3IUYA

Crystal structure of ddx53 dead-box domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
213
Chain Sequence
MTCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX53
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 213
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iuyA00
3KXIA 3EZ2A 4GDFA 2IL1A 3KQNA 3BGWA 2IYYA 3QKUA 4GRAA 1X6VA 4QHSA 2W2VA 5AJVB 1TF7A 2ZI6A 4O0MA 4Q1FA 2J0UA 4HI0E 1Z8FA 1W5SA 4CIDA 2WKRA 1TF5A 3AKYA 3R9IA 4UJ5A 2WJYA 4TLDA 3AVQA 3KKNA 5JI2E 4NYMQ 1FX0B 5H68A 2DYKA 1NSFA 3FMOB 1WF3A 4D4LA 4F92B 821PA 2CHQA 3C4JA 5F98A 3W8RA 1P72A 4ARZA 1JJ7A 1WA5A 3CF6R 5F9HA 3PUWA 1AGRA 1W4BA 4G5SA 4JLVA 1PJRA 3WBJA 1KKMA 2OT3B 2PH1A 4MYCA 4BFVA 3T06B 3KKMA 5FTNA 2H7VA 2PCJA 5P21A 4DLYA 2BMEA 1CR1A 5FPSA 4W5HA 4DXAA 3HR7A 5KTYA 2IYSA 4AKEA 1MO3A 3LQQA 1GAJA 2RGAA 4RFSA 4CEIA 3CZQA 1UEJA 1F2TA 4M21A 4BFTA 4DWJA 4U7DA 1N2CE 3EARA 3PIRA 3HWSA 1IXRC 2I1QA 4LCBA 3O8CA 3DEFA 3NIBA 4QNRA 2FZ4A 2RB4A 2ZJYA 3QBTA 2O8BB 1RJ9A 1G3RA 2FGKA 4Q66C 2ZU6A 4JLAA 3OIYA 1EFUA 2C77A 2WVJA 3C14C 4GP7A 4IDHA 1ANKA 1H8EA 4B35A 3U4QB 4G5RA 2FG5A 1NMYA 4JBWA 4MYUA 1M34E 5EE3A 3EG5A 1M6NA 721PA 5JEDA 421PA 1P9NA 3DKVA 4U02A 1T0JB 2IBMA 1KI6B 1OH7A 1UDXA 4LC1A 3K0SA 1JR6A 3Q5DA 2GJAA 4OK3A 2AR7A 1UFQA 4HDOB 2RHMA 4KVAA 4DUGD 3QY0A 4L5BA 4LJ4A 4CT4B 3RAPR 2PT7A 2QU8A 1ZC3A 3BH0A 1P6XA 5JEEA 3AH8A 2QQEA 2GCOA 1AA9A 4DEXA 1U8YA 3OEEA 3X1DA 3B85A 5C4GB 4QC2A 1JAIA 4URWR 2QSZA 3DMNA 1A5TA 5KDOA 1KI1A 4HAYA 3ZIAD 5BN4A 4FCVA 1YR6A 4FXPA 4AKHA 3U5ZB 4RD4A 5DN6A 2OCYC 1QZXA 1ODFA 1W2HA 5FPHA 4ZV4A 4A6PA 1T8TA 5BXQC 1P9WA 3TVTA 3GP8A 3ONWA 2BMDA 4BASA 1XEXA 3A4LA 3B82A 4JLMA 1M74A 4RD6A 1Q57A 4GP6A 4RZUA 5LD2C 1ZNWA 3FHTA 2QROA 3CX7A 3LH5A 4AYTA 4W5WA 4WZAE 4DT1B 5EXTA 3GJ0A 4QM6A 4M8NE 2ZR9A 5CJ2A 4ZKEA 2IUSA 1P9RA 4C0LA 2OEPA 3S1AB 2BBSA 3RABA 4IVPA 2C98A 1R0XA 4ZIRB 4JJZA 1II8A 1PLJA 2AFHE 2IEYA 1GTVA 4KJZA 2O8EA 1ZM2A 3K70C 4PC3A 1J2JA 2D7CA 1E9BA 3QXCA 5L3SB 2N46A 2NIPA 3QVUA 3UMSA 3GJ5A 4D0GA 1JNYA 1WMSA 1KOFA 1PLKA 1RRGA 3GLFA 2VP0A 3EXAA 2YC2C 5TMPA 1W5TA 4X8MA 1GILA 1NN1A 3GEIA 3AVXA 3IKJA 1VG0B 3VKGA 2QMEA 1IN7A 2LKCA 3E2IA 1U0JA 2VSXA 4DHEA 3ADDA 5D3QA 2H1LA 4AURA 2IT1A 3K1JA 3K8YA 1ESNA 1ZMXA 2ZJOA 3QENA 3LBHA 1XXHB 5FBRB 3WY9A 3BE4A 1IN5A 3LLMA 4D4MA 4TWZA 2LWIA 4LHVA 1T3LA 5IHPA 2BCGY 3WHKA 4NYMR 2OAQ1 3ICQB 3KTAB 3W3ZB 2F3RA 2JLSA 5G41A 1RE0A 1A1VA 3MUFA 1S4QA 2J0SA 4IOJA 3AKCA 1O87A 5DISB 3FGNA 3QI2A 2ZRBA 3AF4A 3C15C 1P73A 2DB3A 5CB8A 2O8CB 2CCJA 4KCGA 1R8SA 2QAGB 3BIFA 1OJLA 1SVWA 2D2FA 1E0KA 3IPXA 4QJ4A 1P5ZB 3NG1A 5HKKA 4QGGA 4Q4HA 3RSLA 2RAPA 3PITA 3VU9B 2WTUA 4GPTA 1S1CA 1XTJA 4JVSB 1NIJA 2OE2A 1W7AA 3OIVA 3QVVA 1AZTA 1H8ED 1TPZA 1U94A 3Q7QA 4CEJB 1VCOA 3WRYC 4UXHA 2RMKA 3LW7A 3ZVMA 4P4UA 1XU4A 1NVUQ 1VIAA 2CCGA 2O0JA 1KSFX 3H1TA 5GADl 2JLWA 5FOUA 3DZ8A 4CEHA 2CL7X 3NC0C 1OT3A 2Z4SA 4EUNA 3VR5A 5AUOB 2WWGA 3SR0A 3CNLA 2QG6A 4B44A 5EP3A 2JLUA 1W44A 4KBGA 4D26A 1IXZA 3U7HB 3BRWD 5FPYA 4DIDA 2OCPA 1G3IA 1I2DA 3NVAA 3SBDA 2ZRJA 2GJ8A 4A8JA 5J47A 2AK3A 1T4GA 2VLIA 4UXIA 1VYVA 1JALA 3MSXA 3TR5A 4LYJA 2ZYUX 4NTZA 1AS3A 4E5UA 1T3SA 5DN6D 3N70A 1NN3A 1ELOA 4Q9KA 5KSYA 1KSHA 1MKYA 4Q00A 5FOTA 5SZHB 1JI0A 2RKOA 3I3SR 3PUXA 2AX4A 5JSZB 3NHBA 2PEYA 2GK7A 5HPYB 4FN5A 1SVOA 2NO1A 3EASA 4RKFA 3ZD7A 2H8KA 1GIAA 3HYTA 3IO3A 4HSEA 5IDVA 2BJWA 1E2PA 4HZUA 2W00A 2IC5A 1QDEA 1PZNA 2ZRAA 1T91A 1PVOA 2EFEB 4C0QC 3W9YA 3DVLA 4P32A 2OBLA 3TH5A 3DOFA 5DHAA 4FMBB 5AUPB 3EAQA 4A6XA 4TYYA 2VHCA 3TUJC 1E69A 3ZD6A 4GOJA 2ZRLA 2VF8A 3CX8A 3GLGA 2FWRA 2N42A 1GKYA 1RYHA 2HJGA 5FOXA 1CJVC 1TNDA 1AQUA 1CBUA 1W0JD 2C78A 4J0QA 1Q21A 1E9DA 3NDPA 3MLEA 4GOKA 3TUIC 3GLFE 1SQ5A 2ZUDA 1XTIA 4HB4A 5GJCA 2HT1A 1U90A 4ZDKA 5BYKA 1IONA 3BFVA 4F91B 4A4DA 5C2JB 2XXAB 1E2QA 4I1OA 4DEYA 1Z83A 4B3GA 1U9IC 4C30A 3D3QA 2BOVA 2W0MA 2ZSDA 4PC2A 2FPKA 4Q9LA 4IDPA 4KBFA 5FI1B 3T1VA 1Z28A 3VAAA 3U44A 3IBYA 1G6OA 4RD2A 1VCIA 4JLKA 2NTYC 1P2TA 2D2EA 1RZ3A 1G7TA 1D9XA 1XPRA 5J40A 1WQ1R 3RHFA 1G8FA 1YZLA 3FHCB 1ZIPA 2ZJ8A 1W0KD 3PR1A 1U9IA 2ONJA 3AP1A 3EPJA 4WIAA 2CK3A 4QHTA 1E94E 1DVRA 4WZ6A 4DB2A 3V4FA 4IFEA 4KO8A 1D8TA 3A1SA 2EFDB 3LLUA 2ODBA 5KSPA 4ESHA 1MT0A 5HKKD 2QT0A 3FVQA 3RRYA 2IS4A 2Z6VA 1BO6A 2IS1A 2FNAA 3THWB 4NE2A 2AXPA 3CB4A 2FZLA 1J8YF 4N0EA 1NJFA 4ZDJA 2WV9A 4AWXA 2XNDD 1G1MA 1A82A 3SJAA 4BGDA 1ONBA 2V7QA 4M1YA 2J5XA 3B1YA 2PZGA 5FBQB 4DLZA 8OHMA 4Q1CA 5AUNB 1KGDA 1ZD9A 1XEWY 2ZU0C 4AIIA 1DELA 3JZMA 5CK5A 1OH5A 2F43B 4FIDA 3VFDA 4EPVA 2J0VA 1G16A 4PAMA 4IDOA 5EJEA 4BUJA 1AKYA 3FMFA 2D3WA 3O8RA 2GXUA 5B2ZA 5HR5A 1E0JA 4LYHA 2XTZA 3GD7A 4HLUC 5EUQB 1RKBA 1S3SA 4YMSA 1XTQA 3AUYA 1YR8A 1EG7A 1MRNA 4KAXA 1M1YE 5JWOA 2ZRDA 4JMPA 4LX0A 2ODWA 2OLJA 1E4VA 4E03A 5C1BA 5FOSA 3VX4A 1II0A 2J7PD 3K0FA 4D0NA 1DE0A 2YNMA 3REFA 2GBLC 4TL8A 1CR0A 1XMIA 1X1SA 2E9SA 3BERA 5CITA 4G3XA 2H92A 4HLUA 4EJSC 1DEKA 3E70C 3W3AA 1LF0A 1BS1A 3AEZA 3ND8A 4ACBA 2QL6A 2ZUBA 3QXHA 3AB3A 3HYRA 4LJ8A 3SEAA 3TAHA 2CNWA 4MGIR 5GJWC 1VIYA 4TN1A 4OI2A 1Q0UA 4JZKA 4LV6A 