3IVGA

Crystal structure of pantothenate synthetase in complex with 2-(2-((benzofuran-2-sulfonamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3ivgA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3ivgA01
1J70A 1N78A 4DLPA 4G5YA 4QREA 3IODA 1EJ2A 5LM3A 2O8VA 1M8KA 1COZA 2Z08A 2HMAA 3HMQA 1EFPB 1Q77A 4U8HA 1GZUA 1I6LA 2PFSA 1WJGA 4K03A 4Q16A 1PFYA 4YP6A 2E0IA 4DJAA 3N8HA 3ZJUA 2V0GA 1T9GS 1TYAE 1J1UA 1GTRA 2WQ7A 3ZJTA 1PFWA 3H9CA 4KR7A 3HL4A 4E1AA 1I6KA 3RK1A 3LOQA 4G6ZA 5KHAA 4A91A 2CFOA 1ILEA 4AQ7A 3BL5A 2WB2A 3H9BA 1JIJA 2DERA 3HV0A 5EKDA 4I6GA 1KP3A 1WY5A 3PNBA 1S4MA 1IQ0A 4JYZA 5K0TA 3E27A 4NAHA 2RD2A 1OWPA 3MLBA 3KT3A 4S1OA 1JZQA 1IHOA 1M8PA 3RK0A 5BNZA 4EG6A 3K9WA 3N2YA 3ZXSA 3COVA 3MXTA 4R0NA 3ISJA 4KKVA 1PFVA 4XFJA 2DXIA 3RJZA 3SEZA 1JHDA 2ZP1A 1VL2A 1MOPA 1NP7A 4MW2A 1JILA 1JMVA 3AG6A 3DO8A 4ND7A 2PXHA 1N75A 1JGTA 3IH5A 3SYTA 1QTQA 4GU5A 4JXXA 3IOEA 4HJRA 1IVSA 4DDHA 3P0HA 1O94C 5J58A 2A84A 4MW1A 3OP1A 2GM3A 4QRDA 4YP5A 1O96A 4J76A 1X6VA 4GRIA 1U3CA 3COZA 1T6ZA 4PBTA 1QU2A 1G8GA 1FFYA 1KAMA 1KQOA 2VTBA 1F7VA 1GN8A 1R6TA 1N2BA 4MW6A 3INNA 3VRHA 3LCJA 1KORA 1FYDA 1H1TA 1M8JA 2O5RA 2RE8A 1RQGA 4CQNA 1IQUA 2D13A 3NBAA 3IOBA 1HYBA 2OV4A 3PNVA 3IMCA 5DK4A 3CLSC 3A4IA 3AFHA 2BTEA 3UMVA 2ZUEA 1K92A 4I6JA 1K4MA 4MW9A 4DDMA 3TZEA 1IFXA 1OWLA 3FG9A 4OJMX 5FNZA 2QUHA 1N2EA 2QJOA 1I2DA 3FIUA 4MW5A 4UZFA 4EG3A 2H29A 1J1ZA 1VBNA 1T6XA 3LE8A 1R6UA 1MRZA 5TEVA 2A86A 4EFKA 2PZBA 3UOWA 2J5BA 3ZGZA 3N9IA 1QRSA 4R2MA 4PBRA 1QQTA 3H97A 4EG5A 2QUIA 3TQOA 3HZRA 5J5AA 3PXUA 5IJXA 3X1KA 4MW4A 3NBKA 4HK4A 1XJQA 4PY2A 1TQ8A 2A4MA 4ARCA 1KR2A 3FI0A 4JZYA 3VGJA 1H3NA 4MUJA 1T9GR 3CLUD 4EG8A 2CYCA 3VU8A 1WOYA 1G8FA 4G5FA 4ZCQA 4MWDA 3G6KA 1QU3A 3CVYA 1SURA 1YI8A 1O97C 1EUQA 2WQ6A 3F3MA 3CLUC 1O96B 2HGZA 2WSIA 1PG0A 3IMGA 5HG0A 2CT8A 3D6UA 1V8FA 1N2GA 2QTRA 3FDXA 1EFVA 1VBKA 3SP1A 5TS2A 3Q10A 1MC1A 2VTBB 3IMEA 1NZJA 2J09A 1M83A 1KH1A 1KQNA 4ZT3A 1PFUA 4MUNA 1GAXA 4NZPA 3X1JA 2IJGX 3G5AA 4YBRA 1M8GA 1KH3A 1NUSA 3MUEA 4JFAA 2CYBA 2G36A 1XNJA 4MVXA 4NATA 3AL0C 2HZ7A 4MUGA 1P7PA 1LI7A 1OD6A 1IQRA 4BWVA 2A7XA 3IVCA 3COWA 4MQ6A 1V47A 2X3FA 1N77A 4R2LA 1N1DA 4X0EA 1JECA 3TZLA 3JXEA 2A1UA 3P0IA 2DLCX 4XFDA 1H3EA 2CUZA 1NUTA 1Y42X 3SDBA 1U3DA 5HUHA 4EG7A 3TS1A 5KWVA 3QE4A 3UC5A 2Z09A 1Q15A 2YXNA 3FY4A 4MUIA 1WQ3A 1VLHA 2QJFA 3Q4GA 4CDNA 1MAWA 2DR2A 1O94D 1N2IA 3CVVA 2OQ2A 4ZT4A 1GPMA 4KPUA 2AZXA 1PG2A 2R5WA 2NZ2A 1U7DA 5TEWA 1F9AA 1X8XA 4YP7A 1IRXA 1NSYA 1I6MA 5IHXA 3G59A 2AG6A 3HGMA 3SZ3A 3FNRA 5LFAA 1KP2A 1Q11A 4DNXA 5HUJA 1N2OA 3L92A 4DE5A 3M5WA 2J07A 3ND7A 3GMIA 1M8FA 1R6XA 1J20A 3AIIA 1N3LA 1TEZA 3SZGA 1WXFA 4NAUA 1ZJWA 2DPLA 1U0BB 3A05A 1NUQA 1OWNA 3CLSD 4P2BA 1OBHA 1G8HA 2E89A 4RPIA 3KFLA 1JEEA 2A88A 1MB2A 4KR9A 2QTMA 3IOCA 1G59A 3ZIUA 2E21A 3C8ZA 1WXGA 2Z3VA 4YMIA 4MUEA 2JA2A 3IVXA 3QTBA 4J75A 4ARIA 1NI5A 2EL7A 5DEOA 2A1TR 1XNHA 1KAQA 4AS1A 1JZSA 2IP1A 1J21A 4CDMA 1Q19A 1WKBA 4HPWA 1ZH6A 5H7XA 4ZT6A 1MBZA 1O95C 4ZT2A 4U7JA 3TQIA 1H3FA 3PNYA 4TS1A 2A1TS 1WXEA 1NURA 4ND6A 4I6EA 4MUKA 2EJCA 3ZUGA 3AKZA 3IUBA 4HJXA 4ZCPA 1A8HA 1O97D 1T6YA 4KPUB 3RFFA 3AG5A 4EG4A 4PBSA 1DNPA 1EE1A 3GLVA 2QUJA 2QJTA 3U1VA 1MAUA 5AHWA 1JIKA 2YY5A 3CR8A 1CT9A 2CV1A 2CV2A 1JEDA 3UK2A 4MWCA 4MW7A 1QRTA 2X1MA 4MWEA 1WXIA 2BYTA 3FWKA 4FZJA 3QTTA 2I1LA 2J4DA 2TS1A 2V0CA 4MULA 4OUDA 1F7UA 1OWMA 1TFUA 3DLAA 1B6TA 4H3SA 5FO0A 2H2AA 4MW0A 1NUPA 4ZCRA 2PG3A 1K4KA 1J09A 4UZEA 5K0SA 1YUNA 3FH0A 3IUEA 2GOYA 4WSOA 1M1ZA 1O5TA 4MUFA 4NX2A 3CVXA 3KT8A 1O0BA 3HFJA 4F3RA 3A04A 2JAXA 3FHJA 1NUUA 1ZUNA 4QBTA 3COYA 2VXOA 3CLTD 2PZAA 1OWOA 3UY4A 1ULHA 3KT0A 3L93A 1YIDA 4U63A 3RBAA 4CT0A 4L2IA 2GKSA 5DASA 2PIDA 4MUHA 1KH2A 2X0KA 4MVWA 1GTSA 4KR6A 3DV2A 3CLTC 3A2KA 3K32A 5KCMA 2J08A 4EF6A 3ZXIA 4RUKA 1MB9A 1QJCA 4MAFA 4F4HA 3ELBA 4EGAA 3SEQA 1EUYA 3CLRD 5F23A 2D54A 5J59A 1GLNA 4MWBA 2QUKA 1TYCA 1YUMA 4ZT5A 1QRUA 4EG1A 2QTNA 1F4LA 3CLRC 2YWBA 3N05A 3OTWA 5H16A 4K0RA 4ZT7A 1OBCA 3ZJVA 1MJHA 1LW7A 5FO1A 3RHSA 1EFVB 2PZ8A 5LLTA 3DPIA 3PRHA 4MVYA 1WXHA 3IDFA 1ZH0A 1EFPA 2ZUFA 3FOCA 3MMXA 3FETA 3ILVA 1TYBE 3D6VA 4OUDB 4JXZA 1U7XA 2IELA 4ZCSA 4DDKA 3GUZA 4XSVA 4WNYA 3H05A 1KKUA 3ND5A 1O0CA 2DEUA 2AKEA 1EXDA 1VBMA 4MLPA 3IVGA 1O95D 3P52A 3P0JA 2C5SA 2X1LA 2CSXA 5DB4A 2A1UB 3MLAA 1UFVA 3ND6A 1YIAA 1XNGA 3S3TA 2DUMA 2XRYA 1YULA 4L2IB 3TNJA 1TYDE 2YWCA 1K97A 1BS2A 3CVUA 1D2RA 3X1MA 1O6BA 3KT6A 2XRZA 3CVWA 2JANA 2DETA 1NYLA 2B7LA 2NSYA 2CV0A 1QNFA 2CYAA 2E18A 3I05A 4Q93A 1JIIA 1N2JA 4ZCTA 3Q12A 1KQPA 5JBNA 3CA8A 1N2HA 5TGTA 1LI5A 3NV7A 1WZ2A 1WQ4A 2D5BA 3H99A 4MVCA 4NDAA 1IH8A
chains in the Genus database with same CATH superfamily
