1B 3HU1A 1GKYA 4DJTA 1G4AE 1UKVY 4V0ME 3GLIB 1P2VA 1U99A 4NYIR 2IUUA 1FMLA 1E2GA 1SVLA 2YOFA 3L0IB 3ZD7A 3Q7PA 4Q4JB 3LY5A 3PENA 1N6NA 3QXCA 3T1VA 2Q21A 3HJNA 4AK9A 1NY5A 5H70A 4Q1DA 4WXPA 3THWB 1OIXA 2QRNA 2J0UA 1JB1A 2CL0X 3I92A 1T0JB 2BKEA 4US1R 1YE8A 4FI3C 4DCTA 4DZZA 5J4LA 1DO0A 4MGZR 3CB4A 4JZKA 4ASUD 5JECA 5GJBA 2W2VA 3ZVNA 3KKPA 1II8B 3L82B 1EXMA 4TLCA 3NHBA 3X1YA 4JVNA 4WIAA 3SQWA 2ZRFA 3HU3A 4S2EA 1N0UA 2OAP1 3TQCA 4BFSA 2ECKA 4CT4B 4M21A 2A7QA 3JZAA 3ICQB 5J5CA 4RFSA 3CNLA 2ZRMA 2V7QA 3LLMA 4LX0A 3UIEA 1KO8A 2QZ4A 1GAJA 3QKRB 2HXSA 5L3VA 4C30A 3SU8A 4EPWA 1GKIA 4HAVA 3B1YA 2UKDA 1JR3A 4KFRA 3D3QA 3KFXA 2Z4RA 1W0KD 1XZQA 3EIHA 2W6JD 4PZLA 4TZ0A 1OHHD 1TEXA 3IHWA 1WP9A 4CEIA 1E94E 1OW3B 4BZQA 2G0TA 4GL2A 2AHOA 1A7JA 2Z83A 1XZPA 2BDTA 3WHKA 3P32A 1NN0A 2FEOA 2EFDB 2ZREA 1A4RA 2F1IA 1FTNA 2VF8A 3EZ6A 3RS5A 4JVLA 5KSZA 2RAPA 2ZJZA 3IHLA 2GETA 1VCIA 2GCOA 2O0KA 3Q85A 4GZLA 4LPSA 1IQPA 4M0LA 5DSZA 4B71A 2ERXA 5BN4A 4FMCF 5FBLB 4NCJA 2ZJ8A 3THYA 3X1WA 2HT1A 3RRNA 4GOXA 2JLYA 1ZCAA 5G41A 2F55A 4PO9A 1KI1A 4HB2A 3AKEA 5L3QA 2DFLA 1GM5A 1I4TD 2AFIE 2VP6A 1WRBA 2A5JA 3CF6R 1U9IA 1YZLA 3T1OA 5CDFA 1R10A 2V9PA 2F1JA 1RYHA 1N6PA 3AP3A 4HYYA 4ZO4A 2OHFA 5DYGA 1G8GA 3IBYA 1F2TA 1RRFA 2PEYA 3AUYA 3AVOA 5EP2A 3QBVA 2ODWA 5ANRB 4MYCA 2YWHA 4IXNA 5FUXA 4ZIRB 4Q1FA 1NLZA 1KKMA 1A2KC 2VO1A 3M0EA 4JLVA 2R6FA 3GLGA 1WF3A 1TADA 3V4FA 5B57C 1DADA 1JR6A 2ONJA 1DG1G 2E87A 3HDTA 4P33A 4F4JA 3B9QA 1L7VC 4QBGB 1AZTA 1UKZA 2QGZA 2KBEA 2ZAMA 4M2LA 2PH1A 2C2HA 5G53C 4BFZA 1FPMA 1DAMA 3PR1A 2ODBA 1C4OA 2F6RA 2Z4SA 3CIOA 1I4DD 3NVAA 2JATA 2QPOA 2FF7A 4RSGA 3ZZ0A 4QGFA 2I4IA 4GOJA 1OB2A 4IVPA 2VHUA 4NCHA 1TUEA 2ZRDA 1GP2A 2ZQ5A 4B34A 4MDEA 5FI0B 2B7BA 3I5YA 1ZP6A 3NHAA 3KKQA 4TLDA 4QM7A 1IHUA 3QF4A 1PJRA 4M1MA 2AFHE 2GILA 2WICA 2YVUA 3FFBA 2VEDA 3KB1A 5JJIA 3EZ2A 4TTPA 2XB2A 1WE2A 4QC2A 2K5UA 1OFTA 4Q4HB 5EQTA 2VP9A 2Y8EA 1T4GA 3GJ0A 5FL7D 3SYKA 1Z6TA 4HZUB 4OQFA 4MRPA 3PV0A 1ZNXA 2HDNB 2ZI4A 1NBMD 4NU0A 4BZXA 2P6RA 1IAQA 4AURA 3FYHA 2J45A 4FCWA 1AKEA 4TQAA 5HCNA 1SKQA 3CNOA 3AKDA 4OQNA 1E9RA 2CLDX 4MKFA 3WRYC 2XOKA 3AKYA 1QG2A 2IYTA 1EX7A 4B44A 3B13B 5TXGA 2GKSA 4DKXA 1XJCA 2QMHA 5AWFC 3EPHA 2WV9A 2F43A 1LS6A 1Z08A 2A78A 3BFVA 3GLFB 1J7KA 2ZE7A 2N42A 3UG6A 4BFTA 3TMKA 1KHTA 1ZIPA 3Q5EA 3A8TA 2C77A 2WWXA 4EPVA 1DOAA 2BJWA 1IXZA 2CCKA 2XNDA 3A1TA 1N0WA 3U7EB 4B48A 4YMTA 1BMFA 2NZ8A 1NN5A 1KY2A 2PMDA 1AN0A 2VP0A 3NTUA 4B33A 4G5RA 4HUTA 1NL3A 1I2MA 5JCZA 3K9NA 1Z8FA 2CVHA 2DWPA 2I1VB 4JLPA 3BAFA 1ZM7A 1NVUQ 5E3HA 4A0HA 1KK0A 1YHNA 2FGKA 5EZ5A 3K70B 4MH0R 2QNRA 3GQBA 4KU4A 5FH9A 4PC2A 5J47A 3F3YA 4DLXA 2GJKA 3ZZTA 1XD2A 2ZE6A 2V3CC 4LPKA 4MRSA 3QQ5A 1OXXK 3BBPA 3VMFA 3EG5A 5KNCA 1NN1A 2Z5FA 1Z2CA 4XH9B 5FOVA 4OHYA 4Z1MD 5C1BA 3EASA 3P20A 1FX0B 2OAQ1 5TV2A 2ZE5A 4LYFA 1FNNA 2GA8A 2QQEA 3SJCA 3THXA 1AM4D 3TGPA 4KXFB 1OH6A 4RD4A 4Q9HA 5FI1B 3RS7A 2IYSA 5B58C 3CLVA 1Z5ZA 4DIEA 1O87A 2ERYA 5K8UA 1DVRA 4DT1A 3R8CA 1OXTA 1YR7A 4JLBA 1KNXA 3GLIA 5CJPA 2BBOA 2XITA 1L8QA 1XJ0A 1RPZA 3I3SR 3RRMA 1DELA 5F3WB 1ZCBA 2GZAA 2WIAA 4R9UC 1AGPA 1P72A 1E9DA 1P60A 4Q4JA 1NVXQ 1E2LA 2ATVA 2FZLA 1NVWQ 2QTFA 3MD0A 3ETLA 2ZRKA 4XVRA 2XTNA 4GOKA 1KO7A 1ZC4A 2WJJA 4EPXA 5AUPB 3THWA 1Q21A 1XXHA 1COWD 2O0JA 5JHHB 4U00A 2VQSA 1HTWA 3DZ8A 1RFLA 3AV0B 3GEEA 4C0QC 2YC4C 4MUAA 4MYUA 1Z06A 2VHTA 1VYVA 1X8LA 4PC6A 2BIFA 3ADBA 3RWMB 1YZKA 2OFOA 4RVCA 1D2MA 5JMTA 4Z8YA 2IS6A 1II8A 4B47A 4JLJA 5GADl 4NMMA 1ZAKA 3RRZA 3ADKA 3A4MA 4JJZA 2CL7X 4LJYA 4IOLA 5DGXA 3DL0A 2IA5A 4D2IA 2BKUA 2GCNA 1H8EA 5CK5A 2DBYA 3CR7A 4R71A 4A0GA 621PA 5ELXA 1G16A 5DHAA 3H2YA 4LDJA 2DCUA 1IN6A 5FBWB 4IOMA 3CRRA 2XXAA 1MH1A 2BBSA 1RKBA 3CZQA 3QKRA 5FR1A 5TY0A 1WBBA 1TX4B 3LBIA 4G5GA 1G18A 1U9IC 3ZJYA 1OFHA 4OQMA 1ESMA 4GP6A 2C78A 2YYZA 5LB2A 2G1KA 4L9WA 5FOUA 2O8EA 2NO9A 4B3FX 4LHYA 4QJ4A 5KOYA 4FIDA 2R65A 1W4AA 2A3RA 4HB3A 4DSTA 3TKLA 4UXJA 3C5CA 2QTHA 4OL0A 1ZM3A 1EWQA 2J87A 4JLOA 4Q00A 1GWNA 4US2R 3U4QA 3I73A 1S4QA 2JIZA 2ZR9A 3REFA 2J46A 5KPDA 4B2IA 2A30A 2WZQA 4LRWA 1KSHA 1DPFA 5CIWA 3RRYA 1KIMA 1KI9A 1OYWA 1II9A 2GXUA 4LYJA 1K5DA 1T8TA 3U61B 4E07A 2O8FB 3FVQA 3R20A 4HI0E 1XEXB 2ZR7A 4OK5A 2QA5A 2GCPA 2IHBA 3L8ZA 4MDFA 1Q1BA 2PZEA 3OEHD 3MSXA 1AQYA 3WYFA 4AD8A 5M04A 2O8CA 1E1RD 4LHVA 1UDWA 2RH5A 1LFDB 3W3ZB 5LPNA 2J0UB 3UATA 4B75A 5KNBA 4M9QA 2DB3A 4MITA 1YZNA 2QG6A 3B60A 3RAPR 3BS4A 5J4HA 3BB3A 2VP5A 2ZANA 1C1YA 4BFXA 2D3WA 1QRAA 4C0LA 3NKVA 1QHHA 4OI2A 1CIPA 2RGGA 2QI9C 3R9IA 1ZUHA 1HUQA 2J0QA 5K8LA 1KKLA 2GXQA 4GPTA 4E5UA 1UBFA 4F92B 2YJTD 1R2QA 2WWGA 3NH6A 4RFSB 1J2JA 1QHXA 3TW4A 4DCVA 2O8DB 1OF1A 1NMZA 4PC7A 4EFMA 4A92A 2R6AA 4ZIRA 4C4PA 3VKHA 1R0XA 2C5LA 3WNCA 1NI3A 2WJVA 4Q7LA 4A9AA 3ZS8A 4MGKR 1W36C 2CE7A 3GPLA 4QM6A 3AGPA 4Q02A 1E9FA 1TL7C 2AD1A 2OCAA 4D0GA 1RE0A 2ZI7A 3K0AB 4MGIR 4UNSA 1K8RA 2ZPTX 5AJZA 2GDJA 2GEVA 