1US8B 1Z2CA 4QM7A 1RVDA 1G4UR 2GBLA 4FW9A 5FTKA 3ZQ6A 3QIAA 1GNPA 4DBLC 2ODEA 1CRQA 4ACAA 3N2IA 4N0DA 1S1MA 3B1ZA 1DG1G 5JECA 3CRRA 4Q4JA 4IOKA 4DLXA 4XTCS 3B7GA 2MMGA 1OXVA 2A2ZA 2CE7A 2EWWA 2WOOA 5EP4A 4GZLA 4AYWA 1W36C 5CDFE 4U5XA 1KO4A 4WOPA 5E4FA 2ZS8A 2HV8A 1P4SA 2P3SA 2ZJ2A 4B2IA 5IK2D 4M9QA 1N6IA 4DLSA 2ANCA 3V00A 2V1UA 3TSWA 3VR1A 1IY2A 1Q3HA 2MSCB 1BOFA 3RSOA 3GLIA 1GOTA 3AP2A 4Z8YA 3QKSB 4TMWA 4MDEA 4P4SA 1T5LA 4AD8A 4IOLA 1ZNZA 1KHTA 4I81A 2HUPA 3BC1A 2FDCA 1GG2A 5TB5A 4B73A 1QG4A 2YWHA 1UAAA 2WSSD 3A1WA 1B0UA 4O2LA 1AZSC 3BXZA 3GEHA 4Z54A 4V0MA 1CR2A 4CYMA 2PBRA 4KXFB 3VR3A 3WXMA 1E2GA 3EIQA 4IRUB 1YZQA 3NBXX 4P0TA 2JLYA 5FR2A 3PG5A 4C7OB 1NN0A 2CCKA 4HZIA 2ATVA 2RGDA 1OYYA 4ITRC 1DADA 2CK3D 4L4UA 5IT5A 1K6MA 4Z8XA 3TBKA 3SQXA 1EWQA 1G3MA 5JRZA 3AP3A 2OHFA 2TMKA 4IKEA 4B3BA 1UKVY 3GJ6A 1Z0IA 4BLOA 2NMVA 2B6HA 4I4LA 1N25A 3D6TB 4X8HA 4S2EA 2V54A 3TQFA 4DDTA 2C9YA 2OFOA 2QRZA 3DKPA 5FBLB 2W6ID 2HXSA 2FA9A 3LD9A 1R0YA 1SVIA 4BE7B 3K09C 4YMTA 5DO9A 3WBKA 4B43A 4BFYA 2FX3A 4US2R 1XCPA 2P6UA 3P4XA 5FL3A 3EZ9A 2QGZA 4FINA 4TMKA 1FPMA 1ZM7A 2CHGA 3GEEA 4R2IA 5CLQA 2F1RA 4DDUA 3RS0A 4IXNA 3IQWA 5KNDA 3HPQA 3SDZA 3KJIA 2Q6TA 1Z22A 2HLDD 4PPQA 3PEYA 3I5YA 1M7GA 1Q1BA 3EIHA 4PHFA 5J4HA 2CE2X 4Q48A 1DOAA 2DWOA 2J0UB 1YZKA 2XZPA 3SBEA 1U8ZA 1RRPA 5DI3A 1X3SA 3A4NA 2F6RA 4MGZR 2QTFA 3I72A 1Z0FA 3BORA 4QRHA 2D74A 2HYIC 3CPHA 1Z47A 2WWYA 3SYNA 2DBYA 4O25A 2G88A 3T34A 4FI3C 1Z29A 3OFND 2PCLA 3QEOA 4B34A 1OH6A 2VTKA 1KDPA 3K9HA 2GHIA 2QT1A 4ARZB 2F1HA 3SS8A 3CWZA 2GK6A 3AGQA 4HEJA 2CL0X 2WKQA 3OEHA 3C7KA 1P62B 2ZSAA 1R4AA 5DGXA 1E9FA 2FF7A 3LAWA 4PC6A 2VP9A 1C4OA 4PC1A 1EFTA 4YMUA 2KBFA 4NU0A 2IYWA 1Q1EA 3FOZA 4BFUA 4KITB 3KFXA 2XNSA 1F5NA 4RFSB 1SXJA 1UPTA 2ZSBA 4OI0A 4CEIB 3A37A 1F2TB 2DFKB 3A8TA 4LHWA 3UG7A 1JEEA 4OYHA 1ZW6A 3IEUA 3QKRA 4D4JA 2A78A 3ZS9A 2D4HA 3IHLA 3SJCA 4DCTA 1QHIA 2CL6X 1RRFA 1I2MA 3ZLJA 2QY9A 4JYBA 2XEXA 4YC7A 1JXOA 1RJ9B 1TF2A 2BVNA 2ZRPA 2WPDD 2J46A 4LBVA 1GNQA 4LV8B 1A4RA 2IXFA 1ESMA 3G0HA 2DFLA 2GA8A 2PJRA 4Q1AA 1YE8A 1FUKA 2QBYA 3TAUA 4TTRA 1KNQA 2B92A 3VHXA 1LW7A 2WOJA 4TZ6A 2CDNA 1YR9A 1D2EA 1NKSA 5G3YA 4MYTA 4NP6A 2BM0A 4KHZA 4CF7A 4PQFA 2Q9CA 1HYQA 4LDJA 1UADA 3Q5EA 4PZZA 1KY2A 1W4RA 3VQTA 5H8WA 2OCAA 1COWD 3L2OB 3GLIE 5E3HA 4LPKA 1CP2A 3NHAA 1N5KA 1XF9A 4IHQA 2QPAA 3DDCA 2J3EA 1D6JA 2ZR0A 3QEJA 5AJYA 5LPNA 3CH4B 2GCOB 2XSZA 1NBMD 2WWFA 3OHMA 3BH6A 3CPJB 3WP0A 3L8ZA 2NO6A 3AQ4A 4B33A 2OSBA 1G41A 1JPNA 4KFSA 3CBQA 4JBYA 2LCFA 4NCHA 5H70A 2ATXA 2PLFA 1NBME 3A1VA 3CRW1 4JL5A 4RD0A 1OV4A 1Z5ZA 3QQ5A 2R6AA 1DTSA 3TSZA 4JLNA 3R9XA 2FEMA 4PO1A 1YZTA 4NMMA 2O8FA 2ZAOA 2R44A 3PQCA 5EE1A 1VHTA 1T3HA 3DM5A 4JIMA 4EPWA 1YQTA 3VKHA 1LTQA 2VBCA 3EA0A 1XEXB 1KMHA 4L8GA 3X1WA 3KQUA 4OJQA 4V0OA 2FN4A 5HE8A 1YU9A 1TX4B 1VYTA 3J81k 1GKIA 1X8KA 1E2LA 1R5BA 4RD3A 1JPJA 4EJSA 4NKRA 2PX3A 4RZXA 3SE0A 1ZM4A 1JB1A 4EPRA 1RRCA 3OIUA 1UDWA 1Z63A 1KO8A 3WRXC 4UNQA 1II8B 5SZKB 2IA5A 3NTUA 2RGXA 1W4CA 3LVQE 5LD2B 3GFOA 1PLLA 1IY0A 2NZJA 2BMJA 5JBQA 1U81A 4PHTA 3GLFB 3ZZTA 1GP2A 1TAGA 1WDTA 5DYIA 3E5HA 2WJHA 4IW3B 1CKEA 4JLPA 1ZAKA 2F1IA 2WJVA 3PCRB 4ILEA 1M2OB 2OBMA 1RIFA 4DSTA 3AF2A 4MKHA 2XGJA 6Q21A 3WYAA 4TL7A 2I3BA 2G83A 1PUIA 4MITA 2Y8EA 1CIPA 5FH9A 2BKUA 3OF5A 1MOZA 1E2HA 4GMDA 5FUYA 1J8MF 4FMCB 1VKJA 3OEHD 4JT2A 5L3QA 1PUJA 4LZZA 3OZXA 3O47A 3SHFA 4ERNA 3IHWA 4NPHA 1HUQA 1WB9A 1Q22A 1LV7A 2X2FA 2QE7A 3RRMA 2Q3HA 3QF4A 2YYZA 1E32A 2QEQA 1OW3B 4B3XA 4BLSA 1GITA 2CHVA 4Q01A 5AJZA 5SZIA 2ZE8A 1J90A 2VEDA 4E09A 3M6AA 3SJZA 4EPXA 2H57A 4M1KA 1SXJD 1RFLA 4HLQB 2QTHA 4ZI3A 3IEVA 5E95A 2XB2A 4IJMA 2JJ1A 2VQSA 4MH0R 4QJ5A 4V0NA 3U3RA 2FFBA 1SXJE 4EIWA 2ZVPX 2HXYA 2Z43A 2YOGA 3DO6A 2GF9A 3FE2A 2YJTD 3R8FA 5GVSA 3LO5A 4Q4HB 1N0UA 1VHLA 4ZKDA 2C8VA 1MRSA 1W4AA 2ZRMA 2GXAA 1VG1A 2BV3A 2XJ9A 1II9A 4LJYA 1YR7A 2A5GA 1XD8A 1G4AE 2ZQ5A 3KXKA 2VSFA 4UXJA 2RGNC 2ERXA 4CEHB 1E0AA 5FOVA 3B5JA 4IVRA 4I1VA 1NL3A 1ZM3A 5FUXA 4C3ZA 4MGYR 3GJ4A 2IUUA 5M04A 2FSFA 1RC8A 5E7JA 3BJIC 1XDBA 2QUZA 2XSZD 4LYAA 4V0KA 4A8JB 2BC9A 2JAQA 4PANA 1F3OA 1LF5A 2CMKA 2RGNA 1HH4A 3BK7A 4KLZA 3RANA 4BEJA 1JR3A 1KZ7B 4IFBA 4TTQA 1QHXA 1W46A 3WNDA 4BLPA 3Q85A 4AYXA 4XWOA 2G3YA 4EQ6A 3KQLA 2G77B 1E1RD 2J41A 3QXJA 3TGPA 4AI6A 2AN9A 4PSAA 4POAA 4N1AA 4DCSA 4BEBA 4Y0VA 1XD2A 4C0AC 1KAOA 4DSUA 3UIEA 2AL7A 3SU8A 1C1YA 3K0AA 4YLGA 1E2DA 5KU1A 3HJNA 3Q3JB 3LXXA 4TYPA 3CRQA 4TMZA 3BAFA 4TLCA 4HZUB 2OFXA 3LFUA 5KNBA 4EPYA 1IXSB 3AKEA 2ODNA 2H17A 1S8FA 4M9XA 2O0HA 4TL6A 1KYIA 1OB2A 2DPXA 4PZLA 3THYA 3NWJA 3UATA 2GEUA 1P2VA 3SZRA 2VSOA 3QPUA 4Q47A 3PUZA 2A3RA 5JCPA 3A6PC 2J9RA 2QRNA 3NBZC 3B78A 2QENA 3W5IA 3GLGB 2L0XA 2ORWA 3MMPA 2FOLA 2NO7A 3ZZUA 4UKDA 3TJZA 3TW4A 2XITA 1ZCBA 4OQMA 1ZNXA 2V1XA 2ZTSA 3VHLB 1QVRA 5JLJA 1TADA 1WXQA 5JWHA 4Q7KA 2YZ2A 3BWDD 1NNEA 5LB2A 1R0ZA 2ZYTX 1OH8A 3JVVA 1KI4A 2QE7D 1QF9A 2J7KA 5J4YA 3U44B 1D5CA 2C95A 3D31A 4NCIA 3U3KA 3BFXA 1KNXA 3GJ8A 1KI8A 2R62A 3CWQA 1JJVA 4TLAA 3KFVA 1UEIA 3L0IB 2PLRA 2GZDA 3L43A 4NCKA 4E07A 5IRCD 