3IVMA

Appep_wt+pp closed state
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
682
structure length
682
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords prolyl endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase/hydrolase inhibitor
total genus 210
structure length 682
sequence length 682
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3ivmA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ivmA01
4Y2VA 4AN1A 1HKHA 3I2GA 2AJDA 1CQWA 3EQ8A 2C0QA 5CT8A 2JGJA 2AJ8A 3WA7A 3PUIA 3V1LA 1CUDA 1EX9A 1TAHA 1CRLA 5DYYA 3IULA 1XZLA 4UBJA 4X91A 2VJDA 1CUGA 3GBSA 4B85A 1K6EA 4C4YA 4E14A 1A8SA 1JU3A 1P0IA 2PUJA 4B80A 4Q34A 1ZJ4A 2J3DA 3DCNA 1GPNA 4KE9A 4B6GA 3A6ZA 4DNPA 5JZBA 4IH4A 4Q3KA 3G0DA 1QOZA 1QE3A 3LIPA 4I3FA 4MYSA 2HIHA 3DL4A 1TK3A 4QDZA 1WB5A 3STYA 3WYDA 1EI9A 1L7AA 4X6XA 3JWEA 4NVRA 4OCZA 2PU5A 4S0XA 2QMQA 2CKMA 5HFNA 4IQ4A 4N8DA 1AQLA 2C4HA 5EIEA 1QIFA 1TCAA 4HXGA 3KXPA 5DJ5A 5JYCA 2QTBA 4HRYA 3V1KA 1XQVA 1EK1A 3FCYA 4G8BA 2AJBA 3RM3A 4OU4A 5AKJA 4BRSA 4XX1A 2ZYIA 2CBGA 4A5SA 4JNCA 5K3FA 4HXEB 1A8QA 3BF8A 3WK9A 3WZMA 3C43A 5AKHA 4MEAA 3LIIA 1XZBA 1GGVA 2ECFA 4AMZA 2GYVA 2XB6A 4WCVA 3W2TA 3FLBA 5IVDA 3FVRA 1MTZA 5JAUA 1HDEA 5K5EA 3AZPA 3DD5A 1EXWA 5ALRA 2QRUA 3QZUA 4J3JA 3MGAA 1CUVA 1SCKA 5CMLA 2PU7A 4I19A 2V98A 1AC5A 5AHXA 2V97A 1R88A 2IX9A 2QS9A 2V96A 3NWOA 2VQ6A 2WUGA 5AKIA 3DDUA 1LPPA 2Z3WA 3B3QA 4IO0A 4X97A 1UKCA 7YASA 1QIHA 3OM8A 1CUYA 3ICVA 3B12A 1XZKA 4AMYA 5LZ9A 2VA9A 4IHAA 1H2XA 3STVA 2H1IA 2VATA 3DEAA 4MQLA 5FPPA 1N5MA 1R3DA 2QR5A 4ETWA 3NGMA 4GHWA 1ETHA 4JYPA 5I8PA 3WJ2A 4Q1VA 4FWBA 4W1SA 5CT6A 4XJVA 4B7ZA 2WFLB 1QTIA 3H04A 1E8DA 3DKRA 3G9ZA 1ODTC 5LYYA 1EDBA 2FJPA 3D3NA 1CVLA 1ZD2P 1MN6A 4X3CA 5AI4A 4WFIA 1GPKA 2DHCA 4OB7A 4QNNA 3HYSA 4CG2A 3SX4A 2K2QB 3WA6A 1BN6A 3FLEA 5JALA 4RNCA 