4WFKA 2E4VA 1IEWA 1L5HB 2GS9A 2QZZA 1JIQA 3CEPB 4N0QA 3LL7A 1B3RA 1S3GA 3ENQA 1SU4A 4G5YA 2FPGA 4UFPA 2QM7A 4YUZA 2HW8A 1P9NA 2FPSA 2PXCA 2ZJ1A 2JD0A 4PLHA 4TV8A 3PFNA 4ZHSA 4DILA 3JQCA 3EC7A 4H7PA 4L4UA 3B1WA 4DJJA 4F72A 4YYZA 2P79A 4H16A 2Z2XA 3LW7A 2FQYA 5BRJA 2Y93A 4CQLA 3OOEA 3U44B 3ZWNA 3WAKA 4H0NA 3V33A 4C4ZA 2GBCA 4W1SA 1VHTA 3JS5A 2WJZB 5DXFA 5JJIA 1FLNA 2YV4A 3PCRB 4ZOLB 1NNSA 2J3LA 1H8HD 1K2VN 1MO2A 1N9GB 1TYAE 1UZNA 2HMVA 3Q3IA 2XKKA 2QTVB 3NHBA 4FGZA 4DPKA 3D3EA 2P4SA 1SC3A 3GEHA 2FW0A 4MAMA 4J0IA 2J30A 4B81A 1U2GC 3DYVA 2X3UA 3CQ9A 3GCGA 5BMVF 1DFGA 3LOQA 2A3NA 2BR4A 5C4GB 3ICPA 4NYMQ 1QAMA 3OCYA 2HUNA 1G4AE 1C4OA 2HC9A 1EGMB 2ZBRA 3IIJA 1RRGA 1IM8A 2VYND 4GSYA 4ZVNA 5JVDA 3DL7A 1VCOA 3H9BA 1HMPA 3CMCO 1D2NA 3BFKA 3Q8WA 3MCZA 2RG7A 2VAPA 1ZI8A 7MDHA 1S4MA 3LLVA 4J3NA 1V7ZA 5K0FA 3Q15C 3O73A 5BXQC 1OWPA 2DWCA 3TTUA 4C06A 1RWNA 4PZLA 3WHIA 3OI7A 1M8PA 1WAMA 5IRCD 2GD0A 3R40A 5F5LA 1IOWA 2FX2A 1Q83A 1XLWA 4ZEWA 3X1XA 2ZT8A 3D8HA 3E82A 3IS3A 1CDOA 1QKKA 2B4QA 1MEJA 3NAMA 3QM1A 4V2IA 3VSAA 3ZKWA 2O5EA 5AW5A 2W4MA 5GIOE 1MOPA 3F96A 1ADGA 4EY4A 3TVDA 4WXYB 5AW3A 5TT0A 1U0NA 2Q5IA 1CXZA 1JXMA 2XLBA 4OQLA 4TL9A 4B71A 5I7AA 4ZI7B 4FXPA 4IJVA 4M0UA 1T8UA 2RBKA 3DKVA 4CQMA 2C2GA 4WUVA 5EPEA 2WF7A 1T10A 1U8TA 4RIFA 4V39A 4JXXA 4TRRA 5EXEA 4C05A 3E15A 4UCQA 5C32A 1G21E 6ADHA 4NNPA 2OHJA 1CUUA 2BMJA 2DC1A 1YJ5A 3A6KA 3JV7A 5CT5A 2I7CA 5HA5A 2UYCA 4M0MA 3OEYA 1FLDA 3H2YA 3RFUA 3HDYA 2JCYA 3NBUA 4C1BA 1S2LA 1Y6JA 4R9VA 2WU3A 4IINA 3IULA 4YAOA 4KHZA 5IBQA 3RUCA 5HKKA 1UQTA 3W77A 1THTA 2JIZA 3LCUA 4E6EA 4EFNA 2AOWA 4LRTB 4UJ3A 5JLAA 2VJQA 3T7EA 1FFYA 1DPGA 2V4UA 2GCEA 5CT8A 4AZVA 2W5UA 1U1IA 4NESA 4XTCS 4K9LA 4MPJA 5CD1A 3U7EB 4B3BA 1HQKA 1TLTA 1KEZA 3QK7A 1R64A 4IY1A 1EVIA 4FTWA 1EX7A 4M76B 1QOQB 4B6QA 2D13A 1JP7A 1SB9A 4RPLA 2X6QA 4Z8XA 5DK4A 1JHQA 5DN9A 1TZ2A 1Y9AA 5KNBA 1OFUA 1AMUA 4R7GA 3AFHA 1NDHA 5SYNA 1NBME 2Z8YA 1ZINA 1HFWA 2QG6A 4P4LA 4BWGA 2Q8PA 3WG9A 3QPCA 2P90A 3O74A 4URHA 3KYBA 2JI4A 2RMKA 3VZSA 4J16C 1P2BA 2ZWVA 3DKPA 1OT5A 3SJZA 1N6OA 4JBGA 2E3JA 4O2AF 3ENNA 2HTEA 1ONBA 2QLJA 4UM9D 3VTKA 2J7PA 5KSOA 1GT6A 1DAOA 1G0OA 1UMBB 3F6SA 1TK2A 3R76A 1MT3A 2K4MA 3U7GA 1U6IA 1CUXA 2Z2ZA 4IQ0A 2II6A 4Q7LA 1GZ4A 5HHTA 1OX5A 3MSXA 2PRJA 1ZRSA 4XR9A 3JQFC 1KAEA 4HRXA 3PR2B 4BVFA 4CMBA 4MGIR 1W0JA 2B21A 3LUKA 3MWFA 3A1UA 3PB3A 1DX4A 4RQUA 3L0ZA 4ZPXA 3TCKA 1MP0A 1Y80A 3VZDA 3M6VA 1AMNA 3T1TA 3DDZX 4C2UA 4B84A 2VSYA 2JAHA 4JZYA 1RKBA 4Q48A 2I2AA 1LKZA 1H1LB 1Y7TA 4BAZA 5AH0A 1XDBA 3BC1A 4QOGA 1YK1A 2P69A 2RGWA 3LQQA 3RU2A 4D41A 1UUFA 2RC5A 3HBNA 4KO8A 4URZR 3EXHB 3DHEA 3KKZA 3MS2A 1QU3A 1FVOA 5JZVA 2C9CA 2JJ2A 3WJ1A 4KPEC 4B4WA 1O97C 2CNKA 2FKAA 3JATA 4TWIA 3KLOA 4W5WA 4BFXA 4F3NA 1PUIA 1HZZA 1YB7A 3C6ZA 1V8FA 4B3RB 4BIIA 4I9GA 1QM5A 2AI1A 3STYA 1TE2A 4LNAA 2ON6A 1EWYA 2LCQA 3QKWA 2ZIEA 5AI8A 5FH9A 3LYAA 3FUXA 1KI3A 1RWOA 1NNUA 3BGVA 2FMHA 5AJHA 4MQMA 3UPDA 4DA7A 2OXIA 1EGQA 3UBMA 4C2TA 1WW3A 3UKJA 1O9GA 2HWXA 5E9WA 5JNRA 4KQMA 1Z8FA 4G0NA 1B74A 3PHHA 3QEKA 4HY3A 1DXHA 1OCEA 3Q3GE 2F4NA 4GD3Q 4DM4A 4ZHQA 3AHHA 2A7XA 1XKXA 4YT2A 5B3AA 3HYLA 5K8VA 5KMGA 1VG9B 3G2OA 3M6FA 2Z5GA 3LKVA 2IYLD 4HPJB 4E51A 3ZNPA 1XTBA 4I8IA 2QVZX 1C9DB 2CUZA 1XZNA 4WNAB 3AVXA 4OJYA 1P19A 1YS7A 2Y2VA 3ELYA 2HIGA 1Q2XA 1LV7A 4PGAA 5IP5A 3Q9NA 5G1PA 2HQ1A 2O7NA 5CIYA 1JHXA 1VLHA 2Q1SA 2XWPA 4J2TA 5G2OA 1L7AA 1CRQA 3K0EA 4B3GA 3OE7D 3WDSA 5GADl 4YONB 2HNAA 1T0IA 2LUOA 4MEJA 2O0JA 4ZT4A 2UZ0A 3L0IB 1U4OA 2NZ2A 2ZAOA 5KX5A 1QDUA 4UARA 1NVTA 2WPDA 1FXSA 5TMPA 3MC1A 4OGKA 3DH0A 1A96A 3A1CA 1NBEA 1W44A 4QOEA 4OHFA 5AW9A 1CR1A 2O2SA 3A1TA 5BSRA 2FCAA 1B14A 5CT6A 4KOEC 4ERXA 5BWOA 1NX6A 5KHOC 4GT1A 4DV6B 3H8VA 4UCWA 3NHWA 3ORHA 3KELA 2C3MA 2H1HA 3EEQA 2HI0A 2IHKA 4XD7A 4TT3D 3KQKA 2C84A 5A9SB 3C6YA 4IH4A 2GBLA 1M8FA 2H18A 4XVHA 1KVUA 3WFZA 3UT6A 1TEZA 1VCNA 3PEFA 3SAJA 3JVEA 2X7HA 3VNVA 3PTAA 4EHAA 3I0ZA 4U7TB 1WBBA 1KYTA 2LVBA 3W5DA 1WSAA 4C30A 2QHXA 1EWRA 4ZYUA 3OT1A 1KEVA 1S3FA 1E7YA 3SC4A 1WB6A 4HATA 5WRFA 4I4TF 1NJ6A 4I2VA 1Q7EA 4Q7KA 4CMKA 3IOCA 1CJUC 1EWVA 2SICE 4G8DA 2W37A 3H1EA 4TT8A 2O20A 4PTYA 1TA0A 3PGLA 4AX8A 4CN9A 4XGRA 2R96A 3V4RA 4HDMB 4CLHA 1LK5A 1RKUA 2FB9A 3OJ0A 4MRMA 4LSGA 4Q3EA 3G88A 1NRXA 5GJWC 5FUQA 4NULA 2V5UA 4OLAA 4PSCA 2J48A 3W3ZB 4Y9RA 1TD9A 3CUTA 5B6JA 5KS2A 2B4YA 4K9QA 4CEJB 2ORYA 2I7DA 2GN2A 5EI5A 2ZSIA 3BXOA 3KLBA 3OH8A 3SIWA 4K6GA 3SVZA 3VISA 5C5DA 3UM9A 1E9SA 4CDMA 1Q19A 3RVPA 2VWPA 4HPWA 1E8NA 2BM1A 4DVGA 3H2ZA 2ZJZA 2PZMA 3O7WA 3Q7RA 2RI6A 1XZHA 2XNCA 3PDIA 3TTXA 4BVKA 5CXQA 3CPSA 2XCUA 5BQXA 3EY4A 4PC1A 1QANA 4DR7B 3CINA 5H7XA 4L9WA 5ARBA 5IVHA 1O95C 1D4AA 2MSLA 2FPIA 3HU2A 3KZCA 3U3ZA 3UWOA 4LZNA 5TX7A 2EG5A 3B6JA 1JG7A 3L18A 1VZ3A 1FNNA 2HD4A 5CM8B 4FINA 4XEHA 2J4CA 4N8SA 3AKZA 4IV8A 3DUFB 3IQZA 4HJXA 4UBMA 1TVEA 5CTAA 4YI3A 2OK7A 3BULA 3AV3A 3KOMA 3EMVA 2FK7A 4HTFB 4M7WA 1D2GA 4HAWA 1W4CA 4M0DA 5IUNC 3BMQA 2PMCA 2ZAYA 3FMFA 3GLVA 1XWIA 3KEMA 3KJGA 2QUJA 2RGAA 3L4SO 1GU7A 3SKXA 3B1VA 1V5EA 5IC5A 3OP4A 3F2VA 2GR7A 4REOA 4XGNA 5AI4A 1VECA 4YRJA 4DMCA 4BXOA 3I73A 2EZ8A 5F21A 1MEEA 3AJ8A 1E4EB 2QVGA 3GRPA 4EY8A 1JEDA 1G20B 3D8TA 3JRNA 4MWCA 3WTBA 1QRTA 1RYHA 4AECA 4C78A 4CM6A 4H6WA 2Y6UA 5J4LA 1N2CA 1POWA 1HO3A 1SA0B 2AMYA 3FYUA 1M2JA 2I1LA 1PZMA 3CIFA 5C51B 1XK7A 1W87A 3NJRA 5LOVF 3DDSA 1QQAA 3V9PA 1JLRA 3OZFA 