3ADBA 1KI9A 1QBKC 5EQTA 2JIZA 2IYUA 1Z6AA 4QGHA 3U7EB 2R6DA 1SVLA 4DKXA 2F1JA 2C5LA 1T6NA 1XJ0A 4EKDA 3T35A 3QOFA 3MWLA 3NEYA 1Q1ZA 2IYXA 1CR4A 2OBNA 3AF1A 4LUCA 4AC9A 1N3BA 1YRBA 4QBFA 3VR2A 3WMGA 2HDNB 3HR8A 2Z83A 1GFIA 4BLRA 1OKKA 4EAQA 4DLUA 2O8DA 1NSTA 1YJ5A 2JLQA 1XPOA 1S9DA 1YVDA 2REBA 4FWTA 3OEED 2FGJA 2PX0A 1ZM9A 3CONA 1A2KC 3NEJA 4G5GA 2EFHB 2OCBA 2NZ8A 2QA5A 4BZXA 2KBEA 3QF7A 4A92A 2JGNA 5A0FA 4PTLA 4TL9A 5DNYB 1JQJC 4MQBA 1XCMA 2PL3A 4M1MA 4A0RA 3EPKA 1CEEA 1W49A 3B6EA 1G7CA 3FFBA 5B64A 1SULA 2FFHA 4LBZA 1CF4A 4A1FA 4Z1MA 1NVXQ 2IWRA 2HF9A 3MCAA 5ELXA 1CRPA 2GILA 2NO0A 5K8UA 5CM8B 1IJFA 1GVNB 4GOXA 2OXRA 2W6JA 1JR3D 1OFHA 3L0SA 3N2EA 4BFWA 2WBLC 3K0FB 4BQSA 4F4JA 2KB0A 5DSZA 4HAUA 2CBZA 1JR3E 1XX6A 3HU1A 4RJLA 4ZDWA 2GAAA 3K0CC 3H84A 3RS4A 1ZVQA 4HUTA 2BMFA 3CW2A 1VCMA 1YKSA 2ZI7A 3EZ6A 4M53A 5KDLA 4DLTA 1TQ4A 1HV8A 1ZD8A 2G1JA 4A15A 4YDHB 5EE9A 3C8UA 4JLOA 3KB2A 2J87A 4F7WA 2X2EA 1TEXA 4M22A 2IXGA 4BWYA 3H2YA 3N5CA 4DSOA 1AK2A 3MWKA 3T1QA 1H65A 1GL6A 2CJWB 1SVKA 4Q7JB 5EE5B 2ZI3A 3KZ1E 2EW1A 5EP1A 2GEDA 5IF9A 4TQUS 5KSZA 4Q4JB 2ZYVX 1Q44A 2OAP1 4F38A 3QXXA 2GXSA 3SOPA 3K70D 4MKGA 3WHLA 4TLBA 1NMZA 3RS2A 4JT4A 4LJ7A 3PFIA 4B2LA 1JAHA 1GRRA 4GBMA 2ZRGA 2E1RA 4Q4AA 4QNMA 5EUMA 1EX6A 1XEFA 3P32A 2QGNA 2ZJ5A 4LHZA 4UNSA 2QAGC 3GLIB 1BMFA 4IEIA 4NH0A 4F93B 4YXWA 2V8OA 3I8SA 4ZCIA 1N6HA 4P4SB 3NH6A 2FE4A 2O0KA 5G53C 5FUWA 1NG9A 1G8YA 2JJ2A 2ZJBA 1W36B 2WMOB 5JWRA 4KFTA 4GZMA 4L9SA 4B3DA 1YHNA 5CK4A 1SVSA 4UNNA 1K5DA 1XPUA 3DMDA 4W5JA 1SKYB 1LB1B 3WYGA 5J5CA 5JJKA 4Q9IA 2UZ3A 2QAGA 1GRQA 3RNLA 2BEJA 4WW0A 2ZSEA 3CZPA 5CIQA 1E9RA 4OHZA 1KMQA 1N6OA 1EFCA 3NDBB 1DAEA 1G5PA 3AVOA 1FFHA 3MWYW 5CIWA 4WAUA 5FOWA 1YZGA 5JHGB 2CLCX 1DAFA 2QMOA 4M9ZA 1RPZA 3UXMA 2KE5A 3ZVRA 1D2MA 1G5TA 3UWKA 3ZDQA 1XMJA 2IS2A 5A5GA 1FMLA 4LGMA 3VR6A 1Z07A 4II7A 1G7SA 3ZJYA 1J99A 5BW8A 3PUYA 3SJBA 1WCV1 4XWAA 4FCTA 2QMHA 3ETLA 4Q9HA 3BBPA 1MV5A 2B7BA 2H16A 3QXSA 4LBWA 2JCSA 4TSFA 1DAKA 3W5JA 5CLLA 3SHWA 1ZC4A 2ECKA 3FKSA 1OHHA 4GI7A 4TYNA 3IBGA 2GVZC 4B48A 2DHRA 3AVYA 2WAYA 2AXNA 3GFPA 4XH9B 1B23P 2ZI5A 4LJ5A 2QP4A 4M1OA 4NYIQ 621PA 3CM0A 1J70A 1CU1A 5DI3B 1KDTA 2BCJQ 2YVUA 4Z1MD 4PQYA 2QQ0A 3M4YA 5KNCA 2RCNA 4QGAA 3T5GA 3U3JA 2WWHA 4C0HA 2W6JD 4C0KA 4PPFA 5DLQC 5J4VA 1NP6A 1AS0A 4TYQA 2NPIA 3GLHA 2ZXUA 1I4LD 4M0LA 4RZ2A 2D7DA 3C16C 1QVAA 2ZRHA 4FMCF 1R8QA 1GZSA 1VTKA 2PEZA 2VHUA 1XWIA 4N3NA 5TARA 3ADCA 5DE3A 3G5UA 4JSYA 2P5SA 4BLTA 3RS3A 1EFHA 3HU2A 4BRWA 1ZU4A 3P26A 2WICA 1TL7C 2GZAA 1FOEB 2XB4A 2CXXA 1SXJB 3I92A 2VP5A 1JXMA 2BEKA 5K8TA 4FCWA 3EWSA 2V3CC 2GRJA 4DLWA 1GM5A 4HATA 1XP8A 1W2GA 3QKRB 1Z0AA 2QNRA 2DWPA 2R6CA 5DHFA 3GLGE 2GETA 3MJRA 1U98A 2HJVA 4LJAA 4PHHA 1N6RA 4B3FX 3IIMA 5JHHB 3B8HA 3MG9A 4NCJA 1G6HA 2RGGA 1S9HA 2QBYB 4R98A 1E2JA 1VDZA 4HAXA 5KOYA 3LQRA 1U0LA 1XBTA 1NLZA 3B1XA 3FYHA 5CB6A 5GJBA 3CR8A 2J1LA 3OAAA 3TK1A 2A5DA 1BMFD 1CJMA 4C4PA 3D7MA 3FFAA 4QOSA 1UKYA 4URXR 3KQHA 4D82A 1TUIA 4NL4H 2JLZA 1SKQA 2J45A 3I73A 3A4MA 1TTTA 5JRJA 3IUYA 5F9FA 1PV4A 3MFYA 3FTQA 4CT5A 3EA5A 2GKSA 4KFUA 1OXTA 4Q21A 3PXGA 2Q9AA 4B3CA 1J7KA 5G3ZA 1UF9A 1AM4D 1ZRHA 5CYOA 3SC3A 1E0SA 1I4DD 1E9EA 5L3VA 2BBTA 3TMKA 1AJEA 3WNBA 3IPYA 3KXLA 3RS7A 1NRJB 3A1TA 4UQOA 2QM7A 4WXPA 1KK0A 3ASYA 3REGA 5A4JA 2NOAA 4OI4A 1AIPA 2V7QD 3CNOA 2A7QA 3F5FA 2AK2A 4HB0A 2O8FB 4XWKA 3TSOA 1QHGA 1VG9B 3KB1A 1KMHB 3GPLA 5TVKA 2ZE7A 4OKSA 3KUDA 4HB3A 4DDWA 2UZIR 3K0EA 4L16A 4Y0AA 1ZUHA 3AVWA 1E2NA 1NMXA 4DB4A 3R7WA 3CRVA 3K09A 2BIFA 2FEOA 4Q03A 4O2RA 5CJPA 3X1YA 2JDIA 1D9ZA 2ZR7A 5JJLA 4EJSB 3THXA 1F6BA 2IEZA 2PZFA 3BB1A 4GMXA 4D25A 2OESA 4W9MC 3FMPB 4TSFD 2ZROA 4IDQA 2ZUCA 2HT6A 3L82B 3ZZ0A 3U61B 3FKSD 4Q02A 2QTVB 1QHYA 4A0FA 4ASUA 3K9LA 2GESA 1E79A 1XZQA 4M9SA 2G1KA 1NVVQ 1UM8A 4M1SA 4R2HA 2A30A 1SVMA 5FBVB 2DCUA 2A9KA 3VR4A 3B1VA 3DOEA 3LXRA 1E9AA 4R9UC 1G291 2OLKA 1VCNA 4IEEA 2DFTA 3VNUA 4PSKA 2AFIE 2OXCA 2ZS7A 4OK5A 3RYTC 2CNWD 4QJ3A 4B6FA 1DO2A 3PV0A 4I1UA 4V0LA 4B76A 4HAZA 1N5LA 4IOMA 2R6GA 4JS0A 3KL4A 1X8LA 3W90A 5L3QB 4E22A 2EU8A 4CRWB 4KFRA 5AJWA 1JQLB 3EPLA 4MYHA 4NYIR 2QAJA 3QKTA 2FPLA 3QF4B 5HZHA 1R7RA 1HQCA 2K5UA 3DHWC 4F4IA 4JLJA 3TW8B 2JATA 4O3MA 1L7VC 2AD5A 4TT3A 4C0BA 3CNNA 1LS1A 1X1RA 1Z6XA 4HLDA 5ANRB 3SNHA 3GQBA 3IIJA 3UG6A 5J4LA 4HDQB 1BKDR 1TU4A 3FMIA 3B9PA 2VO1A 1Z0JA 4RCYA 2IK8A 4OQXA 1KTVA 4P4TA 3PENA 4EPTA 2FSHA 5TDHA 5K8LA 3DPUA 3K53A 2VRWA 1VPLA 3IQXA 3AF3A 4G0NA 1W36D 4TMXA 2IHYA 2BJVA 4YQFA 5AK0A 1TQDA 4PX9A 3QUSA 1FUUA 2X77A 2AWNA 1WBBA 1A7JA 1EK0A 4K81B 4A2QA 1E98A 1G9XA 2KJQA 1FNNA 4URUR 4OHWA 2FPMA 2X1VA 4JL8A 3TLXA 2RH5A 4JKIA 4K46A 1P3JA 2GJKA 5EP2A 3RWMB 3TUZC 4OHVA 2WJIA 1X8JA 2GCPA 3UMRA 4HYYA 1SKYE 1W1WA 4P31A 4V0ME 1M7BA 4JKYA 5FPTA 2CVFA 5L3RA 2FU5C 4KU4A 4B47A 4YDSA 1Q1QA 1Z6YA 1EXMA 2PJZA 2IYZA 5FBWB 3T5DA 3IGFA 2WSMA 2GJ9A 2B8WA 1E2FA 4RSGA 1IN8A 1UBGA 2BKEA 2J0QA 4FMDB 3HDTA 3W8NA 4LV5B 1BYIA 4JJKA 4LK2A 1NY6A 1ZU5A 1KZGB 3EW9A 2FJUA 1U99A 4EQ6B 4I99A 1N6KA 1WRBA 2DY1A 2KWIA 3O8BA 4BRUA 2XOKA 3JZAA 