1PZNA 4CVNA 1GITA 2DFKB 3T5DA 1IONA 5E4FA 1U94A 5GJVC 5GVSA 2ZR0A 4CEIB 3D8BA 3L2OB 4JL5A 4PZZA 3QJYA 2XSZA 4Q9LA 3AVYA 2KWIA 4YMSA 4URXR 3A1WA 3SDZA 5DNYB 1GFIA 1G9XA 1Z0JA 2GCOB 2BMJA 3AVPA 4OI4A 1E3MA 4JLKA 3HU2A 2IEYA 2OXCA 2WKPA 3TAUA 4CIDA 2WJGA 3I61A 4KYUA 3PXGA 4DLZA 1GSIA 4Y0VA 1Q12A 1N6LA 5FTLA 1TU4A 1XTKA 4EKDA 3LW8A 1SQ5A 2Z0MA 1HQCA 3W8RA 2FPLA 1XD9A 3MFYA 2JJ1D 4EAQA 4NH0A 3TR0A 3WBKA 5L3QB 3BJIC 3P4YA 2C99A 4JBYA 2ASEA 1JQLB 3O47A 4HZUA 2JLWA 4Q5IA 3WP0A 2OM2A 1FMJA 4DUGA 1FQKA 1M1YE 2WOOA 1Z6AA 2BCJQ 4FW9A 3C16C 1G1MA 1NKTA 4KV9A 3KTAA 3ZIAA 2YWEA 1S0UA 4DLWA 1QHSA 2OBMA 1Z0KA 1OJLA 3VKGA 4LHWA 2OLKA 1W5SA 4P31A 3ZQJA 1R8QA 5IDVA 1Z3IX 4KFTA 4NP6A 2H5EA 4KFSA 4M1WA 1G3MA 1XU4A 2ZS7A 2HV8A 4BLTA 4BLSA 1EFRA 3SOPA 2ZRHA 3GLGB 4W5WA 2HLDD 3GLFA 3U7HB 1EWRA 4GBMA 4JS0A 1GNRA 1JEDA 4D6PA 3B8HA 3DO6A 3WNBA 4TTRA 2JAQA 4HAYA 2DFTA 4ZCMA 5BYKA 3TVTA 3SJZA 3U3OA 1NIJA 5CITA 4FWTA 3U3JA 1TF7A 4LBVA 1S1MA 2OILA 3VR2A 4WBSA 2CLSA 3RABA 3T06B 2ODEA 3N70A 2Z43A 2R44A 2ANBA 3K9HA 4PPGA 4ILEA 4U02A 4AYXA 2VP4A 3FFAA 1CJKC 1OYYA 4KLNA 4RD6A 3RLFA 3CONA 2P6NA 3AVUA 2AK3A 4UNQA 3VU9A 1HE8B 4MRRA 5JWHA 1E9EA 2WWIA 2Q3FA 4TYPA 2QAGB 1Z47A 4V0LA 3FTQA 4DIDA 3GJ5A 1VYTA 1FX0A 4FMDF 4YDHB 1MR3F 3TSZA 2AX4A 4I1UA 5AUNB 2ZJBA 1JQJC 4Q1CA 2VA8A 5A5GA 1ONBA 3K53A 3L0PA 4ACBA 4L16A 1BYUA 3CUEF 2IS2A 2CHQA 2CDNA 4DDTA 4F93B 1W36B 2W0SA 2EQBA 1IN4A 4BECA 5E7IA 4IFEA 4AC9A 3CR8A 2YINC 3WY9A 5JFGA 1P5ZB 2AK2A 2WKRA 3H1TA 4AWXA 3T12A 4BLPA 1IN5A 3KFVA 1G7TA 4D4KA 3TJZA 3CPHA 2AL7A 2ZRBA 1SHKA 1O3YA 4M53A 1SHZA 2QE7A 3TUJC 2WJIA 1SXJB 3TUZC 4IRUB 3LBHA 4KSBA 4L8GA 2RCNA 4TSFA 3D31A 1Q1EA 3AVQA 3X1DA 3SFZA 4QBIA 3AVVA 1X8JA 2DR3A 3AGQA 4Q9KA 2F43B 2F3TA 2ODNA 2GWHA 2RHDA 2TMKA 4BWYA 1JXMA 3OAAA 4A8JA 3I72A 1IM2A 4I1VA 2FE4A 4Q48A 1Z63A 5F9FA 5EP4A 4ZDJA 4M9ZA 1DAIA 1VPLA 1OT3A 2JA1A 4K81B 5F98A 1G19A 1TPZA 1FNMA 2NG1A 4HLUA 4JL8A 1F3OA 4OYHA 4B2PA 1DAEA 1P7CA 5JZVA 5EUMA 5DLQC 3F8TA 3T1QA 2GJ8A 2IF2A 2ZRNA 4RCZA 2FNAA 1EGAA 4PHFA 4ZDWA 3WHLA 4L4UA 3QBTA 3OZXA 1XD2B 5BN5A 4NYMR 2JJ8A 2Q9BA 4V0KA 5KTYA 1W2GA 3B1VA 3B9PA 3K09A 2SHKA 3QEOA 3KUDA 1OE0A 1Z22A 3EW9A 2J1LA 3THXB 2QTVB 2GRJA 2ZSAA 3U3MA 1TQDA 1TQ2A 4NPHA 2MSDB 3FKSD 5KDOA 4ASUA 2H17A 1Z83A 2PX0A 4B74A 4TYQA 2FN4A 4C2UA 1VCNA 2G0NA 3VR4A 4D4JA 2Q3MA 3V4RA 3FB4A 1YU9A 1ZUNB 4QGHA 4TT3D 1OKKD 2XZOA 2Q6TA 1CJVC 3I8XA 2O8FA 1XEXA 2J7PD 2PJRA 1P9RA 4XD7D 3N2IA 2FWRA 3BC1A 1S9DA 2D62A 2C8VA 3IUYA 3TK1A 4C2TA 1FTSA 4HDCA 1CR4A 1ZNWA 3J81k 1XXHB 1LF5A 1P73A 2YWGA 4FCVA 5JEEA 4AI6A 2FMXA 4TYWA 1CBUA 3U60B 5HKKA 1Z6YA 2ZIAA 1SKYE 2H8KA 4C9BA 3PFIA 4YONB 5B64A 1N6KA 1VHTA 4IEIA 2J3EA 2W6JA 4LBYA 2B7CA 1JAIA 4BFWA 4P32A 3EWAA 4PHTA 1SGWA 3FOZA 2UVQA 4DHEA 4URWR 1CKEA 1ELOA 4EFLA 2O8DA 3DVLA 4MKHA 2D7CA 4D4MA 4NYMQ 1B23P 4PQYA 1D9ZA 1IN7A 1IJEA 3IILA 3LXRA 2XXAB 3VX3A 2HYDA 1DE0A 4FWIB 1CR0A 1G17A 3TSWA 4A4DA 2QU8A 2D7DA 1XRJA 5DO9A 5G3YA 1MV5A 3GFPA 5FTMA 1KAOA 2X19A 3K0AA 4DSOA 1QG4A 2O8EB 4M22A 1ZM4A 3EA0A 4UKDA 4IDPA 1FOEB 1IBRA 3MWYW 4IJMA 1RVDA 5EUQB 3WMFA 4EDHA 2J9RA 1KI4A 2KE5A 1AS0A 2FFBA 4ZCLA 4A6PA 4C0AC 1LTQA 4ZDIA 2NZJA 3A1UA 1ZD9A 4DWJA 2IYLD 3U4QB 3SQXA 1UEJA 1UBGA 1G8YA 4V02A 3A58B 1SVWA 1XCMA 5F2EA 1XTQA 2NO1A 3BB1A 3X1XA 2BM0A 4PAQA 4D0LB 2QPTA 1NSFA 2QUZA 3VNVA 1N5IA 2V6IA 1T0HB 1GRRA 4C3ZA 1GG2A 2A5YB 3B1XA 2EVWX 1UADA 2D2EA 3G82C 2NTYC 4XJXA 1QHGA 1Q3TA 1P75A 2A5DA 2NOAA 1P3JA 1Z6XA 3LX8A 2KB0A 1JPNA 3TW8B 1KO1A 4WAUA 2O8CB 1XX6A 4GMXA 3PEVA 2WTUA 2V7QD 3KXIA 5K8IA 3SBEA 1U8YA 1GRNA 2F1RA 3K70C 4DB2A 3K9LA 4X8LA 5SZIA 3C7KA 3MMPA 1G5TA 2OT3B 2IX3A 1YVDA 3MJHA 2X1VA 5FOTA 1QHHB 4XVQA 1OIVA 3RC3A 3SJBA 1XDBA 4EPTA 5JJKA 1W47A 4PX9A 2GXAA 4N1AA 3KQUA 3ADDA 2D4HA 1QHYA 4B73A 4EQ6A 2GBLA 4CF7A 1ZYUA 2H92A 3EC1A 2F9MA 2IXFA 4QJ5A 4QJ3A 2P5SA 1GTVA 1OH5A 4WZ6A 5LDDC 1KDRA 3LLUA 4NONA 3KB2A 1H8HD 1VDZA 4MRVA 5HZKA 2DWOA 2O0HA 1R6BX 3AB3A 4TN1A 4I81A 4C0BA 4NE2A 1E4VA 4DCNA 2ZSEA 2H7VA 2PT7A 5L8VA 2EFCB 2W83A 5EE0A 4D82A 4G01B 2X2EA 4URUR 5CYOA 3WMGA 5JS8A 4RD2A 2CNWD 3QPUA 1E2HA 2FH5B 2QGNA 4O0MA 4P4SB 2D06A 1Q44A 2WVJA 5HE8A 5EP1A 3DM5A 3FHTA 1KO4A 2GHIA 2KJQA 4MGYR 5HTKA 4Q7JB 4I4LA 2ZITA 1ZINA 3LBNA 1BS1A 2A2ZA 4HUQA 2FU5C 3P27A 4M4SA 5LD2C 3IGFA 4DSNA 1H65A 2N46A 4BEJA 4IXMA 3I8SA 1LNZA 1AA9A 2O8BA 4URZR 1NBMA 2CBZA 2HF8A 2PZFA 5C18A 4A8JC 2QMUA 1US8B 5G40A 3W8NA 4V03A 1PLJA 1KI8A 2QAGA 4Q4AB 3UXMA 2PLRA 2WJYA 3CWZA 1WA5A 4O2RA 3D6TB 5FOSA 3QSYA 2XGJA 3B1ZA 4HLUC 4R7ZA 3QXHA 3ND8A 3LO5A 4TYYA 5EZ6B 5JI2E 3AVWA 1Y63A 1ZBDA 3HWSA 1F5NA 2REBA 3E70C 4TMKA 2V1XA 5CM9C 2EW1A 2NMVA 5AJWA 3L8YA 4JYCA 1N25A 3DPUA 4XSHA 5LBIA 2IYRA 2ORIA 3MG9A 4DVGA 3T61A 3ZGXA 4MYHA 2O5VA 1Q0UA 5B2ZA 3VR3A 2VH5R 2VYFA 1VCOA 4HLQB 5DISB 1Z0IA 3BIFA 1G8PA 3EIEA 1AIPA 3K09C 4LJ4A 2JLVA 3EZ9A 3KTAB 4NTZA 3VKWA 4F4IA 4PSKA 