5KYWA 3DAFA 4TLBA 4G37A 5KQMA 2LDXA 3K09C 1PR9A 2TECE 4RS3A 3B1XA 5JS1A 1V41E 4KSCA 3L0SA 2Q5QA 4RE6A 4MICA 2GOYA 2NXCA 1HLPA 1CUJA 2K2QB 5LXTF 3AFOA 4D0NA 5HS4A 1PR4A 2QSZA 3F73A 1RP1A 2HV9A 4R5MA 4M21A 3E7FA 1A9PA 2CLKB 2JAXA 4HPXB 1BGVA 1PU2A 1EYZA 2ASEA 2Z3WA 3ETDA 3R0JA 1K7SN 1XTIA 1D6MA 4GLJA 2J41A 3AM5A 3Q1KA 5H0IA 4BECA 2YXBA 3R7SA 1BCSB 4G2NA 4NEHB 3LTNC 3RBAA 1MAAA 4NYJQ 2CY0A 1JHUA 2I5PO 3ZX5A 2BMFA 3HLYA 4JENA 1KH2A 4FDLA 4UTVA 4DT1B 4JOQA 4GICA 3TRHA 4CLOB 3OLWA 5CJJA 1BKSB 4ESVA 1SKAA 2G6BA 3U4GA 4UW9A 3DZJA 2B1RA 1JFFA 2IOYA 4OQXA 2M1ZA 1R5JA 2AW3A 3QNUA 4OHCA 5I4IA 4U02A 3R7AA 1Z08A 3KP1A 5I6DA 1DIGA 1IN5A 2WVJA 5JSQA 3UBTA 1XTPA 3QKSB 3ZHOA 2VQDA 1I9GA 1T6BY 2D54A 1GOTA 4K9RA 2E5FA 5HFAA 1TJ3A 1TIPA 2PL1A 4HN4B 1J97A 4ZT5A 4ZGBA 4NR0A 4BEWA 1N4AA 3O1JC 2IH5A 3C97A 2IHVA 3BE4A 4DB4A 2BUBA 3PGMA 2VNAA 2YWBA 3N05A 4Q66C 1YONA 3PPVA 1I3OA 1PTJC 4JFRA 5AVUA 2H11A 3D7RA 3WLOA 1CY1A 1BXRB 2XY4A 3M4XA 3PGJA 3I12A 1E1DA 4O2BA 4RJJA 1CZKA 3JWIA 2PH1A 4YRKA 3DEIA 4GL4A 1G7RA 4UVEA 2G0AA 5FUYA 1DQPA 4DLXA 4MVYA 3HXQA 3LLSA 4RAOA 4HS9A 2ZUSA 4AJJA 1L7PA 4LVNA 1KYZA 1ENPA 1GEGA 1Y3IA 3DM5A 3UJBA 1SXIA 1ZXXA 2L19A 5FOXA 3I45A 4CMEA 4XSVA 2IHNA 3ER9A 1ZA2A 1ZM2A 2CWWA 1ACJA 1T4MA 2ZT7A 3EARA 3D0OA 3ZUPA 3L8MA 3UHJA 2YOGA 3G0HA 2XNDA 3OD5A 4HDCA 4AZ0B 3ZVKA 1NY5A 2GKOA 1NBOA 4KMOA 4WGGA 3ROFA 3FOFC 4CGYA 4CIYA 3KWLA 3IVGA 4S04A 3KL2A 2IHTA 4DSUA 4IS3A 2I2DA 1FSSA 3AEKA 3U3RA 2Z8XA 3ZTWA 1CIPA 1FUEA 3BGOS 2GFIA 2AF4C 2ZWPA 2W48A 4ZCLA 4G1BA 4QEKA 3MLAA 2XMSA 2ZBFA 3JALB 1E3WB 5COBA 3TLGB 4RMIA 1PGPA 1OI7A 3R7NA 2RGYA 1ACLA 3F0TA 5JU6A 4AMBA 1T3SA 2FZGA 4MQ5A 1ZNXA 4ZDWA 3S3TA 3UXEA 4YV1A 5FLKA 2VHTA 4FOSA 4BDSA 3HKBA 1UK9A 4FFDA 3H5WA 3KYDA 3OQOA 2I2WA 4YN3A 4UUBA 3QUTA 3MOSA 2QT9A 2GXQA 1D1SA 3U56A 3A31A 1NBWB 3D7NA 1MG5A 2PVCA 1E2MA 5TC4A 5AM1A 2JANA 2EX4A 2A1IA 3RK4A 1IJFA 2IPXA 3ZY5A 1NQWA 2Q5EA 4NC9A 3CB2A 1GPJA 2IWHA 1AO0A 2GN9A 1AQNA 3N28A 2PRKA 5FD8A 4JMPA 5JZ9A 2PNFA 2ONCA 3ESZA 3H9QA 1KQPA 4MVJI 1TK3A 3SBOA 1K1EA 1R3DA 3EVZA 4LF8B 3KPYA 2IZ6A 5L6MB 1N2HA 2Q5CA 3QE3A 3A1WA 4PX2A 4MRSA 3SVTA 2H1SA 2JFFA 3IQWA 3HCFA 3LT5A 3F3KA 4P7KA 3GQBB 1EUDA 3BERA 2DQZA 1N78A 3OZTA 1H1DA 1U2DC 5IW8A 5HIMA 1B6RA 3KFVA 3KQUA 1WHTB 3STWA 1NVVR 2Q46A 1R9MA 5J2TB 4RTLA 4EWLA 3WYAA 4RVGA 2QE6A 3L04A 4QYTA 3H1TA 5DW0A 3PE6A 3TQHA 2BHNA 2D1TA 3PXEA 4ILKA 2M2IA 1NRIA 3A4TA 5TPZD 3T7TA 1JAIA 1MQAA 3K4PA 3R6LA 4JXJA 3LT4A 5B5SA 1W8IA 2JATA 5TPWA 4TSRA 3WE7A 2H0RA 3CE9A 1DWQA 3WQSB 1JIUA 3F7MA 5HTKA 3UG7A 2R8PA 1XIVA 2NV2B 4X20A 2DGDA 4L0MA 2RH8A 4XDHA 4ZYXA 2E4UA 4FYVA 2JIMA 1X38A 1EK1A 4IILA 1PL7A 4QDOA 1KWKA 4UZSA 3V8NA 3P9PA 5LA6A 2J9XB 2KSQA 1NONA 2X5NA 3VMFA 4PO1A 1BFKA 4RK5A 4B3CA 2G3DA 3C3JA 3LA6A 4X71A 1YZHA 4ARZB 3D8RA 3ZQJA 2OBBA 3L7MA 5BRAA 2IS4A 1A4XA 1RMYA 5DE3A 4UTXA 1NR5A 4Y7DA 4KN9S 2ACEA 3S2IA 1VXOA 4HBZA 5GGYA 1ZBDA 4ZJZA 3SR3A 4OQMA 2GVDC 5AK5A 4JYZA 3RODA 1KI7A 4LDAA 4RD0A 3D7LA 4NAHA 4Q37A 2OO7A 3QVGA 4H1HA 5HIJA 3GPLA 4S1OA 2AZDA 3O3MB 2ERYA 5I7SA 5CNMA 4JODA 2J5RA 2P5YA 4D9IA 1L5SA 3QUSA 1P5ZB 1FPQA 1SVIA 4EHNA 3EZGA 3C0KA 5IANA 2F8SA 3RUHA 3DNFA 1CJMA 1YKGA 4OHZA 2BGWA 2ZP1A 3IPCA 1W5EA 3OZVA 4EGFA 3BH7A 3TZ6A 3ICWA 1F0KA 3M9WA 5JCJA 4ZAXA 4BQPA 2P9HA 1FFXA 3LWDA 3M2TA 5JE8A 1SCAA 1ETUA 4OQPA 4EYQA 2YXPX 2ZRIA 3AFNA 1ZWLA 3ILSA 3OPYB 4TROA 3E9YA 1I80A 1KK2A 2AKAB 1LX6A 1AQUA 2IYXA 4U5XA 1NYTA 3WMEA 4DANA 3DB2A 2D06A 4R9SA 3ZIAD 4Q4HB 5HDQA 3EVNA 3LCMA 2HJRA 1F14A 4LHXA 4BRSA 1XD8A 1X1TA 3VPDA 5HS6A 2HV8A 1XZBA 4S3MA 4YJFA 4ZEXA 3WIVA 2B36A 4UE2A 4YP5A 4ADSG 1LLCA 5ALWA 3ZD6A 1RAFA 1G18A 3IUYA 4J76A 4RSMA 2NO9A 1U0EA 1BO6A 1U6JA 1AKTA 2AJTA 2I2CA 2NOAA 2R5NA 3BQMB 4C7XA 3MTAA 2HNBA 3M5CA 1Q1AA 4UUQA 1MOQA 4D8TA 4RTPA 1EFCA 3T41A 5B3LA 2WIDA 1UBJS 2XCSB 4MUYA 4ZV9A 2C0CA 1H6CA 1NSTA 4ARVA 1VPWA 1PEYA 1F8GA 3AHFA 1WXXA 4YACA 1CNMA 2PJRA 3UJ7A 3HYSA 5AVSA 5KVSA 3EDCA 4C4YA 5FWXB 1QV9A 2ILTA 1T1JA 5IWAB 1I7SB 2XIJA 4JY7A 1R5OA 5EKXA 3C7KA 3VR3A 1XQXA 4ENPA 4IVQA 1XCLA 4AL4A 4AUEA 1EK5A 2IEYA 1AUOA 2Z57A 3WIUA 4C0WA 1U0HC 5IDYA 3V8PA 2PN1A 4UVHA 1K92A 2R8BA 4UCFA 4DS3A 1CIJA 5HNKA 1NNLA 1NLMA 3IUQA 4Q7EA 5D6NA 1OWLA 2I4LA 5EXTA 5LBTA 2G9UA 3LPLA 2YMPA 3DVQX 4KN5A 4B6SA 1A50B 3DNMA 3CCBA 1V8PA 3ILYA 4EX6A 1B0ZA 4B4UA 5D00A 2GK6A 4S0ZA 2O0MA 3C41J 4EG3A 5JEDA 4M8LA 1MORA 1JHVA 4G9BA 3BHIA 3GC6A 3KKQA 3K0FA 1VSTA 2Z83A 3V4SA 3IPAA 3I04A 4K9MA 4EPTA 4RKFA 3R41A 4RNCA 5AI6A 3D0KA 1U3WA 5KJ6A 3ADPA 3N8GA 4B17A 1XLVA 3RHFA 1BOFA 4DCNA 5HRCA 1EQ2A 1D1TA 5DI3A 5CBKA 3UW1A 4NU6A 1GL6A 2BGTA 3ANNA 4XCQA 2PKYX 3PXUA 3PG5A 3PEYA 5IJXA 4IW3B 4NMXB 1KE1A 1XT6A 2OCLA 1VMKA 2WWHA 2IYYA 1UBFA 3V1UA 2ODWA 3MAAC 2Q9CA 4J1SA 4JC5A 4UDOA 4A16A 4BVBA 4MUJA 2X42A 1ZISA 1TKBA 5A9TA 1A0OA 3LQYA 3M49A 1KZYC 3EWSA 3THOA 2R6DA 1BKYA 1JSZA 3Q1LA 5KJEA 2EDCA 2NO4A 4DXDA 4MVJH 4MWDA 3F46A 3ZBPA 4JP5A 4JB0A 1PJTA 4QUIA 5FV4A 1GUAA 3LLUA 3Q5GA 2G06A 2FPRA 1XKTA 1M6YA 2EIHA 5EIOA 1M1UA 2HGZA 1N5MA 4KN6A 5ARCA 3S2ZA 2PLFA 