1XD2B 3LV8A 4XSGA 1DAMA 3ZYCA 1KI7A 1Z3IX 2EQBA 3QBVA 3LDAA 4A0GA 3K0AB 1HY3A 2O8EB 2AKYA 1BIFA 3I5XA 2GF0A 3PEVA 1E3MA 1XRJA 4HUQA 4QKQA 2IWHA 1KO1A 1S3GA 2V4ZA 1NJGA 3CR7A 4IDNA 2JDID 4DVGA 1KK2A 3ZQJA 1G7RA 3SFZA 3BD9A 1XJQA 3LBIA 2ZIAA 2ZAMA 4JLDA 5F3WB 2G0TA 4A0HA 2WIBA 1Z0DA 4D4KA 1P61B 2VHJA 3LX5A 4PR0A 3AGPA 1VECA 3THYB 4B74A 2JLVA 4ASUD 1U0HC 2CVHA 3NH9A 3K70B 3VNVA 1E79D 5UKDA 2IHBA 1G21E 3L0PA 4KV9A 5TY0A 3RLFA 4R7ZA 5D3MA 4MKFA 5HE9A 2B7CA 1G5RA 2OUKA 2IYTA 4QBHA 1AQYA 4DIEA 4R71A 1GDDA 5H1YA 2BHRA 4ZI2A 1FL9A 2ZRFA 4QFMA 4ZPXA 1HQYE 3EWAA 4FWIB 2QSYA 4Q4LA 5J4KA 1U2RA 4YMVA 4Q9JA 4NDZA 1DO0A 2E87A 1KJZA 4UNRA 2W58A 4AG5A 3T1TA 3SN6A 3U6KA 3P20A 4A2WA 1QHSA 1NVVR 4TMVA 2ZYWX 4Q18A 3C5HA 4WVFA 2ORIA 2VP4A 4DCVA 5HTKA 3RRZA 3MD0A 2IF2A 1CJTC 1E2KA 1CLUA 1XCGB 4G1UC 4TT3D 4U00A 5KSOA 1NKTA 1G8GA 4Q1DA 1QHHA 3CLVA 2MSEB 4LJ9A 4KODA 1LNZA 3KJGA 3QG5A 2ORVA 1EWRA 1DAIA 3H0KA 1GKUB 1VG8A 2JASA 2XTNA 4NCNA 4OK6A 3W6PA 1R6BX 3CUEF 1FP6A 4ZDIA 1E2MA 1MO4A 4FD2A 5F2EA 4TQ9A 4RZ3A 3V9PA 1GNRA 2YC4C 5C18A 1OF1A 3SYKA 2GXQA 3I4LA 3M1IA 3VTKA 1OXSC 3UKDA 4MRSA 5KUTA 3EIEA 4KYIB 3B13B 4Q1EA 3EZ7A 4WZBE 4JVMA 3P4YA 4NONA 3X2SA 3BB3A 4URZR 4PHGA 2P6RA 2O8DB 1GUAA 5AUQA 5DH9A 5LDDC 1NG1A 1MABA 2NGRA 4W7SA 1KAGA 3AKDA 4XVQA 1T8UA 3AUXA 2ZRNA 1N0VC 3AVPA 3WMEA 3X1XA 4XVUA 5KYKA 3U60B 1R0WA 4D2IA 1F2UA 4AKGA 1IN6A 4D6PA 3GMTA 5DYGA 2LKDA 1V43A 1QHNA 1OYWA 3VX3A 4DLVA 4LJ6A 1Y63A 1KJWA 1E9CA 2JLRA 4MRNA 4H1VA 3U3MA 2NQ2C 1N6LA 5FTJA 4ESVA 1R10A 2CLSA 5L8VA 3E1SA 1CULC 1S2MA 2YV5A 3ND9A 2QN6A 3T61A 3CX6A 4AK9A 4TYWA 3DM9B 1SGWA 5FUVA 2PT5A 1YRAA 1K5GA 1L4YA 4GT1A 3SFVA 2FH5B 4IVQA 1IQPA 4PAQA 1FX0A 4TMTA 5SZJA 2XOKD 1IOZA 3WMFA 4I1SA 2F7SA 2XZOA 2KSQA 1IAQA 5HCNA 4A36A 5GJVC 1HE1C 2XTMA 2WKPA 2F3TA 3KX2A 3O8DA 3Q8XB 4RD1A 2DWQA 2G9NA 2FFQA 2IW3A 5FL7A 2FSIA 3F3YA 4WBSA 1W0JA 1MR3F 3LW8A 4HDCA 1DG3A 1Z08A 4B2PA 1V5WA 2C9CA 2EFCB 1NLYA 4KSCA 2ZE6A 1MO6A 1KDRA 4RY2A 1NF3A 2OZEA 3QPWA 3R8CA 4DZZA 5EE0A 4Q4AB 3IDQA 1GWNA 5JJIA 1CS4C 4GSYA 2O8BA 2OM2A 2WAXA 3IILA 2WMNB 4H1UA 4KSBA 1KSGA 5FI0B 1OIWA 5G40A 4XD7A 1KKLA 3OESA 3I61A 2A5JA 1ZIOA 3B9QA 2A5FA 1T5IA 2JJ1D 4CW7A 1W0KA 2GTPA 3U4QA 5FR1A 4Q19A 4QHYA 2ZRKA 2Q0HA 3AV0B 2HYDA 3LBNA 4D80A 5BYJA 3CH5A 1LY1A 2FSGA 4OJKA 1E1QA 2GWHA 4PSVA 3KJEA 4BZQA 2W2XA 1KI6A 2GEVA 2VH5R 2ZJAA 1WE2A 3LRPA 3NBFA 3UPUA 2VL7A 3QG1A 4HAVA 1IBRA 2J59A 3FDIA 1K8RA 1DARA 2XNDA 4MUAA 2G0NA 1AKEA 4MUBA 1ZUIA 1HT1E 1O3YA 3KQKA 5EZ5A 1E9SA 5DI9A 3SYLA 1KO7A 2HCBA 3MJHA 4A8JC 1XZPA 2F55A 2Z5FA 2IYLD 2KI5A 3DL0A 1F60A 2JA1A 1L8QA 2C96A 4WXRA 1P7CA 3EC2A 1F48A 1XFAA 4NYJQ 1R2QA 1CXZA 4K8OA 1MH1A 4UJ3A 4AY2A 4YMWA 2EYQA 5EXPA 3CF2A 1Z06A 1G3QA 4JSTA 5EZ6B 4D0LB 1TQ2A 2UVQA 4BFZA 1S0UA 2VHQA 4LHYA 2Z0MA 2OO7A 4DRZA 1T9HA 3KKOA 2IYRA 1HT2E 2QPOA 2J7PA 4DT1A 4PO8A 4AKIA 1DS6A 121PA 3S1AA 4PPNA 5B57C 2QP9X 4YONB 1KK3A 1XMVA 3AF0A 2V6IA 2IX3A 1EX7A 4ZIRA 2P6NA 4US0R 4LSGA 2ZJZA 1L2TA 1P2UA 3F8TA 4JVLA 1OE0A 2GZHA 3TRFA 4B71A 2ZPTX 4LRWA 4NZYA 4Z51A 2ONKA 4WA7A 5L3SA 1JBKA 1X86B 2Q3FA 3GLHB 2C99A 1TUEA 3FHOA 1S96A 5FPKA 3K0CA 3Q7PA 5CDFA 2C03A 4LYFA 5TV2A 1DBSA 2EFGA 2BDTA 3T15A 4QGFA 3H86A 3RRNA 3L0OA 1ETUA 2I4IA 2OV2A 1KI3A 3B2EA 5JCZA 2QZ4A 1M7HA 3EC1A 4OQFA 3TIFA 2B21A 1E2EA 1OFUX 1ZJ6A 1WP9A 2AHOA 2YINC 4RCZA 1I4TD 2WWIA 3BFKA 3GJ7A 1XXHA 2OILA 1M8PA 1OPXA 2WWXA 3TNFA 1JECA 4BFSA 5FL7D 1UJ2A 2H5EA 2GNOA 5IK2A 4DC9A 5KPJA 1N6NA 2RGEA 2MMCA 5CM9C 4ZO4A 3UK6A 1AGPA 2ZSFA 1DPFA 5JMTA 3KTAA 1OXXK 1EFRA 4ON9A 2SHKA 2P0EA 2R65A 3PUVA 4GNKA 3UMFA 2YHSA 4JYCA 1CJKC 1H8HA 1GL7A 2B8TA 2WSSA 4PQRA 3ECCA 1UKEA 1OFTA 2Z4RA 4BLQA 3MGCA 3HPRA 1HTWA 2O8CA 2R8RA 3A58B 5JZVA 3GJXC 4NBSA 1Q3TA 4XD7D 5AR1A 4XSHA 3AM1A 3VU9A 5FFMA 4DSNA 2VIIA 2A5YB 4B75A 1E96A 1DAGA 2BBWA 4DJTA 2ZS9A 1BH2A 3T12A 2ZRCA 2JIZD 4PPGA 4CEJA 3SI7A 1Q12A 2R9VA 3VKWA 5KO2A 1ZBDA 1ZCAA 3GCGA 2QI9C 2W0SA 5HZKA 4S35A 3UANA 2VPPA 3P1JA 2AKAB 4OL0A 1E1QD 3MAAC 5JFGA 5FTMA 4M4SA 4FMDF 3RS5A 5AWFC 3ADKA 4C2UA 4C2TA 1XD9A 2W6IA 5B58C 3FB4A 2ZANA 4G5OA 1OKKD 2P5TB 3CF0A 4C9BA 4EFNA 2N1BA 3A36A 1AS2A 1NVWQ 4L9WA 1ZINA 2ERYA 4EFLA 1HE8B 1U8AA 3SQWA 3OIWA 1G3UA 1OLOA 3MWJA 4DDVA 3H4MA 2V6JA 5BWMA 1KIMA 1GL9B 2YOFA 3K9GA 4KI0A 4KLNA 4M1WA 5BN3A 2HLDA 2VYFA 1EGAA 3OE7A 1E99A 3C41J 3G82C 3NBYC 5DIFA 3R7WB 3PJRA 1FTNA 2GJSA 2ASEA 3CRMA 2Q9BA 4HB2A 1G20E 4Q1BA 3RDPA 1DAHA 4HLCA 1XJCA 4EDHA 3THXB 4TZ0A 3AVVA 2EYUA 3X1ZA 2WHXA 2ZE5A 3WNCA 5JSZA 3DZDA 2NPFA 2ZVQX 1G17A 221PA 1T0HB 3P27A 3OFNA 3TVDA 4LI0A 4LY6A 2H18A 3CO5A 3NKVA 3GFTA 2PMDA 2X8AA 2Q21A 3KKQA 3WYFA 2WIAA 4NYJR 4F4CA 1P2SA 3L8YA 4LHXA 3RC3A 1RW4A 1W47A 3TR0A 1IN4A 1ZUNB 1AN0A 4XOIA 2REXB 5CYPA 1XTKA 2P65A 3W6OA 1YZNA 4PFSA 1TEVA 4LWZA 5BQ5A 4RKEA 4A82A 3UWOA 1NY5A 4X8LA 3M0EA 4GFDA 4LC0A 1KO5A 4G01B 2W83A 1FP7A 1SHZA 2ZI4A 3EPHA 4OQLA 1FQJA 3LWNA 5JI3E 1TQ6A 2OG2A 4MA4A 4XJXA 1OXUA 4TLEA 3R20A 2QP3A 2CJWA 3B1WA 2RGCA 1G19A 3LX8A 2WJJA 1MO5A 4Q5IA 4TQAA 2FV8A 2WPDA 1P60A 1UBEA 2R2AA 2XXAA 3CKLA 4X8OA 