4K8OA 3FKQA 4LV5B 5BN3A 5GJWC 1UAAA 3KXLA 2C95A 3B78A 2GAAA 1SXJA 1Q22A 2X8AA 3KXKA 4X8MA 4ERNA 3T1TA 4URVR 2ZUDA 3VX4A 3CW2A 4AYWA 2ZJ5A 4C0JA 2C03A 4LUCA 3NIBA 2YOHA 1E4YA 4L15A 4QFMA 2GEUA 4YDSA 2QSZA 4Z1MA 3LVQE 4LYAA 3IIMA 2RHMA 4IVQA 1QHIA 1WXQA 4Q21A 5E7JA 4M9XA 3LNCA 3QG1A 1RRGA 4LJ8A 3B2EA 2NPFA 5KUTA 1NF3A 4HEJA 4G3XA 1IJFA 1NIPA 1CULC 3PEYA 1Z07A 1TNDA 2JJ2A 2W2XA 2FOLA 4GP7A 3AQ4A 1GILA 1JR3E 2X77A 3W6OA 4GDFA 3FE2A 1CU1A 4LZZA 4LOAA 2EFGA 5IT5A 4FMCB 3T15A 3PUYA 3QPVA 4I1SA 5E7MA 4M8NE 3VU9B 3M4YA 1RRPA 3ONWA 2FFQA 4OJQA 3NC0C 5P21A 1HYQA 4UXHA 1VYUA 3QXXA 2UZ3A 4LHZA 3SHFA 2YHSA 1BYIA 1EK0A 1VECA 4KLZA 4GSYA 2ZU0C 1XEWX 3EC2A 2WSMA 1YQTA 4ZI3A 4W7SA 4Z51A 5JCPA 1K6MA 5J4YA 2ZAOA 2IUSA 2XOKD 3L0SA 4WW0A 4CEJB 1M2OB 2X2FA 4R2HA 1CLUA 1F6BA 5GJCA 3JVUA 5H68A 4DEYA 2NGRA 2IWHA 1XPRA 3KJIA 2WM9B 2NIPA 2YOGA 3ZS9A 3ZLJA 1L4UA 1KGDA 4C7OB 1QHNA 1T3HA 4QG7A 4BRWA 1JI0A 3TAHA 4Y0AA 1E32A 1BMFD 1W46A 3AUXA 1OXSC 1BKDR 2P6UA 3GEHA 3RYTC 4OI1A 1R5NA 5FUYA 5CDFE 3M6AA 2PJZA 4YXWA 4KVGA 4BLRA 1OB5A 2DYKA 5LD2B 4OHVA 3EIQA 3OEEA 1X1SA 2FFHA 3R7WB 1E98A 2OCPA 2AR7A 4DB4A 4CDGA 4LK2A 1KK3A 4A8JB 3U2QA 4R98A 3GCGA 2WWWA 1EX6A 3RS2A 1D2NA 2H18A 4LYHA 2QAJA 4WZAE 2CVFA 2W2TA 2G3YA 3B7GA 1W44A 2B6HA 2YKGA 1F48A 3GLGE 3A4LA 2XTZA 2PLFA 4PANA 3QKSA 4WZBE 1DO2A 1KNQA 1TMKA 2BM1A 3PITA 4L5BA 2CLCX 3B82A 1DARA 1MO3A 4ON9A 5FR2A 2FG5A 1XJQA 4AY2A 1CRPA 2REOA 1E2KA 4PTLA 3QXJA 4QRHA 2Q3HA 3EPKA 1R0ZA 3OEHA 4S35A 2ZRAA 1U0HC 2ATXA 5JEDA 4DLRA 3Q9LA 2GBLC 3MLEA 3G0HA 1MO5A 1KSGA 1HT1E 4NDZA 4F91B 1DTSA 3ZVLA 3U44B 3AF4A 1YZUA 4IEEA 4PAMA 4KI0A 4PQRA 2ZROA 1KK1A 4G5SA 1E99A 3SEAA 3UWOA 2ONKA 4Q01A 3SFVA 4KO8A 2V1UA 3NWJA 3U7GA 4WA7A 1UDXA 2ZETA 4DLTA 4ZV4A 3TE6A 1DEKA 1TAGA 1N5LA 2HJGA 3H86A 4BFUA 1XB2A 2GK6A 3BD9A 1OLOA 5FPSA 1U8ZA 1X8KA 2BMDA 2ZRLA 4N0DA 3RSOA 3PIRA 1ZRHA 1H8ED 1Z0DA 3GD7A 4B2LA 2LKDA 1G5RA 3TH5A 2QP9X 5GVRA 3R9WA 1L4YA 4O2LA 3CH5A 1E1QA 1XWIA 3KZ1E 4U5XA 1KJZA 1PVOA 2QAGC 1UM8A 1WCV1 3CPJB 3I5XA 4D81A 3K8YA 4OBEA 4W9MC 2RB4A 1W0JD 1J90A 1NN3A 4PPFA 2FPMA 2HJVA 5HCIA 3GLHA 2IT1A 1UFQA 3C14C 1II0A 1VMAA 3MAAC 5CB6A 2F9LA 3AP1A 2JLUA 3EXAA 1M8PA 2IBMA 4DLSA 4N0EA 2NO6A 1TU3A 4CRWB 2ZI9A 2IYQA 3PCRB 3WYAA 2J0SA 2OBLA 1U0JA 1GZSA 2KI5A 1NJFA 821PA 1LY1A 1NG9A 5FPYA 2VSOA 3EZFA 4A15A 1HH4A 4GMDA 4PHHA 4F7WA 3LQRA 3LQQA 4OHWA 1JPJA 3FGNA 3K9GA 4P4SA 2NQ2C 3T35A 3W5JA 3O8CA 2IYYA 2HCBA 3U5ZB 1N3BA 1P61B 2ORVA 2W6ID 3LW7A 3CF0A 4IHQA 2FDCA 4PSAA 1SXJC 3BH0A 1UBEA 1PV4A 3DDCA 3GJ7A 3T5GA 2ZI6A 1E96A 4AG5A 4LJ9A 1ANKA 1N5JA 3K0FA 1G7CA 1LB1B 3BH7A 1OIWA 2GF0A 4RZ3A 4Q18A 1E0KA 2ZVQX 1TF2A 1M74A 3Q8XB 5FTNA 1VHLA 1US8A 5DYIA 4Q4AA 2IWRA 4HAUA 1LF0A 1RZ3A 1TTTA 2BEKA 4BLOA 3VR6A 3UANA 1M7GA 1AS2A 3GLIE 5FUWA 1MABB 5DI9A 2OFXA 1CRQA 4BZPA 2ZYUX 2C98A 2P2LA 2IXEA 3IIJA 2YC2C 3AH8A 2WWYA 2IUTA 5C46F 1GVNB 4LCBA 1KMHB 3PQCA 4QNRA 2VPPA 2WSSD 3NBFA 4A2WA 2Q9CA 2G9NA 4U7DA 4DDVA 1WQ1R 3CKLA 3DKVA 5DIFA 3L0OA 1HE1C 1XXHE 2B8WA 2BMEA 4DCUA 2WPDD 4V0MA 1U90A 2VF7A 1ZM2A 3VR5A 3I4LA 1KYIA 4EQ6B 1P2UA 3UMSA 5IK2A 1U0LA 2CK3A 2JCSA 4GI7A 3I1FA 6Q21A 4Q1BA 2XSZD 4A2QA 5TDHA 1JNYA 2WMNB 2ZRJA 4JYBA 1DBSA 1G6OA 1FUKA 1QVRA 1SZPA 2WAXA 3S1AA 2B8TA 1W4CA 3UWKA 1E2JA 3DZDA 3IPXA 1Z29A 1J99A 3DMNA 3RSLA 1PLLA 3ECCA 4XTRA 1AK2A 5IF9A 2QT0A 1T6NA 3IIKA 5KO2A 2FZ4A 3K0EA 3U6BA 4DSUA 4JBXA 3PJRA 1IY1A 1GNPA 2VLIA 3NC1C 2QEQA 1KMQA 3NBYC 1E79A 1YR9A 2QRZA 3N2EA 1GOTA 4HUQB 5J40A 3AVXA 1XMIA 1MKYA 2QBYB 2PCLA 5DH9A 5B30A 3LWNA 4D26A 2O8BB 1KO5A 3IQXA 4GFDA 4KSCA 1AKYA 2J7KA 4DUGD 1KTVA 3HP1A 1E0SA 3KL4A 4IVRA 4TTQA 2RKOA 1JJ7A 5EXTA 2ZVPX 1KJWA 1J8MF 1G3IA 3IDQA 4G1UC 4JT2A 4W5JA 3X2SA 1P6XA 1PUJA 2FFAA 4TL6A 2I1QA 3ZIAD 1R8SA 3BK7A 4RJLA 1E2PA 3KJGA 3DOFA 2GNOA 3QY0A 2LKCA 4CEJA 4OK3A 1UKYA 1XBTA 5BQ5A 3BXZA 2VL7A 1NVVQ 4P4UA 4C0HA 1GL9B 1CP2A 1DAHA 3PEWA 1CS4C 2ZEJA 2BV3A 5KYKA 1ZUIA 1YZQA 1GUAA 3BGWA 3RWOA 3OF5A 2QENA 3KJEA 4MYTA 4TWZA 1OXUA 3UMFA 1OXVA 4JVSB 2AXPA 4UQOA 2WMOB 4C7OA 2CL6X 1YZTA 1KOFA 4WOPA 2PL3A 2DWQA 1F2UB 4A1FA 4RKFA 3ADCA 2ZRGA 5C2JB 3SS8A 4XWKA 5AR1A 3ZDQA 3K70D 3DEFA 3THOA 2G88A 3BWDD 4Q1AA 3R7WA 5AUQA 5BW8A 4ACAA 1T5IA 2E1RA 2XJ4A 5FFMA 1MOZA 1QVAA 2B92A 5D3MB 5JJLA 2V6JA 1NSTA 1HURA 1NJGA 4KFUA 1Z0AA 2IXGA 5JRZA 4RZXA 2OO7A 4NZYA 4DCSA 4B6EA 1BH2A 5E95A 5BYJA 5FPHA 3HPRA 4WVFA 4B3GA 1BIFA 3LAWA 3EWSA 1LVGA 1N6RA 3R9XA 1E9CA 5FBRB 4XWOA 3CX7A 3LV8A 1EFCA 1S2MA 4ZPXA 3SHWA 1HEIA 2WWFA 3ZVRA 1WB9A 1OKKA 3QF7A 2RGCA 4RKEA 3CH4B 1IXRC 4PO1A 2B21A 5TVKA 3QIAA 1E0AA 4OJKA 521PA 4XWAA 2QP3A 1IY2A 4LC0A 4XD7A 1C9KA 4PFSA 4B76A 3OE7D 4KODA 2MMCA 2ORWA 1AJEA 1OV4A 4M1OA 4NKRA 4G5OA 2WIBA 3GP8A 3F0TA 4LV6A 2AN9A 2BWJA 4KHZA 4PC1A 3U44A 3CX8A 3OFND 2JLXA 2QE7D 3FHCB 2BOVA 4LBWA 4UXIA 1Q1ZA 3IPYA 2F3RA 4JMPA 5KDLA 5HR5A 4E03A 4II7A 3RS4A 1E2MA 1U2RA 1V43A 3OAAD 