3IUYA

Crystal structure of ddx53 dead-box domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
213
Chain Sequence
MTCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX53
total genus 66
structure length 213
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iuyA00
4IVPA 3EA0A 4BFVA 4Q1AA 5K8IA 4HAVA 1KKMA 1M1YE 5H1YA 2W83A 4TZ0A 3LY5A 5GADl 1W36D 2WKQA 1I2MA 3HR8A 4ARZA 4RY2A 4OI0A 3A37A 3WBKA 4YQFA 5FOUA 2HCJB 4LBYA 1VG0B 1YE8A 1TQDA 3HWSA 4ASUA 2WJIA 1SULA 1E9RA 1ZU4A 2RGXA 4DSTA 2QE7D 1VIAA 3AKEA 4D0GA 1GSIA 1EWQA 3B85A 4B3XA 3GLFB 4Q1BA 4NCNA 5FUWA 2WTUA 5FL7A 4V0OA 1T3HA 5E3HA 2ATXA 2NO6A 4Q1EA 2CNWA 4R98A 621PA 5SZKB 3ADBA 2HYIC 3K0AB 4BASA 4MDFA 4EPYA 4GDFA 2KB0A 2G1KA 2EFCB 3LVQE 3IUYA 4UNQA 2RGNC 1W1WA 2NPIA 2FWRA 3DM5A 4FXPA 3REGA 1G21E 5FBWB 1YRAA 1AM4D 2CHQA 1KDRA 2G88A 4TLDA 1GNQA 5BN4A 2GCOA 4AIIA 1R0XA 1ODFA 5E7MA 4BRWA 1R0ZA 4NU0A 1FP7A 1F60A 3VMFA 4IEIA 3P20A 2QP3A 4LCBA 1EK0A 5EE9A 4B6EA 2NZJA 3GLFA 3KDSE 1EFRA 1MRSA 3OFNA 4UNRA 4PAQA 2WSMA 3BE4A 4QJ3A 2A9KA 3N70A 2HJVA 4M1MA 1KNQA 1VG9B 4LV5B 3WHKA 4TYNA 4V0MA 2MSDB 1G41A 4M1YA 5FI1B 2GJSA 4HDCA 5EXPA 3U7EB 2ODWA 1US8B 1S1CA 1T8UA 4LYFA 4KU4A 5JRZA 2HJGA 3MWLA 3C7KA 4PX9A 1FFHA 4UJ3A 4P32A 4LUCA 4CW7A 3SE0A 1S2MA 2WV9A 4B2LA 3OIUA 1T6NA 1S9DA 3M4YA 1ZM4A 4WXPA 1ZNZA 5FBLB 1JB1A 2ZJZA 4JLMA 1N6HA 3BD9A 2VP6A 4ESVA 3NH6A 2V54A 4MRVA 5JSZA 5KSYA 2ZRIA 1XTIA 3RWMB 1CP2A 1U9IC 3M1IA 4QBIA 3AVQA 4O3MA 2GWHA 2ZRBA 1N5JA 1O3YA 2Q0HA 3FMFA 1HY3A 2FEMA 3QEJA 3I61A 2X19A 3B82A 1X3SA 3NHAA 1FOEB 1YR7A 1GFIA 5DLQC 2W6JD 1CIPA 1QHHB 1VG1A 2RAPA 2BHRA 3CF6R 5TVKA 5TARA 3WMFA 1GUAA 4S2EA 4UKDA 1RYFA 1N6NA 1A2KC 2VQSA 4F38A 1ZJ6A 3PENA 3ZIAD 1Q1BA 2C96A 3GJ5A 3UKDA 1MV5A 4P4SB 4B3GA 1XX6A 2JLSA 4C2TA 3IILA 1XMIA 1JI0A 3AF4A 1XTRA 3IQXA 4TLEA 3I73A 4UQOA 4Q1FA 4PQFA 3OEHA 2QY9A 4YMVA 1YHNA 2HCBA 5HE8A 2PJZA 3BB3A 2OAQ1 4M1WA 4LJAA 4Q4AB 4DBLC 4XTRA 3GLIE 1G5TA 2WSSD 4IW3B 3U44A 1BKDR 2XOKD 3NC0C 4JVLA 3VR4A 2W0MA 3QXCA 2VHCA 2CCKA 3HU2A 3KKNA 2D2FA 3AF1A 2ONKA 4LJ6A 4PFSA 2X2FA 2GJ9A 4TYYA 4DB2A 3CBQA 1S1MA 4HZUB 2WWGA 1QZXA 2VSOA 1MKYA 2PH1A 4JLVA 4QL3A 5AR1A 4PZZA 2EW1A 2JGNA 3OZXA 3MJHA 1G5PA 3QPVA 2O52A 1E0JA 1QHGA 1W36C 3IIKA 3K0FB 3LVRE 4A6XA 4LOAA 2BMEA 2MSCB 3BBPA 3RHFA 2O8BB 2OT3B 3S1AA 4NYIR 1WDTA 4DKXA 2F43A 3QF4B 2VP4A 1KI3A 1BO6A 5FBQB 1PUIA 2A5FA 4IKEA 4QGAA 4V0NA 2EU8A 5KYKA 5GJCA 4XH9B 2ZSFA 4JLKA 4B2IA 2JDID 4DLXA 1A1VA 1MO3A 4OL0A 1D9XA 4TMTA 3KKMA 2Y8EA 4C0KA 3E2IA 2VEDA 3C15C 1TU4A 4P33A 2W2TA 1GITA 3TAHA 1HTWA 4Z8XA 1UF9A 3TR0A 2MMCA 4CEJA 2CK3A 4I99A 3ASYA 1IXSB 2H92A 4JVMA 4TYQA 3K9HA 4U7DA 4KYUA 1ZRHA 4GT1A 4JL6A 4CIDA 2P2LA 2YWGA 5EQTA 4D2IA 2QAGA 3SQXA 2J46A 4ACBA 3B1WA 5ANRB 5FPYA 4M9XA 2GA8A 1P60A 1VHLA 2C9OA 1HT2E 2GJKA 1KO1A 1UEJA 1VKJA 2Q6TA 1TQ6A 3B9QA 4IFEA 3CNNA 4MRPA 4OJQA 4EAQA 3MD0A 4Q9JA 2WWYA 3CNLA 1P61B 3WYFA 1PV4A 2QPAA 4FCVA 3BH7A 2NOAA 2QE7A 3CR8A 2YVUA 5KUTA 3KB1A 3T15A 2ZJYA 1M7HA 1Q1ZA 1N6RA 5EZ6B 3ZQJA 2AWOA 5B57C 2IL1A 2YWEA 2PCLA 3NEJA 1HURA 2BBTA 5IHPA 2CNWD 2AXPA 4OK5A 3EPJA 2IS1A 3EPLA 4M21A 1Z29A 4KFTA 2FOLA 1OFUX 2RGCA 2VPPA 5LPNA 4YMWA 1JAIA 2ZANA 2NO9A 4NL4H 2R6CA 2ANBA 5EP2A 2IT1A 3L0SA 5CK5A 3OAAD 4ZV4A 5DH9A 2H16A 4P31A 4BQSA 2WKPA 5AUPB 4P3YA 5BWMA 1OH7A 2KWIA 1KI1A 2YJTD 3EZ2A 1ZNYA 2PJRA 4NDZA 3FKQA 5CM9C 2ZROA 3RRZA 2NIPA 1KJWA 3FGNA 4X8MA 3QXJA 1QVAA 2DCUA 1FUUA 1IJFA 1DOAA 1NI3A 1S9HA 4DRZA 5KNBA 1GDDA 4FMCB 4XVUA 3AVTA 3PVSA 2IF0A 2IYLD 4HB4A 4LHVA 4HI0E 4MYCA 5CYPA 4OQNA 4PPNA 1SXJD 5TXGA 3TVTA 4BEBA 3U44B 4C7OB 2R6GA 1DARA 4ZCLA 5KDDA 4HB0A 4FN5A 5AUQA 2BDTA 4LJ4A 4UNNA 3T35A 4DZZA 2RGDA 5IDVA 2VSFA 4NYIQ 3VQTA 3C16C 2DYKA 1Z6GA 4BFUA 3B2EA 2ZRPA 3QVVA 4B74A 4Q5IA 1CR4A 2PBRA 1KMHA 2JASA 1G1MA 3NH9A 4KFUA 1UKEA 3T5GA 2JJ8A 5D3QA 4B75A 4IDNA 3DHWC 4HUQB 5TY0A 1D6JA 4I1OA 4R9UC 1E2KA 1LF0A 1V5WA 2RB4A 1XXHA 3ECCA 4P4SA 4E5UA 1WB9A 5AWFC 3GQBA 1Z0FA 4GZLA 2O8EB 3WNBA 3MGCA 2DFKB 1SXJC 4RKEA 3ZZ0A 2IXEA 1G5RA 2ZVPX 3LW7A 1KGDA 3OE7D 1IHUA 4JLBA 2OLJA 4RZXA 4K81B 4LJ7A 2FPMA 1JEDA 3ZIAA 1EFUA 4E07A 4ZIRB 3SZRA 2VP0A 3OEEA 4PXAA 3V00A 4ESHA 2IYUA 2J0UA 4W9MC 2C9YA 1Z0AA 1D9ZA 3EC2A 3PUXA 2IWHA 4B6FA 3EW9A 6Q21A 4JT4A 1EX7A 1QHNA 4A6PA 4EIWA 1P2SA 4Q9IA 2OBMA 1P62B 4PHFA 4BLTA 4WZ6A 5J4VA 2A5JA 1W4CA 1AJEA 1J99A 2G0TA 2CCGA 1AZSC 4PPFA 3FVQA 2PLRA 3OIYA 1WBDA 1YKSA 2YNMA 1Z0KA 3A1VA 4P4TA 2XZPA 4G5SA 3WP1B 2RCNA 2CHGA 3GFOA 1AGRA 4KFRA 1T3LA 1T5IA 4MGYR 1OYWA 1JJ7A 4A82A 1GL7A 2IYXA 2OM2A 4URVR 4KFSA 2H7VA 1ZU5A 1XF9A 1NVUQ 2AL7A 3VR6A 5CJPA 1XCPA 1Z0JA 1FQJA 3CKLA 2VA8A 2GXQA 2H5EA 2H1LA 3F8TA 4WVFA 3TW4A 3FB4A 3OEHD 2QSYA 3RS7A 4FMDF 3KQKA 5JJLA 1HE1C 3UPUA 2ZJAA 4PC1A 2QL6A 3K0SA 3KJIA 5J4LA 4I1SA 4TTRA 2CL0X 2DFNA 3OEED 2NG1A 5JRJA 1GL9B 3K9NA 5HKKD 3P4YA 1P9NA 2GNOA 2XXAA 3QPUA 5DHAA 3AVXA 2B8WA 1HEIA 1NVVQ 1LF5A 4ZIRA 4W5WA 3W8NA 2O8DA 1U0HC 1ZW6A 1FZQA 1T5LA 3GMTA 2IBMA 1CTQA 2NGRA 1WP9A 4TL8A 1JR6A 4NCJA 1GTVA 1QHXA 3D7MA 4KLNA 1TQ2A 3NDPA 4AYTA 1BS1A 2E9SA 1E79A 