4B84A 1W1IA 1WB4A 5FLKA 1HLGA 4FKBA 4CCWA 1C7JA 2XMCA 4J0HA 1OILA 2HU5A 1X2BA 5LZ7A 3C45A 1BRTA 4K5QA 1XZDA 3FYUA 3WWOA 4FNGA 4ZI5A 5JZSA 1MX5A 4PSUA 2HU7A 4CI9A 1AUOA 2ZYSA 4YK7A 2VF2A 3V1NA 2JEYA 4Y2TA 3DQZA 3PFBA 3HACA 3GA7A 4U2BA 2XQKA 4MWTA 1CUFA 3BWXA 2HL6A 3R41A 1LPMA 2XI4A 2EEPA 4GI1A 2OQVA 3RARA 5HZGA 1YS1X 4LXGA 1MX9A 1R50A 4DMCA 1FFAA 5EHZA 1N5RA 2I03A 1UK9A 1BCSA 1OXMA 1LPNA 4INZA 4RE5A 4DSAA 1XRQA 1J06A 3M3DA 3K6KA 1VE6A 3BXPA 1AGYA 5A6VA 4UBOA 4AZ3A 4UHFA 5CH5A 2WKWA 2XQFA 1BN7A 3C6ZA 3UUEA 3QM1A 3HRHA 4W63A 3O4JA 2E3JA 4OPMA 4BTVA 4DTCA 4EY8A 5JADA 1MO2A 1SCIA 4YPVA 1DWOA 1HL7A 3D2AA 5AI6A 5ALUA 4Y2YA 4OB8A 1I6WA 1AKNA 4MYDA 4BYMA 3KWFA 4BTLA 1UXOA 5A7GA 3AIMA 2PL5A 2XQJA 2WHQA 1A7UA 1L7RA 3BDVA 2CB9A 5A71A 1MNAA 3VXKA 2ZSHA 3STUA 2X8BA 3C5WP 5D6OA 3E4DA 3EF3A 4DYHA 4EY6A 5AKGA 4Q3OA 1VLQA 2QKYA 1JJFA 4BATA 2H7CA 3F8SA 3S8YA 2HDWA 2RAUA 1F0NA 4AO6A 2Z8XA 1UWCA 1VXOA 5ESRA 3H17A 4WY5A 3FBWA 4FOLA 3Q8WA 4AX4A 1E8NA 1QIIA 2YXPX 4J0CA 3KD2A 4G8DA 3WKDA 4Y2QA 4WFJA 5JARA 4Y2JA 2HFJA 5CT9A 2WIFA 3WWCA 5C8XA 5AKZA 5JD5A 3L1JA 4LHEA 4BDSA 5KWIA 2FJ0A 4MQMA 3D0KA 1MAAA 3HEAA 4MEBA 5KREA 1U4NA 3QMVA 1A88A 4BE9A 2WG0A 4HVTA 3VKFA 3IIIA 4HRXA 1YASA 3ESAA 5ALDA 4UPDA 2H7YA 3QBJA 4P9NA 4N8SA 4PNZA 4KR0A 1YR2A 1QJ4A 4XIIA 4EY4A 3O4HA 1CUEA 3O4IA 3S2ZA 4X95A 4UBLA 2DHEA 2QJRA 4G4GA 5FUMA 1CFJA 4P93A 1WCYA 5CW2A 3TGLA 2VT7A 2G63A 5HKAA 3DYIA 1ZI6A 4QE3A 5EIAA 4CIBA 1XQXA 4N8EA 5AKLA 4BCCA 1KU0A 5AJHA 4G5XA 5BV7A 1KU6A 2JGEA 3I6YA 1FFEA 3MUOA 4K2AA 2JGMA 4IH1A 3A2NA 1Q0ZA 3PUHA 2WFMA 5CXXA 4M0EA 1CPYA 5T4BA 3AILA 2O2IA 5SYNA 2PPLA 5ALIA 2D0DA 3FYUC 2BAGA 2OG1A 4QWMA 4U2GA 4P08A 2WIKA 3EQ9A 4OSEA 4U2DA 1LPOA 5JANA 1XLVA 3FNBA 3ESDA 2Y1KA 5ALSA 4OUKX 2WIGA 1QIEA 1XRRA 3R3XA 5CBKA 3GROA 1ZI9A 2B20A 2Q0XA 4Q05A 1ORVA 1VA5A 5ALEA 