2FEMA 3QG5A 3O8RA 1E2IA 221PA 1XMJA 2WKQA 3U3RA 1EFUA 3QENA 4M1KA 1ESNA 2IEZA 3QNUA 4OHZA 4OI0A 4TLBA 1EG7A 1AZSC 4TMXA 1XMVA 1ZD8A 1N0VC 4FXPA 3KX2A 4TYNA 1RJ9B 4DRZA 2JLZA 3O8BA 2D74A 2FSGA 2REXB 4PXAA 1E2QA 3GFTA 4BASA 4JKIA 3ZZUA 1TEVA 1WMSA 4NCIA 2W00A 1E2EA 3CF2A 4JSYA 3RHFA 1ZU4A 3G5UA 4QL3A 3PG5A 4LSGA 4ARZB 1W0KA 2ZUCA 2JDID 3FDIA 4DBLC 3QVVA 1OHHA 1R0YA 4TQ9A 4QKQA 5TMPA 1TF5A 3CZPA 1G4UR 1SVKA 2GAOA 1MO6A 2IC5A 5CK4A 1YR8A 1G5PA 4BGDA 2IYUA 3TNFA 3UPUA 1ZD1A 4MQBA 1KI6A 1VTKA 3GLFE 3NEYA 3K0SA 1XD8A 1CJUC 1MT0A 3QKSB 5DN6D 5KSPA 4QGAA 2IL1A 2P5TB 4HATA 4NYJR 4Q7MB 4TMZA 3V9PA 1DAKA 4TZ6A 1GIAA 2CE2X 3M1IA 2C9YA 4FMDB 4JJKA 5FBVB 2ZXUA 4BPBA 3RC8A 1M34E 2JASA 2VRWA 1AQUA 2HT6A 4HB4A 4TLEA 4A0RA 5KNDA 2R8RA 4KYIB 2AKYA 1W48A 4K46A 3SC3A 3IBGA 3F5FA 3RS0A 5J4VA 1YZGA 4ZCIA 1EESA 1NY6A 2EWVA 1DS6A 3VHXA 5JWRA 4HLDA 3LA6A 2J0VA 4PQFA 1N2CE 2BVNA 2JLSA 2OV2A 2F1HA 4NBSA 3SBDA 2Q9AA 1T5LA 5DE3A 2LWIA 2ZSBA 3C5HA 1D2EA 3WMEA 5HKKD 2W0MA 2XAUA 4M1TA 3Q7QA 2ZM5A 2ZI3A 2QQ0A 3MWKA 2MMGA 2QMOA 3P1JA 1KAGA 2HCJB 2YV5A 5G3ZA 1QZXA 3QOFA 5J4KA 3BERA 4PPNA 1W4RA 4Q47A 4LI0A 5SZJA 1B0UA 1MABA 4XTCS 4CT5A 2C9OA 4NYIQ 2BJVA 1H8HA 1W2HA 2BBTA 3VTKA 4ABYA 1T3LA 4HAZA 4GZMA 4D4LA 4TL7A 4RY2A 5F9HA 5KSOA 1VCMA 1R7RA 4JVMA 4OQXA 4TL9A 1KMHA 5DI3B 1ODFA 3NDPA 2A5GA 4POAA 4KAXA 2QN6A 4EJSB 1SVMA 3GJXC 5KU1A 4FD2A 1JR3D 2CNWA 2OEPA 2XTMA 2WJHA 3A1VA 1XTSA 4FCTA 4URYR 2GTPA 2XB4A 1HA3A 2RGXA 4NYJQ 3GLHB 2ZE8A 2OSBA 4Q4LA 4BLQA 4IDOA 4JLNA 4AG6A 3U3KA 4DLYA 4O3MA 1S3GA 5JLJA 3TQFA 1QBKC 1G291 3GJ8A 4FMBB 1OPXA 1ZNZA 5BXQC 2C9CA 1KSFX 4F38A 2WHXA 4YLGA 2OBNA 1P62B 2IF0A 2VHQA 1M7BA 2RGAA 3OESA 1KSJA 4NHOA 3KUCA 2MSCB 1IN8A 3Q72A 2CXXA 2OCBA 3Q5DA 4EFNA 3ZVMA 2HXYA 3UG7A 2EU8A 4J0QA 1T3SA 4RCYA 1MO4A 1KDTA 4JT4A 2G1JA 2C04A 4B3DA 4IDNA 2H1LA 2QP4A 1KJYA 4DLUA 4TMVA 2QBYA 5FL7A 1W1WA 3TR5A 2CCJA 2EYQA 2OFWA 2VHJA 3QVUA 4PC3A 4W5HA 5CIQA 2BCGY 3N5CA 3K0FB 4B35A 4YC7A 4I99A 4KITB 4AKEA 5CYPA 3QE0A 3LD9A 4RD1A 3W9YA 2EFEB 3IQWA 5FBQB 3B5JA 5C4GB 1KY3A 2DFNA 3ND9A 3LH5A 2GJ9A 2FA9A 1RIFA 4P3YA 2RMKA 2VIIA 3MRSA 5JHGB 1FUUA 3CWQA 1T9HA 2GVDC 2IYVA 2OXRA 4FINA 4RD0A 3W90A 1X86B 4GT1A 5EE9A 3QKUA 3Q3JB 2J59A 1D9XA 4PAOA 1RC8A 2YNMA 1A1VA 4Z8XA 3EX7C 3BOSA 4QBHA 3FMPB 4CYMA 1M7HA 1YRAA 3PUWA 1VG9B 1Z0FA 2XX3A 3CRVA 3I62A 1XPUA 4JLMA 4IOKA 1F2UA 5AJXA 1XCPA 5EP3A 1I2DA 3DM9B 2I3BA 3B85A 3AP2A 2YWFA 3ZH9B 3RANA 5KDDA 1W5TA 3S1AB 2BHRA 1YRBA 3E5HA 1GL6A 3BE4A 2IYXA 3REGA 2R6CA 1OSNA 5D3MA 3D7MA 3NXSA 1KDOA 2RGNA 2EWWA 1SKYB 4KCGA 4R2IA 1R5BA 4KBFA 3A1SA 1GDDA 1A2BA 3OIUA 5KPJA 5L3RA 3HPQA 2WWHA 3GFOA 1EFHA 2ZS8A 4Q03A 5TARA 1G20E 3FMFA 121PA 1D5CA 1RRCA 5JSZB 2JEOA 3MUFA 1W36D 2CMKA 1G8FA 2H16A 1ETUA 3ICEA 2HYIC 1I4LD 2IW3A 2BEJA 4DLVA 3U7FB 4LJ5A 4ESHA 5CJ2A 1F60A 2W58A 2GESA 4DEXA 1U98A 1YR6A 1DG3A 1G6HA 1QDEA 3EARA 1W7AA 1COWA 1P4SA 2R6DA 2CJWA 1G41A 4LBZA 1FQJA 3VQTA 2A5FA 1SXJD 3LXXA 3VFDA 4CEHB 1NKSA 3K0CA 1U8AA 4HLCA 1SVSA 721PA 3AF2A 4TQUS 1TUIA 3H84A 5AJYA 4HAWA 1MRSA 4QBFA 3RNLA 2VSXA 3A36A 3ASYA 3R8FA 1VG8A 2QSYA 4MKIA 2P0EA 2XJ9A 2OE2A 2OCYC 2A9KA 5LB4A 3BH6A 2XNDD 3EA5A 3O8DA 4UNNA 3NBXX 1ZC3A 2OZEA 1CTQA 1XEFA 1RJ9A 2JJ2D 4LWZA 4Q9IA 2IS4A 1E2DA 2ZRIA 4PSVA 5AJVB 3TLXA 4DDUA 1JALA 2AWNA 4EUNA 3BFXA 3IO3A 1G3QA 2Q0HA 1N5KA 4BE7B 1G8HA 4MUBA 1ZM9A 1VIAA 2E9SA 3PUZA 4OQLA 3TIFA 4ARZA 2GVZC 3EAQA 2ZS9A 1KK2A 2DPXA 1NLFA 2N1BA 2VSFA 3GJ6A 3GEIA 3SYLA 1TQ4A 3TRFA 1D8TA 3IO5A 2VHCA 1UPTA 1VG1A 2QMEA 4F4CA 1P2SA 1CXZA 1P9NA 1FW6A 3FPAA 3GJ3A 2KBFA 3CPEA 4RFVA 4NCNA 4Q19A 3W6PA 2QL6A 4B43A 2D2FA 2ZUBA 1HQYE 3UKDA 4HSEA 3MGCA 1XPOA 4Q66C 1UJ2A 4PHGA 4G0NA 4M1YA 4RD3A 4OHXA 3CRMA 1LS1A 1DAFA 2AXNA 1FFHA 4A82A 3H0KA 4P4TA 1FL9A 3MCAA 4JBWA 2ANCA 1E1RA 3RVBA 4BQSA 3VR1A 2BBWA 1HV8A 1ZIOA 1BOFA 1R0WA 1SVIA 3PUXA 4QHYA 2GEDA 1NBME 3HR8A 3ZYCA 4B3CA 1LV7A 4BFYA 5JBQA 3EPLA 2FX3A 4YXWD 3C15C 4JLDA 3EZ7A 5FOXA 2WOJA 1L2TA 3GJ4A 4UJ3A 5EE1A 3KQLA 5HE9A 4B3BA 3OEED 4BFVA 4L9SA 5L3SB 2NO0A 4E09A 5JS7A 4XSGA 3OHMA 1VIYA 4HB0A 3W6NA 2ZU6A 1V5WA 1QF9A 8OHMA 1FZQA 1S3SA 1HT2E 2DHRA 1W0JA 2QROA 2NPIA 1J70A 3HYRA 2ZRCA 5FPKA 3AF0A 2V55B 1OFIA 4HZIA 1E2FA 3FWYA 4MRNA 3ZQ6A 4DXAA 4EIWA 2ZJOA 4XIGS 2DY1A 4LY6A 1G7RA 3AM1A 3X1ZA 2CEAA 4GRAA 4ITRC 1XF9A 5KHOC 1SVOA 5DI3A 2WBLC 1X1RA 3B1WA 2ZYVX 3MJRA 2FV8A 5EXXA 4YMWA 4QGGA 3KKOA 4EJSA 2MSEB 3NDBB 4MA4A 4LJAA 3TBKA 1NLYA 1G21E 1ZVQA 3BORA 3MWJA 1SXJE 3UK6A 4V0NA 2ZYWX 1S96A 2WAYA 3CM0A 3KKMA 3NEJA 2W6IA 5A4JA 4H1VA 1E2NA 2VP2A 1IY0A 2PBRA 3QKTA 2HF9A 1KI6B 5FTJA 1XTIA 2CHGA 5H1YA 2JIZD 2ZRPA 4C0KA 3DKPA 4FN5A 4A6XA 3IKJA 3VAAA 2JLRA 5IRCD 2R62A 2AD5A 4IDHA 1G64A 2JGNA 4ZKEA 3ASZA 3EPJA 2AWOA 3QEJA 3WRXC 4MKGA 4TMTA 4HDOB 2EYUA 4BUJA 1YKSA 2ZSDA 4XVUA 2R2AA 1G3UA 2PEZA 2ZJAA 4QHTA 1GRQA 4YMVA 4EPRA 3H4MA 2JJ1A 5CM8B 3IEUA 4Q1EA 2P67A 