5H70A 1XRJA 5C2JB 3SS8A 2ERYA 4BEJA 1XTSA 3H2YA 2I1QA 5TDHA 3TIFA 3SU8A 4V0KA 3EZ9A 5B58C 2IS4A 3P32A 3GJXC 1ZC3A 3ZVMA 3FHCB 4LJ8A 3VKHA 1TNDA 3OIVA 3NWJA 5CIWA 1JR3D 2JLQA 3NG1A 3UMSA 1OV4A 2RKOA 1J7KA 1SVLA 2XITA 3DMDA 1W2GA 3X1YA 3FFBA 2UVQA 2ZI9A 3OESA 3SR0A 3PUYA 4DLUA 4NCIA 3KQNA 2IF2A 1CR1A 3PEYA 2AKYA 3AH8A 4G01B 4LRWA 1U99A 2RGEA 4TQAA 5DGXA 2OBLA 3GJ3A 3RAPR 5EZ5A 2W00A 2QENA 4EPTA 5AK0A 4BRUA 3PUWA 4M8NE 4MUBA 4TMZA 2BKUA 4JLNA 4QNRA 1FUKA 1Z07A 4NPHA 1R5BA 1J8YF 5KPJA 2J9RA 3AVYA 1OXUA 4DXAA 2IHYA 1JALA 4Q9LA 2GXUA 1UBGA 1XEXB 1KHTA 2J0SA 3QXSA 2OAP1 1EFRD 2VHJA 3ADDA 2BWJA 2YWFA 4Q7KA 1CLUA 2RHMA 1XJ0A 1SVIA 4PR0A 2JJ1D 2BVNA 4RD4A 4F4IA 3NHBA 4P0TA 3ICEA 3MMPA 4Q18A 1KK1A 4FI3C 4BFWA 1OFIA 4A8JB 1T9HA 1GNRA 1UADA 3CZQA 3SHWA 4AYXA 2GEDA 2OBNA 4IEEA 4A0RA 2IYWA 1J2JA 1Z63A 1MT0A 2GAAA 4YDHB 1N25A 4C0SA 1XD2A 1CKEA 2O0JA 2TMKA 3I8XA 5AJYA 5F2EA 5TB5A 1ZM9A 2OFXA 3L43A 3LXXA 2HEIA 4X8OA 1H65A 3TSWA 1YZKA 1R7RA 2FV8A 4PO8A 1KI9A 1NY5A 1ZBDA 1ZYUA 4FCWA 4RSGA 3A4LA 2D4HA 3MRSA 2A5DA 4H1VA 4AKIA 1QHHA 4EFLA 3GFPA 2JIZD 4CT5A 1SVOA 4F4CA 1A2BA 4JVSB 3WBJA 1XXHB 3WRXC 3MSXA 1N3BA 3HU1A 4KAXA 2B21A 4LHWA 4A9AA 1XPOA 3THYB 3AGQA 1MRNA 1DEKA 2G1JA 4MGZR 5B2ZA 1ZD9A 2R65A 4Q1CA 1FMLA 1R4AA 3IO5A 4FMCF 4C0HA 3UXMA 3G5UA 2ZETA 1F6BA 3EARA 4TWZA 4URXR 5FTNA 4QBHA 4XVRA 3W5IA 1E1QD 1NVWQ 1QHSA 4FW9A 4US0R 1TL7C 1G4AE 3HYRA 2Q9CA 2QPTA 2ZSDA 1R2QA 2OE2A 5A5GA 5KNCA 1KZ7B 2B92A 3B1VA 4JS0A 3THXA 4V02A 1X8LA 1G16A 1WQ1R 3PIRA 5J4YA 2XOKA 1EFCA 2EQBA 1PLKA 3ZJYA 3Q85A 1JBKA 4KLZA 1S0UA 1NLYA 4Q4AA 2GTPA 5LB2A 4IJMA 3KL4A 1N0VC 1D8TA 2IUSA 2JIZA 2WBLC 3WHLA 2O8BA 3PG5A 5L3SA 1OF1A 1XTKA 2J7PA 1VDZA 1R8QA 2VBCA 4R71A 4DT1B 5KDOA 1Q1EA 2YHSA 3BOSA 3HPQA 1W4AA 2GF0A 5DHFA 1GNPA 1IN7A 3B1YA 2ZEJA 3FYHA 3GEHA 3N2IA 5FTMA 2AX4A 4RZ2A 4AD8A 1AN0A 5CJ2A 3UG7A 4IDOA 1OH5A 1UFQA 1W46A 2IYRA 5IK2A 2BBSA 3CRQA 3R7WB 2ODNA 2IS6A 4RZUA 2I1VB 1VYVA 1DG1G 5DISB 4PSKA 3U3MA 2E1RA 1LVGA 4KO8A 3R8FA 1P2UA 2QM7A 4M9ZA 3QE0A 4QGHA 3WMEA 4Z8YA 3PJRA 4L16A 1F2UB 3T34A 4PC2A 1KDPA 2BOVA 1XMVA 4UXHA 3F3YA 2JLZA 2D74A 4MITA 1P7CA 4PZYA 3TR5A 5TV2A 4B71A 4MGIR 1YQTA 4TT3D 5JEEA 3LWNA 1G7RA 1OXSC 3Q72A 3I5YA 2ZI6A 4H9GA 2OCPA 4IVRA 2GCNA 4M9QA 4OI2A 2JLXA 8OHMA 2GCOB 3F5FA 2HLDA 4NHOA 3DKVA 1E1RD 1T0HB 1Q12A 3H1TA 1XCMA 5P21A 2NQ2C 2OV2A 5FR2A 521PA 4JLPA 1XEWX 2QGNA 3G82C 3B5JA 2J1LA 1DPFA 1M7BA 5L3QB 3P1JA 4LSGA 2OHFA 5BQ5A 3QJYA 1NG1A 4JYCA 4JLDA 5C18A 4LYHA 3DO6A 3LX8A 4QRHA 1U81A 2QMUA 1JPJA 3U6KA 4TMXA 1OW3B 1QHIA 3BGWA 4CGZA 2XZLA 3I92A 2BM0A 2V4ZA 3SDZA 3R7WA 3RANA 1KK0A 2QEQA 2P67A 1UM8A 2QP9X 2OCBA 2IS2A 2WAYA 4PPGA 1KO8A 4KJZA 4I81A 1YZLA 2GK7A 1T3SA 4G0NA 4IOMA 4CEIB 1KAGA 1W5SA 3AF2A 2R9VA 4KBGA 4OHWA 4DSUA 4DUGA 2ATVA 4M2LA 3KXLA 4Q00A 3MAAC 2H18A 2HV8A 4GL2A 2ZI5A 2DPXA 4HUQA 3PV0A 4D25A 3K8YA 1TQ4A 2FA9A 1E2FA 3B60A 1EXMA 4B47A 4AURA 4BECA 1FL9A 4NYMQ 2VP9A 3BAFA 3WYAA 1IM2A 4NP6A 1Q20A 2WOOA 4EJSC 4H1UA 1G7CA 3HU3A 1JNYA 1G64A 3RWOA 1OB2A 1IBRA 3T5DA 4QJ5A 2QA5A 5H68A 1CBUA 2EFHB 2V7QA 3EC1A 5F9FA 3RDPA 1XD2B 3TLXA 4PHTA 1ANKA 1E0SA 4DCTA 3A4NA 4MRRA 1IOZA 1QF9A 2D62A 4W5HA 3QKUA 2QAGB 5LD2B 4ZPXA 1XPRA 4GP7A 3X1WA 3GFTA 1XB2A 2NTYC 1U94A 3G0HA 4B2PA 3RRYA 1L4UA 1S3GA 1SXJE 1ZUHA 3KJHA 5EXSA 4WXRA 2WWFA 1E6CA 1LY1A 4X8LA 2ZR7A 1KI7A 4F4JA 1G19A 5E4FA 1B23P 1OJLA 3L8ZA 1CF4A 5B64A 1Y63A 3RC8A 1DELA 1DAEA 1II8A 2RGBA 2Z5FA 4LPSA 4WA7A 3RS5A 1P9RA 2YC2C 2AK3A 3C41J 2CJWB 2GDJA 4GZMA 2YOHA 1XP8A 3AKCA 4V03A 4A0HA 1GVNB 2G77B 5HCIA 5HZHA 3EXAA 1HT1E 1E3MA 2CMKA 1D2MA 4JL8A 4AK9A 1HA3A 2JCSA 3QG1A 3EWAA 2WJYA 3SJBA 3TUJC 3I5XA 1E2QA 4LY6A 4O0MA 4RZ3A 3QOFA 3D8BA 5HZKA 1Q21A 3O8BA 1ONBA 1AQYA 1YU9A 4NYMR 3THOA 3K70B 3CPEA 1G17A 1LV7A 1MO5A 4L5BA 1F5NA 4Q02A 1MH1A 4V0LA 4A8JC 2A78A 3L2OB 5G53C 3S1AB 1YR6A 2D06A 1CXZA 3LBIA 3BFKA 3W3AA 4QFMA 1SKYE 2EFEB 5JI3E 2IEYA 2ZRLA 4DEYA 4G5QA 4M4SA 3D3QA 4C0BA 2ZJ8A 1MO4A 1Z6XA 1E2LA 4I1VA 4LYAA 2J0UB 4BFXA 2C9CA 1XTQA 2PEYA 4NE2A 4EUNA 4DT1A 5DN6D 3GP8A 4PSVA 3U3OA 2QORA 2D2EA 2HDNB 2GILA 4NMMA 5SZIA 4DVGA 1NSTA 3R9IA 5C46F 1AKYA 2IYZA 4JMPA 4Q4HB 4BUJA 1KSJA 3RNLA 4HAWA 4QGGA 2ZAOA 3EPHA 5J4KA 3I32A 4OYHA 2C98A 4DB4A 2GJAA 2N42A 2QG6A 5DI9A 3FOZA 2CJWA 2WIAA 5LDDC 1U90A 3IHWA 3MUFA 3KXKA 1II0A 1X6VA 4MKFA 1TMKA 3RS2A 1T4GA 3EZFA 2J59A 2J7PD 1SVKA 2SHKA 3IO3A 4JLJA 2KE5A 3ADCA 4DCSA 1BMFA 4II7A 3AV0B 4FD2A 4HAUA 3WYGA 2R8RA 1ZAKA 4DSNA 2FU5C 1NBMD 4K46A 5K8UA 4JIMA 3V4RA 1UEIA 2X77A 1NVVR 4LJ9A 4HYYA 5DO9A 3SC3A 3CW2A 5M04A 1N6LA 3MWYW 2ZSBA 2QAGC 1Q0UA 3TBKA 2XGJA 4O2LA 4PC7A 2DWPA 1YVDA 3T1VA 3CF2A 1IN5A 1KSFX 3CX6A 1E1RA 1YJ5A 1SKQA 3R8CA 3FMOB 2ZJOA 4L4UA 1I4TD 4MYTA 3AGPA 5CK4A 4JBWA 2AD5A 2ZR9A 3DL0A 1H8EA 2PZGA 3K09C 4MQBA 3GPLA 5KOYA 3DZDA 4BLRA 1Q3HA 3BB4A 3K9LA 3LW8A 4EPRA 2ODEA 2VL7A 4LHYA 5K8LA 3EZ6A 1W0JA 3BERA 1N2CE 4BPBA 3EWSA 3KFVA 2VH5R 3HJNA 2F9LA 3O8CA 2O8CA 2FH5B 2P5SA 4GNKA 2QRNA 4O25A 1G20E 1P75A 3TH5A 5FPKA 1TEXA 1GM5A 2PX3A 3ZS8A 1OHHD 5EXXA 2L0XA 2IYVA 1K8RA 