1FMJA 1N0WA 4P3YA 4C0JA 4P33A 1ZD1A 1KDOA 1UKZA 4LPSA 2FFAA 2ZETA 3FWYA 4BFXA 5TXGA 5KPDA 3U7FB 4RVCA 3V4RA 3Q72A 1NLFA 2XZLA 1RYFA 3FPAA 1G64A 1OFIA 3PEUA 4YXWD 1XXHE 1OIVA 1EFRD 2JJ2D 1OIXA 1W48A 3LNCA 2X19A 4M2LA 3QSYA 4BPBA 521PA 4XTRA 1D2NA 3LY5A 1COWA 4NHOA 3BB4A 4MGKR 3I32A 5E7IA 1H8HD 1L4UA 2AD1A 4URVR 4OI1A 2I1VB 3KKPA 1NBMA 5EXSA 2D06A 4PC7A 4CVNA 2WM9B 5C46F 3PEWA 1SHKA 1N5IA 2GVDC 2JLXA 4EFMA 2XX3A 3THWA 4DCUA 1GSIA 1E6CA 4XVRA 1QRAA 2XAUA 3U6BA 1XTSA 3QE0A 4CGZA 4ZCMA 3QJYA 2IYVA 3ZH9B 4QL3A 2XJ4A 1XTRA 1Z0KA 2YWGA 3QPVA 2ZM5A 3ICEA 2RHDA 4RFVA 2F43A 1Z6GA 1UBCA 4PXAA 2BBOA 3FKQA 1LVGA 1NI3A 1UBFA 4JL6A 2DR3A 1IY1A 4US1R 3ZVLA 4LOAA 3WP1B 4ZCLA 4PZYA 1IHUA 4URYR 1XMSA 1VMAA 4GL2A 3D8BA 2V55B 1G8HA 2YOHA 3CPEA 2YWEA 3EZFA 2HEIA 2O5VA 2WWWA 2P67A 2QM8A 4A2PA 4MRPA 1C9KA 1OB5A 2P2LA 1Z2AA 4BECA 1OHHD 3MRSA 2EWVA 3NC1C 1XNJA 2OFWA 4JBXA 3EX7C 3IIKA 1R5OA 4MRRA 4QXAA 3A1UA 4AG6A 3RVBA 5K8IA 4LBYA 3OE7D 3NXSA 1SZPA 5JS7A 2Q3MA 2RGBA 3Q9LA 4HUQB 5HCIA 3I62A 3JVUA 1KJYA 2QORA 3TE6A 3BH7A 3BOSA 2GAOA 3HP1A 1FNMA 4PO9A 4OBEA 1GRNA 2ZI9A 2EVWX 2IUTA 2VA8A 3GJ3A 4G5QA 2PZEA 3R9WA 2VHTA 5E7MA 1SXJC 1E4YA 2WJGA 1FZQA 2C04A 2BM1A 3I8XA 1HEIA 1US8A 4IXMA 1Y3AA 4JLBA 1HURA 5D3MB 3AVUA 5EXXA 3RWOA 2UKDA 2HCJB 1CTQA 4D81A 3IO5A 3W34A 5AJXA 3GLHE 4B6EA 5B30A 3U2QA 1LS6A 3LVRE 4XIGS 5LB4A 2G6BA 2ZEJA 3TQCA 3VMFA 2C2HA 4CZ2A 1WBDA 3W6NA 4OHXA 3KDSE 2IXEA 2F9MA 3I1FA 1EESA 2VF7A 4JVNA 2ANBA 4QBGB 2IS6A 2ZITA 1XB2A 1TU3A 2ZREA 1N6PA 1G8PA 5FTLA 4MDFA 1Q20A 1YZUA 2ZRIA 4V02A 1KK1A 3BS4A 3B60A 1TMKA 1JEDA 1N5JA 1QG2A 4TTPA 4UNPA 1G18A 2IYQA 3THOA 3ZS8A 2YKGA 5JS8A 1HA3A 1Z6TA 2R6FA 2W2TA 4PAOA 4OHYA 3QKSA 4QG7A 1P75A 2JJ8A 1KI2A 1VYUA 2CEAA 2GCNA 3ASZA 4MKIA 3U7GA 1BYUA 2C9OA 3KUCA 1QHHB 4DUGA 1OSNA 4L15A 3AVTA 3QNUA 4Q7MB 4BZPA 4DCNA 4MRVA 3LA6A 3OAAD 3RC8A 2QPTA 1XEWX 1LFDB 2PMKA 4C0SA 2QMUA 2MSDB 5LBIA 1IJEA 2AWOA 4M1TA 2O52A 1FTSA 3C5CA 2CLDX 1CJUC 2REOA 5BN5A 2V9PA 3ZIAA 5GVRA 3KJHA 1E2IA 4C7OA 3PVSA 3U3OA 3TKLA 4QBIA 4KVGA 2DFNA 2GDJA 4H9GA 2F9LA 1NIPA 1NN5A 3ZVNA 1FW6A 1KY3A 1FQKA 1ZYUA 2VP6A 2VP2A 3HU3A 2D62A 1MABB 5KHOC 2IF0A 2WZQA 4KYUA 2HF8A 2NG1A 2YWFA 4CDGA 1IM2A 1KSJA 1ZP6A 1F2UB 2JEOA 3T1OA 4DLRA 5KDDA 1A2BA 1ZNYA 3F0TA 4Q7LA 4ABYA 4HAWA 1R5NA 2FMXA 2BWJA 3ZGXA 1E1RA 4OQNA 2NO9A 4V03A 4B32A 5C4MA 3K9NA 3CIOA 4A9AA
chains in the Genus database with same CATH superfamily
1UWCA 2AJCA 3ASVA 3KXIA 1EA5A 1Y1PA 4RWZA 2HFJA 5ALLA 2IL1A 3N9IA 4DN6A 2IYYA 1G4HA 4JC5A 3KLBA 1X6VA 1FP1D 4Z7JA 4D44A 5FWXB 5AJVB 2QLFA 4S1OA 4MWGA 4XYBA 4O0MA 1AQLA 3Q8WA 4JUFA 2BSXA 3F6EX 1OREA 3NT2A 4FZ5A 2JCXA 5ER9A 4CGYA 1GU7A 3ROEA 3D5EA 1EVYA 1UMCA 1TF5A 5AI5A 5LLTA 3BWBA 1GYRA 1RWMA 3KKNA 4NYMQ 4BJHB 1NSFA 1X1AA 1WF3A 3IAS6 4RK0A 4ZANA 4D4LA 3RC2A 2WVGA 1L8XA 1RXIA 2AG5A 4V38A 2OD7A 3C4JA 3HFRA 3KQTA 4G8DA 2CV0A 4BHTA 1OPRA 4H4DA 4GOND 5JY1A 1R37A 2I7VA 1S89A 1AGRA 1N2GA 4ZOLF 3I9NA 5ICEA 1KKMA 1TA4A 1SA0B 1UZUA 1U3UA 2IU6A 1ZSNA 3EIOA 4MYCA 4BFVA 3O4VA 1TK2A 3KKMA 5FTNA 4BQNA 1Y8RB 4F96A 1TA9A 5P21A 4DLYA 4L8WB 4NYJQ 4W5HA 1N9GA 1RHKA 1JEYA 2RHRA 3A4IA 4MQUA 3AFOA 4AKEA 1XTTA 5JSHA 3LP5A 5CEEA 2NVBA 1N3IA 1HLPA 1PR1A 5LYYA 3V8EA 1E6EA 4IIJA 1LDBA 3LTNC 1DBRA 1UEJA 1DX9A 3RU7A 4BFTA 5FNVB 2RHOA 4CQMD 1NXSA 1UXJA 2R8PA 3DVQX 4W7IA 3NZEA 4ZEWA 4U7DA 1V7QA 2O0MA 4XD2A 2GWRA 2HK7A 2Y1CA 4KWTA 3HWSA 4JB3A 3DEFA 2OOKA 4RMGA 1H2EA 3STVA 1V4VA 2J67A 2O8BB 2AV6A 1Q17A 1RJ9A 3U5TA 2FGKA 1Z56C 4XVCA 2AFVA 3HJRA 1Z6PA 4DE5A 1A88A 2E4AA 4GYKA 3OIYA 2P9HA 4OXIA 4JYZA 1EFUA 3R23A 5ICGA 1I6LA 2OZPA 4MGHA 5K0TA 5LXTA 3EQ9A 4B35A 1EGMB 4GI1A 2NZYA 4F06A 5JAIA 4ND4A 4O1MA 2H7CA 4UBIA 4MYUA 3OOWA 3W7AA 5EE3A 3D6AA 2JIDA 3SEQA 721PA 1P91A 3E27A 3RYFA 3EIFA 4ETIA 1GZHB 1YFLA 4JWKA 1K7EB 3HZZA 3DKVA 5A9RA 1T0JB 1SBIA 1V1JA 2E48A 2H4ZA 2IBMA 4XGRA 3I8OA 4ZVUA 1BE6A 4LC1A 1IPEA 4EW2A 4QYXA 3SYRA 3WE7A 4A0QA 3BCSA 2C00A 1D6SA 2GJAA 1LV8A 1UFQA 1ZOOA 2AR7A 3NVMB 4HDOB 2FDXA 3O1LA 3SQLA 4CIWA 5H81A 3PRJA 3WS7A 4NU8X 4NV3A 3KUKA 2Q1YA 4XFDA 1MP0A 2QU8A 3OJXA 4XQGA 1P6XA 5JEEA 2QXYA 4MNTA 5BSUA 4F5WA 5KX5A 1AA9A 1W73A 4BE4A 1O9HA 2HC9A 3A6GA 3FLEA 1BMDA 3M9WA 1UOEA 3EGVA 4QC2A 5D5PA 3N87A 3ZWYA 4MEJA 4X1IA 2CV1A 4E30A 5JZBA 3JATB 1SCQA 4FCVA 4GLBA 2OQRA 5E4TA 5CLFA 5JNRA 4RQBA 4GYJA 4K6OA 5A4AA 4QUKA 5JIBA 1NX9A 5FPHA 4ZV4A 5K7SA 1P9WA 1U3FA 2JGEA 1QYCA 3ONWA 5KB3A 4FZJA 1U04A 1ZBQA 1XEXA 2XQIA 5AKZA 4BASA 5F33A 3HHEA 1Q57A 1N75A 4C5AA 1VI2A 3JV7A 4GP6A 4P3KA 4ZALA 1GFZA 4RHFA 3T52A 4RZUA 3TDNA 5LD2C 3FHTA 1RXSA 1RMYA 2GO7A 2ATCA 5TLSA 3HR4A 3CVYA 4WD3A 3P0IA 3TJMA 5C8YA 1U1EA 4R1NA 5EXTA 5EZSA 3ZHUA 2JJQA 1UPCA 4M8NE 5GPBA 2C5HA 1XZJA 3IAUA 5B3LA 4WNIA 2KM1A 4J7XA 3MYRA 3BWCA 1NZJA 1EFVB 3H8VA 3R3WA 3FCEA 2W6MA 4C0LA 5C5DA 1IWOA 3GYGA 1KVUA 3IVGA 2YZKA 3CQ9A 3RODA 4HDSA 4KQ2A 1QPBA 2IEYA 1ONNA 4KJZA 1ZM2A 13PKA 2RONA 4JP5A 2H1VA 1I10A 5L3SB 5L53A 4CM8B 2N46A 2O2CA 4KGXA 3UMSA 1AKUA 2FP4B 4D0GA 1WMSA 1KOFA 1UBMS 5AVRA 4FJ2A 4MULA 2YC2C 4LE1A 4O5AA 