2YZ2A 3CX6A 2ZJYA 2QORA 4JLAA 1E6CA 3CRQA 2GF9A 3QPWA 5AK0A 2PZGA 2WSSA 1CJTC 1Q20A 3AKCA 3KQNA 1E1QD 2Z6VA 2GJAA 3OIYA 4LC1A 4RZUA 3WNDA 4ZKDA 1XCGB 4TMWA 4X8OA 3SYNA 3WP1B 4QHSA 4Z54A 1S9HA 2WPDA 2XNSA 2XEXA 3CO5A 3C41J 3CNNA 2RGNC 2XZPA 5C4MA 2G83A 5FPTA 5FUVA 3E1SA 1GL7A 2P65A 5EE3A 1OH8A 1CR1A 4JIMA 4YMUA 1A82A 4GNKA 2F7SA 1KZ7B 3RDPA 3SNHA 5UKDA 3KQKA 4TL8A 1UKEA 4AKHA 5K8TA 2ZTSA 1OH7A 4M1SA 3MWLA 3HYTA 3TUIC 3DMDA 4YQFA 1KDPA 1AGRA 2HLDA 5AUOB 4C0SA 4CGZA 1NG1A 3T34A 4B3XA 1N6HA 1X6VA 2G77B 2JLQA 3QI2A 3DOEA 4NCKA 1A5TA 4ESVA 4PZYA 3W34A 1XFAA 1NVVR 4RZ2A 4AKGA 2PCJA 1G3RA 1UBCA 1NMYA 1MRNA 3AEZA 1IXSB 1TQ6A 4QNMA 4BEBA 1T8UA 3C8UA 4KJZA 3THYB 4HDQB 2RGEA 3BB4A 4ZI2A 1BO6A 5HPYB 5CLQA 4N3NA 5A0FA 2O52A 4Q4HA 5SZKB 1WBDA 3K0CC 5EE5B 2QT1A 2VBCA 4IOJA 4H9GA 2GZDA 4IFBA 5CLLA 5D3QA 4AKIA 3A6PC 1RYFA 3LFUA 3LX5A 3PUVA 3KQHA 4UJ5A 5H8WA 3JVVA 3LDAA 1W49A 2ZYTX 4G5QA 1F2TB 2V4ZA 2J5XA 2OESA 5JWOA 3IEVA 4IDQA 3LVRE 5FL3A 1KI3A 1PLKA 3U6KA 2RGBA 1R4AA 1E0JA 1XTRA 3DHWC 3LRPA 4HAXA 4TLAA 1E9BA 2EFHB 4CZ2A 1NNEA 3A4NA 4AIIA 3WBJA 2OUKA 4PO8A 4A2PA 1E9AA 4CW7A 4JL6A 3NG1A 1XEWY 5JSZA 1XTJA 3HR7A 4QOSA 4PR0A 3UMRA 2UZIR 3W3AA 3KJHA 4WXRA 3GMTA 2PMKA 4LHXA 3WXMA 1CR2A 5FOWA 1FP7A 2ZJ2A 3KDSE 1AS3A 1N6OA 3PEUA 4X8HA 5EXSA 4IKEA 2V54A 1JAHA 3FHOA 2R6GA 3SR0A 4LJ6A 4KBGA 4A36A 4D25A 4V0OA 5IHPA 1CEEA 1Q3HA 3W5IA 3CBQA 3SJAA 4DDWA 2BC9A 1XP8A 3SI7A 4DC9A 2HUPA 3PVSA 1XMSA 1Q57A 2GK7A 4ZDKA 5IK2D 2CK3D 3BRWD 1JECA 1ZMXA 2FJUA 1NMXA 4CEHA 4AYTA 1ZU5A 5HZHA 2PX3A 2L0XA 1JJVA 2FSFA 1E9SA 3RS3A 1G7SA 2IHYA 5KSYA 1EFRD 1KI7A 4D80A 2QM7A 2ZI5A 1Y3AA 4KVAA 2FSHA 2PT5A 3SN6A 2IS1A 3FMIA 1CJMA 2CHVA
chains in the Genus database with same CATH superfamily
3KKNA 3QY9A 5EAIA 2R8ZA 4S05A 3EH1A 4HQKA 2Q9UA 1RQXA 3HNPA 3QF4B 5EJEA 1EFAA 4C06A 2CCGA 1HNXB 4RAOA 4CLRB 1YJCA 2GJSA 3NRCA 1Y1SA 4KG7A 2JHPA 3N58A 3ZHYA 1NI4A 1HDGO 3TIGA 1HZJA 3I32A 4RMIA 3F47A 2E6UX 1P9WA 1AXEA 2RBGA 4D0NA 1C80A 1RW4A 3CZ9A 4QAQA 3GUUA 5I5EA 1JEQB 1T2VA 3SZRA 1CQWA 2D7JA 2ERCA 3AOEA 3A9CA 3RHSA 3JAKA 3VDNB 4D8VA 3CVXA 1H0KA 2BH2A 4F93B 3HADA 3JCZA 1QS0B 4QOEA 1SQ6A 1TT5B 1A5SB 3CLUD 2LCFA 1F0NA 3X44A 4B32A 2NTJA 5HF8A 2I4NA 1HY3A 1X3SA 1D1PA 1T91A 2IYWA 2VTKA 1VOTA 3M5CA 1EFTA 1JBKA 2WHPB 2XAAA 1YJ5A 4ARBA 4RH0A 4G4GA 3AL3A 3HJGA 4GGOA 4A23A 1O5OA 5A3JA 2R97A 3H1EA 3MZ0A 2ZYHA 4FGWA 4K9KA 1QKJA 3VUFA 1BC5A 1ZNYA 1HK7A 1R9JA 3FMOB 1UDRA 4AZ0B 1TYEB 1E20A 2R7AA 1XCBA 2ZJ4A 4D41A 3TFQA 4DMHA 4LRQA 4JGIA 3V00A 2NX2A 2B6NA 4EJSC 1UT8A 2J7PA 5CX1B 5ER9A 4EUHA 4XOIA 5FWDA 4K9SA 3WYGA 1PYGA 1ECJA 1L5FA 1REQA 2FPUA 4X1YB 1NP6A 2WYHA 1M1UA 4ND6A 3ZOZA 5TB5A 3TZBA 3LLSA 1RCUA 4GICA 4LKOA 5JDCA 2JK1A 3DV0B 2YMQA 3FD8A 4XRRA 1XNJA 4FT4A 4YJGB 1J8YF 1KU6A 4O33A 3RT7A 5SZHB 2HEIA 2ZTVA 3BQNB 5CP8A 3ZE7A 1Z6GA 5I6DA 2P90A 4BO9A 3LPMA 4WKNA 5G02A 4D0RA 4KUHA 4Q3BA 2BTOA 2B0CA 3HV0A 4I1OA 2IVZA 4KGVA 4HNSA 4TTVA 5A71A 1ZOLA 3PYXA 3S8MA 4IW3B 4Y1RB 1A9XA 3HB4X 2QPAA 2XYVA 2CF5A 4TS9A 1I51A 3NH9A 1RWXA 1BCRB 1DKUA 2GXSA 4WMLA 5KCMA 2CNKA 4GXNA 4LX8A 4AF6A 1KI2A 1D1TA 3P0JA 1EZZA 4FFPA 1Z9BA 3NBZC 2EKPA 1BWRA 4BRUA 4JQSA 2IYNA 4LXHA 4ZVOA 2FVYA 4MW6A 4V24A 5DN6A 3SJ7A 3FXAA 3OD1A 1ZX1A 1E66A 2Q5CA 5T4HA 3QFTA 3AVTA 3W4KA 2CV2A 1GKYA 2W37A 1G4AE 4RDIA 4V0ME 3CEMA 2C83A 3RTCA 1N1GA 3ISVA 3UV7A 1YFJA 4ZVVA 1N2IA 3BMXA 2YOFA 4LMRA 1Y8RB 1XL0A 1DKOA 3Q7PA 2XB6A 3AR4A 1X9GA 3K3PA 3OE1A 1VXOA 2Z1MA 1CZHA 3IH5A 3MK31 4MZDA 3VYUB 3HJNA 3GFVA 1NY5A 3UOAB 1M83A 1XT6A 4N0PA 3W8FA 5KVVA 1USVA 4ONEA 2F90A 4XE5A 2O20A 4WWHA 3VSDA 4JYMA 2C9ZA 1B74A 1X1QA 4EARA 4B7ZA 4DZZA 1N75A 3EQ8A 3UJBA 2PGNA 1HDYA 4JCCA 1V25A 4ASUD 4W82A 2GA9A 3ND6A 5JECA 3ZVNA 2GPNA 1EK1A 1P7ZA 3KKPA 3VR4D 1FU7A 1EXMA 3L82B 2BJHA 1DC4A 2Z2KA 3GNLA 2VOEA 3IOBA 4TLCA 4OBWA 3RSZA 4HMOA 1FVOA 2ZRFA 3HU3A 1SHTX 3PQ8A 1Y98A 4S2EA 3DJYA 3IV7A 1L5GB 3TQCA 2DLCX 2XUZA 4AZTA 3RRBA 5GWXA 4G36A 5CLHA 2WD7A 1L6IA 3JZAA 5J5CA 1V11B 2I2AA 4G0ZA 3CNLA 5IUKC 4HQ0A 2DULA 1KZ4A 2JCVA 5BSKA 1QG6A 2FK8A 2X3FA 3PI6A 2GLXA 1SO8A 1Z5UA 2ADMA 2QX6A 2V7QA 4LX0A 4K40A 1ZN2A 1ADYA 4P92A 3UIEA 2HA4A 4KBYA 4KK3A 4OJTA 1XVLA 3CE6A 3JATA 3IAS6 2I4OA 2Y4NA 5L3VA 1FC0A 3C3CA 4AUMA 2R25B 3I53A 1CZRA 1KPIA 1TD1A 4TV9B 3B1YA 2M1ZA 2UKDA 4KFRA 3RUEA 2HNKA 2O0LA 4ZQIA 5L53A 2Z4RA 4RV5A 1XZQA 1BE0A 3DLPX 1XYGA 2PKWA 4MOWA 4KUEA 2PV7A 4LGVA 3CISA 4WCVA 1DC3A 4AJOA 1TEXA 5IK2A 1WP9A 1NJ1A 1E94E 3EF0A 4UVHA 1T5OA 5AW5A 1TAHA 2FWBA 3D7KA 4B46A 4BZQA 2AHOA 1S01A 1T1RA 1VLQA 2K4MA 1H42A 1ZVMA 2Z83A 3ABIA 3CZCA 3FAKA 3GRUA 4MUEA 4UATA 3VPDA 1KYQA 4B3JA 3VC7A 3M4XA 4YAGA 1OYVA 1PVDA 1UWVA 4PWYA 2WQ6A 2UUAB 3P32A 2DSTA 2BL4A 2J9XB 1XNHA 1HGXA 5BSTA 1A4RA 3O9VA 3Q40A 2A5LA 1JZQA 2KLHA 1Q84A 2G1AA 4PLCA 5FWAA 3U4AA 4B5KA 1C4KA 4R5HA 1I0LA 1E8NA 4M0LA 2VWQA 1IQPA 4RM2A 5DSZA 1QR2A 2GO7A 3DMPA 3V2IA 