4NTZA 4ABYA 4LHXA 5JJIA 1NL3A 1O87A 5CITA 1OIXA 4BGDA 5EXTA 2ZU0C 4O2RA 1KO7A 1KNXA 4YMTA 1C9KA 2IXFA 4HATA 4DCVA 1IN4A 3ZQ6A 4LJYA 2QGZA 4HAZA 5HTKA 1XJQA 4LC1A 5D3MB 2DWQA 4JLOA 4BE7B 5L8VA 4PANA 2PT5A 3PEUA 4XVQA 4UNSA 2CL6X 3LO5A 4KODA 1NY6A 5DYIA 4DDUA 3DM9B 4BZPA 1RE0A 1S96A 3PQCA 2IX3A 2CVHA 2XX3A 1OH6A 2ZYWX 2CE7A 2W2VA 4OBEA 1G6HA 2WPDD 2QBYB 4LV8B 2YOFA 2JATA 2P3SA 3V9PA 4B73A 4KI0A 1DVRA 1KO5A 3CPJB 3ZZTA 4OQMA 4DLWA 4IOLA 4DUGD 4DLRA 3PEWA 2G0NA 2FGKA 1IY0A 3IIJA 4US1R 1QRAA 1AK2A 4BLSA 1Z08A 2W6ID 1ZVQA 2GJ8A 2RH5A 3FE2A 2YYZA 3VR2A 3ZLJA 1AA9A 1FTNA 1P72A 4ITRC 4CEIA 3O47A 3BH6A 4AKEA 1RC8A 3B7GA 1NMYA 2J87A 1E4VA 2FDCA 5JECA 3Q3JB 1E2PA 3WY9A 5TMPA 2O8FB 1Z22A 2GETA 3LLUA 3EASA 3AQ4A 4TL9A 2VF7A 4XJXA 4Q7LA 3H4MA 3EIQA 4A0FA 4A2PA 4BZQA 2AFHE 4WIAA 4FIDA 1G6OA 4J0QA 3BJIC 2V7QD 4YMSA 3ZGXA 1ZIOA 4PHGA 2RGNA 1E9SA 3UIEA 1QBKC 4CDGA 5DE3A 3GLIB 4IDHA 3LBNA 2R6AA 1M2OB 1TUEA 4D0LB 1OKKA 1ZUIA 2BM1A 2O0KA 4HB2A 4DWJA 3C5HA 4L15A 1DAKA 3Q9LA 1VCNA 3CNOA 2LCFA 1HV8A 4Q4JA 2Z4RA 4TN1A 1DTSA 4M1SA 4OI1A 4B3CA 2ZE8A 2O8DB 1I2DA 3K70C 3ZD7A 2ZU6A 4HDOB 4KXFB 3ND9A 5BW8A 2Q21A 4LBWA 3LX5A 2BCJQ 2JLUA 4TMVA 2W6IA 3KQUA 1BYIA 1RRFA 2FFBA 3C14C 4AKGA 4ZI3A 2J0VA 2FSIA 1DAFA 1KK2A 1XZQA 2F1IA 4M1TA 3RVBA 4KV9A 3DKPA 2ERXA 1NJFA 4OHYA 3BK7A 4OHXA 1ZP6A 5CM8B 3NDBB 1L4YA 4B34A 3SNHA 1W4BA 2F7SA 5KSZA 1RRGA 3QQ5A 1N5KA 1F2TA 3AP1A 2H17A 4M9SA 4B3FX 3RSLA 3C8UA 1N6PA 4A36A 2DY1A 1OXTA 1R5OA 3CB4A 1IY1A 1TEVA 2CK3D 3SEAA 5HKKA 5C1BA 2FJUA 3CONA 1OFHA 2OEPA 4Q7MB 3SBEA 4RCZA 1RPZA 1OKKD 5JWRA 1XPUA 3PFIA 4AC9A 3E5HA 1X8KA 1RFLA 2P5TB 2RMKA 1SVWA 4QHYA 1E0KA 4OHZA 3IDQA 4LHZA 4Z54A 5C4MA 1GAJA 1E2JA 1OLOA 1ZCAA 1KSGA 1NRJB 4Z51A 4U00A 4CEJB 1DBSA 1E4YA 5J5CA 4Q4LA 3K53A 4TZ6A 1F2TB 1RKBA 4LDJA 4GP6A 1NLFA 2OLKA 3PR1A 4PQRA 4RD0A 3U61B 5F98A 3NKVA 2Q3FA 3KJGA 2ZI3A 4KSBA 2FPKA 2UZIR 5FPSA 2OZEA 1XMSA 3GEEA 3GLHB 4A2QA 1RIFA 4ACAA 1ZINA 4F91B 1VIYA 1Z28A 2C95A 2IUUA 4ZCIA 1Z6YA 1EG7A 1YR9A 2CLSA 2GZHA 4FMDB 1UDXA 4D80A 2E87A 2X1VA 4QKQA 4IVQA 1E0AA 1AKEA 1EFHA 1FP6A 2X8AA 3MG9A 3VNUA 1QG2A 1JEEA 2W6JA 1CJKC 5FFMA 4KSCA 4IOKA 4JLAA 1Z0DA 2V3CC 1YZUA 2OXCA 1NBMA 1WF3A 4G5RA 1CEEA 1G7TA 4U02A 2GESA 3UK6A 3L0OA 4PO1A 3KTAB 2B7CA 1T91A 1QDEA 2JJ1A 4TMWA 4B32A 1XEXA 3QBTA 1UBFA 1OHHA 2A3RA 1L7VC 5BXQC 3I62A 1J90A 1Z2AA 4ZO4A 3FFAA 3OF5A 4DLYA 4ASUD 4E22A 2MMGA 2ZRFA 4URUR 3CM0A 3ZVNA 2GCPA 2OFWA 1P5ZB 2WJJA 2WVJA 2PZFA 1ZMXA 2XSZD 2ZYUX 2GAOA 5E7JA 2YV5A 2J45A 3BXZA 1NBME 2WSSA 2PMKA 2XTNA 4CEHA 4B43A 4JJKA 1XXHE 1NKSA 3DPUA 4BWYA 1KIMA 5EJEA 1Z6AA 5CB6A 1P6XA 2QP4A 2XB4A 4Q9HA 4IFBA 5DIFA 1VG8A 3GJ7A 1W0KA 1CR0A 1XJCA 4YONB 3OIWA 4B3DA 2VRWA 2BKEA 2GHIA 4MH0R 4A2WA 4ZDIA 4HZIA 4QM6A 1E98A 2AD1A 3U2QA 3VX4A 2IEZA 2WIBA 4MKHA 4P4UA 3VHXA 1DADA 2FSGA 4LPKA 4CRWB 2BJVA 2QMOA 2W2XA 4HLDA 2ANCA 1MR3F 3SFZA 5A0FA 4G5OA 5GVSA 5IT5A 3OFND 4GOXA 1JQLB 3HDTA 1WCV1 4OHVA 4Y0VA 3GLIA 2NZ8A 2P6UA 4OKSA 2V8OA 5FOXA 4B35A 4EQ6B 2QN6A 4NCHA 4US2R 3AEZA 2XZOA 2ZYTX 1KSHA 5JSZB 2QT1A 3X1ZA 3DOFA 5AJXA 2ZXUA 3K09A 1ZD8A 2XSZA 3VKWA 3BFVA 3NC1C 3SJCA 2ZTSA 2N1BA 2RGGA 3I3SR 3U5ZB 4BLOA 3SJAA 4GBMA 3ZVRA 3ZDQA 5B30A 3FTQA 2XTZA 4PC6A 2ZI4A 1CJTC 3BB1A 4TSFA 2OO7A 1R5NA 1SZPA 3LBHA 4OI4A 2QI9C 4FWIB 5CYOA 4CVNA 1JXMA 2HF9A 2QZ4A 5AUNB 2QMHA 5IF9A 5JHGB 3U7FB 4MRNA 1GRRA 4NONA 3Q5DA 3SBDA 3BIFA 2QSZA 2ZIAA 3TSZA 3DEFA 3AVVA 2IK8A 1H8HA 1E9FA 3NIBA 4LK2A 1P73A 2F43B 4JKYA 1B0UA 3A1WA 5JHHB 4G3XA 1F48A 1PLLA 1OIVA 1U8YA 2RHDA 3KUCA 1CRQA 2G6BA 3N5CA 3BFXA 5AJZA 2NO1A 2GZDA 4K8OA 1FMJA 3T1QA 3T61A 5DN6A 3TUZC 2ORVA 2FX3A 4LJ5A 2WJHA 3AUXA 4RD3A 3SYLA 1DO0A 2BIFA 1TTTA 1OH8A 5KSOA 2V6JA 4Z1MA 1L2TA 1G3IA 2V55B 4MDEA 1E2DA 3NTUA 4XOIA 5JCZA 1OXVA 3B8HA 2HF8A 3L0PA 1JECA 2IUTA 4ZDJA 3T12A 5HCNA 3CRRA 3F0TA 2FFQA 1OE0A 4BFSA 2WICA 2O5VA 3QKRA 2P6NA 2EYUA 5GJWC 1I4LD 3IEUA 4M0LA 5EE1A 1KI8A 4Q03A 1G3UA 1G8YA 4M1KA 3QIAA 1W36B 3BRWD 2P0EA 2XEXA 2QUZA 3O8DA 4F7WA 1C1YA 1Z5ZA 4EPWA 1T0JB 2CVFA 4G5GA 1GOTA 5LBIA 4D4LA 1XU4A 2AXNA 2IHBA 1UKZA 1JR3A 4HLUC 2XNDD 1CS4C 2A5YB 4QGFA 3VR1A 4CZ2A 3A4MA 4PAOA 1N5LA 2UKDA 4L8GA 5GVRA 3TVDA 4Q4HA 2GXSA 2FGJA 4IRUB 1P9WA 4LBVA 4PO9A 3U3JA 4B76A 2GXAA 2YWHA 2B8TA 1LFDB 3A36A 4XD7D 3TGPA 2BBOA 2C03A 5JS8A 5E95A 3FHOA 2VYFA 2ZQ5A 3GJ4A 2R62A 2FNAA 5DI3A 2AKAB 3FMPB 5EP1A 5CDFA 1XWIA 4A15A 4WW0A 3LXRA 3QKSB 2VSXA 2ZM5A 4TLAA 4JJZA 3SN6A 2DWOA 1XD9A 2V1XA 3P26A 2V9PA 1JAHA 4HSEA 1KK3A 2CDNA 2LKCA 3ETLA 2QM8A 3LNCA 1M8PA 3QKTA 3WXMA 1K5DA 4TYWA 1FX0A 5FOWA 1MABB 4D82A 1TF5A 3JZMA 1NG9A 3UWOA 1YZQA 2D7DA 1TUIA 4QOSA 3W6PA 4UJ5A 1WBBA 3REFA 2JLYA 4MYHA 3VTKA 3TSOA 4ZDWA 3SYKA 1XZPA 1A4RA 1VCIA 4YLGA 1Q22A 1OPXA 1M34E 3P27A 1FW6A 1NN1A 2I4IA 2ZAMA 1KJZA 1UBEA 2O8CB 1PZNA 1E94E 1XEWY 4DCNA 1Z06A 2WPDA 4TYPA 1FPMA 4DLSA 4D81A 2H57A 3CIOA 1E9CA 2A2ZA 2NPFA 3GLGB 4DLZA 1J8MF 4U5XA 3QPWA 3I1FA 4M53A 2XNSA 4QBFA 3EG5A 2IC5A 2ORWA 1RYHA 2IYYA 4CF7A 2ZJ2A 3AVUA 3QXXA 4WZAE 1T8TA 3OAAA 2YC4C 5J40A 2OCYC 2VP2A 5SZJA 2CXXA 