3RUDA 3F47A 3ZCPA 1W5TA 3DFIA 5CX1A 4A91A 5IVPA 5JQGB 4ND3A 4KZPA 5D8DA 2QMEA 4WCDA 3E22B 2R6HA 2VSXA 4ETWA 4ZARA 3M34A 4JBLA 3F8WA 4ZQBA 2BH2A 1EP9A 3K1JA 4I5DA 3WTCA 3I9V1 5CT6A 1HLFA 1ZMXA 4I08A 1R88A 3LT2A 3NJ8A 1XXHB 3WY9A 3QFRA 3WIDA 3T1YB 4FEAA 2SKEA 1FU4A 2BRUA 3NV9A 2JGMA 2QW0X 3H1BA 3NTLA 4DJ5X 4LHVA 5F21A 1UWVA 3HUUA 3WHKA 4NYMR 2P6PA 3ICQB 4KN9S 1WHTA 4RENA 3KHUA 3HADA 3W3ZB 1YUBA 2A9JA 2Y0PA 4V2UA 5HIKA 3GF4A 4IIXA 1M2NA 4QUGA 3MBKA 1CDDA 3WLOA 5T5QA 4U6QA 2EKLA 2BGTA 2CL5A 5FP0A 3G0CA 3T7JA 4BZXA 4ESEA 4IOJA 4M8IA 3AKCA 1ZQ9A 5TPWB 2FB9A 1O87A 3GPCA 3QI2A 1PS0A 2ZRBA 1NQAO 2ZWMA 3AF4A 1P73A 2JBWA 2ZYRA 4IJUA 4UE2A 5CB8A 1PK7A 4PRZA 2H4FA 3ZV7A 3S2EA 4QJ4A 2LR0A 3NG1A 4O63O 2Y1LA 5HKKA 4QGGA 4Q4HA 3WZ2A 3DQQA 1GY8A 2WTUA 1O0CA 1WETA 1MRZA 1W7AA 2GK3A 4YASA 7REQA 3Q7QA 1C1HA 2I6QA 1T9DA 2I2BA 2ON6A 3FTNA 3ZVMA 4JFRA 2OECA 2P4HX 2CCGA 1KSFX 4INJA 4GX0A 4AMBA 3A05A 4ZYWA 3DZ8A 5FA8A 4BATA 4XYGA 4KJXA 2VDKB 4EUNA 1LC3A 3OOSA 2VZ8A 3R3HA 3CNLA 1V3TA 5IKPA 2FWMX 2XT0A 3FCOA 3L6BA 3OU6A 4NK4A 5LQCA 2JLUA 3ZDBA 2OBBA 4LMRA 2XV1A 2FN8A 3D02A 3BXXA 4UUBA 1WZCA 3E0QA 1DEHA 3RU3A 3BRWD 4CKBA 2OB1A 1YVEI 1JG1A 2OCPA 1I5OA 3NVAA 3Q7TA 2B98A 4N3CA 5DYYA 5ARCA 3G8BA 5J47A 1OWNA 5J58A 1T4GA 2PYZA 1QH8A 4ZD6A 1WCXA 2V7GA 3DDZX 2XIJA 2O1WA 2ERCA 3HVUA 1YBAA 3TR5A 3B9RA 3WLAA 5LZ4A 1O95A 1TOAA 4HDKB 4NDNE 4NTZA 4ZRMA 1AS3A 5BOVA 3MCTA 4PPYA 3TX2A 5IT0A 1P9LA 3E2PA 3JYPA 4WN9B 4C5BA 1ELOA 4FYXA 1KSHA 3H0CA 2GX6A 5SZHB 4LJRA 1WZNA 4H4CA 4I55B 3JQEA 1I4WA 5AW1A 2R4QA 5T4EA 4F2DA 3R7AA 4ND5A 4F8EA 5JSZB 3NHBA 1NPYA 4HSGA 2CUTA 2VZ9A 4RY8A 1ZA1A 5HPYB 2I3DA 4EKEA 1SVOA 2NO1A 3PFHA 3ZD7A 2EG9A 4EX6A 4D9HA 1YUMA 4U7GA 5HUJA 2XECA 3WZLA 1E1MA 4Y6GB 3IO3A 3DXYA 2HNBA 1E7YA 2BJWA 4HZUA 1DQSA 2GHTA 1KQ3A 2WB2A 1PZNA 2KW5A 2P68A 3NHSA 5JRDS 2R7MA 4RVGA 2WD7A 2ZRAA 1QLWA 4R41A 4F04A 3HA5A 4CV1A 5BOSA 1FIUA 2EFEB 1LDEA 1PTJA 3DVLA 4P32A 3BD8A 2PKEA 3DOFA 1A4IA 4A8TA 1WDKA 4FMBB 3EAQA 4Z0PA 4ZJZA 1Y42X 3DLBA 1NF8A 1ZY2A 1G38A 3QK7A 3UB4A 2WTAA 1PBTA 1PZFA 4AECA 1R0KA 5DM70 1JDBB 5TQVA 4ITUA 4GWLA 3KE8A 2GZ2A 2PWPA 4TQGA 3JWEA 4NABA 1FMCA 4PN3A 5JDIA 1GU1A 1O6GA 1VJTA 2C78A 4E2YA 4PQGA 1P0CA 4FFPA 5HK9A 4RMJA 1UQRA 4GOKA 2AI3A 5AVYA 1MVNA 2ZUDA 3DOIA 1MG0A 3H7AA 2Q2WA 4MAMA 3DMFA 5CH8A 5CH3A 3GUCA 3UOWA 1JIQA 1XR3A 1T13A 3O8LA 5EPOA 3FHJA 2I4OA 4BKPA 3KSRA 2W0MA 4ZXPA 1GGFA 1QR6A 3D1LA 4PC2A 1RLIA 1USVA 4YRPA 5T41A 1E3WA 2OCKA 3KQYA 4K28A 5CIYA 1B26A 2B4YA 4JH0A 3T1VA 1Z28A 3VAAA 4PRKA 2K2QB 4RD2A 1CUIA 3ZBTA 2NTYC 4O2AA 2G4CA 3IOMA 2QUJA 4N7MA 1YRHA 1ZEJA 2XCUA 1WQ1R 4Y2UA 5J40A 3CUTA 2ZCJA 3DFFA 2AYXA 1ZIPA 2Q1XA 3PR1A 3C5EA 2ONJA 5B55A 2HCRA 4XEHA 3RVLA 1XO1A 2OHIA 5F2NA 5K6TA 4C4TA 1DVRA 1VE6A 2LZ0A 1EPUA 2BFEA 2EFDB 3A1SA 3DKIA 4MV1A 4U8GA 3AHGA 4IWYA 5IU6A 1XN4A 3C0KA 3KO8A 2FNAA 2ZDHA 3MRXA 4PU0A 1VBKA 2H11A 3G7UA 4Y0NA 5BSEA 1J8YF 3ND6A 3V1TC 1OWPA 5FWNA 2WV9A 1VJCA 2GPBA 2QVCA 1A82A 2CFCA 5DTIA 5E38A 2XMZA 4RNCA 1EXWA 1ONBA 2X9QA 3N6XA 3TQSA 4C29A 2G1PA 4M1YA 4DLZA 2J5XA 1GQYA 3B1YA 3ZI7A 3B3AA 5AUNB 3U09A 1KGDA 1X2EA 2ZU0C 1RZVA 3CNEA 1DELA 2VPQA 2WABA 3HKDB 4LJLA 4V0SA 5CK5A 2F43B 1LI7A 5LLDA 4L8LA 1OH5A 4EPVA 4BNKA 1AHHA 2YCBA 4R68A 4UCWA 4B7XA 4ER0A 3QLJA 2QRGA 1LZLA 1R4ZA 1AKYA 2L18A 4YGXB 3FMFA 2D3WA 3AEKB 3O8RA 1XRNA 1A04A 4Y2VA 3DD5A 1E0JA 1I7PA 2DPMA 3E9CA 5LN1A 2BSQA 1M66A 2CLIB 3UJ3X 1M0WA 2Z6QA 4ZI7A 1EXVA 3GD7A 3GJTA 4HLUC 4YMSA 3L4JA 1XTQA 4PLGA 1M1YE 5JWOA 2F00A 4E21A 1AMOA 4TVKA 1ATZA 1FTQA 1W87A 3I34X 1QP8A 1R9NA 3A26A 1OI2A 1E4VA 4FYKA 1Q15A 5C1BA 1U7PA 2CZGA 5FOSA 4AN0A 3VX4A 1II0A 2FPWA 2J7PD 4IPTA 2OPHA 4D8XA 4D0NA 5JOQA 4CQNA 1SUIA 1DE0A 2YNMA 2JBHA 4A6DA 4WUTA 1FRZA 1CUWA 2E9SA 3BERA 4YAWA 5DSXA 1P5FA 4YAKA 3GLKA 1QKJA 1SURA 3A6DA 3OLCX 3E70C 4X92A 5LC1A 1ZIYA 2JI8A 4LWQA 3AEZA 4YBRA 3WLTA 1XL0A 2QL6A 2ZUBA 5CURA 1YRWA 1P5HA 4RGYA 3QKIA 2OWDA 2PVSA 2CNWA 3PQDA 1YBFA 4MGIR 4J0IA 5LNK6 4IR7A 3LXUX 2PMEA 3QE9Y 2XKJE 1Q0UA 2ACKA 1US8B 2FPIA 2GEKA 1Z2CA 4BB9A 5JBNA 2FUCA 4MKRA 1RVDA 3WMRA 2ZB4A 4DJFC 2GBLA 5J3JA 3AM1A 5JSUA 1NXPA 3O31A 3QIAA 4IJWA 1YULA 5KYXB 1L5SA 1MC1A 2ODEA 4N0DA 4Y1EA 3BRSA 4Y67A 2O05A 2C97A 1DG9A 1JJIA 5KMGA 3B1ZA 1DG1G 1TLFA 3CRRA 4Q4JA 2J9YB 4RE5A 1ML3A 4XTCS 2JHCA 2EWWA 1W36C 4GZLA 3ENKA 3ANNA 1J0EA 1Q1GA 3OG9A 1ORDA 4U5XA 4XM2A 3ZIDA 4BV3A 1Y8CA 1YB4A 2F8MA 4WOPA 4M88A 1NBWB 1ABFA 2ZS8A 2FEKA 2HV8A 3PTLA 5HM6A 3FTPA 1FFXB 3D6MA 2C4HA 3LCMA 4KVFA 4BP3A 4MSUA 2UUPA 1N2BA 1T36A 4G0WA 1TFUA 1ADYA 1TDJA 3RSOA 4AG3A 5BURA 3GLIA 1TK3A 1QO7A 2QK4A 2DQKA 1TCBA 4QPPA 5DBIA 3WR5A 4BX3A 1T5LA 2R4UA 3H2GA 4R2WA 1LBEA 4AD8A 4AUMA 2GOYA 1XVUA 1JHDA 4WFJA 4KC0A 1ZIXA 3L8CA 1W4LA 5FPPA 2FDCA 3FF1A 1SBZA 2VUIB 1U02A 3TS1A 1C7JA 3R7BA 4KQGA 3LT4A 1TVKB 1AZSC 5A6SB 4RXMA 5TF4A 3MS4A 4KR3A 1LBQA 4OJMX 3WLJA 1CR2A 3DEYX 1I3LA 1N1DA 4TTJA 4YCBA 3E2MA 4CYMA 1AV6A 5AHOA 1WOMA 1YMVA 2HMTA 1AKTA 4KXFB 4RSRA 5HCUA 5JMPA 1FC0A 3EIQA 4TMYA 4D9BA 3HGTA 5IKMA 1JHQA 3E48A 4B4VA 1K9SA 3WNVA 1V41E 5LQNA 