5EWJB 3UAYA 3UJHA 3H5RA 1VKRA 2UUPA 3HDYA 1CCWA 3JS5A 5JTUA 4NCJA 1PJCA 1GAQA 2HT1A 1XK6A 4GOXA 2YWDA 1U1CA 1JKXA 1XK7A 1ZCAA 2GZ1A 3JQAB 3N0RA 3PFNA 5AM1A 5FI3A 5G41A 4DJFC 4EA6A 2OFFA 1QH8A 4HB2A 3O9ZA 1U11A 1V8PA 3AKEA 3SM9A 5K0TA 3H2GA 1RS0A 3HJTA 1NR7A 2DFLA 4PYMA 4LRXA 5CFRA 5L3QA 1RMTA 2PD4A 4FIZA 4ZO9A 2XLCA 1WRBA 3KZMA 1N1DA 1U9IA 1SIWA 1DINA 1TZ2A 4JA2A 4MO2A 4QQ8A 4Y6OA 1R10A 1ZEMA 4GI3A 4I46A 4MS1B 1NATA 2HMTA 4U7PB 2FPWA 1N6PA 4AJ9A 3ZKWB 3DMGA 4MWOA 5DYGA 1E3JA 4RTPA 1F2TA 2PEYA 3I6ZA 1CT9A 1YIDA 2HH9A 3HCCA 1KJIA 1OI2A 3PR2B 2PZLA 5EP2A 3RADC 2IDMA 4HS4A 3ZPXA 4F85A 2ODWA 4Y2PA 1OD6A 2C2XA 3BCHA 1C3EA 3O7MA 4ITVA 3RV4A 3DMHA 3EPPA 1V48A 1YCHA 5FUXA 5ALSA 1YDMA 1MXHA 3LP5A 4Q1FA 2XNKA 2VZ8A 2HGSA 5C9ZA 5LM3A 1PQPA 3ABQB 4PLGA 4TZ6A 4N4AA 3M0EA 5IBQA 2JFWA 3HCPA 3GLGA 3AOEC 4OSOA 5E4TA 5AVTA 3WWCA 2IHNA 5B57C 4PCUA 3VYRB 1DADA 5L4NA 3NPAA 3CT6A 4K86A 1XZEA 4P33A 5F5XA 4OKNA 3OUTA 4JLSA 2NU7A 2QGZA 4J3NA 2ZAMA 2ECFA 3EXIA 3GT3A 4EYGA 4B7CA 2W2KA 3DLTA 1XNQB 1LC0A 4MQ5A 2QRJA 1ODIA 1Y6QA 3NNDA 1DAMA 2PUTA 4G1FA 3LBAA 1JR2A 4HFJA 5JG7A 4EL0A 1C4OA 1Y7LA 1ULTA 2F6RA 1U4NA 3K94A 1DX9A 2JATA 3NVAA 3OJCA 1JMYA 2FF7A 4LXYA 2C3MA 4LYEA 5CB4F 4GOJA 5HMLA 2JRCA 4MS4A 3DV2A 4IVPA 4BX8A 2VHUA 2ZTHA 1S8AA 3I6BA 4M8SA 4QO7A 4Q7QA 4Z4EA 2F3UA 4YUZA 4FU0A 1PD1A 2ZQ5A 1U1GA 1YI8A 4K5QA 5BV7A 1FMTA 1UZMA 2HV9A 1T1IA 1JLLB 4QUHA 5K03A 3DXXA 1ZP6A 3VO8A 4HAIA 1ENPA 3OLZA 4QM7A 1SK8A 3TLJA 1WUIS 5JDCC 2CLFB 1R8YA 2WICA 2YVUA 3FZEA 4IIXA 3CVUA 1SMKA 1RAGA 3T3IA 2VI5A 5EHQA 1ZL0A 3EZ2A 1WUKS 2JCBA 3R74A 5KWVA 1EUZA 2MDTA 3U4HA 2GKOA 5A0TA 4FEAA 5EQTA 3UAWA 4YR9A 4W1SA 3LGSA 3H9GA 4CLXA 3VPCA 3BE6A 1IBMB 3PV0A 1ZNXA 2HDNB 1AOXA 1NBMD 4K26A 4KZKA 4OAOA 1AQIA 1J8QA 3D7SA 2P6RA 5LXTF 3WFJA 1CEYA 4AURA 1Q3KA 5JJCA 4U8GA 3U1VA 1S02A 3O2JA 3WISA 2J45A 4ZCTA 4FCWA 4RY0A 1AKEA 3K0HA 1ICIA 4CCSA 2FWJA 2VAPA 3AFOA 4OQNA 2BMAA 1DFIA 3TD9A 4W1PA 3WWPA 1DEHA 4QUEA 2P91A 3WC4A 2EFYA 5KQGA 4BMVA 1QG2A 2BPOA 4D6XA 1L3BA 5TXGA 3L7DA 2GKSA 4YRNA 1WCWA 1PT9A 1XJCA 1QCZA 4FZVA 2PX5A 4W9RA 1YUBA 1AGXA 1J5PA 1P7WA 3DH0A 3DDHA 3H3JA 3EQ2A 2N42A 4QODA 3C45A 3DULA 3UG6A 3TGLA 1F4LA 1FBTA 4IXWA 1KHTA 4TUYB 2WWXA 4EPVA 3BN3A 2CCKA 2PFGA 2CJPA 1DRUA 2X76A 1EE9A 3E8SA 1BMFA 3WBFA 4M9RA 4B75A 1AN0A 4Z4FA 3PF8A 4HUTA 1NL3A 1I2MA 3TQQA 2X9GA 1OXKB 4RENA 2I1VB 1FUEA 4Q82A 3T1NA 5BSWA 1FSZA 1YHNA 3ZCQA 4BO5A 4AMUA 4D9BA 3JSXA 3TQIA 3GQBA 4PXYA 2IU0A 3QHPA 4NOLA 3W2IA 2OHGA 2IPLA 4UUPA 1WS6A 3B6KA 2FK7A 2WIFA 2P9JA 4X7BA 2HA7A 4XPIB 5E9WA 2V3CC 4ES6A 3EG5A 4MEAA 3WDLA 1M2NA 2OQRA 2QTCA 2FJPA 1Z2CA 1OU0A 5FOVA 1AKVA 4OHYA 1WW2A 1VKOA 5C1BA 3GFSA 5FEUA 5TV2A 1YDEA 1SXGA 4IO1A 2OGUA 4XD2A 2EQAA 3SJCA 1VJGA 1Z74A 2V58A 5FWXB 2VYNA 4CF6A 2BHLA 3E9YA 3JVIA 3HXMA 3UWPA 3VXKA 4DIEA 1KEEB 2PIDA 4ZYZA 2DKNA 1Q0TA 3WIDA 4S12A 2EKDA 1T9BA 4MULA 5D86A 2BGWA 2DPMA 2WB4A 2OK7A 1T5BA 1GGVA 5A04A 1VHJA 4MJLA 4M9CA 3NR2A 4R9UC 5F7ZA 1AGPA 4Q4JA 1E9DA 1JTFA 1E2LA 4U1RA 3K1AA 4YJ3B 3MD0A 5ECGC 1JWLA 2R6R1 2ZRKA 4XVRA 4PGGA 2Y77A 3EG9B 4F5YA 1ZC4A 3E3LA 3F9CA 3D4NA 5FA5A 3S27A 3C3BA 4IUBS 4E13A 1Q21A 3IURA 1OTYA 4KWEA 4U00A 1HTWA 2ZWOA 3KUXA 3QBJA 4PAWA 1RFLA 4UAJA 3HTXA 4UEJA 3GEEA 4C0QC 4IF4A 3D6AA 5AXDA 1L4MA 2R48A 1SBZA 1YZKA 4RVCA 1D2MA 1DAPA 5TE9A 1RHUA 2PKRA 3DOHA 4NMMA 5ALNA 5IXJA 2IHUA 3ADKA 4XQEA 3FNEA 2P2ZA 1XTUA 4YS6A 3ULKA 4BNNA 3PFCA 5HIMA 2Y3IA 3DL0A 2IA5A 3WO0A 5JTTA 3I3OA 3TPZA 2DUUA 2GCNA 2Y1KA 2DBYA 3K31A 1E1CB 621PA 4QA9A 3R3UA 1JLKA 1VL1A 2R7KA 2Z3WA 3H2YA 3OKCA 4IDCA 4KIWA 5FBWB 2PQ0A 4U2DA 4DN6A 3PNOA 1W94A 4IOMA 3CRRA 3V55A 1MH1A 3CZQA 1DQSA 3AFIA 5CB0A 3LBIA 3WAJA 3BDIA 3W2FA 3LUBA 1U9IC 1X2BA 1K92A 3EEQA 3OCCA 5KCZA 4YRKA 3IALA 3JZIA 4IIDA 1PCXA 2C78A 2YYZA 4ZMRA 2I8LA 3PHBE 4RTNA 4L9WA 5FOUA 4CFZA 2O8EA 4MCJA 5I9BA 2NO9A 4GMKA 5DYWA 3KVVA 3WGZA 4FIDA 1W4AA 2A3RA 1XHFA 4QRDA 3DDWA 3IESA 3RSGA 3RYCA 1O0CA 1YKFA 1X7DA 4J0FA 5T3UA 3WL8A 4JLOA 4K03A 1T3TA 4WLOA 4EWLA 3U4QA 1NP7A 1ODSA 1JWAB 1U5BB 2ZR9A 3REFA 4LCEA 4KQ2A 1J4AA 4H4DA 4LRWA 4F4FA 9MHTA 2Q5HA 4AF7A 1DPFA 3OQJA 4JQOA 2HHCA 1KIMA 3DEHA 5C0OE 4LYJA 3U19A 1Z4QA 3AY0A 5ENZA 5FBKA 3UGJA 2NZXA 2PKQO 1Y82A 2WZCA 3FVQA 4MVJM 1GGMA 1XEXB 2YN2A 2ZR7A 1NUHA 3A1EA 3FLEA 5DX8A 4FFBB 1IZYA 4FB5A 4MDFA 1T25A 1Q1BA 3OEHD 4NU6A 5LUBA 3WQSB 4AP6A 1IVYA 1IZ7A 4YY3B 1AQYA 2Q6IA 2MOKA 1N2JA 1UBNA 2C3PA 2ILVA 1KC1A 4JITA 4LHVA 3GF4A 3L8MA 1LFDB 4BPRA 5JH7F 1NW5A 1A96A 5LPNA 1NUPA 3PLNA 5CDTA 1XQXA 4EKNB 2DB3A 2DY0A 1YZNA 1AV6A 2UXCB 3V1NA 3B60A 2BELA 2QDXA 3C3PA 5CT5A 4NE9A 4HMPA 1GU1A 3HNOA 3VTZA 4OI2A 2I2XB 1PWYE 2JEYA 5C1DA 5JNSA 3IVAA 4F72A 1HUQA 3M5DA 4F7DA 2WM3A 4ZJYA 4EBBA 4GPTA 4YT4A 1UBFA 3GCDA 3JD4A 4UFNA 1GSAA 1JDBB 2WWGA 4RFSB 4QFDA 2O8DB 4XFDA 1P0PA 3ZH2A 3U4QB 1NMZA 5FBHA 4K8RB 4NEQA 1X7XB 2X0IA 1SG9A 1WWKA 1AU9A 2O6LA 3I2HA 4OHMA 