3LA6A 1U8ZA 3CO5A 5D3MA 4HLUA 2Z83A 2C5LA 4N3NA 2FZ4A 2Q9AA 2OFOA 3H86A 2EVWX 4RVCA 3W9YA 1DAMA 4GOJA 2AWNA 5KNDA 2XXAB 2EFDB 3CWZA 3RSOA 2ZS9A 4RFSB 3SFVA 821PA 5KDLA 1LTQA 1XNJA 2PZEA 4PC3A 4AI6A 1XMJA 3CR7A 1G3QA 2P65A 3MLEA 4EFMA 1L8QA 3NEYA 3EZ7A 3RC3A 5SZHB 3THXB 3PUZA 3DOEA 1X1SA 1G8GA 1SGWA 4CEHB 1D5CA 2CE2X 2WZQA 3TE6A 1EX6A 1YRBA 5FPHA 4AYWA 4RCYA 1G3RA 2FSHA 1K5GA 1COWD 3CF0A 2WWHA 2KBEA 2JLRA 3L8YA 1A82A 3GLGA 2YZ2A 1ELOA 2QTFA 3K70D 2KSQA 4BLPA 1SVSA 3M0EA 3H0KA 4W5JA 3O8RA 1QVRA 1TPZA 4F93B 3C4JA 3W8RA 1RJ9B 3QF7A 4XWKA 1VHTA 1VPLA 3QSYA 1E96A 1RRPA 3GD7A 1CJVC 5H8WA 2CCJA 1J70A 5IRCD 1E99A 4LYJA 3LQRA 4HAYA 3V4FA 4PAMA 1CRPA 4IDPA 4FMBB 1I4DD 3MJRA 4RFSA 2OG2A 4AG6A 3AB3A 4YXWA 4Q1DA 3NBZC 5DSZA 3K0CA 2ZRNA 3AP2A 5AJVB 2CLDX 4RD2A 3B78A 1EGAA 1H8HD 3KFXA 2JJ2A 1OB5A 4G1UC 4JSTA 4E09A 1HE8B 1M7GA 2F1JA 1F2UA 4Q48A 2PT7A 3A1TA 4HAXA 2F1HA 5DNYB 2QT0A 1COWA 1RVDA 4WAUA 2PL3A 2G3YA 2Q3MA 4GRAA 1FQKA 1JPNA 2FN4A 5DI3B 5L3RA 2HYDA 1M6NA 2XB2A 3KKPA 3U4QA 2B7BA 4YC7A 1IJEA 2K5UA 3LAWA 1KTVA 2MSEB 4GMXA 4OQLA 2ODBA 2DFLA 2V6IA 1XBTA 3N2EA 4BZXA 5L3QA 2V1UA 1IXZA 4FINA 4C7OA 3GJ0A 2QAJA 2F3TA 1W0JD 1TF7A 4L9WA 4FCTA 3W5JA 4URZR 2W58A 5CLQA 4M22A 4DDVA 3CRW1 3QY0A 4AG5A 3LLMA 4EPXA 4QHTA 4URYR 3VAAA 2IXGA 2FFHA 2VHQA 4MA4A 1NMZA 5KPDA 3UMRA 3KQLA 1TADA 1AIPA 2REOA 3D6TB 1F3OA 2XNDA 4EKDA 4LV6A 1BYUA 1BIFA 2QU8A 3QVUA 1MOZA 4NKRA 3B1XA 5JMTA 1G8FA 1G3MA 1Z2CA 1GP2A 1TX4B 5EE3A 2ZR0A 2ZS7A 4C4PA 1WA5A 3PITA 4L9SA 4C0AC 4W7SA 1VTKA 2J3EA 2ONJA 4Q66C 3P4XA 3W90A 3A6PC 3VHLB 3TQCA 1SXJB 1W49A 4NBSA 2JLWA 1Q44A 1OSNA 4QBGB 5L3VA 5GJVC 1AS2A 2ZYVX 3KUDA 1U9IA 5A4JA 4ZKEA 1XD8A 3MWKA 1U8AA 1G8HA 3U4QB 1FNNA 4QG7A 5DYGA 1W7AA 4C0JA 3AVOA 4C2UA 2Q9BA 3U3RA 2WOJA 2CBZA 3FMIA 1PUJA 3FKSD 4A4DA 5JBQA 2FE4A 3QENA 2GVDC 3VR5A 4D6PA 1KAOA 3ADKA 1CULC 2FZLA 1KI4A 3KB2A 2C99A 5KSPA 3IHLA 1KZGB 1XDBA 4PQYA 2ZSAA 5BYJA 4OQXA 4RFVA 2FG5A 2DBYA 4NH0A 3RLFA 5IK2D 1IN6A 1UKYA 2ZRHA 3CPHA 1DAHA 4IXNA 1ETUA 1KKLA 1R8SA 2D3WA 4DIDA 2J0QA 3LFUA 4DC9A 2IWRA 1G4UR 4N1AA 1N0WA 3R9XA 121PA 3W3ZB 5FOTA 2QBYA 1LW7A 3CUEF 2ZPTX 4BLQA 2PMDA 5JCPA 1X86B 4EQ6A 3FPAA 3M6AA 4EPVA 2ZS8A 2ZRJA 3OHMA 4NZYA 4Q21A 3RS0A 3ZYCA 4M1OA 1M74A 1AGPA 3K0AA 1E2HA 2LWIA 5EE5B 1NN3A 1KJYA 1N5IA 2DB3A 1NNEA 2ZE6A 4HLCA 2XAUA 4PZLA 5AJWA 2VHUA 2GRJA 1OIWA 2A30A 4Q7JB 4ERNA 1CR2A 5FOSA 2PX0A 4HZUA 5BYKA 1BMFD 4LC0A 2BCGY 2ZUDA 1IAQA 2ZRCA 1CU1A 5L3SB 1AQUA 5ELXA 3K9GA 1II9A 1RRCA 4OJKA 4ZCMA 3B1ZA 1DAGA 2ZRGA 4DJTA 4TMKA 4Y0AA 4JBXA 4POAA 2UZ3A 3DMNA 1NJGA 3SYNA 3CRVA 4MKGA 1Z6TA 5JI2E 3IQWA 4LX0A 1TU3A 3VFDA 1NIJA 3ONWA 4QHSA 1GKUB 1X8JA 2GBLA 5CDFE 4HLQB 1KI6B 4KBFA 5JWOA 5JFGA 4ON9A 1KDTA 4B48A 3RRMA 1DE0A 2QNRA 3CWQA 1VCOA 4KHZA 3RS4A 5JEDA 2GKSA 4Q9KA 1G18A 1SKYB 5HR5A 2NO7A 3WNCA 3K0EA 2D7CA 3KXIA 3Q8XB 3NBFA 3WMGA 1IXRC 3BWDD 2OUKA 1YZTA 4A8JA 3L82B 5G3YA 2OILA 2VF8A 2JJ2D 1GWNA 1N6IA 1UDWA 2AR7A 2R2AA 3AVWA 4XWAA 1Y3AA 4WZBE 3W6OA 4UXIA 4D4KA 2EFGA 3LQQA 2R44A 2QQEA 4DSOA 3EIHA 1P2TA 2ZRAA 4JBYA 4MKIA 1S8FA 1G7SA 4NYJQ 2J41A 4TQUS 3FDIA 5EP4A 3UATA 4NYJR 3ZVLA 1IQPA 4OK3A 1AS0A 2QROA 1R10A 5E7IA 2ZE7A 4DHEA 4EJSB 3IIMA 3VU9B 2F9MA 2LKDA 3DVLA 3IPXA 4QC2A 2C77A 3SI7A 1E32A 1LS1A 1G9XA 3AKDA 4MGKR 2REXB 2WMNB 4GMDA 2W0SA 2Q3HA 5G3ZA 3T1OA 2F55A 1MABA 2AK2A 1KOFA 3KJEA 2IYSA 4YMUA 4TTQA 2BEJA 3FWYA 3R20A 4AY2A 2WWIA 4GI7A 2HT6A 3QI2A 3BH0A 4ZDKA 4JSYA 2J5XA 3GJ6A 4C0LA 4R2HA 1E2GA 4QNMA 5LD2C 2H8KA 2ZSEA 3AP3A 1MO6A 5FTKA 2HT1A 2GK6A 2HLDD 2ZVQX 2WWXA 3JVUA 2KI5A 1GKIA 2ASEA 3TJZA 3A8TA 1W48A 2ZUCA 1SXJA 4LZZA 4MUAA 3W34A 2R6DA 4LBZA 1UBCA 4B33A 4RD1A 1KY2A 2WHXA 1U0JA 1K6MA 1D2NA 2HXSA 3MWJA 1Z3IX 3I72A 3TUIC 1TAGA 2AHOA 1GG2A 3ZD6A 1ESNA 3EX7C 1FTSA 2AFIE 2KBFA 1XEFA 2X2EA 1US8A 4QM7A 2DR3A 3E70C 1GZSA 1FNMA 4LGMA 1NF3A 4KVGA 4E03A 3Q7QA 1N6KA 1NLZA 4KVAA 3AKYA 1CJUC 3PEVA 3K0CC 4R2IA 4UNPA 5F3WB 2WM9B 2VLIA 4TTPA 2YOGA 1YZGA 5FUVA 5J4HA 1N0UA 2FF7A 2IW3A 1DS6A 1NN0A 1FX0B 4CYMA 2JA1A 2CLCX 4JYBA 3VU9A 1G291 1SVMA 3CH4B 3IGFA 3AUYA 1KMHB 5JWHA 3KKOA 4Q4JB 1HH4A 5G41A 1KO4A 4D0NA 3EAQA 4KCGA 1D2EA 1ZCBA 3GLGE 3SJZA 2WMOB 3FKSA 3LRPA 3OE7A 1CJMA 1ZC4A 4XWOA 3QBVA 1Q57A 2JEOA 4XTCS 3SOPA 3EPKA 4QXAA 4GOKA 4C9BA 4JKIA 1P4SA 2BJWA 1UJ2A 4TL6A 3HYTA 3THWA 4N0EA 4TQ9A 4IDQA 1GILA 3U7GA 2GBLC 2VO1A 1JQJC 3UWKA 2ORIA 2DHRA 5JS7A 3TQFA 3CZPA 2NO0A 2XJ4A 3WNDA 4AWXA 1WXQA 5FH9A 3RYTC 1IONA 1PJRA 4TSFD 3B9PA 4XIGS 1NMXA 5FI0B 5HE9A 1P2VA 3QUSA 1GKYA 4MYUA 2O8EA 4DCUA 3HPRA 3AVPA 1N6OA 5CIQA 4PHHA 3TRFA 4C0QC 3A1UA 3U6BA 3ZH9B 1XFAA 1NSFA 4D4JA 4TLCA 3RS3A 1BOFA 4ILEA 4YDSA 1E9BA 2YKGA 1IN8A 2IA5A 2R6FA 4C3ZA 1U0LA 3JZAA 3VX3A 3QNUA 4A1FA 5K8TA 2B6HA 4I1UA 3LD9A 2J7KA 2WJGA 2Z43A 1W4RA 1VYUA 2VTKA 1GRQA 2F3RA 3DZ8A 5FOVA 4C30A 1UAAA 4JL5A 3TK1A 3FHTA 3UG6A 5KO2A 1VMAA 1WE2A 221PA 3VKGA 3QF4A 4F92B 3EA5A 3R9WA 1NIPA 4GFDA 4IHQA 4YXWD 3J81k 3GLFE 5EE0A 4JVNA 1BH2A 3THWB 3EIEA 4RD6A 3QG5A 3HP1A 2A7QA 3K0FA 1GRNA 2WWWA 3B6EA 2QTHA 3L0IB 3GJ8A 4EFNA 4LWZA 