5DM60 3IL2A 3PG5A 1NN0A 2CCKA 3FNRA 1ORIA 4KX5A 3TZLA 1LQTA 3ZCVA 2ATVA 2G67A 2RG1A 4D9EA 5FKJA 5LMUB 1DADA 2ZGVA 4L4UA 5IT5A 1K6MA 1GKLA 4Z8XA 3JQ8A 1EWQA 5JRZA 4ZI5A 3AP3A 1PKEA 2OHFA 2VHWA 3QU5A 1G5IA 1OZ0A 4IKEA 4DABA 4BLOA 2B6HA 2EEPA 1TT5B 1N25A 4I4LA 4X8HA 4OLFA 2C7RA 4DDTA 3ETEA 2JGFA 2OFOA 1JR2A 1TKCA 2B69A 3DKPA 4XUGB 3LD9A 2HXSA 2FA9A 3LUBA 4MKZA 4WOJA 3TRDA 2Q0XA 3K09C 3RYHB 2P27A 3WBKA 4BFYA 5K01A 4L50A 2J3IA 4RM2A 3W5AA 1WIWA 4FINA 2R25B 3MOGA 1Z12A 1FPMA 1N1MA 3PNOA 5CLQA 1TZKA 2ODPA 2VJCA 2ZYIA 4PV7A 4PNHA 4IL5A 4X7MA 2F1OA 1U7HA 4Y6RA 4B1FA 4DF3A 1EHCA 1SUCA 2D13A 1WB5A 2WG1A 3LM8A 4INPA 2FUKA 1OLXB 3NW9A 1OX4A 1AOXA 2A88A 2JFUA 5DASA 4PHFA 3QMVA 2J0UB 1YZKA 5C35A 1Q6YA 1YQXA 5KC8A 1AXRA 4ZRNA 2ZIXB 1ORHA 3L1JA 1IVNA 3G3EA 3L1IA 2HYIC 2ZIGA 3CPHA 3GRVA 4M46A 2JD0A 1B1AA 1Z47A 2P9QA 4BVEA 2NU9B 2AZDA 3SQMA 1G6Q1 1QF6A 1F17A 1Z29A 4G25A 3QEOA 4DNQA 5K0CA 1OH6A 1KDPA 3K9HA 2GHIA 5DBFA 1B0ZA 3F6CA 3MJVA 5DOZA 2M6KA 4ARZB 2NZWA 1W88B 4YJFB 5IP5A 3RSCA 3B3FA 4Z7QB 5LOVF 1TCUA 3V34A 1QE0A 3DT9A 4H0CA 3VU3A 5T64A 2J31A 5J2UF 3N53A 1KEVA 2G9QA 3N8NA 1R4AA 3WGMA 3QUAA 4F2GA 2FF7A 1CY1A 3JWGA 5ESDA 4YRNA 2JCGA 1C4OA 1SUDA 3PK0A 4YMUA 2BZ0A 4GU5A 2IYWA 4N18A 3R5HA 2ZTUA 3PLNA 3KFXA 2GM4A 4RFSB 1SXJA 4E7PA 3DMGA 3UXYA 1WTAA 2CWDA 3A8TA 4LHWA 1U28A 1ODLA 2AFRA 1EEXB 3AFMA 2ES4A 2BHNA 3MTEA 4IV5A 3REOA 1NDUA 1MC5A 4HS4A 4BKRA 1AQNA 1TQHA 4I1YA 1F8YA 1OLSA 3PNPA 3TE7A 1QHIA 1QIDA 2DLDA 2AE2A 2QY9A 3OCUA 2A9PA 2QKYA 5HRUA 1WG8A 1R8YA 5KTTA 3IP9A 4FS8A 1TF2A 4AMZA 1ZGGA 4DDHA 2VUHB 5LQUA 3TGLA 1MNAA 1DIHA 4M8KA 1WZUA 4KR9A 1DFGA 2F3UA 4PE5B 4Q1AA 1YE8A 2B61A 3PHHA 2IEIA 1G55A 4WFIA 3H4IA 1M0TA 4TZ6A 1IULA 4Q93A 5FO0A 1C3EA 1LPBB 4F9TA 3C1TA 3FPEA 4MYTA 4NP6A 2GMWA 4UULA 4GS5A 2QQGA 1PZGA 3M6IA 3ZHCA 3FR7A 2OCAA 2YWBA 4BB5A 1U2EA 1R0RE 2RBEA 3SOZA 2TECE 1LSUA 1H5NA 3PDIB 4MW0A 2YBEA 4R01A 4BPRA 4CPDA 1D4ZA 4AN1A 3L2OB 3VTZA 1KQPA 4ER7A 1AB6A 1LPOA 2F8LA 5H3CA 3ETGA 3MJTA 1U2SA 2OVBA 2H3EA 1JJFA 4DXDA 2ZR0A 3QEJA 4C4YA 2DLCX 1HDRA 1JHRA 1K3UB 1Z5NA 2P2YA 4KOAA 1ONSA 3EVFA 3SEFA 3TTVA 3GRFA 4KQWA 3CPJB 3PX2A 1NT2A 2GM9A 3PNMA 2VKTA 3CZRA 3TB6A 3NTVA 3VR3D 2OSBA 2PQ2A 3ELYA 4B33A 1I1NA 1JPNA 5CT5A 3CBQA 1TB4A 4NCHA 1D4FA 1LGYA 3P9RA 5H70A 2GVNA 3EJ6A 4JL5A 1QCCA 4DCCA 3BKXA 4RD0A 1Z4MA 4AMVA 1W6UA 3HVJA 4MTLA 3ZBUA 2Y3IA 1K8QA 3UOAB 3WDLA 1HNWB 1YZTA 3CNHA 1D2HA 1VGVA 2ZAOA 3IAS1 1SKAA 3EXHA 3PQCA 2MT9A 4D9FA 1CNEA 2A9OA 5JH7A 1YQTA 2HA0A 5KU7A 1QORA 3A6KA 2F8SA 3KQUA 4GC9A 2QRVB 3OJWA 3QBJA 4FTWA 4TSKA 3X1WA 5L40A 1Q19A 1GPDG 4NZ9A 8ABPA 1OBVA 3TRJA 4GUDA 1K0FA 2H7XA 3C3CA 4D3ZA 1J23A 3L7LA 2FWNA 3QYJA 5B4VA 3UBMA 1YU9A 1TX4B 1VYTA 3NGLA 1O1YA 4Q37A 1GKIA 3AR8A 2GPYA 1E2LA 2QM3A 3V7FA 1SG6A 2OAEA 1TZCA 3MGAA 4FGUA 4NKRA 4EJSA 1W581 3EXIA 4YCNA 1ZM4A 3KOWA 3VHQA 1F7VA 1JB1A 4EPRA 1EZZA 4MVJH 1JT2A 3RV4A 3P0JA 2NPOA 5FI5A 1JSZA 1N92A 2FEWB 2J5QA 4Q6BA 4UZEA 5MFPA 2V74B 3LRTA 1II8B 4OH1A 4UNQA 5SZKB 5J9FA 4BO1A 4EG5A 1FFWA 2GCEA 1D2RA 3DOUA 5LD2B 2IY8A 2OHJA 2WAOA 4K03A 3ZLBA 3GNSA 2PU7A 3IVXA 4C87A 5KWJA 3EGCA 4V39A 1RLOA 2XB6A 4UM9D 3EH2A 4F2PA 1I6MA 1HE5A 2RHGB 3ZZTA 1TAGA 2AS0A 4NATA 5DYIA 4JI7B 1MZPA 1U3CA 2WJHA 1N9KA 4RH3A 1C3XA 2WJVA 2VR1A 3PCRB 4LJSA 4DSTA 5BSVA 1I3KA 4HNAA 6Q21A 2B83A 1E7WA 1QOPB 1NVBA 5DM4A 2E82A 2G83A 1PUIA 1YC5A 5FH9A 3PC8C 1JLMA 4DLWA 1E2HA 1Q50A 1ZMBA 1J8MF 3GUZA 5JSYA 4N12A 2IODA 3AJRA 4YAJA 4YI3A 4LZZA 3AOGA 4K9MA 2IPMA 4HT3B 3O47A 3UH0A 3IHWA 4IINA 1LV7A 1ZVVA 1JI3A 2JIRA 3RRMA 1J8DA 2FPGA 2Q5FA 2YYZA 2HHHB 2FOXA 4B3XA 4Q01A 1U8XX 2CHVA 5SZIA 2EDCA 1QO0A 2ZE8A 1J90A 1YUNA 3KQWA 1RWKA 5AFSA 5T8KA 2WSIA 4K05A 3VOAA 2DFDA 4FP9A 2ZOSA 3HKBA 5CFQA 1NJ8A 1RFLA 2H07A 4HDNB 1ISIA 4HLQB 3VJMA 1ZRNA 4WBNA 3FIUA 1X7XA 3C45A 1KDYA 3FNGA 2VQSA 2H7YA 1EDDA 3MJ4A 3C7DB 3SC2B 1EYZA 4NOKA 4YJDA 3GEDA 1JKIA 1UDBA 2ZVPX 4TZTA 4YV0A 5CFOA 1AKNA 1PP4A 1T4CB 2YOGA 1X1QA 1VA4A 3HKCB 3KPJA 4H1HA 3FE2A 1XALA 5BNFA 1Y1QA 2FG7C 5GVSA 3G2QA 2O3JA 1XELA 3C6QA 4TTAA 4EELA 1BA3A 3MW8A 2WB4A 1H93A 3KTOA 1MRSA 1W4AA 4IXDA 1F1JA 1GTZA 3TIGA 5F51A 1ZESA 3OQMA 2Y1DA 5EWMB 4BV8A 4CDMA 3KXKA 3CSSA 2ERXA 1HLGA 4YRJA 4DVJA 4CEHB 1SC6A 5EUCA 3ZE2B 4LF6B 1RBMA 1YRQA 1S3IA 4QT0A 3FVVA 1ZMRA 4I1VA 4MVJA 1XQ9A 3R40A 5ITZB 1NL3A 3GWGA 3C5WP 2O1EA 4H60A 2AUNA 1EVLA 2PG3A 3GJ4A 4MGYR 4OEHA 2FSFA 5IJ0B 1QK5A 5JC1A 1XF1A 5E7JA 4BVJA 4NBKA 1VCHA 2XIQA 3JYLA 3KLMX 5ALQA 3Q8LA 3ENQA 2IV2X 1O03A 3DBRA 1BMTA 1HLDA 2RGNA 2EHJA 2NNLD 1NFRA 2PX5A 3VVBA 3L4SO 4BEJA 4D3YA 5JO0A 1OD6A 1PZHA 2G3YA 2A57A 3KQLA 2RGWA 3KT6A 1CP3A 5J5VA 3QXJA 4TWIA 4Z7NB 4HFNA 4AI6A 4WFKA 2B9EA 3V8VA 1IBMB 3PRYA 4MI1A 4OHOA 4PSAA 2I7TA 4DCSA 3JASA 1KAOA 2FTKE 3A10A 2AL7A 3R5KA 3T9FA 3L40A 2EL9A 1HK7A 1O2DA 2PSSA 2Y0EA 4PLPA 4F11A 2HHAA 4YLGA 1E2DA 2CHEA 4FMPA 4M0EA 3AYZB 5EVCA 3W06A 2Y0CA 1FS4A 3F2IA 1MC4A 4LS3A 1ORTA 4TYPA 1Z16A 2PA0A 4LFCB 1USUA 4TMZA 1LLCA 3TSCA 1JZSA 2BSAA 2BHLA 3W5HA 3HFJA 1GUYA 3AG6A 3L6UA 3REQB 4QTXA 4B3IA 4CWAA 4TRJA 2G80A 