3CT4A 4EAQA 3RG8A 4G07A 5KYXA 3TIXB 3PICA 3PQFA 3RYCB 3DTTA 5T64A 3PX2A 3SP1A 3IOYA 2RB4A 2J09A 1A2KC 2C97A 3HBLA 2X8AA 2G9NA 4FBGA 1UPBA 4MUNA 2DFTA 4DIUA 2PLAA 2GLTA 2WJIA 2XUAA 4JI4B 1U81A 2BFMA 3BHMA 4NECA 2GTPA 4E7PA 3MUEA 5LZ5A 3A6JA 3JZFA 3DFFA 4I99A 1DPFA 4FYIA 1JX6A 4MUGA 3S44A 1D2MA 3P4YA 4PCLA 8LDHA 1Z7WA 1Z6ZA 4QQKA 4C0LA 3S2UA 4PHFA 3QVSA 4Z53A 1Z37A 5FL7D 2C8VA 3TOZA 1YOBA 1GNTA 1IATA 4W5JA 1G41A 4LXHA 3RVKA 1N9ZA 1ULTA 4JP2A 3MD0A 2XNJA 2OZEA 2RGGA 3A4MA 2TMYA 4D26A 3F74A 2W8BB 4II3A 1A2OA 5CX1A 4IQ8A 3A36A 2XNHA 3NUZA 1R4NB 1RI1A 1N5KA 4J07A 4XFDA 4L7VA 1D2AA 1A3CA 1D9XA 2QD1A 4GPEA 4MKGA 1YKFA 4OA5A 1GARA 4OL9A 4OSEA 3VH2A 2RAFA 1U3DA 1ESCA 4L0CA 2WU4A 3TNLA 3WZMA 5BUQA 5EJ9A 4UXJA 2YVLA 3KJIA 1Q15A 3RTGA 3OQVA 2VTEA 4KGXA 1WQ3A 2E5LB 3ILHA 2BEVA 3EUWA 4TSFA 5IMSA 3EPHA 2E49A 5T4HA 1CBUA 1Z5PA 4HWOA 5EVCA 1VCHA 2YOHA 3LUFA 3ORYA 4N12A 5JDCC 1ZGCA 2XGOA 4MQFA 5K20A 1WKVA 3LBNA 2DT5A 2R8OA 3HU1A 1Z63A 4YRBA 2QT0A 5EXPA 3Q7SA 3D4IA 1Z47A 2OM2A 5FBHA 1QO9A 3PV0A 3FNQA 2QIPA 5IHXA 2VR1A 1FRFS 2A7QA 2ZYDA 4LV6A 5C1IA 1K66A 3EG9B 1J8MF 3GNLA 4ZD6A 4TV9F 2W2NA 4U7GA 5DNAA 3T9EA 5IX8A 3NG1A 5KQGA 5LSAA 2QMUA 3GFSA 4DE5A 1NJ2A 4JUCA 4QUAA 4HGQA 5FHQA 3T0GA 5JEEA 3O4VA 1H05A 1M1YE 4C5CA 2WPNA 1B43A 2WBLC 5F7ZA 3UK0A 1CX9B 4ITVA 3RVBA 1CJCA 5LP6F 1S8FA 3KLMX 1XALA 5LP1A 1U2TA 2PS9A 4L4RA 4ALJA 5K4AA 3VU0A 1E8DA 1O3YA 4LFCB 2BSAA 3H7IA 1M74A 3WGUA 3BKWA 9LDTA 2CXHA 2GUGA 2VBFA 4CR8A 2IXAA 1PUXA 4OBEA 5HF9A 3NNDA 5LYJF 4BDTA 4DJDC 1HFEL 2NX2A 3BHNA 4IHJB 4US0R 3KTOA 3M4JA 5JECA 3EAQA 3IKJA 2AR0A 2EFDB 4MB2A 5JMPA 4BMPB 2F1OA 3O1IC 5D3MB 3KXIA 3NOQA 3GLHE 3ZWKA 1BCRB 4BV2A 4BP9A 4UQLA 2PXAA 1SO8A 1VKZA 4U5QA 3T4UA 1Z2CA 2IXBA 2ILVA 2O3TA 3N2ZB 4QRIA 5G2FA 4JEHA 4OMFG 4F3KA 2IZ5A 5GV8A 3DHVA 2DH6A 3SLRA 2WV7A 4DSAA 1FDRA 2VBGA 1YBHA 4LBWA 1SZPA 4FGSA 3A0UA 1IY9A 4ALKA 4JV5B 1QV6A 3RYIB 2BC9A 4R9UC 2Q3EA 3IP1A 4LDZA 2NUPB 2H51A 2VT2A 4JEIA 5B37A 3NBMA 1OXKB 4I8DA 5F1YA 1P0MA 2ZRPA 5TT1A 1W52X 5HW0A 3OJWA 4RHYA 2FDCA 4FN4A 3KZKA 3IUBA 3K5PA 4B6JA 1CP3A 3G8AA 4MV5A 4RK0A 4OHVA 1L4UA 1OASA 1O97D 1PJRA 2YS6A 3A9WA 2FPUA 3HY4A 4LIPD 3RS8A 4ER5A 4EG4A 3G3EA 2PX5A 2ZI9A 3PZBA 2FK8A 1UPUA 3HCWA 3OLVA 3CW8X 3MJSA 3QVTA 4TRJA 5J40A 4RVNA 4RF2A 3C3CA 1YF3A 2C5FA 3V4OA 3JYNA 1AA6A 2FSIA 1W6UA 4O1MA 1CY4A 1MN6A 1NYRA 2NM0A 3OQ6A 3FGPA 3L8HA 4O8ZA 3FFBA 4V0MA 2QYHA 2W2TA 5BRNA 4DOMA 4RTQA 3NBZC 5L3VA 3H9GA 4LGCA 1JTFA 4D9BA 5JARA 3CEMA 3HVJA 4QJBA 2Y71A 3WFJA 3HA5A 4B7CA 3OQBA 7REQA 4AQYB 3ORFA 3G1TA 1JIVA 4AX4A 5C7IO 1ZM3A 3GWGA 2CCJA 3S7TA 1FS4A 1HDXA 5BN1A 3AF4A 4LXTA 1QJ4A 2H2AA 2C5HA 4MYSA 4CLDA 1CFJA 4L8GA 4LTDA 1J0XO 1UT6A 2B92A 4M0EA 3R3HA 5DRTA 3PVSA 2GA9A 1X77A 1NYQA 1Z45A 4ZVPA 1B0PA 1YQUA 3P9RA 4HGYA 5K0BA 5LZ4A 1RCFA 2QX9A 3DT8A 5JUWA 3IAXA 1C1DB 1SU7A 1Z7EA 1G66A 5DBHX 4D4JA 2HK7A 3Q2KA 4HNSA 5JAUA 3KEFA 3DAYA 3HXKA 3M1AA 1PLJA 4Q1DA 4KO4S 3UY4A 2EV9A 3E48A 3JZMA 3OKPA 4IFTA 1NHGA 2AC7A 1Z3IX 5DASA 2E4ZA 2P9FA 4YMUA 2LBPA 1G59A 2X8LA 3P45A 4MV3A 2UUPA 1R6VA 1Y9EA 3DV2A 5IYZA 5FT9A 2FW8A 1PWHA 4DXHA 4YV2A 2YVUA 1BE8A 1PKXA 3ABOB 5EE1A 1VKNA 2C96A 1C8BA 4XQCA 2JGNA 5CX4A 3WK7A 4RUKA 1TDJA 4FYJA 4RDHA 4YMLA 1ZH2A 1KQFA 4F4JA 4YDQA 5KC8A 1C0PA 4LW8A 4K9SA 3T5MA 4FFBB 4J0QA 1MPXA 1RW4A 3G9QA 3LECA 3QYFA 4GH5A 2JI6A 3JAWA 4HDQB 4LOHA 1L6IA 4RVHA 3HJTA 4Z0HO 1VYUA 4EG1A 4Q4JA 4DCPA 4LXXA 4Q3BA 1U0SY 1VGVA 1J24A 2PJDA 5AMXA 2O6LA 2IZ0A 4O8CA 4CDRA 3W9YA 2H5LA 1EM8B 3I2FA 3CKLA 1C9NA 1HBJA 1XU4A 3EFOB 3UT5B 5FB3A 4YMGA 4DCVA 3GLKA 4MYDA 2WZQA 3FYSA 3X2SA 3TM4A 4P58A 3RHSA 5HF8A 1R0KA 1C5KA 5AOAA 3AM4A 3D43A 3MCAA 3ROQA 1KI6B 3D3JA 1EU1A 1Z62A 2Q9AA 5EHQA 4F1WA 1JQJC 2WMOB 1PWEA 3BJZA 3PF9A 2Q9UA 1SVKA 1Q50A 4H3HB 3S5JA 1DKNA 3FMVA 3P5BA 4GBJA 1ZM4A 2HKIA 4JOBA 1Z0ZA 1UPAA 1V3QE 2J7KA 4CKEB 4LS3A 1JDBC 3Q7TA 3EBPA 3HM9A 2REXB 3KK0A 2DEUA 4R7ZA 3H19A 4HH0A 3JAKB 1P80A 1KAGA 3I9LA 4R51A 1MJGA 5AW1A 2F3UA 2P62A 2Z04A 3IYLW 2Q3DA 3BDVA 2WWTA 2XUDA 3O92A 4JLUA 4QAQA 4AMGA 1UCFA 1O95D 3UENA 3Q0EA 4AW9A 1RBZA 1SBIA 2Q4EA 3TWOA 1L4BA 2IF2A 5C35A 1E32A 4ZQBA 3J81k 3FVWA 3GLQA 4H59A 3RTAA 1UDBA 3GP5A 2X1LA 3OUUA 4PC6A 5IDQA 5DB4A 4EB6B 1IRIA 3HG7A 1LVHA 3ME5A 1Z8NA 3VGPA 1UBHS 4IXWA 3TXXA 4JMLA 2P2NA 1U0FA 2ATCA 4QZVA 1NMXA 2AEJA 1T2VA 4RSGA 4I08A 3O4GA 4DN6A 2X4LA 1Q91A 5EXDA 3N76A 4B2LA 4BFUA 4LBVA 1G60A 4BO4A 5CCEA 2CE7A 2I55A 3HKDB 2AJCA 1Z4JA 2CL0X 4E5YA 2B7LA 1K6IA 2EYUA 3AC0A 1ISFA 1RYEA 2QMQA 2MT9A 5EZQA 1KZ6A 1NW8A 3INYA 1JIIA 1D6JA 5CVTA 1ZAYA 2DFLA 4DYVA 1DV1A 1DTWB 1ZIOA 5AM3A 2QI9C 4PSDA 1TZBA 2ZJ3A 3T9DA 1ZN9A 3O3CA 3VR6A 2RGRA 2Y92A 1E18A 3EXG2 5AOCA 4ZGWA 1B8UA 3NV7A 3PQCA 2C92A 2Z9CA 2OBNA 3NJ4A 2P9QA 4RDCA 4KWTA 5A71A 3AL3A 5G40A 1LF0A 3RSHA 1FFBA 1RM3A 4PYOA 1GAWA 3N0RA 3ZZ1A 2SNIE 3L1JA 2EQ5A 5J9FA 1C7ZA 4X00A 1QVZA 4XTRA 1U28A 4O4LF 1QUEA 4V3CA 2GAIA 3IE1A 1NPDA 1VSBA 4D7AA 2DFDA 1EVZA 2VSOA 3M70A 4FCCA 2CLHB 4HXFB 4C6TB 3FWPA 4RD4A 3PQDA 4M55A 2IV2X 3VOSA 4BUJA 4DR2B 2KI5A 1CIVA 