2EYQA 1Q1QA 1E79D 3ICQB 4OQFA 1OT3A 2N46A 4KYIB 4R7ZA 3IBYA 2BMFA 4RJLA 4TT3A 3MCAA 5FL3A 2EWWA 3ZZUA 1LB1B 1HUQA 2CEAA 1ZD1A 3TMKA 1ZM7A 3AF3A 1A5TA 3IPYA 3ASZA 4PTLA 1ZNXA 4EDHA 3RABA 2DFTA 1EWRA 1Z83A 1RZ3A 2C8VA 3AF0A 3B13B 3IEVA 3LDAA 3CX8A 5C4GB 3X1XA 5FPTA 5KHOC 1KMQA 5CB8A 5FTLA 4I4LA 2JAQA 3BORA 1ESMA 1E2EA 2BBWA 1Z47A 2BEKA 2Z6VA 3GLHE 2Z4SA 2ZRDA 1W44A 4N0DA 4Q01A 3NBYC 1EESA 4MRSA 2GF9A 3ND8A 1S4QA 1XTJA 3GCGA 721PA 3I4LA 5KTYA 1AS3A 1PVOA 2FSFA 5FUXA 4B44A 2FFAA 2QPOA 1JJVA 3T06B 3KTAA 5LB4A 4JZKA 1E9EA 2G9NA 1Z0IA 1KDOA 4PPQA 3WP0A 2F1RA 2AN9A 4LI0A 2XTMA 1DAIA 2C78A 1W0KD 2ZJ5A 1KY3A 4JT2A 1ZNWA 5CLLA 4IOJA 1PLJA 1SHKA 5FBVB 2ZUBA 2WAXA 4B3BA 4S35A 3SQWA 3QKSA 1U98A 3WRYC 2IYTA 4UXJA 3KX2A 4DEXA 2BMDA 3TW8B 4DLVA 3LH5A 4ZI2A 2WKRA 2HUPA 3Q7PA 1LS6A 2FEOA 4HUTA 1RW4A 2A5GA 2ZITA 5JJKA 4DDWA 3UANA 1TF2A 3NBXX 3D31A 2BC9A 4DDTA 1SHZA 2NMVA 4KITB 2GEUA 4EJSA 1P3JA 2CL7X 2YINC 3TKLA 1E9DA 1HYQA 3KKQA 1E2NA 2QQ0A 1Q3TA 1H8ED 1GL6A 1LNZA 1R0WA 1UPTA 1HQYE 1Z8FA 3PCRB 1U2RA 3HR7A 4BFTA 4PSAA 3DDCA 3SHFA 1JXOA 3CX7A 3GEIA 3JVVA 4RKFA 3NXSA 2VIIA 3BS4A 4GSYA 5G40A 4IXMA 3AM1A 1OFTA 1NVXQ 3IKJA 4GPTA 4V0ME 1XCGB 3X2SA 4WOPA 5FR1A 1VECA 1YR8A 4TLBA 2F6RA 2P6RA 1UKVY 4NCKA 4BFZA 3VNVA 5BN3A 1ZM3A 4DIEA 2OESA 5AUOB 1WMSA 1E1QA 3THYA 2FPLA 1VCMA 2ZRMA 3X1DA 2HXYA 2VP5A 3IBGA 4D26A 2GZAA 4Q19A 2C2HA 4BFYA 1HQCA 2OCAA 3MFYA 5GJBA 4TL7A 4WBSA 2QMEA 1EFTA 2G83A 5JZVA 1W47A 2ZRKA 4Q47A 5EUMA 4OK6A 1GIAA 1R0YA 2Z0MA 1II8B 5FBRB 5JLJA 3W6NA 1NN5A 1KI2A 1OYYA 1NP6A 3H84A 2BMJA 3TAUA 2OXRA 2JDIA 1NKTA 2GVZC 4XSHA 3QEOA 3ZS9A 2PEZA 3C5CA 3RRNA 4A0GA 4D4MA 2KJQA 1W2HA 1QG4A 1ZIPA 3BC1A 1ZUNB 3T1TA 2EWVA 2PLFA 1DG3A 4DLTA 1E9AA 1X1RA 2ZE5A 5EP3A 5J47A 1AZTA 2C04A 2ZI7A 3PXGA 1QHYA 2VHTA 1E69A 1W5TA 3QKRB 2GEVA 1G8PA 3A58B 1OXXK 3KZ1E 5BN5A 2XJ9A 3E1SA 3CLVA 1SQ5A 4XSGA 4CT4B 5EUQB 2ZREA 2I3BA 2OSBA 2QTVB 3Q5EA 4URWR 2BV3A 4HB3A 1RJ9A 1S3SA 1V43A 5FL7D 3LV8A 4AKHA 1C4OA 1E2IA 1ZM2A 4Z1MD 3KQHA 1IY2A 3QXHA 2QRZA 3U60B 1KI6A 4HDQB 3VR3A 1E2MA 5KU1A 2REBA 3CH5A 4QJ4A 4X8HA 5FTJA 1KYIA 4FWTA 3PUVA 2CHVA 5FUYA 3I8SA 1DO2A 5UKDA 5HPYB 1YZNA 3U7HB 2O8FA 2ZJBA 1JR3E 4XD7A 3U3KA 2IYQA 2FMXA 3A1SA 421PA 3CRMA 2JLVA 3TNFA 4ZKDA 2RGAA 3GLHA 3NVAA 3UMFA 2PCJA 4A92A 4ARZB 5F9HA 3K1JA 1WRBA 1VYTA 2WJVA 2ECKA 2O0HA 4HEJA 1A7JA 1R6BX
chains in the Genus database with same CATH superfamily
1E6LA 3P19A 1BD4A 2B3DA 3O5AA 1BXRA 3OUUA 4GP9A 4HAVA 4OGLA 4PTZA 4TZ0A 2Z2XA 3FWKA 4L3VA 1I2MA 1TA0A 2YXBA 1C7QA 1FNBA 4A8HA 3ETDA 3BIOA 3OOYA 2WUEA 5FOUA 4GKKB 1Y6FA 1TQDA 1SULA 4DSTA 5IJAA 2QE7D 3PQ7A 3N59A 4TRMA 1N0IA 3TD6A 1KPHA 4MV7A 1ZMOA 3VTZA 3VVMA 5HKBA 2EG5A 2RONA 3D2BA 5FUWA 2CXRA 3M9WA 5FL7A 2ISQA 2O4UX 2R1TA 1THGA 2VJNA 3SSOA 2DZDA 4F8JA 5IJ9B 2HYIC 1DV1A 1R3UA 2FX2A 2YWXA 4ID9A 4B0PA 4MJ3A 3BMCB 1WDKA 4MDFA 3W2GA 1F2VA 3NTQA 2CDBA 3LVQE 5BMVB 1NULA 1W1WA 1FFYA 3MBOA 2CKDA 4DADA 4YJDA 4WGFA 3EXHC 2QX8A 1AM4D 5DEOA 5JYEA 2CHQA 3CXRA 2RHJA 3E05A 3GV0A 4PAWA 4Y2GA 3TPFA 1N9ZA 1RJGA 1QCCA 3KLOA 4AIIA 1KEUA 2D8AA 2AEMA 1RI2A 3T9BA 4BRWA 3MHTA 1LJLA 4NU0A 5E4YA 1FP7A 1SRQA 1S8AA 2UV8A 4FEYA 4KXYA 4EHKA 4IEIA 4RPKA 1EK0A 1HDGO 1LRLA 3MS4A 4A0SA 2OVFA 4X6YA 3ISVA 2WSMA 4C4YA 2A9KA 4M1MA 1OU0A 1KNQA 3WHKA 1X92A 4V0MA 2YYYA 5C35A 4BX0A 4M1YA 5FI1B 3MUOA 5IM4A 2GJSA 5F12A 5LXTB 2ODWA 3TTVA 1DC6A 3I34X 4NJEB 2CFSA 1TC2A 3E5MA 2HJGA 1O89A 1OA0A 2NTNA 1F8GA 1RQXA 2W98A 3I2KA 4P32A 2PRKA 4R1SA 5IFKA 2HMYB 4CW7A 1S2MA 2AC7A 4IHJA 4H7KA 4EW6A 1S9DA 3A9SA 5B3KA 1JB1A 3SQMA 3IP1A 3OLQA 4JLMA 1ZKMA 3GARA 1MG0A 1N6HA 4HHEA 4XWTA 5DT9A 1CUGA 4ESVA 3HTXA 3TD2A 3D8TA 3WAKA 1K88A 2SECE 1JHDA 1LVUA 2HLPA 3G23A 3HCNA 1PJ8A 3JAWA 4LNAA 2W6OA 4FNGA 4MRVA 4E5VA 4F9TA 4H2DA 5HFJA 3M1IA 4IRXA 4G0WA 4ZVPA 2ZRBA 3FMFA 2AOTA 3QEJA 4U2EA 4L0QA 4O2BF 4BDSA 2R8PA 1ZICA 3DFZA 3IAHA 1PEYA 1VG1A 1I3NA 3CF6R 2M1XA 3Q3GE 2PL1A 1TEHA 4S2EA 3WMFA 4GM4A 4G4IA 3ADPA 5G4LA 4IQ0A 4C7KA 3PENA 4FE3A 2AS0A 1PHPA 5E3IA 1MV5A 2OGWA 1UWCA 3DTTA 2JLSA 3LG2A 4GXQA 5LZ7A 1PDVA 5U4XA 5BQPA 4D9BA 5DTRA 2FCAA 1JI0A 3WIVA 1FXUA 1O58A 3AF4A 1XTRA 3IQXA 3E81A 4BQEA 1X80B 3HSKA 3R3XA 2HA6A 2QY9A 4U6SA 1DDIA 1L8OA 1YHNA 3E0QA 3G9TA 1UQUA 1F1JA 2PJZA 3QYJA 4JEIA 1QVZA 4GU5A 4WESA 4XQGA 3N39C 2JFXA 5F1KA 2PJUA 4Q4AB 1D6SA 2DTDA 2J4DA 4LZNA 3TNJA 1DBVO 1Z4MA 3ZGYA 3U44A 4AF7A 1R4MB 2ZBQA 1ZONA 2FUG1 3VR4A 2VQ3A 2W0MA 1TT5B 2GZ1A 2CCKA 4IWNA 1C4XA 4QGBA 1QLJA 3HU2A 4G0MA 2Q99A 4QGSA 2R5NA 3KKNA 1U0FA 3PWTA 4TVKA 2C84A 1JPUA 3IQHX 4S0ZA 4OAOA 1QSGA 1E1MA 4PFSA 2GJ9A 4MQEA 1YB1A 5HM8A 4LQCA 4HZUB 4ZXFA 2WWGA 3N6XA 2XB6A 4QJIA 4MIKA 1NBEA 3MJHA 4KXUA 3A9VA 1ZUD1 5A4DA 3QPVA 4L4YA 4FGUA 4O63O 1J8FA 3TRKA 1ZFNA 2LP4Y 1GXSB 3C3WA 2CVQA 3IIKA 3IR7A 3D6UA 3HNOA 1AKMA 1DUSA 3LVRE 2BMEA 4Q12A 4A6XA 3BL6A 4WRRA 1A5ZA 2D1TA 4XB6B 3AZOA 4GOLD 1ID1A 1HM5A 5T8KA 1QZTA 2HZ7A 3CCFA 1CQJA 5LYJB 1XDSA 1K2WA 1I0IA 3BL5A 4ROSA 2H1HA 3BMQB 3IMCA 4FOSA 4OU4A 4ZAXA 4MVWA 1EM8B 2Y1WA 3WO0A 5B55A 1O08A 2Y99A 4NBLA 1KMIY 