3AKEA 1RWQA 2ODNA 4IUBS 4E70A 4K9SA 5FCDA 1QNFA 4Z4HA 1N2HA 4HFJA 5F52A 5G4LA 4TV8A 4UOEA 2DPXA 3GVHA 3CY6A 4JGBA 4MLZA 3THYA 1Y6GA 3RSQA 3QPUA 1CV2A 4UFNA 1PO7A 1Y37A 3PUZA 3PNKA 3UV7A 5JCPA 2J9RA 4YYZA 2HIHA 2PYDA 1E8NA 3B78A 3W5IA 4R51A 4G0YA 3O92A 3MMPA 4MV4A 2FOLA 4YR9A 2NO7A 3ZZUA 6GPBA 2GZ3A 1GTJ1 1JX6A 1CIVA 3MBIA 2NQTA 3U80A 4LFBB 3GIWA 4CI9A 2QZ9A 4WZZA 3WGZA 1WCYA 1NXVA 1NC1A 1QV9A 3V80A 4FYHA 4PFKA 1ZNXA 3RJTA 1KYTA 1CJSA 2WVAA 4BRZA 2XW6A 3H75A 4Z99A 2C59A 4HGQA 4LZWA 1W0CA 2ABWA 3NTQA 1NNEA 1N5MA 3NHRA 4AMGA 4RTPA 4HNTA 2NADA 5IVKA 1XDDA 1QF9A 3U44B 1D5CA 2C95A 3U3KA 3TCKA 1GG8A 2V7UA 2VJOA 1VA5A 2Q3DA 3BFXA 1KNXA 1X39A 1KP2A 3E53A 1POWA 1I5EA 5A9TA 2Q5QA 2R62A 1NU6A 3EOBI 4YCCA 4R16A 3L0IB 3QPAA 2PLAA 4X24A 3GB9A 3L43A 4TXHA 4P35A 3VPGA 5HM8A 1B15A 1KI9A 1QBKC 4H7FA 2JIZA 4YREA 1FZTA 1SXHA 3PUHA 3U7EB 2HU5A 2R6DA 2WIKA 3FOCA 4DKXA 1ZRSA 2C5LA 3ESYA 3NT4A 2I2CA 1WY5A 1XQXA 3TI7A 3KTDA 4EKDA 1JFTA 3H6KA 3TLJA 2H06A 1CRWG 4MA0A 4EEZA 2JPDA 1DV1A 3AF1A 1JG4A 1LUAA 2YUIA 3EAFA 1YRBA 3CEPB 1T8SA 2FW9A 4H08A 2DCMA 1AE1A 1L6IA 1Z8DA 1GFIA 3HR8A 5IVDA 4EAQA 2C7PA 3RKRA 2M1XA 4R05A 3WRYA 2O8DA 1YJ5A 1C80A 1IZ8A 2JLQA 3EXG2 4RPKA 3KAJA 2REBA 5CD9A 1QWOA 1PDOA 3K3PA 4FWTA 1HE3A 1VOTA 2CXQA 4UUMA 4Y6SA 2R5FA 4F85A 1A2KC 3NEJA 5J1TB 3I1YA 4G5GA 5I6DA 3T7DA 2YQ5A 2KBEA 3QF7A 5C7YA 1WOYA 5A0FA 4EUFA 1SIWA 1TVEA 1MZVA 1CUVA 1JQJC 2EJUA 2G72A 3CLRD 3I53A 3NALA 5LYJA 1YVRA 1E9VA 1URPA 3QNMA 2FX5A 2YFHA 4DG8A 4ODIA 3FFBA 4C21A 4M1EA 1JE0A 3DEJA 4BO2A 4DXHA 1CETA 5B64A 5KINB 2E5FA 1AUOA 3PC3A 5ELXA 1CRPA 1QCYA 1YAHA 1Z15A 2L17A 1PR6A 4KXVA 2PX6A 3VOSA 5K8UA 1ZVMA 2VRCA 4MWDA 5JXHA 1J20A 4CR8A 3RIMA 2M6RA 5ALGA 3I09A 3QPCA 3DBLA 1OFHA 3N2EA 3OMLA 4YUWA 2WBLC 3S8EA 4BQFA 1PCXA 4EYEA 4R9NA 2W43A 5F12A 3LPCA 4PR3A 4AY4A 2RIPA 1C41A 3Q3HA 1ZKDA 4J3JA 3K0CC 1EVQA 2Q2NA 1X19A 2IOYA 5DX0A 5IKXA 2BMFA 3HGMA 1VCMA 5KDLA 2ZI7A 4B6RA 3QX3A 5KWIA 1DTEA 4TT8A 2QL7A 2HTFA 3C8UA 5E0KB 4DSAA 1LW6E 1T3TA 1ZJYA 3TG8A 4IIJF 1F4PA 3V2HA 2DFPA 3G13A 2RI0A 4PWZA 4XRRA 1IUPA 4UVIA 3H2YA 3LBAA 5KNBD 4RLQA 2F3PA 4IZHA 3T1QA 5I47A 1H5QA 4Q7JB 5EE5B 2ZI3A 4UVEA 4BE9A 4BLWA 3H3JA 1WLYA 4AY3A 3VYVA 3O5AA 2XUJA 4GSKA 5IF9A 5LP6A 2D3TA 2Q4DA 3KFLA 1W9HA 2AJDA 2P1RA 2OAP1 3VC3A 5A5VA 2E5WA 2HSZA 3H2KA 2ZIWB 1FVFA 1F4LA 3LC0A 4IDGA 4J1TA 1U9CA 4MKGA 3W3AH 1V48A 2NV2B 2W98A 4JT4A 4IS3A 4FZ3A 4PCLA 4QREA 5KNCH 4GBMA 1UANA 5ADUS 4Q4AA 1PAUA 2FXIA 3GRYA 4QNMA 3UJHA 1S2OA 1Z7YA 2AZXA 1XEFA 4FE4A 4B17A 2C9BA 1V9LA 4AP9A 4BGVA 2QAGC 3ZHOA 1T1EA 4NH0A 4TYMA 5GOTA 5U4XA 4YXWA 2OZLB 5KYVA 5NLLA 4ZCIA 5B3AA 2VA9A 3NH6A 1P39A 3R0XA 3VU0A 5CA1A 4LXIA 3DZGA 1G8YA 3KPUA 2EF1A 3S4YA 5K6RA 4YJ2A 1DIGA 1W36B 1ZIDA 1TLLA 4KFTA 3STXA 3O8NA 3OE1A 4FLFA 4GZMA 2UZ4A 2UYCA 4HWSA 5SY6A 2QVYX 4UNNA 4C4AA 2FZ5A 1LJLA 2WFMA 3BEDA 4CLRB 4ZHQA 1XPUA 1QE3A 3DMDA 4LRSB 3U40A 4W5JA 3WYGA 4KNWA 5KX5F 3U9TA 3PL5A 4H7PA 4X95A 1UFRA 3CMCO 2H9YA 3AFIA 2FLVA 1MIOB 1ZN7A 2BEJA 1W1IA 4F6LA 5M7EA 2D7JA 3KHSA 2G5GX 4L07A 3DBHB 1MAHA 4RC9A 1N6OA 4LF9B 4QYWA 4RHEA 1FFHA 2G63A 5KYWB 2FMUA 4WAUA 3UMGA 3QA9A 2ZBGA 5AOBA 4WK4B 4EABA 1XFDA 5AHXA 3MBOA 5AM2A 4RO0A 4FFDA 1D2MA 1GRCA 3ZDQA 2EKQA 7MDHA 1Z62A 4HC4A 3ZD8A 4CFSA 1XT6A 1FMLA 1KZ4A 1VE7A 1Z07A 2CUZA 1BFUA 3A7DA 4HUJA 4RPGA 2OXIA 1G7SA 4DQXA 4YECA 3N0RA 1J99A 5BRNA 2QXUA 1LLUA 1BCRA 1PFWA 3BF7A 3ER9A 1AK9A 5BW8A 4Y2XA 1GNLA 1TM4E 3SJBA 1OTXA 2IP1A 3CKKA 4MMXB 5C8VA 1U6JA 3BBPA 1CZUA 1FSGA 1SD1A 1RADA 3SXPA 4R8RA 5H82A 1IZ0A 4L3OA 2A0WA 2JIPA 4LBWA 1L4KA 4ZO8A 4OB7A 1K2VN 4DV3B 3WZMA 1ACMA 1OHHA 3OX2A 5LNK1 3DDHA 1O95D 1ZONA 2GVZC 4MUHA 4MWEA 4B48A 1YT5A 2VJLA 4Y1FA 2CLHB 4ISCA 5FEMA 5F78A 2NT4A 3AEYA 2CZCA 1N2EA 4ZV7A 2XBMA 5E3JA 2AFIA 2GZRA 1J70A 2QXTA 4NBVA 4F3RA 4D3XA 2YVUA 3V6MA 2C3PA 4PQYA 3VC2A 1DXYA 3GEMA 3GRCA 5KNCA 3BFJA 3WIEA 3SSNA 5KKCA 3NANA 3EY9A 3TX6A 2V6MA 4C0KA 3N0WA 2BF4A 4MQ5A 4FDVA 2YVKA 2BKAA 4Z4IA 1TUBA 1E61A 5I7FA 2HO5A 4G0ZA 4OOFA 4XPIB 1OBOA 3KZXA 3IMFA 3C16C 4D4IA 2P4UA 2QWXA 3FZQA 4RORA 4QUAA 5CD1A 4A1OA 4E2ZA 3T3NA 4ZAYA 4CCSA 2HZBA 5G0UA 2I65A 4UEWA 1L5HB 1WW2A 2XOXA 3EY4A 4RSMA 4EW6A 2WICA 1TL7C 2V5AA 1JFRA 2XT6A 3DAPA 2C84A 3N75A 4G1CA 1PD0A 5EJ7A 3VA7A 4R1MA 2ZZMA 2BEVA 2BEKA 4MUIA 3VKUA 2C4WA 3AR4A 2G9VA 3EWSA 5BQXA 3TLAA 3BPSA 2GRJA 4I2VA 4QWMA 4LDRA 1ZOLA 1W2GA 3TCNA 2R1TA 2QNRA 5DHFA 2HF2A 4IDBA 2YMQA 3FOAA 3QTTA 4EHFA 2GZSA 5C81A 1U98A 2HJVA 1LWNA 4B3FX 4EKIA 3SICE 1TAQA 3O82A 2JAXA 1E7QA 3B8HA 3R0JA 1SFRA 3MG9A 3RUCA 4NCJA 1H6AA 5CB4F 2QDKA 1Q0PA 5KOYA 1IEVA 3VHXB 2V8BA 1UDAA 2C2YA 4E3WA 4QOHA 4XX1A 4EGAA 4JMLA 4G36A 3D0QA 1OU0A 5DZSA 5JXIA 1U0OC 4MV9A 1O08A 3ZBPA 3OPNA 2J1LA 3OAAA 1BCSA 3K16A 3WB0A 4DPLA 1XVAA 3CGWA 4IMJB 4C4PA 3FFAA 1FE8A 5HUQA 2NSLA 1X15A 2OO5C 5LZ5A 4HJRA 2XBUA 3N8IA 1A2OA 3I73A 3A4MA 3TBHA 1REQA 5EHQA 1ICIA 3IUYA 4Y9DA 4JYPA 4QOFA 1A8SA 3RREA 4HMQA 5DHQA 3EA5A 2GKSA 2VLBA 1DPGA 1T24A 3M33A 2D5AA 4UASA 1XK6A 1ZLXA 4XQ0A 5CYOA 1AM4D 2RGRA 1A9YA 1E0SA 2HRCA 5GWXA 2Q2QA 1N2JA