4BC1A 5HF9A 4PSCA 4O08A 2HHAA 1ODCA 4FHZA 1UZAA 2DR0A 3VVMA 5HK9A 4AB1A 3F97A 3H2JA 3ANTA 4GWLA 1FFBA 2DHDA 2PBLA 2NW6A 1R9NA 1CUAA 2WFZA 2FUKA 3GUUA 4LXIA 3FSGA 2IIVA 4C4ZA 4GDMA 1ACJA 2QT9A 2PSHA 4Y2RA 4KE8A 5DTIA 3ICWA 5YASA 3IBTA 1XZAA 3C6YA 1N1MA 1RWQA 3DOIA 4KE7A 4FMPA 4FBMA 1JT2A 2XQIA 1WHSA 4CIAA 4YX9A 3B5EA 4IH9A 4H7JA 3V48A 1AMNA 4FFVA 1YA4A 4DMFA 2HA3A 3H1BA 5K3AA 4H7FA 4UBNA 3WKAA 4A23A 3C6XA 1ZD4A 2DQZA 4F5ZA 4OU5A 1BROA 1LPSA 2BCEA 5CRIA 3R3VA 3QPAA 4HXFB 3C5VA 1MAHA 3V1MA 3FOBA 3DL7A 1TIBA 3WZLA 4H7IA 3WKBA 3DOHA 4CCYA 4ZGBA 5AIBA 1S8OA 5AM2A 3G9TA 5JASA 4TGLA 1Z68A 4H7DA 5T4HA 1W4LA 5JAHA 1CV2A 1XKTA 1QFSA 1EA5A 4KRYA 2RGUA 3FWHA 3ZLUA 3STTA 3U1TA 4ARBA 1TRHA 3IB3A 2WG1A 4PSDA 4DNOA 5AKYA 1CR6A 4X6UA 2BKLA 4UFNA 2JGFA 4EY7A 2QJWA 2R8BA 3WK4A 1CUJA 1U8EA 2PUHA 2BJHA 1UK6A 3QYJA 1RP1A 2WQZA 4Y2XA 2QUAA 3L1IA 2WHPA 3OURA 3WI7A 2R11A 1VZ3A 1GQSA 4WFKA 2Y2VA 3E1GA 3FYTA 4JEIA 3AZOA 1JJIA 1X2EA 4CG3A 3D7RA 2CMFA 4MWSA 3E0XA 2BUCA 5ALYA 1ZIYA 4M0MA 4A16A 4JUIA 3SWWA 4B81A 1CLEA 2HADA 2XUAA 6YASA 3IURA 3R3UA 4UHHA 3C8HA 4OB6A 3OC0A 5ALXA 4QDXA 2CJPA 2J3QA 4Y7DA 1JKMA 2WM2A 4BRZA 4V2IA 2JIDA 3M81A 3KDAA 4J0JA 1ZGBA 5ALZA 4LKOA 5DNWA 4H7EA 1P0QA 4DIUA 2XUDA 3ESBA 1QIJA 3G0CA 2HRRA 1L7QA 3RLIA 4ROTA 1GPLA 5IH7A 5LIPA 3O9MA 2ZYHA 3R40A 3I2HA 1QIDA 4Z49A 3DS8A 4EZIA 2OAGA 1XZEA 2I3DA 1DWQA 1QONA 1EDEA 2X5XA 2RHTA 2EDAA 3D2BA 2ES4A 4FLMA 3H0CA 1G66A 4HZGA 4PO3X 5LZ5A 5CH3A 2O7VA 4CFSA 2B9VA 4X00A 1WB6A 1UK8A 3F67A 3PF9A 1QIGA 5AM5A 4Q3LA 3G9UA 1F6WA 1NU6A 4AZ0A 4UBMA 1SC9A 5JAPA 4H7HA 1E3QA 4TPKA 1XLUA 4J0KA 4QZVA 4DLNA 2WLSA 1A8UA 5AIAA 4KJXA 2VJBA 3FVTA 1BS9A 4DSZA 1CUWA 5AKKA 3TJMA 1XZHA 2DFPA 4EA6A 1G5FA 4Y2PA 1XQYA 5AICA 2WG2A 1Q84A 5K3CA 3PFCA 1QGED 1CEXA 3WK7A 2PSFA 1BEEA 4L72A 2V9ZA 5BWCA 2OGSA 1BU8A 1CUUA 3DJYA 