2RKBA 4XH9B 3T9CA 5K6AC 4YWJA 1GN9A 3S68A 2P4HX 1PW5A 4B2IA 4E94A 4A0QA 1SWWA 2BEVB 2JDID 2GVNA 4I9FA 1WQ4A 5AM3A 4OEHA 5GONB 2I91A 4TMTA 5DXFA 4CCYA 3D02A 4ZTZB 1HK7A 2BFCB 2NQTA 5FHRA 1VL2A 3C15C 3NANA 3D5TA 3L7MA 3LHSA 4H3KB 4HNQA 3DL4A 3S7TA 4AZ3A 4Z8XA 3TR0A 1UF9A 2MMCA 4JUFA 2CK3A 5D5PA 4CEJA 4BQPA 1VPTA 3QIVA 2QZZA 2YXDA 1OTYA 5JATA 3R3SA 3K9HA 4Y18A 1RIIA 3WBBA 4IRMA 1XRPA 3WK7A 1NKVA 4KYUA 2X7JA 1RDFA 5HUQA 2RHGB 1F2DA 4D2IA 2J46A 4OPMA 4WUVA 5ANRB 1UQRA 5JZSA 2RJ3A 4WINA 1P60A 3C3XA 4Y7DA 4JV5B 1DWOA 1JG6A 2BGUA 4JX8A 4EY6A 2GJKA 1YJXA 2AVNA 4MRPA 2O8CA 4V1CI 2NO5A 3LP6A 1P61B 3WYFA 4AZSA 3BH7A 1FFSA 3HB5X 3HZOA 4L4XA 3A1FA 4Y2SA 5C7YA 4L5YA 1SFRA 2YVUA 1NF9A 3P9CA 3LC2O 4RK4A 3I2IA 3UYKA 1M7HA 1XZ8A 4AZ3B 1N6RA 2MT9A 1DRVA 3R5SA 3ZQJA 1TVMA 3H1FA 2AWOA 5KKAA 3NEJA 2ZSHA 4YT8A 3Q9UA 2BBTA 4R2JA 3IR5A 1I3LA 4YEDA 2ZM6B 5KYXB 3UTDA 3ZHZA 4O2AB 5TEWA 2PS0A 5JCOA 3KETA 1OFUX 2RGCA 4YO8A 5TSDA 4YMWA 4RM3A 4BKMA 2FOXA 5EP2A 3L0SA 5K9ZA 2KX7A 1JAXA 1Z7GA 1AHIA 3GAAA 2CB9A 3OT5A 4IQGA 1OH7A 5D85A 1UBRS 4ZIRB 3WWDA 1ULBA 2KWIA 3G49A 1F06A 3NP7A 5D5HA 5CIYA 1KI1A 2YJTD 3KDAA 1ZNYA 3UMBA 1EK5A 3MC1A 4JBHA 1V16B 3OKPA 4C89A 5D00A 4JI3B 3FKQA 1NWCA 1JVSA 2JEZA 4XX1A 2GBFA 1KJWA 3FGNA 3UJ7A 1VC2A 1X9IA 1OLUB 1SD5A 2QVXX 3C45A 1NI3A 2HJHA 3P2OA 2VUUA 3AVTA 3Q7EA 4X84A 4XPIA 1GGFA 2EBFX 4FFVA 4HB4A 3DHEA 3NT2A 5CYPA 4PPNA 1VKHA 4UHBA 3TCNA 4BJ3A 3KAPA 3U44B 2OO5C 2C8JA 2X8BA 1Y1LA 2P41A 1DARA 3QLVA 1WP4A 1Z16A 2PV0A 3G5TA 4FHCA 1H5UA 4HB0A 4NAVA 4WASA 4LJ4A 3T35A 4DZZA 5IZCC 2RGDA 4ARBA 4NYIQ 2GN1A 3IKLA 1T15A 1TGYA 3KAQA 5G1OA 2DYKA 1LXCA 2ZRPA 5HG0A 3T7AA 3U49A 4B46A 4RLHA 4W9NC 4CM8A 3QVVA 3HI6A 3E7FA 4CM3A 3IMKA 2C2ZA 1DTEA 3F5MA 1RAFA 1YRWA 3OJLA 3ZIUA 1Y37A 2JJ8A 5D3QA 3DT8A 2ZKLA 4DN6A 3DHWC 1Z74A 4DPLA 4MR8B 4O3FA 4I1OA 3L7LA 3LBAA 5KQGA 3ISTA 4ER3A 2ZBFA 2QU7A 4JQSA 4OQZA 1V5WA 4E5UA 2H1OA 2QRHA 3LL4A 1E5TA 1WB9A 4HPXB 5AWFC 3WQBA 3WIEA 2HD4A 5IVHA 1Z0FA 4OHKA 4EEXA 4ZOBA 3L8HA 3LUHA 2G6TA 4OKIA 2DFKB 1XE3A 3MM4A 4UUMA 3HM9A 2AH5A 4EW3A 4JLBA 1YNOA 2OLJA 4YJGA 3EVNA 2H2AA 2J5QA 2C2YA 3UAXA 3ZIAA 1EFUA 1KFEB 1PWZA 4K3VA 3PD0A 3SZRA 4ER6A 4ESHA 4GI3A 1BC5A 3EVGA 3CXUA 2QYTA 2WWRA 2PR2A 1Y4AE 4D8XA 1NWHA 3GFBA 3KEOA 1EX7A 1QHNA 1UK9A 2R7MA 3GNQA 1P2SA 1MW9X 1E63A 5DCYA 1LZLA 4QTZA 5BT9A 2GYWA 2NW6A 4IS3A 1PL6A 2C8KA 2VSNA 3HACA 3AERB 3OKFA 2B4TO 2Y66A 3QUTA 1CY6A 3OC6A 4FJ2A 4IYRA 1V5GA 4J16C 4ZHQF 4M0PA 1J99A 3KEQA 1WZ2A 2EKDA 1MOSA 2CCGA 2H63A 2PLRA 3C97A 1I2AA 3ZHSA 2X8LA 4P4TA 3QBEA 1PGQA 2HBRA 2XVXA 1DTWB 2XZPA 3ER6A 5BN3B 4WNIA 5G2OA 3P94A 5BVHA 4EJFA 5AHWA 5FPQA 1IYZA 2I7DA 4NG4A 3QEKA 5JD5A 4ETWA 1OYWA 1TA4A 4YRBA 4LDQA 5GAJA 1GL7A 3OWXA 4DCMA 5A7FA 4R9NA 4N49A 1GFZA 4KFSA 4QODA 2FUEA 1QLHA 4HVLA 3ZJVA 3F1KA 3VR6A 1YACA 2I03A 1BU8A 2WP8J 5I7SA 4EMSA 2Z95A 1XRNA 4HQ6A 4WVFA 2QR2A 3T0FA 3D5EA 3DOHA 2FRXA 1GLGA 5ALKA 1BQEA 2V9CA 2WIGA 1HE1C 3DVAB 4HFMA 2VPQA 4YH1A 4EVRA 2BGNA 1DAOA 5HDQA 4F11A 3K0SA 3KJIA 4TTRA 1Z35A 4Z3DA 1N2HA 1JQ3A 1KP2A 3QVJA 4XFDA 5EY5B 5F5NA 4I14A 1CUZA 1GL9B 1Z2DA 2AEEA 4YRPA 3TLCA 3FYUC 3UFBA 3AHIA 3P4YA 3IERA 3AVXA 4Q93A 1NVVQ 1Z6PA 5FBHA 1LF5A 3W8NA 1SBHA 4RSHA 3WDSA 3GMTA 1UBTS 1OBVA 4ZRDA 1BXGA 1O8CA 3O0TA 3W06A 3R75A 4MUFA 3WV5A 3KCNA 1ADCA 1GSHA 4P83A 3VOTA 4D4IA 3D6JA 1XVAA 3ANMA 3O4FA 1KMNA 5A62A 5JVDA 4FNAA 4D9IA 2XRZA 4YAJA 1Z5NA 2LDXA 9ABPA 3OZCA 3R5KA 5TDHA 3LL7A 3SU8A 5CA0B 2IS4A 2WAOA 3GJXC 3SJ7A 3FHCB 3EB9A 4OGFA 1JLRA 3B2NA 2V0GA 2WJWA 3FSRA 4AL4A 1JR3D 1RRMA 1Y7PA 5BSVA 2JLQA 3NG1A 5H81A 4HGOA 2RKOA 3WGKA 5KWSA 4PCVA 1J7KA 2K2QB 3QPCA 2H7YA 3FFBA 5CURA 5IKEA 1B3RA 2UVQA 4RWEA 1UM9B 1DXOA 1T2UA 1WKVA 1XQ9A 3SR0A 1G55A 1VE7A 1SCDA 1IH8A 2A5LA 1FFXB 4JXJA 4BO6A 2L42A 3RD5A 2G4LA 1QQAA 3HB7A 2I66A 2JBWA 3W5CA 3A2KA 2RGEA 4KO1S 4B4OA 4LXIA 4Y6GB 5T67A 1F8YA 1FDUA 1AC5A 3RAPR 4M86A 4FW8A 2QENA 4WK2B 3BSYA 1CE8A 4LSZA 5JQWA 2XE4A 1GGJA 3DZHA 3WK8A 2BKUA 3HDHA 3ZKWA 5BV0A 1J8YF 4IINA 3I2YX 3AVYA 1TQHA 1GHTA 1WETA 1YF3A 4UBOA 5K8JB 3RHSA 4YRLA 4MK4A 2QN2A 4GRIA 5AP9A 3FVVA 2PXCA 3F71A 5DB4A 2OAP1 3T3HA 4B6PA 2VA9A 1TD9A 2C4NA 1EJBA 1KFCB 3CNHA 1CY8A 1PNVA 2QZ9A 4PR0A 3HXMA 4BB5A 1GZDA 3LA8A 4TN5A 1FJHA 3CY6A 1NQWA 4D9GA 4P0TA 4Z7JA 2E4AA 2J3MA 2WM3A 2NUAB 3SLRA 4E7OA 1CB0A 1HZZA 1KK1A 4FI3C 1R0BA 4GYWA 5K4HA 3GFRA 5LU9A 4QPDA 3SX4A 2P7IA 1YMVA 5M29A 2FPOA 2OBNA 2XUFA 3GGGA 1QFMA 4A0RA 2J9FA 4O4IA 3T7KA 1WAMA 3DONA 4P5DA 4C0SA 3PNOA 2O0JA 1CKEA 1AZWA 2TMKA 4Q9NA 3ENZA 2EW8A 3UHOA 1ZM9A 2JGKA 4ZYYA 3HUFA 4WSOA 4X8OA 1NBOA 1YUNA 5EWJA 1TCVA 1YZKA 1UDAA 2FV8A 2WWTA 3CGGA 1KI9A 4HQNA 4PO8A 5ENVA 4FZ3A 5A3VA 3IEIA 1NMQA 3JQAD 3BDVA 4TLMB 4H1VA 3O8OB 1CY2A 3E53A 4M8SA 5C8YB 3LQ4A 4AKIA 2N9UA 2B20A 3GFPA 1NQVA 1SVOA 3W8EA 3CH6A 4F4CA 4BO4A 1QIEA 1MHTA 4CI0B 3MSXA 1N3BA 2PS3A 4CHTA 2VT2A 2UXDB 3BAZA 4KLRA 2PKEA 3GROA 4P81A 1GPUA 3PT9A 5HIIA 4B5KA 1C0LA 1Y3FE 5B7QA 3OQIB 1HE2A 5IMSA 3VBCA 3THYB 2H2HA 3B12A 3PJDA 1MRNA 4NCXA 4Y1RA 5A02A 2G1JA 5B2ZA 1SM4A 2G72A 3IO5A 