4MSUA 5IU6A 2YHIA 3W9BA 3K72B 4LJRA 2WVAA 3EY9A 4DTCA 4RVDA 2O2JA 1KFEB 2DM6A 1Q5PA 1A1VA 1T4CB 4XWOA 3P8ZA 3SM3A 3N8HA 3SF8B 5B1EA 3WYDA 3EMOA 2G08A 1N8SA 2PWZA 4AO8A 2XVZA 5ANRB 3VR5D 2IHYA 4JU8A 4XSGA 4QHYA 8ATCA 3I34X 3JZIA 5DZSA 1U7UA 1ZXLA 4OXNA 3TRIA 3KBBA 4XGIA 3UZUA 3BGDA 2GJ4A 3GBPA 1D2HA 5E7MA 4EPYA 4FGKA 2H4WA 4UDYX 5E0KB 3AI3A 3F71A 3X1WA 3X3HA 4F2PA 3IEVA 5LLSA 3T3EA 2G4CA 2G4VA 2PX6A 3VVCA 4AT1A 4I9HA 1VGQA 3ZHRA 4BKUA 3PD0A 3FWYA 3QPUA 2NTNA 3QUCA 4RK4A 3HCNA 4UNIA 3QXJA 3A6LA 2B6HA 3LQ4A 1A97A 1OZ0A 3O47A 3HCEA 4JJ7A 4KCGA 4BVGA 2ZIWB 1AO3A 3F67A 1V9SA 2TMDA 1V43A 2H2WA 3BRQA 4O4JB 3TOVA 4LTNA 3KIPA 3C39A 1TM5E 4C7OA 2CUNA 2O8DB 2Q2QA 5GJBA 3E22B 4RCVA 3SYKA 4ZQIA 1W46A 2O52A 2Z0MA 5EP4A 4E13A 5KTTA 2OP1A 1CVLA 4TV8F 4K40A 1VL2A 3MK31 1KF0A 2QU8A 1Y8QA 4XZ3A 3DO8A 2X4IA 2VEOA 3BRWA 1U1EA 2O2EA 3DMTA 2WMDA 5EXXA 2KJQA 3KOUA 1UP6A 3LWZA 4LQDA 1PVVA 1I9CA 3LH5A 4R41A 5BSVA 1X0XA 5AXDA 2FXIA 1E7SA 1A9TA 4HNAA 3IMFA 4B7UA 5KEIA 4JB3A 4MS4B 2ECFA 4E11A 1JH9A 3T1YB 9MHTA 1IVSA 2QM0A 4JUAA 4MV8A 4HYQA 3SDZA 3ZE9A 4POOA 5KTSA 3OP1A 1X1BA 4HLDA 3ZXUB 4JYAB 2YHBA 2OGSA 2VH1A 1OOEA 1PJBA 3UXHA 4MOWA 4PBTA 1UT8A 3WK6A 3E4CA 4ZICA 3GJYA 5CR9A 3WBFA 2A59A 1YQ9A 5FPHA 1NI4B 4BMCA 1K7EB 1XTVA 5JVDF 4EJSA 3L8ZA 2F64A 4MA4A 3I5UA 4PAWA 2PLNA 2AOUB 4MMYB 1ODTC 3F5MA 5BYAA 1XQWA 5K05A 4HNGA 2XOKD 1A98A 1ZK0A 1GPUA 1KO8A 3DF9A 3FIJA 3G9XA 1AKVA 3OJOA 1H1TA 2O5RA 4JP3A 4K1LA 3SJUA 3V9AA 5I3CA 3WGJA 3TGWA 4BKRA 1JQAA 1OKKD 1UAGA 1IQUA 1NM5A 4J1TA 3IBTA 3B7WA 5EWLB 1TZJA 1ZK1A 3T1NA 4EVQA 3AU9A 3HXMA 1OB5A 1FUYB 2SBTA 2G82A 4BQFA 1HT2E 3SR0A 3H9JA 3ODPA 4UE3S 1T0HB 4KH1A 3V2UA 1IEVA 1MXHA 1VI5A 4JBLA 3SZUA 4AN4A 4OOFA 3BICA 3AEQB 4FJ2A 5ALGA 1W7AA 1GNRA 1ZVVA 2IBMA 2B98A 4PYRA 4QSMA 4TYQA 1GDTA 2JBAB 1BS1A 4P93A 2QJOA 4QLAA 1NVEA 4RU1A 3NEPX 5BWMA 2BMEA 2QNIA 4ZRDA 1LVGA 2JFQA 3LE8A 3FSRA 2V3CC 3I30X 5ECWA 1T8PA 3SR4A 2ECOA 2Q1WA 5DX0A 3I23A 1AS0A 2XQJA 3R5XA 2BHTA 2ENUA 1YT5A 2FHPA 1L9XA 2FEOA 3FDIA 3FNEA 2JFOA 3PUYA 4FDAA 4GNRA 5AM0A 4P6VF 3SICE 1OU4A 2OG1A 4NFHA 5KCZA 5IAKA 1M75A 4BGEA 3GLIA 3HVRA 4L73A 2IYPA 2Z3ZA 3KC2A 3X1ZA 1XU7A 1TQ8A 2B82A 2FRXA 2OO5C 3CKKA 4FSHA 5E6UB 4ERNA 3G9TA 4IRUB 1NXXA 3N2GA 4MEAA 2ZKIA 4GC9A 9ATCA 1ODSA 3O5AA 2J9ZB 2D2XA 4OHPA 2GWHA 3HXLA 2CHEA 4TMWA 4B85A 4DCCA 3IRVA 2NZXA 2JHPA 4S0XA 2ZBEA 2CBGA 3A6HA 4G0ZA 4X85A 5SV2A 4BQEA 4GAEA 3HBMA 1M6VB 1YNOA 1CUSA 2XTJA 1Z5ZA 2PKRA 1N7GA 4KUHA 4M9CA 3AR5A 3M3HA 2B6NA 1NVKA 2EJBA 5FYDA 1VA4A 3QW2A 1UXOA 1CUBA 1HE3A 1AGYA 1CK4A 1RM5A 1HY3A 1LRLA 5FLYA 1VIAA 5I48A 1NMQA 1OFHA 2IW1A 4IXMA 2ZZNA 4ETNA 1WE2A 3DXZA 2EIXA 3TR0A 5L4SA 3AEUB 2W2VA 3AR3A 4OP1A 1V9LA 4MRAA 3PGKA 4R8KA 4IIGA 1I8TA 3DBVO 4KWEA 3EMKA 4GR9A 4L74A 1AB5A 1VGRA 2WT4A 1CUCA 3D5TA 4FDMA 4GM0A 2RJNA 2WOJA 3IEUA 3OMWA 4PPYA 1TPYA 3ZPXA 1LI7A 1UC4B 3HCAA 3WL7A 1QGUA 1KK3A 1N3IA 2GN0A 2OOKA 1E60A 4LZPA 2WFMA 3E3AA 3PC3A 4QU5A 3ZU5A 1HQDA 4DDTA 1ESEA 2VTVA 2LD4A 2NSJA 1XRMA 2GNOA 3NM4A 4RVUA 4QTZA 2FVXA 4ZMBA 1QPGA 1L1QA 1ORIA 3KSZO 3RV4A 4XKJA 1TJNA 1ODIA 3VC3A 2ZLBA 3R5HA 1KMMA 1TTPB 3ONNA 4P3YA 5KWVA 5GJVC 2WHXA 3RIHA 1JHPA 3SQOA 4FKBA 4S1VA 4UFNA 1JI3A 4Y2YA 2OBYA 4X61A 5ENVA 3T54A 3UFXB 3WB1A 3SNKA 4LHWA 3BGWA 3TD6A 4LJ7A 1NATA 4UMVA 1LLDA 4EY5A 5T67A 2HAEA 2H3HA 4MV1A 3U49A 3UEOA 3W2FA 2EJVA 1ZD2P 3OX1A 4IZIA 1VOTA 4CUKA 2Q2VA 4R68A 2VSQA 3UC5A 2YQ4A 1VI2A 3K0KA 16PKA 3HGMA 1G1MA 2PV7A 1XJ0A 3LIPA 4YWJA 5AVWA 5M29A 2QGFA 1U2ZA 3DBRB 4NV1A 4PN7A 3FKQA 2C78A 5B7PA 1D3AA 3ZE8A 1ZI9A 3K6SB 1YQDA 4JCOA 4EPVA 4A8JA 2WSSA 4IVRA 1J2EA 1WUIS 2BP7A 1PT5A 3OPXA 3O2SB 1XVLA 3MT8A 3QF4A 1L4NA 1XZIA 4U6QA 2F43A 3E9ZA 4XWGA 4EA6A 1RZ3A 3PYMA 1YDHA 4EGJA 4ZHQF 4MDFA 3R1IA 4FQ5A 4Y98A 3ZLUA 3RCBA 2PJUA 1JEOA 1SCUB 1AK2A 2HCTA 2WG1A 1XQ9A 5UKDA 3U17A 5ERYA 3OEED 4LWPA 1RXUA 1YSCA 2PBZA 1DJOA 1E1RD 2XNKA 2N46A 5EMJA 2OSVA 2AG5A 3A25A 2P7HA 2AXEA 5E3JA 1PWXA 3W8FA 3DAPA 4I55A 3HGQA 1G64A 4QOHA 4PPFA 3NALA 4YCCA 3QTBA 4B0PA 3G5LA 3N86A 5L53A 2GVNA 1KAQA 3WS7A 1ZSVA 5LB4A 5JCOA 3RE1A 1CUYA 1UWCA 2Q4DA 1JZSA 2EATA 1B8VA 3KPWA 4TQAA 4M1OA 5F5XA 3S1AB 1JXAA 1X42A 4CF5A 1MO6A 4OATA 5DCLA 5EE0A 3S8MA 2C04A 3ND8A 5JATA 4MUMA 5KX5F 2NSHA 2OAEA 1TMKA 4XIYA 1ZH6A 4MKRA 2R7LA 4D3YA 1P72A 4XE5A 3O4FA 3M82A 4AVYA 5HE9A 2QTLA 1QO0A 1BMFD 1JG4A 2G1UA 2UZ3A 4KAJA 4RIHA 4ZT2A 3PNYA 2ZSFA 3EEYA 1GPLA 1XTUA 4YYEA 4EGQA 1ML4A 3FOZA 1CQWA 4FJ1A 3KCNA 1QYDA 3LUCA 2ZUTA 3PPWA 3GEIA 5FF9A 5TMBA 2EF1A 3OIYA 1L7DA 3RYFB 4G0WA 2IECA 1FTGA 1R37A 4CM4B 4RMGA 5CEEA 1I0LA 1GPWB 5EWJA 2Y1CA 4M88A 2VN8A 1N7JA 4IGKA 2XZOA 4IDHA 1VE3A 3FJOA 3VYTB 5MFPA 2WHQA 4TKUA 1LNQA 3W3AA 1KZ9A 3VV3A 4ZZ3A 2QN2A 1TYZA 4PPNA 5AHWA 5TQ2B 5BQPA 4EL0A 3GFTA 3SLGA 4FLMA 5KDDA 4IDAA 2HY7A 4FHEA 4PG5A 2RBEA 3WLFA 2FR1A 1XYVA 4D9HA 1J2UA 2X1MA 3MTEA 5IBCA 3R5KA 2RGCA 1BXKA 3JARA 1Q7TA 3R8CA 5KYKA 2DLCX 4J90A 2V7QD 2XMBA 2BHLA 3K0CC 5ITWA 1B41A 5AW4A 2WE8A 1AKNA 4N5LA 4RK1A 1F0YA 4BRZA 2H9AA 3LGAA 5K0JA 4HWPA 3E9NA 2OUKA 2ACKA 