3BSYA 1X15A 2HK6A 4KQEA 4RLHA 3JD2A 4PAGA 3N53A 5EGNA 1YS7A 3TLAA 1FMFA 4EB0A 1U9CA 2ZG6A 3ZS8A 3QE3A 3WR5A 4QM6A 1E3QA 1PF7E 2Q4OA 1TL7C 2QTZA 4C0XA 2OCAA 3RTDA 4NV3A 5HTOA 1SUSA 4MGIR 4Z0TA 1KQFA 4UNSA 3RSQA 3ZLVA 4RZQA 5JCOC 1RXVA 4N48A 3M9XA 3LKBA 4EEKA 1GITA 1YRQA 3ZLTA 2VQFB 1RP7A 4IXTA 4MAAA 3T5DA 1U94A 1ZKMA 4E94A 3RCBA 4RE5A 1VE1A 3R3WA 1V6SA 1IJBA 3L2OB 3UZUA 4C07A 5ARBA 4JL5A 2H4WA 3GY0A 5DNDA 1T36B 3PWKA 4AM8A 1DEXA 2H2WA 5EWMB 1OV6A 1TJYA 1JS1X 2M32A 2VXBA 2SCUA 3BAZA 3IVGA 4QT0A 1K7YA 4M38A 1KZYC 2CUKA 3AVYA 4M76B 1Z17A 1M2JA 4Z3DA 4YMSA 1VZ3A 3V6LA 3A1WA 4DJ5X 1GFIA 3OZIA 2XDWA 3L93A 3VYTB 2BMJA 2WDPA 4HY3A 4AIRA 1E3MA 2Q7XA 4FONA 4JLKA 3BE8A 2WKPA 3DTVD 1F51E 3TAUA 5ESWA 4FUTA 5A4DA 1O6FA 4OHPA 1TU4A 1XTKA 3LW8A 2RGRA 4QQNA 2GTIA 2Z0MA 3W8RA 5H59A 2NM0A 2BTQB 1T0UA 2FQ1A 5EKTA 5DXJA 2O23A 3PPIA 4H1WA 4ZA2A 3NJ4A 3WBKA 3UT0A 5ITVA 5F7OA 1DTEA 1K66A 3G68A 2XECA 4JBYA 4U6NA 5D7NA 2KQUA 5AXBA 4HZUA 1CFJA 3WP0A 4FILA 3E03A 1D0SA 4DUGA 1H2XA 5FUMA 2PWAA 4CUJA 1FQKA 4JYZA 2WOOA 4FW9A 3I6YA 1FRZA 1FUYB 2LGJA 4NJMA 4CNQA 1UIRA 5A5FA 3ZNQA 3GOHA 2YWEA 1YQXA 4J7UA 3W4JA 3WHPA 2G82A 3ZCVA 4DJAA 2PLAA 4BKPA 3HQ4O 1B8VA 3B3JA 1V5IA 5IDVA 1Z3IX 1MC4A 5I4BA 4JJIA 1OWPA 1MXFA 3OZVA 4KFTA 5TT0A 2QNBA 4TV8F 2HO4A 1RI3A 5AHKA 4BLSA 2HM7A 2POCA 4YRPA 2CLMB 4HDNA 3E1GA 3EQ6A 1GNRA 3AXSA 1YK1A 4IAOA 3VBEA 4D6PA 3WGIA 1H9CA 3L1HA 4AKHA 2FMUA 4HAYA 4KNWA 3W3AH 4ZCMA 1Z2EA 5BYKA 3RIMA 1GEGA 2E5LB 2D8MA 5CITA 3G0IA 1L7AA 4FWTA 4NOKA 3U3JA 4K6OA 1S1MA 4JYPA 4WBSA 4EMTA 1UDCA 2R8EA 1WB4A 4FHZA 2ODEA 1F5SA 2Z43A 3QVSA 4J9VA 1MUUA 5ERYA 4FS3A 5C5DA 5ALZA 3E53A 2GNPA 2H0QA 3L9WA 1QVWA 5DN9A 4AYXA 2WYUA 2CMDA 2M6RA 3CONA 4ZC8A 3AVUA 1T8RA 1YT5A 4MRRA 1E9EA 2YVKA 4D74A 1C3VA 2R1TA 4LQDA 4LOJA 5JD3A 4TXHA 5C3MA 1FX0A 3N3BC 1YC5A 5LYJF 2O2DA 3DWFA 3H6KA 1ZMOA 1RXSA 2H0AA 2DPYA 4MVJA 4Q1CA 5AXCA 3FUVA 2C2KA 4UREA 5EHIA 2C59A 3RRXA 5A5GA 4PRZA 1IOLA 4U2CA 2DEUA 7YASA 3WIOA 3DDOA 3BX1A 2QE6A 4G25A 5HUJA 1VBFA 3CUEF 2RI6A 5TRTA 4HGPA 4E5KA 4ENPA 4JAVC 2QN9A 1C0IA 2WTXA 2C4NA 3KM0A 3DR5A 3P2MA 1W36B 4BY9E 3D5EA 2ZJFA 3FUCA 4ZAWA 4ZYUA 3DFFA 2ROQA 3M49A 3NXKA 4G2TA 1XP5A 1H6CA 2DR2A 4Y2RA 5JZOA 2ZUEA 3M81A 3V8MA 4MS3A 4RK4A 4QVIA 1GTSA 3DOJA 1KVUA 4CFYA 3KFVA 1G7TA 2PLNA 1SFRA 5TQ2A 3EGVA 4PINA 4D4KA 3SWWA 1C3JA 1OGYA 3EIOA 2AL7A 3O3NB 1O3YA 1SHUX 3SEZA 2OAGA 3VO9A 1SHZA 1EPUA 1XFDA 1R8XA 2WJIA 4MTLA 5ULLA 2CD9A 3TUZC 2P3QA 4IRUB 4KSBA 4YV0A 5C5CA 3ESZA 4P7BA 3D31A 1FVHA 4RESA 3X1DA 1UKAA 1E6WA 3SFZA 3AVVA 4HQLA 1TM3E 4KQXA 4JDPA 5CX4A 4A8JA 1SC3A 1KQPA 1YULA 3I72A 3JQ9A 4I0WB 4ZEXA 2VQEB 3T1HB 3EXG1 4JUIA 5KWIA 2I71A 2J9GA 3C3MA 3NHUA 4POOA 2Q5EA 4R8SA 1VLLA 3U7RA 3T9CA 1F3OA 5AOVA 5HK8A 4QICA 2EKBA 4QQRA 1P7CA 4N8EA 2YHBA 1EHCA 2A1TS 1WLSA 5EUMA 2EF1A 4Y2HA 5DLQC 1HFWA 3BQMB 5BSVA 5I3ZA 4BKUA 2IF2A 4ZZ0A 4RCZA 2JFVA 2DG2A 2FNAA 2R1UA 3BTOA 1EGAA 1R4NA 3FSEA 2J09A 4L4UA 5JFTA 1AG9A 3QBTA 4KYVA 3TNYA 3IJ5A 3OZXA 3C7DB 2PAAA 4NYMR 5LQRA 4D3XA 4M46A 5GV7A 2D2IA 4J7CA 1LX6A 1QF7A 2QVLA 3KHKA 3OTIA 1W2GA 4ALJA 2AB0A 4NOMA 3PIDA 1QX4A 5JMPA 4UM7A 2G67A 5EXDA 3SKXA 3VZDA 4OFBA 4IMPA 3EW9A 3IMCA 5ESXA 4ZVNA 2QTVB 1EVKA 1OLSB 1ZHFA 1TQ2A 2I4RA 4GQBA 5KX5A 4NPHA 3FKSD 2CFTA 3CQ9A 4C04A 1Z83A 2PX0A 1EHYA 2B4AA 4C2UA 1WABA 2CNDA 1BFUA 2QAIA 2PO5A 1ZVJA 1GD1O 4JODA 1G59A 1Q50A 3EFOB 3PQDA 4ADSG 2WLTA 1HNWB 3V8EA 1ULUA 4QLAA 4WDQA 5CXSA 3ZHVA 4ZIRA 2FX5A 3L18A 3PGXA 4IPTA 1M6EX 2FWRA 2P9BA 3PNQA 3BC1A 4N76A 3DB1A 1PGPA 2ST1A 3TLCA 4ZHQB 1R6DA 4IIJA 3J81k 2WQ7A 5JEEA 3JASA 5IJ0A 1EIZA 4AN1A 3UFXB 4KWIA 2O59A 2FMXA 3WB0A 4TYWA 2P4HX 3GRPA 4BQEA 5K6AA 2H8KA 4QDOA 1EB8A 4ZAYA 4EB8A 2ZSHA 4YONB 3KT6A 3WNQA 1N6KA 1ONPA 2VAXA 3JWJA 3U26A 5ALHA 2NV2B 2JI6A 3ANXA 3W8EA 1X8XA 1RWWA 1N92A 5F4BA 1Y5RA 1DQPA 1E60A 1U7HA 5G0WA 5G4LA 5TPZA 4AZWA 5LLTA 3ES9A 1HYEA 1NQ5A 3ZCUA 1VE6A 4DHEA 3LUAA 1ZO8A 3ISJA 3BJZA 5F33A 4X65B 3ZCXA 2A0XA 2VF4X 4LWPA 4NYMQ 3PQ7A 3WIEA 4GR4A 2P27A 3GVPA 1IJEA 1ZJ5A 3LXRA 3FWNA 3FPJA 5KYWB 1QNFA 1U7TA 1CR0A 4M7WA 2ATCA 1QVVA 1NR5A 1EM8A 2QU8A 4IJWA 3HUDA 4OYRA 3WGJA 5MGNA 3S81A 2PXCA 3TOXA 1HMYA 1OBHA 3K0AA 4URFA 4EVSA 1XCJA 4E0BA 4JOBA 1ZM4A 3EA0A 3MWYW 5EUQB 3B70A 4XM1A 1Z88A 4EDHA 1NOKA 2QNIA 2J9RA 2ZXEA 4WNAB 4CM8B 2UYHA 2V0GA 5JCJA 5JUWA 5HKKA 3TNLA 1WMDA 3NM6B 3RQIA 4GMFA 2NZJA 3A1UA 3DZJA 3HB0A 5EG5A 1LH0A 1ND5A 3K9BA 4ZVMA 1XTQA 5DU2A 3BB1A 3X1XA 3ZR4B 4A6EA 7GPBA 4KO4S 2OKGA 3L4SO 1NSFA 5DCYA 2OD2A 5DNVA 5CA1A 2V6IA 1T0HB 1GRRA 3ZQ4A 3LKZA 3VNVA 3QH4A 2A5YB 3AM5A 3G82C 4XJXA 2FSSA 2UZ1B 2LVBA 1Q0HA 1Y3CE 1C1XB 2JD2A 2NOAA 3LX8A 1P2DA 2KB0A 1Y81A 1PGOA 2H1SA 3JQRA 2QTBA 4IIVA 5K0CA 1PZHA 3AIOA 1WZNA 1JQEA 5IWAB 4QUKA 3KPYA 2WTUA 3RG8A 1SQFA 4NHEA 3R7SA 3UMMA 1FMCA 2F1RA 2BKVA 3G8AA 2HIAA 3IUJA 5U4XA 1T4BA 4OLAA 4AO7A 1AC5A 4IF6A 1PNOA 2W11A 5AQEA 1YVDA 