4RJJA 4G56A 2Q0SA 4MMYB 5IVKA 1ZQ1A 4C0HA 1K6EA 3EEIA 1F6BA 3QFHA 3RROA 4C0LA 5IU6A 4QBHA 4R68A 4AT1A 1E1QD 2XCRB 1NVWQ 4PG8A 3KPVA 5K03A 1WWKA 2B98A 3EFHA 4MWBA 1G4AE 2IJGX 3HYRA 2Q9CA 4HAIA 5FRDA 1UWVA 2QPTA 3DZFA 1LLCA 2ZSDA 3ZY3A 5A6SB 1W34A 3NUZA 1WHTB 5HCUA 2B92A 1ZO8A 2Q5EA 2QL7A 4FT4A 4MQUA 5DTQA 4CQMA 1H0HA 1XEAA 4V02A 1WD7A 1XI2A 1X8LA 1RM5A 3C98A 3KS9A 4B6GA 2X40A 5J4YA 2C7OA 2EQBA 2FETA 2Z1NA 4PS1A 4DJJA 1PLKA 3ZJYA 3CBGA 4Z6KA 2XYRA 3BWEA 3X43A 1ECGA 3V8MA 1ZZEA 1GNLA 2CUZA 4DV7B 1VE3A 5AXBA 1SKMA 1RM3A 4UCQA 1E8MA 1X42A 1MJGM 3EUFA 1QFYA 4QAJA 3PB3A 2H1RA 4I1RA 3VYSB 4C20A 1L7RA 1SCAA 1ZNQO 3LVBA 1I3MA 2OAEA 2P91A 2PX6A 1TM2A 2VBCA 3GPDG 3KD2A 5LQDA 4R2WA 1PZGA 1YB4A 4AG3A 3PFGA 3QX7A 3NBUA 1QP4A 2GF0A 3LO8A 4G4JA 5DHFA 3UAYA 3CURA 1IN7A 3FYHA 4KE6A 2W22A 1T35A 3R6WA 2D6FA 5KTNA 1YR2A 1U7TA 2P1RA 4MW6A 1PJSA 3AUAA 2XADA 4TMFA 4MVJF 3UG7A 1RQNA 4PFJA 1UFQA 4N5NA 2FLWA 4F45A 2BBSA 1UC9A 2ODNA 2QRLA 4DIBA 3DMFA 4GMGA 4RZUA 4BX9A 2I1VB 1C7RA 5IN5A 1VYVA 2H8GA 2XCLA 3BQMB 3HY4A 2FHSA 3ANXA 4PGGA 1P1JA 4PSKA 5DISB 2YZGA 4ZHQB 4V1CA 4YAUA 3R8FA 2GT1A 4W8GA 2ZOSA 5EUBA 3U81A 1NUUA 2C57A 2FW0A 4BEVA 3C5WP 4IG9A 3RVNA 3T99A 3BTOA 2JI9A 3EC7A 2BOVA 4JQCA 1XMVA 1FDIA 1VLQA 2AX3A 3FDJA 2QSUA 4WTOA 4KRXA 1A9XA 1NMEA 2D74A 4MITA 1P7CA 2ETVA 4B71A 5KWJA 5FP0A 3R3HA 1YQTA 2PUJA 1NJ1A 1W30A 3EHDA 3KYDA 4S2UA 3LWNA 3LPAA 2M6LA 3QWBA 1E7WA 5KJCA 1Y4UA 4DV3B 3ESCA 2OCPA 1Q1AA 2XIJA 2Z9BA 4M9QA 3S81A 5JARA 5IYZF 3EBLA 5C5EA 2H5LA 1V7PC 2D1FA 3DKVA 4L2IB 1J42A 4B7CA 3KJNA 2WD9A 5I3ZA 1OD6A 1T2CA 1V9LA 1XCMA 1ZN7A 3L9WA 4M6WB 5TJHA 5P21A 1QONA 3OWOA 5FR2A 3MD9A 4GX2A 521PA 2QGNA 3B5JA 3HI4A 1DPFA 1IB0A 3EIFA 3GFGA 1N4DA 5KYXA 1EWVA 3GBVA 4TXJA 1VE5A 5A1TA 3L7KA 4JLDA 1NUAA 3DO6A 3GPBA 1MEOA 1MRZA 3G2JA 2IZOA 1Z4QA 1MP0A 1JPJA 3G0GA 4YK7A 5FYDA 3S5UA 5EJ8A 2X8JA 1K6JA 2F3PA 3G9ZA 1CQIA 1OW3B 3RTEA 3S99A 4CGZA 2P35A 1HTBA 4B2YA 4RHFA 3QGMA 5EI5A 2Q7OE 3SDZA 4CCWA 1THTA 4OKNA 1M2GA 2KLBA 3FLBA 3SC6A 4DUPA 4G0VA 1UM8A 4LF4B 3PKJA 2OCBA 2SCUA 1VBNA 4ZC8A 1EAMA 4YV0A 1MX1A 3KPJA 5BVGB 4CEIB 4NU5A 5HF9A 5CA0F 4W5OA 3G8BA 4OXIA 2JIQA 1VZ2A 4ER5A 3VPAA 1I32A 4DUGA 1UOEA 4FFDA 4N47A 5CFQA 3EXHB 4NMXB 4Q00A 3EEBA 1CUAA 2H18A 3ROMA 2ZI5A 4HUQA 3ZU6A 4CM4B 4H0FA 1Z4OA 3J81A 2PKQP 2FA9A 1T36A 2BR5A 2I4MA 3HYCA 1EXMA 1F12A 4B47A 3TYXA 4WEQA 4C1NA 1GT6A 1MN6A 4G1FA 4OGKA 2VP9A 1VBMA 5BR1A 3RC2A 3WYAA 2G8LA 2FSSA 1Q20A 2WOOA 4EJSC 3ZQ4A 5ALHA 3RWOA 3PQFA 1ZN2A 3KVOA 5H68A 1JDVA 1T2NA 1W93A 1Z7BA 2EFHB 4EH1A 2V7QA 1N3YA 1QCDA 3EC1A 4FCCA 4E7PA 4M0DA 4XIJA 5CM2Z 4BC1A 1TA9A 1ODJA 2O48X 4JK3A 3IDFA 2O20A 2EZ4A 3U39A 3G13A 2FQYA 2QD3A 1E7MA 4WJZA 1GN8A 4YQEA 3V80A 5ED4A 2CSUA 2O6LA 1QFZA 2WK1A 3ZDEA 1YWGO 1QRSA 3IJEB 1V96A 1XAHA 4MRRA 1B0ZA 2A1TR 1RYDA 2F17A 2XH8A 3QKUA 4W5HA 2IGBA 4TMYA 1XVIA 4BVJA 4P54A 2PVSA 4J76A 1XB2A 3G0HA 5CDSA 1QOZA 5HILA 1MNQA 4AN1A 1QH1A 1SXJE 1ZVKA 4YDRA 3KWFA 5EXSA 1FNDA 4XIYA 1YC2A 1I7PA 1YS7A 1HC7A 2ZR7A 3C43A 3LC7O 3QMMA 5FCDA 2BF4A 4F4JA 1Y9DA 5IVPA 5IYZA 4XJTA 5E4FA 5C8XA 4RU1A 1D4FA 3RFXA 4N6NA 1NBIA 1U8UA 1Y63A 4P8RA 1RMTA 5K20A 2D1RA 2RGBA 1RKQA 2Q1YA 3HKDB 3COPA 4WA7A 5AI5A 2XYGA 5AK5A 3MWDB 2JBHA 1I2CA 3KLPX 2YOHA 3FCXA 5KOHA 3AKCA 3V34A 5JCJD 4YP5A 2A9FA 1GVNB 2VRCD 4OFBA 4HZGA 2G8NA 3BMQA 3G1UA 4KAAA 4U2FA 1AX9A 3USCS 4MVJH 5IJZA 1OVGA 1QTRA 4H6PA 4JITA 2ZSKA 4M49A 1HA3A 2JCSA 3Q0IA 3EWAA 3GRZA 3QG1A 1U4NA 4PZDA 3TUJC 3VR4D 4B82A 1E2QA 2HA3A 3IX7A 4BFCA 1U2DA 3B70A 3QOFA 3NDJA 5LWHA 3HZRA 1ZN9A 3UH0A 2UAGA 1DBRA 4PN7A 1E0DA 1Q21A 3O8BA 1YU9A 4GMHA 3THOA 3IP8A 1QS0A 1BVYF 1G17A 3M5PA 1JLLB 1MH1A 5AVSA 1P0MA 5T7BA 1QP0A 3L2OB 4G86A 4DR3B 2XUZA 1C7IA 4WERA 2HMSA 4M9UA 5BOVA 2PA0A 1X3LA 3BXPA 1AUPA 1RQLA 3OQ1A 3ZLVA 3BFKA 3GW8A 3HM2A 2IEYA 4INZA 3CVVA 4G5QA 4XEUA 2X9NA 4H3SA 4NULA 5E9AA 1DKUA 1X0VA 4MWEA 1Z6XA 4LYAA 3U3XA 4BNZA 3PUJA 4BFXA 2C9CA 2PEYA 1ZJ5A 4NE2A 4CQMD 4DT1A 1T4BA 4OOEA 7YASA 4E88A 2YBEA 1P5FA 1G8MA 4DDHA 1P8AA 2D2EA 2HDNB 1ZI6A 3A6HA 3KHUA 5T6MA 3DQZA 3VI3B 4BNNA 4IQ4A 2FPGB 1AKYA 4JY7A 1V2GA 4Q4HB 2Q2WA 3U62A 3AL0C 2HDHA 1KSJA 3RNLA 4HAWA 4S0XA 3IP5A 4BNKA 3EPHA 3A04A 4FFNA 3Q6MA 4ZP1A 2ZJ3A 2GK4A 3JX9A 3KZMA 2C98A 2IXTA 2GJAA 5AHXA 5CYFA 2CJWA 3D7LA 4Z7OB 3RRXA 3KOZA 3PYMA 3S55A 4AJ4A 4J43A 3KXKA 3QOYA 1N8NA 1QFJA 1I01A 1TMKA 3RS2A 2J59A 5CGQB 1SVKA 1B3BA 2AOUA 1CPYA 4C3VA 5BWCA 2SHKA 3DVQX 3FFTA 4CG3A 1BMFA 4LRTB 2B0JA 2I7CA 3OM9A 4FD2A 4MULA 3UA4A 1ESDA 1WXGA 4K46A 4JIMA 1YQWA 4LJ9A 4CTNA 4PINA 1HR0B 1FFBA 1N6LA 1M73E 3EDQA 3EVBA 2QIPA 1TO2E 2ZSBA 1LWOA 4MJ7A 2PYDA 4O2LA 1VSQA 1YVDA 5B6PA 3CF2A 4KGZA 1NYRA 3CX6A 1BE0A 2ZZKA 1YJ5A 2OXEA 2ZT8A 3NIGB 1Y9JA 1I4TD 1KXZA 1M6YA 1V1MB 4URHA 4Z9BA 4D9CA 3K70B 3DE0X 3HEBA 2HSEA 4X0EA 2AD5A 4W1PA 3RF6A 3DL0A 3D4IA 2AE1A 1A95A 2H06A 4MDYA 1GQOA 5HRUA 1YI0A 1T4DA 4IV0A 1GO2A 3UT6A 2VXYA 3VO8A 2VL7A 2I6TA 5K8LA 4C4AA 1I5RA 3V4VB 3DAOA 2WQ7A 2AMVA 1F6DA 3L1HA 3HV2A 3KP1A 3QI7A 5H02A 5JAPA 3S8YA 5BV2P 5JT1A 1Z9BA 2D00A 2H11A 3EWSA 