5DGDA 3SZ3A 1C50A 2OC4A 1RXSA 1MHPA 3CX8A 2V7EA 5E9QA 1XL0A 4UREA 2WP8J 2VOJA 3WL6A 3I9MA 1G2PA 1G3QA 1C7FA 1CFZA 1TCAA 4G1MB 4TTPA 3TZQA 2Q0QA 4HH4A 3IEXA 1SELA 4ZEMA 4S12A 1LF5A 4TS9A 2QX4A 4MUFA 2ISQA 4E5NA 2OFWA 3QU9A 2BPOA 4U2CA 2FMFA 2QRPA 1CRPA 4MCJA 1JAHA 3HP4A 4KN8A 3A04A 5MFZA 1H2EA 3MIZA 2H3EA 4C7BA 3KUDA 4IUYA 4KYUA 1Q7RA 4WECA 4WKPA 1RJEA 3GW8A 2PBRA 4U0JA 4X3PA 1XLTC 1ZAKA 2K2WA 2QAGC 2GLXA 4WKOA 2VCEA 3HR8A 2BIFA 4GOXA 4N82A 1G9XA 4OFWA 5EOVA 1EWQA 5JG7A 5BW0B 1E1QA 1GL7A 1RWWA 2IS2A 2ZIXB 1W85A 3C4JA 1QG6A 3TTSA 5ITZB 3GROA 1VI6A 3LC0A 2PWBA 5ED0A 3GPBA 5I9TA 1T2AA 2J08A 1FTSA 3KTFA 4XLZA 1DFHA 1D1PA 2BFPA 2J3QA 2PS0A 3NM5A 4S1PA 5IM5A 5ILQA 2YNMA 1JTEA 5LBUA 1ULAA 5CA0A 3NWBA 3TJMA 3VJLA 1KETA 1UFOA 4LI0A 1J90A 4V0QA 5K6TA 1L7XA 4C3ZA 2XKAA 5EZYB 3UB4A 1XQ1A 4ZAYA 4B73A 1MENA 5THXA 5A3RA 1FQJA 1Z29A 4WLOA 4XFKA 3LLMA 2VC2B 1RCUA 1XRPA 4IJKA 3CLRC 4RD6A 5IVPA 1QKJA 3UHAA 3H9EO 3KG2A 1IOZA 2Q0HA 2PRSA 3D31A 2HSJA 1QQ5A 2X4GA 3JYHA 1L0BA 3IHKA 3VDQA 4YCLA 1RSZA 1Q3TA 1TGYA 1IC6A 2ETXA 3O95A 2C4KA 5LLTA 3LT0A 2D1SA 5EXSA 3T3PB 5U4XA 2YWJA 1UM9B 4PWZA 3T9FA 3L6BA 3PNPA 1AKRA 4RYLA 1ZMXA 3ILVA 1U3TA 4MHTA 3QUAA 2C4VA 4JIMA 1XL1A 2HZBA 4KTVE 5BT8A 1GNQA 4XIIA 2O0KA 1QK3A 1LFAA 2H4ZA 5ALQA 2NQTA 4FW8A 5FA8A 2X2PA 1Y7IA 2ACVA 5CM2Z 2HH9A 2FTKE 2ET6A 2HU8A 4F5ZA 2H4HA 2NZUG 1R16A 2GR8A 3D8UA 1XRLA 4EH1A 4KE6A 2NPFA 1YJ8A 5L51A 3DZKA 2I03A 1RTTA 5BW8A 1HR0B 1DARA 4PE5B 3QJYA 5BT9A 4OIMA 4D3ZA 3HMKA 4FMDB 1B42A 1DG3A 3DWEX 3UJ6A 2FI1A 3AVOA 3RHZA 1MF7A 1NFRA 3EWNA 3EIFA 4PINA 1DX6A 1UL1X 3MILA 4QXRA 4BNMA 1U8XX 5IABA 4ESEA 4C0JA 2Y8EA 2P9JA 3ZOZA 2RAUA 1CJSA 3B82A 1SBTA 1P4SA 1ZICA 2JGEA 1ZEMA 4QXMA 3IBCA 4NQZA 3ZD8A 4BLVA 5IVKA 4CL2A 5BW4A 5DJ5A 2GBFA 4DQUA 1WVIA 5KYUB 3SLKA 1CUIA 2ZBVA 5EUMA 2VNIA 5JJBA 3CVWA 4H6PA 1NYLA 1NASA 5DBIA 4BQOA 4RXMA 2CV0A 4WZBB 5IKOA 3LDUA 3AB8A 4O2BF 2YWXA 3GF4A 5DTIA 3S5UA 2XH8A 4C0SA 4JI7B 3DOJA 2HN9A 2C4WA 2WFZA 2ZKLA 4TYMA 3ZGOA 2V5VA 2QE7A 3EXFB 4ITUA 4ZCTA 5L6LB 3ABZA 3E8MA 2LP4Y 2X41A 1DQZA 3DWGA 2XXBA 4EQ6A 4QVGA 4WKGA 3I8SA 1YCGA 1GQSA 4ACAA 2N47A 3T38A 4Q9DA 2XI4A 2IEGA 5FOWA 3Q9UA 2I67A 3MWGA 4OIFA 5IAEA 3H99A 4MVCA 2IU0A 4IIBA 3D3WA 4NDAA 3PSHA 3N74A 4GMXA 1JDJA 4PCVA 3AJEA 4BMVA 1SCJA 1TJYA 1ZESA 3VI4B 1YZNA 2FU5C 3E8XA 5DSTA 2ZULA 4IUDS 4PIMA 4HGOA 2HSDA 4CV3A 3A6GA 2OV2A 5CIWA 1EP9A 2I9PA 1CUHA 5EP3A 1L5MA 1TMYA 3D8BA 2XXAA 1E2LA 1XUOA 4U9HS 1YQQA 4A7PA 1V1JA 3KHKA 2AFHE 1MV8A 4M54A 4RH0A 1IEXA 3WHKA 4KAFA 2I9KA 1KMIY 1OVMA 4HQLA 1N0VC 5JBIA 1T2EA 1HL7A 2O2GA 4G1CA 1XTSA 1O1YA 1TT5A 3GZNA 2CN1A 3I01A 4CYMA 2QP3A 2G77B 3PJDA 1E94E 1JVSA 3G13A 1YRWA 1VBFA 3BMNB 3KUKA 3QG1A 4DR4B 5ALZA 3L4BC 5I7WA 2XX3A 4JHXA 2QD4A 3NHYA 1EWTA 1YC5A 1TD1A 3O1HB 3OKAA 1D9ZA 2XF2A 1EFRA 1KR5A 4HMPA 3OICA 2MIIA 1FBTA 4JWKA 5CJPA 4BYMA 1T5LA 5K99A 1DCFA 2JW5A 3JD3A 4PGHA 4DMUB 1HEIA 1P0IA 1O87A 3UMCA 2E1PA 1DDGA 2IKSA 2JHFA 4HP8A 3OE4A 1GUBA 4DBZA 5E7QA 3SN6A 4M37A 5JTTA 2SECE 1JDBB 4HDAA 4M0FA 5BR8B 1VLQA 3DVAB 2JEOA 3ULKA 3N2YA 4F8EA 1O7JA 5LD2B 5HTOA 1MRSA 2GCOA 1K8XB 4IWXA 3UWSA 2SCUA 2N1BA 3GPCA 5DKFA 2G25A 3K1YA 3DOUA 3ZV4A 3OY2A 4OQEA 3RC9A 3ZGLA 1JILA 1H9AA 5G02A 3AG6A 4NFLA 4D6YA 3A2LA 1SIWA 3A9CA 2J45A 2ZJ5A 2MMCA 4MWOA 4Q24A 3RUFA 3GGGA 4LKRA 1O03A 4WZAE 5IULC 2MU1A 5CNJA 4PANA 1HNXB 1PP4A 1Z4PX 2RHHA 5BR4A 4GQAA 2J6IA 1NLZA 3B70A 3QWAA 4F12A 1I0ZA 2ZCUA 4UTOA 3RIXA 2ONZA 2NZYA 2QQFA 3HRHA 3PQ6A 4P31A 1WW8A 1FNDA 2ERCA 1FPMA 2VRCD 3AK4A 1FDIA 1W25A 3RRJA 4CRWB 5I51A 1R88A 4J4HA 3C6XA 1O94C 4JH0A 4BU0A 1N34B 3WA6A 1V5WA 2NXNA 2VSNA 3MHPA 4MW1A 5JTUA 2GJ8A 1GFWA 5LA6F 4KQJA 4TTJA 2XUOA 1I30A 1OXVA 4XYEA 1S96A 4EI2A 4YHHB 3D5QA 1DEAA 4MO9A 3TF5A 2J0QA 1QHEA 1NGSA 2O8EB 1HDYA 2BGMA 3AT1A 3GAZA 3L4EA 2BT4A 1ISHA 1OIXA 3ESQA 4LJ6A 4PZCA 5AXAA 5EWMA 4F4DA 1B0AA 4R9RA 1O6ZA 2Y1FA 1AQLA 4EECA 1KDPA 2QGNA 4POAA 2X8BA 3NC1C 1AUXA 1W0JD 4FHZA 1YJXA 4CQNA 3A26A 5HMMA 1H9CA 4C0BA 2VP3A 1H42A 2ZZMA 3NBAA 2ZROA 5C2JB 1PW7A 4LNUB 1NR7A 1HYBA 5EC8A 4G89A 2C2XA 4Z4FA 3CFIA 1EIZA 1TQDA 3A14A 4F9GA 2C5GA 3W3AH 3GO4A 1UPTA 4EMBA 4LVUA 3BQ9A 3RYHB 2EP5A 1RYFA 3FOEC 5ALHA 1RRCA 2Z8YM 3HJGA 1ZGAA 3WBKA 3FG9A 4HD8A 4AKTA 4I4CA 3FLEA 1N33B 1SKBA 1ZJ5A 2ZETA 1SQ6A 3S2GA 4S1TA 4QBIA 1CEYA 3EK2A 4R0VA 4M8SA 1O89A 3F3SA 3KKNA 1UINA 2YFYA 4CTKA 4CT4B 2D8MA 3UB2A 1HWYA 3FBGA 1XXHA 3RRXA 2V6FA 7AT1A 4INPA 4LDPA 1DIBA 4NYIR 5T3YA 4EI7A 3CBQA 1L1EA 3KHSA 4O4IB 4KL8S 3STXA 4O4HB 4JVLA 2IXEA 3K2BA 1SIOA 2J5BA 2X7JA 3AUFA 4JSYA 4PSUA 3JWGA 4Q18A 4ZO4A 1VKOA 2K7ZA 2QUIA 4DYDA 4KQ1A 4KRFA 1B2LA 1Y9DA 1O58A 2FSHA 1J8VA 1RVV1 1D5WA 1B2RA 1GCOA 1HYHA 2I8CA 4OGGA 5L95A 3N6XA 5IBPA 1A72A 1XJQA 2EW1A 3BA1A 3IB3A 3OM0A 3Q6NA 2O8CA 1I36A 4XR4A 1W75A 5JDIA 2WJ6A 2QPTA 2F9LA 2NXWA 2EGHA 3RSLA 1CQPA 2YFKA 1BSVA 3FSEA 2HJHA 4KO3S 4P0PB 4DV4B 1OTYA 3CHYA 1CUGA 3KFXA 3PNLA 4H1VA 4F7DA 2J9YB 2ZATA 5GONB 2AYYA 3N0TA 5B2FA 1ZN7A 4TWBA 2UYOA 1O96B 4XYBA 4WVFA 5DCYA 4OEHA 3IIMA 4F21A 4FI3C 1FYVA 2BCGY 