1AB6A 2X1VA 4NATA 3PTAA 3C48A 4HK4A 4XVQA 3GPIA 2ZZMA 3RC3A 4AFNA 5LOVB 2UUCB 2ZB2A 1LX7A 1V9LA 4N1AA 4H15A 4AO8A 2Q6LA 2H0RA 2JBAB 2GBLA 1ZYUA 2PG3A 3CV3A 3EC1A 2F9MA 3F4KA 5DP1A 1OH5A 3K6KA 2FUCA 3F71A 2E85A 3U9LA 3HBAA 1H8HD 1I8TA 1V9SA 1VDZA 2FN9A 4L5AA 3Q87B 1TKRA 3QVKA 5EPOA 1TPYA 4O4HF 4RX1A 3IHKA 1ORHA 4GLOA 4NE2A 5FIUA 2I1WA 5AICA 2G36A 4C0BA 4WJLA 1RLIA 2PT7A 1RHJA 2YHIB 4IICA 5LQMA 4I4TF 4KL8S 3IT0A 2HBZA 5F5NA 3G8YA 4OQ4A 1EFPA 4RD2A 2CNWD 3FDZA 2GBPA 4O0MA 4P4SB 2WKWA 2H5LA 2A9OA 2VEOA 2WVJA 4N7MA 5JS1A 3HUEA 2HD4A 2KJQA 4WXHA 3W9BA 1QYRA 2Q29A 1PFKA 3FGPA 3PGLA 5IKPA 2WYWA 2XQVA 3FHLA 5HIJA 4J91A 2HSDA 1JNXX 5HTKA 3TLYA 4BQFA 2QJTA 3DDZX 2ZITA 3S55A 3UK7A 1BS1A 1CVIA 2A2ZA 4AJNA 5KREA 2GPWA 3TSAA 1I24A 3ZXXA 1F9EA 4DSNA 2E4WA 1ZH8A 3QHQA 2GQ0A 1TOAA 2WFLB 1ECBA 1Y6RA 1JHZA 1VSUA 3NP9A 4IHJF 3IE2A 4NXNB 1FK8A 2VDRB 5C1OA 4A8JC 2BGMA 5EMNA 3JQ9C 1GQYA 1L3CA 4QZVA 2PAFA 1E1YA 1H1DA 1PLJA 3UXMA 3V4VB 2X8JB 3QSYA 3VKFA 3D6TB 3M83A 5ILGA 1RYDA 1M1NB 4E6EA 5KS2A 1WQ4A 4KMOA 4IS2A 4R7ZA 1R9NA 2I6XA 3LO5A 3OHPA 2BLLA 3CUWA 1GAWA 3AEUA 4M1EA 4DCOA 3KWFA 4NJOA 3HWSA 3RIEA 3TRKA 2REBA 1XZBA 1HORA 1MG5A 3DTTA 2G7MC 2I6UA 1JEOA 2V1XA 2XYRA 4YO7A 2W2NA 4D8UA 1V5GA 3LLVA 1EJBA 1Z4OA 2DX7A 1QBGA 3I8OA 2AC7A 4QPJC 3ZGXA 5ICMA 1MB0A 1QMGA 4J2TA 1CUDA 2GD0A 4Z7NB 2EV9A 5DISB 3EUEA 4B8WA 4PS0A 4MWBA 4CKEB 4F3NA 3R7NA 2C2BA 1G6KA 1JUDA 4N12A 1E7QA 2BONA 1K9VF 2H4XA 1JHYA 3EZ9A 3IQZA 3OQPA 3KTAB 1NVKA 4IMIB 4NTZA 4K8OA 3FKQA 5BN3A 2JAWA 1ZJZA 2EJWA 1UAAA 1Z2NX 3KXLA 1KTIA 2MR6A 8ATCA 3HSSA 4PRKA 1HLGA 3R7DA 3HN2A 1SOUA 3VX4A 3QGMA 1QPZA 3MGGA 5LA6B 2HBQA 4ZOLF 4BDSA 4Q3AA 1DRVA 1WZ2A 4IV5A 3L6EA 3T3HA 2GEUA 2Z57A 4QU8A 2QSZA 4KQIA 4Z1MA 3VKVA 1MZPA 2IZZA 4YT8A 1BMTA 3FOBA 3IAUA 3LNCA 3CIFA 2IHTA 1FS5A 4JDUA 3TDMA 4QOIA 4YFVA 4HEJA 2ZT8A 4NS4A 1IJFA 2A1TR 3W6UA 5IKMA 5AUNB 2LCIA 5JROA 1N2XA 1SPBS 1TNDA 2FOLA 3AWDA 5CFQA 3AQ4A 1RKUA 1T6BY 1P0IA 3KOUA 1XQ1A 4GDFA 1XZLA 4OHOA 1H2WA 4LOAA 4OTZA 4M0PA 5K6AC 2OXTA 2ZT5A 1NHGA 4KO1S 4FMCB 4J0HA 2SKEA 2R00C 4GMHA 3T15A 4EHFA 3QPVA 2WY2D 3Q11A 1E4OA 4R0NA 1P4HA 1RRPA 4A7PA 3Q3IA 1U0SY 3RODA 2PV0A 2YJGA 3WJ7A 4FKZA 3RU3A 2BHSA 3WV5A 4UFPA 2O5EA 3FTDA 3ZZ1A 2RK4A 4CDNA 4Q37A 4MV4A 3A2LA 2AA3A 3CEAA 1Y4ZA 4FNGA 4XGIA 3UBMA 2PQ6A 5E2AA 4BBAA 1VECA 7REQB 2Q5IA 1XEWX 2ZU0C 3EC2A 4GPZA 2B8NA 3WDSA 3W5SA 4ZI3A 5FDFA 3EVZA 1DQRA 1K6MA 3U39A 3B3GA 4AJ4A 3DUFB 2R3SA 2WRZA 4JUFA 1UMBA 2XOKD 3GVHA 4WW0A 1KETA 1M2OB 1VMKA 1QHEA 1T29A 3S6JA 2AOVA 1PGJA 1GCOA 4OMDA 3R77A 3EULA 3GGDA 3H3XA 1Z18A 5KOIA 1BDBA 1J42A 1U3TA 2CB0A 3L7LA 5H3HA 1FVFA 5H68A 3LT4A 4AWAA 4DEYA 4FQ8A 3HNRA 3KJIA 1LBIA 1LWNA 2FSPA 3QELA 5HUQA 4R68A 1RYYA 2R47A 1DOHA 3L4JA 4NZZA 1N2HA 3N0WA 3GZNA 4C7OB 1GQRA 2ISQA 4QFCA 4QG7A 4QOGA 4CIAA 2MYNA 3Q8KA 1W46A 5AIBA 4Q6BA 2F4VB 3OLCX 1TUBA 2XWSA 4NJEA 5JD5A 4OI1A 1R5NA 4MJXA 5FUYA 3CG0A 1YU6A 2PJZA 4PWZA 3VPXA 1N0HA 2V5VA 2IBTA 1ZGGA 2XTJA 5LD2B 3OQIA 1WHSA 3OY2A 3OQ6A 3U9TA 1LJ8A 1BWSA 3OEEA 5C8DA 3O91A 3CVVA 2A9FA 1OLXB 2IDZA 4RIHA 5AHXA 3S68A 1E98A 3FVRA 4M0FA 5I45A 1GCAA 4CDGA 1HG0A 4TKUA 4R98A 1S7CA 4G1CA 3CZAA 2KHZA 3L7YA 4U4AA 2WWWA 2QS9A 1CNFA 2P6PA 1JAYA 2DWCA 2H18A 2IZ1A 1FRVA 1QSGA 1H9BA 2QAJA 2CVFA 3DYBA 1K8YB 2G3YA 1QG0A 1NVAA 2H00A 3GELA 4J90A 1TLLA 2WG1A 1E5QA 2ZBEA 3WIUA 2QJOA 5K0LA 2ZPAA 4TTIA 4MX8A 4F5ZA 1PJSA 2H08A 3Q41A 4NV1A 4UW9A 3UGTA 1ZCFA 2PLFA 2FWIA 3FR8A 3QKSA 2JLAA 4WZBE 4Q4CA 5GONB 1TMKA 1PX2A 4EL5A 5CW1A 5EHGA 3UUWA 3B82A 2VDVE 1DARA 1MO3A 2FG5A 1SCJA 3JD3A 4FTWA 1XJQA 5GV8A 1TAQA 2XNJA 4LSWA 3L7MA 4ISCA 3A2MA 4EX7A 3ROTA 6REQB 1CRPA 5LYJA 2Q3HA 2ZAIA 5IU6A 4GVXA 1F2DA 1HF3A 1R0ZA 3KQTA 4LA4A 2ZRAA 3LSTA 1U0HC 2ATXA 2WF5A 4BE9A 1Y34E 3ZGYA 1Q7TA 1B76A 1FYDA 4CIBA 2GBLC 2IBSA 3G0HA 1ZWKA 4GGMX 2D1YA 4MWSA 4OU5A 3ZCPA 2BGIA 3U44B 1KH3A 1UL1X 1YZUA 3G0GA 3HXPA 4PAMA 1IBSA 2ZROA 3LZDA 3F96A 3QFRA 3USES 3ZW8A 4E1VA 3EIWA 1E99A 4G5SA 4P34A 4LGYA 2ONKA 3VSEA 4KO8A 1H2AS 1O96B 1UDXA 1RM3A 4YAWA 4XXHA 1DEKA 1N78A 3EZGA 3H86A 4XAQA 2CXPA 1NVGA 4BFUA 3X43A 5IFKA 3EEOA 1XB2A 3M7IA 3RJTA 3SIRA 3BD9A 4P81A 2AC4A 3MGKA 2H07A 2HA2A 1P17A 2BMDA 4L5YA 1EWQA 2ZRLA 4AUNA 3RSOA 1B6TA 3PIRA 3H6GA 1YSCA 4L8LA 2X2PA 1Z0DA 2BKAA 1XTZA 1XKLA 3KPWA 3D8TA 2CVPA 4E5SA 3VYVA 3BMOA 4P7GA 1P77A 3GAMA 1EVLA 4I7EA 5JOQA 1G5RA 1RE1A 4FSXA 2PL9A 3UMGA 3TOCA 2VDWB 2X40A 1L4YA 4YQZA 3MA0A 4PSUA 1UDBA 4ID3A 1UIMA 1UZUA 2JIBA 1E1QA 2WIJA 3JQGA 4ZVTA 2PMBA 1PHRA 2UVDA 4U5XA 3ZV4A 5BR7A 1LD3A 1N4DA 2J4DA 1UM8A 1C7QA 2O4CA 2Q6VA 3CPJB 4D81A 4W9MC 5ESRA 2BGGA 1W0JD 2NN3C 1PL7A 2G5PA 4C7MA 3AHJA 1KARA 3OY7A 4PPFA 2FPMA 5HCIA 4ZVSA 2YYAA 3CJRA 5F2KA 3V8NA 2ZM6B 1UFQA 3K92A 3FNGA 3S29A 4E4TA 1WAMA 3PWTA 1VMAA 1ZD3A 1GDTA 2F9LA 1KP3A 3D9QX 4YN3A 2JLUA 2O06A 3EXAA 1GSHA 3UJ8A 4ZYXA 3DE3X 3HKEA 2E5WA 4MK4A 1FFSA 4QELA 1V8ZA 4B8ZA