2JJQA 4MI3A 3WLMA 1HDYA 2A9JA 4RQBA 2VH5R 2BR3A 2HSDA 2X6TA 4PF1A 5AK6A 4BMPB 3DLBA 5IYZB 1P7PA 1T1EA 5DN9A 2FWPA 3Q7RA 3QK7A 2O2HA 3P9XA 4XDZA 5FPKA 1TEXA 3D4NA 5A0VA 4O8ZA 1OHHD 1T36B 5EXXA 5K1ZA 1PW7A 4FYVA 2PKQO 1ZMRA 2W2PA 1B0AA 4UUAA 2IYVA 2XRMA 3B89A 4KH0A 4NTZA 1L7QA 2B34A 2MOKA 4XDGA 4ABYA 1Y9ZA 4KQ6A 4BGIA 1RWMA 5JJIA 1JJIA 1MO2A 4YLEA 3WLTA 5CITA 3AR5A 1QVVA 2HPVA 3PXEA 5KTSA 1LRJA 1OIXA 3JV7A 3SR4A 1ZISA 3ICWA 4H16A 1DIRA 5EXTA 1Y7LA 4YO7A 1CQZA 1C9KA 4JC0A 3TO5A 2IE8A 3WWOA 4DCVA 5A9RA 3K72B 4ARAA 2G09A 1FX1A 3V46A 4RELA 1XJQA 4PX3A 2COUA 3HN2A 5D3MB 1ISJA 4RPHA 1AOXA 2V0CA 2BTOA 4LQDA 3PEUA 1QV7A 1SUBA 4UNSA 2CL6X 4K9QA 4FHEA 1PR4A 3DZIA 3EWNA 4DDUA 3DM9B 2BELA 3E9NA 3MQFA 1RE0A 2NV6A 1MGOA 1Q2UA 3JRXA 2QWXA 1WUTA 4XPIB 3PQCA 1MJGA 2HBYA 4X1KA 3RFVA 3TI9A 3WGQA 3WRVA 2IX3A 5GINE 3GN2A 2CE7A 1G63A 2AB0A 3NYIA 3L7YA 3UV6A 1IFXA 1GYRA 3ID6C 5THKA 2WPDD 1NNLA 2FPWA 1HRDA 5KI6A 2TMYA 2F62A 2YOFA 5E8JA 5GONF 3V9PA 2I71A 3L79A 3R5XA 5CXSA 3ZGVA 3ZZTA 3IVMA 4DLWA 5JC1A 1IUNA 3P0IA 3PEWA 4CM6A 1Q1GA 5FIUA 1LPOA 1MW8X 4US1R 3LBFA 1DLJA 1Z08A 1S3FA 2W6ID 2XT6A 1ZCZA 2Z04A 3AINA 3INNA 3MJVA 5ALPA 5FF9A 2GJ8A 4HXFB 4YYZA 1Y8QA 1FLDA 1X13A 3VR2A 4MS1B 1AA9A 2LVBA 2EARA 1DINA 4XYMA 5D84A 3BH6A 1K9SA 1FMCA 2BKLA 3KT3A 3LUKA 4OP3A 3AYXB 2FDCA 1A2QA 1A4IA 4XZ3A 5JECA 2O2IA 1V5IA 3Q3JB 4P3KA 3A0UA 1LJUA 3LLUA 2Q0XA 4RW0A 2XZTA 3WKDA 2GDZA 2P9GA 4TL9A 1GDHA 4AJ2A 4DR5B 4NSNA 2BFEA 4Q7LA 1F7UA 3H4MA 1AXEA 3EIQA 3VZDA 1XMXA 4FIDA 1G6OA 4J0QA 4JFAA 1D07A 4MQMA 1T8PA 2NSDA 3U09A 4CDGA 4IDHA 3LBNA 3RRBA 3DPSA 5D01A 4HGYA 3B53X 2ZB7A 1OKKA 1UQTA 3PRJA 1QS0B 2X1HA 3R7SA 4BAZA 4IIXA 3TTUA 1ZWLA 4KQKA 3MLAA 4GYYA 3T9EA 1VCNA 3WICA 5B6JA 2FW7A 2LCFA 1HV8A 3C39A 1SVUA 2GPNA 3HJHA 1GQRA 1FP2A 1HE4A 1I2DA 3K70C 4QLBA 1YBHA 4KXFB 3LUAA 4D9FA 2HO4A 2VHXA 3ND9A 2JFBA 3D6AA 5CXXA 4AO6A 1QCZA 2BCJQ 3ZV7A 2JLUA 1W88A 4AVYA 2XQIA 2W6IA 1E5QA 2H4YA 1C0KA 1P29A 3GXBA 1BYIA 2FFBA 5I9TA 3C14C 3KLNA 4AKGA 1M9NA 5JE8A 4ZI3A 2FSIA 2J0VA 4PFQA 2BFWA 3RVBA 2F4NA 3M3HA 3HK2A 3GVPA 4FZVA 1PGNA 1QQTA 3LY7A 4AWAA 3SAJA 8ABPA 1J5XA 2O2JA 1T10A 4GDMA 5AVOA 3E9MA 1RRGA 3U4CA 3S2SA 4LF6B 1TIPA 1X9HA 1N5KA 1ZSNA 5K3DA 4HWKA 1F2TA 2Q28A 4G1BA 2C58A 3F8WA 3DHYA 4YRQA 2HHCA 3RSLA 5CVVA 1WOMA 3FX2A 1N6PA 1L3BA 1G66A 2DY1A 3AK4A 3AL2A 3BA1A 5LYJA 1C3OB 3ZHQA 1TEVA 3LUCA 4FFOA 2NYAA 1M1YA 3CONA 4MVJD 2VDJA 2PUCA 3N58A 3PYLA 4L9AA 1HDRA 2AYYA 3SBEA 4RCZA 3HP4A 2M2IA 2JJMA 1X8KA 1XP5A 4CL2A 1D09A 1RFLA 2P5TB 3DOCA 3EF3A 5K5EA 5ICGA 4LOLA 4CV1A 1HDXA 1XA0A 4LHSA 4OHZA 5C4MA 3K1AB 3CUKA 4HDMA 1E2JA 1MEJA 1NQAO 2VPWA 1P44A 1ZCAA 3MJ4A 1EWTA 3N05A 5TLSA 1I80A 3SKVA 1ULHA 4LMAA 4CEJB 2ZP1A 1L4MA 2V5AA 1CUHA 3HY6A 1EJ2A 4GGMX 4Q4LA 3ZV3A 3IVGA 1F2TB 2BFOA 4M8IA 2A0KA 2KYRA 4IXWA 4GP6A 4IXTA 3TTSA 4AM8A 3PR1A 5GMOA 5A5EA 1KEEA 4RD0A 1I9CA 3T6KA 3ZDRA 5DHUA 2J3QA 2X4IA 3BL8A 3DTVD 3M4JA 1JILA 2DT8A 3ZCRA 2I67A 2XQKA 3Q0TA 3GVHA 4FEAA 5EWMA 4TXMA 3KXPA 3F5QA 5HQ3A 3DTNA 5FPSA 2JBAB 1XMSA 2WG2A 2WNHA 1RQ7A 3CEPB 3DWGA 3GEEA 3GLHB 4ACAA 3GNSA 1YQEA 4A2QA 4ZYWA 4J0CA 5FUBA 4DYHA 5LP6B 3V2IA 3Q2IA 3KHKA 3TRDA 2F67A 1AURA 2PMBA 1YR9A 2UVPA 3BIXA 2Q50A 3UJ8A 2QRQA 1SBIA 1IIRA 1WULS 2HWUA 3IP7A 2FUKA 4G8JA 5EWJB 1M5UA 5C80A 4BATA 5ALWA 4QKQA 3VNUA 5DLEA 1CJKC 5TR9A 4G8BA 3NOXA 2XVZA 1N5OX 4JLAA 5AKIA 1NAIA 1M6EX 1KH2A 3ZU3A 2GESA 1P1CA 1YULA 3T5TA 5HK8A 1M2VA 4GGPA 5BNFA 3SZGA 3I52A 4J91A 5DGDA 3VPSA 1MTZA 1P0FA 3F5SA 3NC4A 4C7VA 3ZWMA 2JGAA 5DZSA 2KQUA 3RF7A 1ISSA 4TMWA 1XEXA 3DV2A 4LEIA 1OHHA 2A3RA 2IY9A 3QQPA 4KR7A 3I62A 1MIHA 1Z2AA 3GYGA 3HVUA 4PWZA 3TLGB 3JZIA 4E22A 4FHZA 4Z0TA 4XRGA 4AJHA 4QUBA 4EK9A 3CM0A 1U5BB 1YJBA 3HV0A 3IS3A 4R7GA 2WVJA 4NV0A 5KEIA 3P8ZA 2ZYUX 4E32A 2GAOA 1Y98A 5IXJA 2YV5A 2YXLA 3BXZA 3C5EA 1GTL1 1YVUA 1N1DA 1QC5B 1NTOA 2BZGA 2WSSA 2XTNA 3B6IA 3MRVA 4ND2A 4ALLA 4I50B 5HKOA 1XXHE 4CEHA 3DPUA 2WJ4A 1MX3A 3T1HB 2BI8A 5G02A 4PYOA 5LLTA 1MB2A 1LBSA 1P6XA 5LQAA 5ABPA 1KMCA 2JRLA 5CTAA 3U4GA 4A6DA 4AS1A 1W0KA 1Y8QB 1XJCA 4PFKA 2YBDA 1J9EA 2YV4A 3MN1A 4IGFA 2XWJI 1TW3A 3LNTA 4MH0R 1XLTC 4HZIA 5D2CA 3VX4A 2CZQA 4MKHA 3VHXA 4E5NA 1DADA 2FSGA 3IDOA 3WL6A 1R00A 4S24A 5HIAA 3WK6A 1WVIA 3SLKA 5AKGA 5EQDA 2OCIA 2VBFA 5KAMA 3I01A 1NVDA 1AKTA 1W85A 5A0FA 1CZKA 4WLOA 1K5PA 5IP5A 4X7PA 3IVXA 3FIUA 2MINB 3HDTA 3OMLA 2FLKA 4Q6BA 1O5TA 4BVBA 5E4TA 1T3TA 2PKWA 4NF2A 4OKSA 5FOXA 1C50A 4MO9A 4NCHA 1KVTA 1U8FO 1YDHA 2ZYTX 1U3WA 3MOGA 4NR0A 3TL2A 2Y2UA 3CE6A 3GLSA 2IUYA 4LVOA 1J49A 1U9ZA 3K09A 4I0WB 5AJXA 2XT9A 4BVLA 2XSZA 4BGVA 1KEWA 4HBZA 1DHTA 1UJCA 3NC1C 4P98A 4B3MB 5EKTA 2OD2A 3SJCA 3O91A 1Y4SA 3I3SR 4PIVA 1ZITA 1RI3A 1E1YA 1K89A 2AGVA 2JFNA 3I4CA 3KSZO 5JNSA 3PLRA 1H6DA 1XZGA 1JZSA 2CFIA 2XTZA 3FTQA 3KLMX 1CJTC 4PC6A 4NH4A 4WKCA 2WZBA 2VZEA 3UCXA 3ZBUA 1VLZA 1XNGA 3SHTA 2X5XA 1XZBA 1R5NA 2A1UB 3IC5A 3LBHA 4EI7A 2P1DA 5B6IA 1QGUB 1CEXA 2QZ4A 1MG5A 5IF9A 1AG9A 3SDBA 3Q3EA 4OSOA 3ZDFA 4EVQA 2IYNA 2XUAA 4N54A 3V4PB 2ZIAA 3IBTA 5K3EA 4FLMA 4D4GA 4LK2A 1H8HA </