2IKQA 3QU2A 2LR0A 1ZUIA 3GFQA 3WRYA 2DUWA 1EIWA 1E77A 2GRUA 1I2MA 1CD5A 3LNTA 1J2JA 4NMWA 3TSCA 2CXUA 2IYTA 1YI0A 4HDNB 1K08A 3N6VA 4JHLA 2VDNB 1Z2DA 2IJGX 2X5OA 3BXHA 2WJYA 1SQ0A 3IHWA 1M8GA 1J9ZA 2QLLA 3LXRA 5E8RA 3KAQA 5JPDA 3VFDA 2CNLA 4PAGA 1AUPA 4LG1A 2VUHB 3ZX4A 5SICE 3CJRA 3CW2A 3FDJA 3NHJA 3W2EA 4YT5A 1C2TA 4DZTA 4JLMA 2IS6A 3R7DA 2GPJA 3DLHA 1SD2A 1JYFA 1A8IA 2JAQA 1V47A 2X3FA 4M0LA 2R65A 2I6GA 1Z0UA 2R5FA 1C0IA 3KQWA 4QECA 1NAHA 2CCKA 4AROA 1VYTA 1F5NA 4MV6A 1IDN1 3CF2A 4ZQEA 3CN7A 3P96A 4IYRA 4EZBA 2DUJA 2A0UA 3I5MA 3PRJA 3QE4A 4EG7A 2FWAA 4FYXA 4X8OA 4F92B 2Q4OA 4NCXA 2COKA 2F6RA 3S6JA 3VXKA 4K86A 3ELDA 5MN5A 2ONYA 2PUVA 1JLLB 3EZ7A 1KS2A 1YDFA 1OGYA 1GPNA 3GRCA 2WHYA 4JI2B 5AVKA 5K3BA 5IAJA 3DQQA 3V1YA 2VQFB 3TKLA 1SUEA 4ZQFA 3WLNA 5TEWA 1RKQA 4CE6A 3OZGA 3CSSA 1PK8A 4J7XA 4KE9A 4YP7A 2XT9A 3GEMA 3G59A 4R1PA 5BSFA 1KP2A 1Q11A 1G3MA 4IEFB 3TNDA 5TF0A 2PZEA 5CDFE 3VSBA 4H2DA 3S68A 2WHPB 221PA 1Y8AA 2ODEA 4O3FA 2PYIA 4R31A 4DCTA 2ZB2A 1S2IA 4D5GA 5I8WA 3S28A 1BA2A 2CNBA 1XTJA 4DLSA 3O26A 3ZYCA 4I36A 4MRVA 3HADA 3P32A 3R3UA 3TDMA 4G4SP 1VSUA 4DNFA 3KXPA 2XBLA 2OFPA 4OYYA 3GELA 4Q9LA 4P82A 1IWPB 4DLBA 3SY8A 4MUAA 1E1KA 2FJPA 2GNPA 2BGJA 5BSWA 1D04A 2W6NA 3LKDA 5T4BA 3DLBA 3FKJA 4L4ZA 4Q4DA 4BMDA 4GZLA 1JJAA 3QP9A 1IXKA 1L5RA 2JCSA 5K2OA 1S8NA 2YWGA 1HG0A 2JA2A 4C2AA 4X9XA 5KOJA 4JBYA 4TS4A 1GITA 4Q7QA 3CG0A 1OAAA 1OZGA 5CDGA 2C7RA 3ABSB 3GJRA 3OQIA 4I3HA 2XQKA 4JT9A 3ZWOA 3CM0A 3SD7A 1E6CA 1BXGB 2J4FA 4M46A 1C41A 1J2TA 1F6BA 2ANCA 4MGEA 2Q07A 3D59A 2VNSA 2WJGA 4N9QA 4L02A 3ZI0A 3R75A 4U4AA 2PUAA 3PJRA 1XA0A 3MWEA 3NWOA 1FFCA 3OAAA 3OTIA 3OIWA 2C9MA 3O4HA 3Q8XB 4QYMA 4R6XA 5ALFA 3LPAA 1LBQA 2P9TA 4C3VA 2P1RA 2O2CA 3G2IA 4TS1A 5K09A 1LD3A 3KQMA 1LVUA 3KOYA 4IEEA 3ICOA 4V38A 2AK3A 3QU4A 3EQ7A 1G9SA 4M22A 2NGRA 1L7NA 3NIFB 2EJCA 1M2VB 3CEAA 5JCXA 2XD9A 2WIAA 5AI0A 1V71A 5D85A 5EHIA 5T8KC 4UE6A 2C20A 3SHOA 4BFLA 4G0XA 2LZ0A 5JNWA 4MA5A 5CBPB 4Q4LA 1ISRA 1EE1A 1R12A 1XC7A 3G68A 3WSTA 1RQLA 4QU0A 1WV0A 4LXYA 2QJTA 1DIHA 4L9AA 3FTEA 3B6IA 1OXSC 2GZAA 3IURA 1U1GA 4JYPA 3DQPA 4K6MA 4M98A 4INAA 1PL0A 4MVJD 5IVIA 4Z7OB 5B57C 4V02A 3BKXA 4BRWA 5C1OA 3HM2A 1KEEA 1TAUA 3ZWYA 3R0XA 2H85A 3U0VA 2W11A 3LG2A 3EPLA 2HWKA 3LV8A 4DWJA 4JJKA 4BHRA 4RKQA 1PNOA 4HWKA 2BYTA 4ASUA 1LBHA 4JK3A 3W8RA 1K8YB 2RJ3A 4BLPA 1RLTA 2A52A 2CF5A 3ZK7A 4ZXFA 5KSYA 1VQ1A 3VR1A 3RLIA 1HV8A 3KQNA 1AHNA 4TKZA 3ES9A 3IO5A 2FWBA 1FVFA 4ZCRA 1WPQA 2WLTA 3W5VA 2PG3A 1G19A 1K4KA 4QHTA 1KE2A 1RKVA 5H3HA 5KAMA 3ESYA 4CI9A 3BE5A 1GKKA 2JLZA 1T6NA 2KLHA 4FR5A 4JYBA 4Q6BA 3KT8A 3PUXA 4WEQA 2VYQA 1PNTA 1PYOA 1XRNA 3IJPA 4GE0A 2O57A 1RQ2A 1Y3AA 2QZSA 2DVMA 3B1YA 4GGOA 5F2NA 2BWJA 3OC0A 4H4DA 1OWOA 3NKVA 1TCUA 3LSYA 3PFHA 5EESA 1P7WA 2C98A 3EC1A 3PWKA 4GYJA 2Z4RA 2B9VA 2XUZA 4FD3A 4QGGA 4UNSA 3SBXA 3TDKA 5BXYA 2HFJA 2XPCA 3P9YA 5FI0B 2IYRA 1JHOA 2P78A 2W2LD 2WD7B 1P7YA 1TVCA 2VLIA 3HCPA 3K0AB 3H5LA 4EKDA 3Q8KA 4KR6A 2ADOA 3CRMA 1TOAA 4RE5A 4E46A 2GH1A 5F52A 3TUIC 3H6GA 2I3GA 4Y6SA 1F7VA 3HSYA 4RJ2A 2NU9B 3GGSA 4DIBA 4GLOA 4D80A 3ZDYB 2YV2A 1XLUA 3GFBA 5DT9A 2UXCB 5TJ9A 2DLDA 1E9DA 1JE0A 1U4SA 1U8EA 3HPRA 4GSKA 4HZGA 2OPHA 4HAUA 1TYCA 1ICEA 5DM2A 3U2QA 3R3XA 1NVDA 1JSCA 4XD2A 4B46A 3C74A 2AJDA 3OCCA 3FCOA 5EIEA 3ZVMA 1JB1A 5LYYA 2XTZA 1W34A 2DHEA 2O8NA 2WDPA 3OTWA 3RTDA 4D4LA 2VWGA 3ORRA 1M2NA 1SBHA 2NZJA 2ALJA 2HLDD 4XSHA 2AFIE 3GNSA 3IAHA 2KLBA 1JKMA 1LW7A 4O02B 1L5HA 3P2KA 1PIWA 1EFTA 2W6JA 5E95A 3N2NA 1L4EA 4JOCA 1A8UA 4JEMA 2ZRFA 2VYNA 1QTIA 1Z4IA 1DCKA 5C5CA 5H83A 3T3NA 2ZIGA 3HYTA 3I72A 1OTXA 4ZMRA 2Z8ZA 1Q0PA 5AR1A 4NCAA 4RF3A 1FL9A 4A0HA 1CZNA 3U44A 4L3VA 1RU3A 4Y0AA 3MJ4A 4QAJA 3R4CA 4RC9A 2BAGA 3L0OA 3NGXA 4M9ZA 4KQWA 4ZOLA 1O0CA 3IAAA 3N7TA 3MTIA 1N9GA 4YH1A 5IYZF 3S1SA 4WXPA 3ZIDA 5KQPA 2QTVA 1AKMA 3V6LA 5CEFA 1UP4A 1NX9A 2C2ZA 3OJCA 1XE3A 1W88A 3COJA 1CV2A 1N8NA 1I3MA 4UBKA 2DKNA 3KZVA 3LUHA 3UIEA 5JY6A 1D4OA 2CSXA 4O2RA 4OAQA 3UMGA 3W1EA 3B51X 1ZUNB 4RCYA 3UMJA 4TLMB 2JARA 3A9RA 1XNGA 1DKLA 5EN4A 4AYWA 2BM9A 3W04A 5HYVA 3HUTA 4Z54A 1TX4B 2WJAA 3C1TA 3LFUA 4GYYA 3DR5A 5JC1A 5K6AA 2C0PA 4OQNA 2OR3A 2CBXA 3PRKE 5LZ7A 2Z2JA 5DNUA 2G8LA 3P5SA 4BVLA 3H1BA 3TB6A 5ILGA 1A8QA 2N9UA 2QMYA 4JN6B 2X8JA 4YAEA 4BLOA 2XVYA 3B6EA 3UAZA 1DJPA 1KGSA 1QIIA 1UC8A 3A1FA 4TXLA 1OZAA 5DX8A 1HDCA 2PH3A 1U8AA 2BKAA 3ASUA 3SQDA 3OURA 4DWVA 5TQ0B 4AKGA 2B5WA 3ZDCA 3KSDO 4RY2A 3OU7A 3WMWA 5JBNA 3A7DA 3RVQA 4XWYA 1YR8A 5KYVA 4ZI7A 3I42A 5CGZA 3EGEA 2GHTA 4OXIA 4XPIB 2POQX 2FGKA 2ONKA 2QAGB 4L07A 2PUHA 4LCEA 4RGYA 3D8NA 2J3JA 4OXQA 4K9NA 1M34B 2OCPA 4ARAA 1SR8A 5H3CA 4BEVA 3U26A 1EFKA 4XW2A 4S2EA 1ITZA 3EPRA 1ZU5A 2A35A 2JLRA 2WSBA 2CXTA 4AJ9A 2H16A 4IIXA 2MSEB 3BCRA 3W6OA 4B6PA 3G2JA 4J3JA 3BMXA 3EWIA 2Z08A 4P8RA 4QBGB 1N1MA 3ASZA 5IM4F 2CXQA 2VAWA 3ETHA 4C2BA 1NULA 1EE9A 2P9CA 4LZLA 1MGOA 3DLTA 2I3DA 1NJ5A 4EW1A 1QHHB 3AKDA 3QEMB 4NNOA 5T41A 1XYYA 3V7UA 6REQB 1I2AA 2AOVA 3STHA 1CQJB 3L7DA 5CNKA 3WB0A 3ZS8A 4YCSA 2XA9A 2E0IA 5I7VA 2I66A 4J7CA 2IYOA 2ZOSA 1LDEA 5TARA 1CCWA 3DMFA 5L4NA 3GJ5A 3HJRA 4LRQA 4D9FA 4DLLA 4EGSA 4DRZA 1OF1A 4F1JA 3OJXA 2UVQA 5TMDA 4ER0A 1GNPA 3HL4A 3VAAA 2GK4A 4DIOA 3RS9A 4G0UA 5JPIA 3HK2A 1KI1A 3ZGYA 1NOIA 2R8YA 4KSBA 4ZYLA 4G1UC 4RHUA 2Y1LA 3FHCB 5A9RA 3T3GA 3L7IA 3M6LA 2A4KA 5D1NA 2HRCA 3VTFA 2DERA 1WEHA 2B69A 4NG4A 5EKDA 2CCGA 3JU3A 1QH1B 4PX9A 4EVSA 3WBBA 2F9FA 3KD2A 1DFIA 3D6AA 3FUUA 3V8MA 3UG6A 3S2EA 5ALLA 4DUPA 1NOKA 3M5DA 4EENA 1RBQA 3MXTA 3GUUA 2VJCA 4QQNA 1QAQA 2OGWA 4XCVA 1ISMA 1JJBA 2JVKA 4EW3A 1IXSB 1BQ4A 4QUGA 1DXQA 1JVBA 1JMVA 2XWQA 2BGIA 3QIAA 3WIEA 1QVAA 3VR3D 4NZNA 5AVQA 5KTMA 2DUNA 3W9SA 4Z7QB 1X3SA 4ND7A 3QEAZ 4MMZB 1A8PA 2R6HA 3ROGA 1Y7HA 1G2OA 3MRTA 3SFZA 1DAPA 4BBZA 1H1LA 1Y8RB 4C07A 3D4OA 5B12A 3WNDA 2BFOA 3PC8C 2OL4A 1J99A 5BORA 4YO8A 1J0EA 1IWOA 3EXHA 5D6OA 4KMMA 5J58A 1WTCA 3PJFA 1G6HA 1CS0B 4G41A 1WU7A 2GM3A 3FPEA 4PLFA 3UA0A 4YTEA 3V7FA 4WLUA 4D43A 4ZI2A 5LJIA 2H8KA 5BSEA 2AMFA 4DR5B 5I45A 4Q9IA 3LQ2A 1B1CA 2Q8QA 3DEAA 5LUBA 3UV7A 1P75A 3HYRA 4QVIA 1KAMA 2CVHA 4DDVA 2C8JA 5F1OA 3GU3A 1N0HA 1RKXA 4AUKA 1XDDA 1Q3KA 2NSDA 4XVUA 4JR0A 4OXYA 2F2TA 4DQKA 1R0YA 2R8XA 3AETA 3NTUA 2CB9A 2DR0A 4MH0R 4R54A 3QOYA 4TQUS 2PMEA 4B3HA 5BP7A 3MCUA 4Q6WA 5KUTA 3FMPB 5HIIA 1OLSB 4KXXA 5HMLA 3DEKA 3LM8A 3IKLA 3LHKA 3ZZTA 1ZOPA 3IDQA 3OE7A 1H2WA 4I3FA 1SC6A 2JLWA 4K9KA 3HLKA 3TI9A 3ZY3A 5DTJA 1C9JA 2AJBA 3BHJA 4BLWA 4I6JA 4X6LA 5FQNA 4MW9A 3GCWA 4RL4A 3VVLA 2A9RA 1FDSA 2H92A 1C29B 3M2PA 2QMHA 4JLAA 4S35A 1A1SA 4RIIA 3UJ3X 2VHWA 2H1OA 3W79A 3LF2A 2XSZD 1DAFA 2ZB4A 4ND2A 2O2XA 1A7KA 2J5KA 2W6QA 4N5IX 1A4RA 1I2DA 4WNAA 1BVHA 2O1XA 3AVPA 4Z3KA 3ZBQA 4QWMA 1BE6A 3PA8A 2PM8A 4P35A 4TT3A 3LUGA 3RTEA 3LP8A 3L7OA 3UXMA 1H69A 3G2QA 1OFTA 2VPXA 1DJLA 4EA8A 3CI0K 3I04M 4M0CA 5JNUA 4M9SA 4PZZA 3OM9A 3T1QA 4HDOB 5CFLA 1HDZA 5D84A 5LMCA 1M3SA 3D6MA 3TEFA 3ZHTA 4EVRA 5A4MS 2OAQ1 4AAYA 1ZVQA 5ALIA 4X65B 3UJAA 1PVOA 4MW4A 3H6KA 1QR2A 4KJZA 1FBNA 2G7MC 4MJLA 2QDXA 4P83A 1V3UA 3M6MD 3LD9A 2YWFA 3NIBA 3ITNA 2F7SA 4X7BA 2ETVA 2PX2A 1QZTA 1NPYA 3QVKA 2QRMA 3GLHA 1F06A 4Y8VA 3V1KA 3AO0B 4X45A 3HO6A 4WLFA 1WOYA 1H85A 1BD3A 1X1DA 1XEFA 2HA2A 4B2YA 4EEZA 2C9OA 1YGPA 3GLFB 3KZNA 2H9YA 4MV0A 5JXHA 2Z5LA 3EE6A 3HDTA 4P32A 5C31A 3TSYA 1Q1ZA 5AHRA 1FOEB 4IRMA 3SGLA 5EUQB 1IY0A 2BI8A 2PTGA 4B7AA 1DIOB 1DKOA 1NMEA 2CT8A 1BU5A 3SSOA 1XMSA 3LCRA 4DWOA 4IV5A 1NRWA 1U11A 1YL5A 1IK6A 2IHUA 1ATIA 2VPYA 3RU9A 3M6XA 1Q0RA 3NUQA 2RKOA 1MC1A 1JR2A 5FTJA 4Y2PA 5EJ7A 4KX3A 1U5BA 1YASA 3UOAB 3NGMA 1KQNA 2AN1A 1CG6A 1L4GA 1GAXA 2GGSA 3CUYA 2YJZA 3X1JA 3HBJA 3MUFA 4MJ7A 2P8JA 1XQ6A 3WXMA 2Y4NA 2IIPA 3GDOA 3TM5A 4HDMA 4E32A 4TTRA 1DO8A 4KP7A 2HZ7A 2XCQA 4LSMA 1BHJA 4WACA 4I1UA 2PGNA 4CM7A 5A5EA 1H22A 1YZKA 3CZ9A 3CRVA 1USUA 1VIMA 3LL4A 4KWHA 4PO8A 1OD6A 4Q3LA 1IVYA 4ZQHA 5J43A 2WQZA 2A6PA 5FRDA 1M72A 3ZE7A 4DMFA 1BDIA 1SFRA 1J5EB 2B3DA 3F9CA 3RAPR 3GNTA 4D4GA 1N1DA 3TD9A 3GFOA 5D7BA 5KNCA 3JD1A 3HB5X 3FOWA 5AUQA 5H70A 4TVOA 5K01A 2XQIA 2WZBA 1P5HA 3X2FA 2Y68A 3FY4A 1DINA 4TTSA 1PQWA 1VJGA 3VPFA 4RZUA 1ML3A 1MB4A 2J6CA 1O94D 1Z2NX 2IA5A 3EIHA 3JD2A 1GG9A 1GTZA 3NZEA 2RJOA 3OIVA 3BDIA 2XJ4A 2AZXA 2XOEA 4HTFA 2XV1A 3E5MA 1VP9A 1BA3A 4N39A 5D2CA 1UODA 1EX6A 4KLAA 3URMA 2H5JA 3W1WA 4MV7A 3E1SA 1NI3A 3FTNA 3RBZA 5JMOA 3BL6A 1KSFX 3RSOA 1C7JA 1P77A 2PRZA 1VJ1A 4D4HA 2GK7A 4KMSA 3GN1A 4CF6A 3ZD9A 3BD8A 5H4GA 1E4EA 5I8PA 4X6UA 2RIRA 1G20A 3PP8A 4RHTA 5ISMA 1ATZA 1KBZA 1NG1A 1SUFA 5CVEA 4A0QA 3ND7A 1KMHB 4ZWNA 1Y82A 1UKVY 3FYDA 1SA0A 4NAUA 4HWGA 1ECGA 3L43A 4ZVTA 1ZGGA 2QZPA 3DW3X 2WIJA 2AE2A 4RA9A 4XQ9A 5K0ZA 4RYDA 2ZBPA 4Z0PA 5HJ2A 4COOA 2IUFA 1Z5WA 1C80A 4CEHB 3AY0A 1SD5A 2EU8A 4MKHA 4I1RA 5T57A 3UMYA 1A5BB 4KXUA 3U7IA 2AGVA 2QTMA 3G0GA 1A8SA 1WG8A 4TTTS 3PFBA 5BNIA 1XMOB 3C8ZA 4E30A 2E9SA 5JALA 2O3UA 3D1VA 3DD1A 2V54A 3IPXA 2Q50A 3NFYA 2AXNA 2P75A 1VG1A 2D1YA 2XCLA 5E0OA 1D8TA 1E79D 1NI5A 2D1QA 4RESA 1CPYA 1W9MA 2XRMA 1OJ7A 3QENA 1XNHA 3I4CA 5DHRA 3W7BA 3IR6A 4F9TA 3DZGA 4Y2QA 4HMQA 1SOUA 2D0DA 2OVFA 4FYKA 3NIWA 3NWPA 4TWAA 4RH3A 4U2KA 1BCSA 1EXNA 4X8MA 5CGQB 2JVIA 4I66A 4OAPA 5BSUA 1RMTA 2ZAIA 2GZSA 4FT4A 2PGDA 1E7RA 1Y5MA 2RG1A 1Q0LA 1QRDA 1XEXB 3PBKA 5HBRA 4EUNA 3BBLA 1RWVA 5C7LO 4CLOA 3MINA 4G25A 1P60A 3X44A 1N2CE 2B7CA 3R44A 1UBMS 3B1KA 2G07A 3QBEA 3AXTA 3NDIA 4BO0A 3LO5A 3DO6A 5FUXA 1Z4QA 3UAXA 5FTNA 5AJXA 3W6UA 1JT2A 1GR0A 2P5SA 2JFXA 2PSDA 2W90A 3EB9A 3OX4A 3QKSA 4ZCPA 5H80A 1NJ1A 1T6YA 3N2LA 3DLIA 5G3YA 3ROTA 4DM3A 4MPTA 3A0RB 4B43A 2I6UA 2G9RA 4GF5A 3B13B 4HLUA 4RX1A 4TL7A 3UJHA 4D44A 4B6GA 1CSEE 3WSVA 4URWR 4RPKA 1A5AB 4OQFA 1MAUA 1NW9B 1RPAA 2BOVA 4I55F 2IV3A 1MT0A 4OBXA 1A4UA 1HEYA 1U7TA 2DHDA 3USZA 5EHZA 5L3QB 2IBSA 1UK7A 1XRRA 2CV2A 4UEQA 1OFIA 4A1OA 1CUFA 4MVJE 1MD9A 1FJGB 1CP2A 2XWSA 3VH1A 4AF6A 2B4AA 3T3MB 4ZK2A 4J03A 1A9QA 5KU7A 3DP9A 2I71A 1ILWA 1GIAA 3OEWA 5EY5B 2WY2D 3T52A 4CMIB 4EJ2A 2FWMX 5E6SB 4EKIA 1WMSA 2C9BA 2QJRA 4I50B 5ELMA 5HIAA 2IYQA 1ZOOA 3MJEA 5A4IS 1E0SA 5TRTA 2GF0A 4H3SA 4J0JA 3C3YA 4TMZA 4WERA 4C4PA 5JHHB 3ADBA