1HQDA 4H35A 4XVCA 3I2FA 3KOOA 3AJAA 3QMWA 2WTMA 1F0PA 2OGZA 3T4UA 3X3HA 4BBZA 1QFMA 1JJBA 5DYTA 2P8SA 1B41A 3G02A 5DTJA 4KYVA 4C6HA 2J4FA 3Q0TA 1XFDA 2G4LA 2C5GA 1NU8A 2HA0A 4DMKA 4NMWA 1MX1A 3MVEA 4J03A 1UFOA 2ORYA 2XMQA 3I1IA 3QVMA 1GZ7A 1FFCA 4ARAA 2WUDA 3O95A 1JFRA 1EK2A 2WTNA 3GFFA 1GT6A 5LKRA 5ALLA 3D4LA 2BFNA 2ACKA 2XUKA 4UBKA 2HA5A 4L9AA 5D3ZA 4EY5A 1QZ3A 3WKCA 2XUPA 3CCBA 4J0DA 3G0BA 2WSLA 3G7NA 1YSCA 3R3ZA 1W76A 4UBIA 2OCGA 5T4EA 4BAZA 3R3YA 2XE4A 2ACEA 2WUEA 3AZQA 3BJRA 3CN7A 2DCMA 1DQYA 4C01A 4F21A 1R1DA 2ZJ7A 4UHDA 2OCIA 3R0VA 4KAFA 2WJ3A 5AM3A 1VOTA 4BZZA 1LPAB 1EINA 4PV7A 2O7RA 3W06A 1Y7HA 3AFIA 4X94A 1HBJA 5FOQA 5EHNA 2WFLA 5E4YA 4I4CA 3I28A 3K2IA 1DTEA 4GBGA 2C7BA 4X92A 5DYWA 2Y6UA 1JU4A 1YCDA 3VVLA 3BIXA 1ZGCA 1AX9A 1ACLA 5AK6A 5SYMA 5K3EA 3D59A 4OYLA 1UKAA 1VA4A 1P0MA 2Z8ZA 4J7AA 1P0PA 1FJ2A 1MPXA 3VJMA 1UKBA 2UZ0A 1JI3A 4YASA 4BC0A 5LZ8A 3H2KA 2QZPA 3AIOA 4LYDA 1GXSA 3GELA 1B6GA 4QLAA 3KSRA 5EI5A 2VAVA 2WIDA 2PSEA 1XZGA 3UUFA 5FXMA 1XROA 5ALPA 3M82A 1QO9A 5HCUA 1UOOA 1DX6A 3I6MA 1O6FA 4BB0A 4ZREA 5AP9A 4G4JA 4BCBA 2QUBA 3ZWQA 1YA8A 2ROQA 5HFAA 1AURA 3A70A 1DT3A 4BAUA 5HK8A 2I3ZA 4C88A 4AO8A 3IUQA 5CT5A 4FTWA 3H1AA 1VXRA 4QDOA 4TVKA 4HAIA 1TQHA 2GYWA 1H23A 2VSQA 4E11A 3LS2A 1THGA 3D2CA 3RKSA 2XMZA 3CCCA 1W52X 2VEOA 4FBLA 2I78A 4FFWA 4QWWA 4W1PA 4C4XA 2HA7A 5ALMA 4KEAA 2WJ6A 5AM0A 5AH0A 3QITA 1TKRA 5IKXA 5DNVA 2CZQA 1FFDA 4C89A 5EFZA 5BOVA 1XRNA 2ZVDA 1DU4A 2WILA 3O4GA 2GZSA 1WPXA 3HC7A 4FDMA 5LZ2A 1BE0A 3OPMA 5FP0A 4GXNA 3HI4A 2VT6A 1R9MA 2VJCA 1SCQA 1D07A 5CXUA 3ZLVA 1TCCA 4LIPD 5J3JA 4BAGA 1AZWA 2QXTA 1R4ZA 3GZJA 3FAKA 1M33A 3WK5A 1JMYA 4JH0A 1WM1A 5AOBA 4DNQA 1FSSA 1PV1A 4X7BA 3E3AA 1LZKA 1SOMA 5FPQA 3ZV7A 3WL6A 3I2IA 1UK7A 2YASA 4H0CA 4KRXA 4L0CA 1PFQA 4AXBA 3VJLA 1ORWA 5E2IA 4GLBA 3EBLA 3I1YA 1UOQA 1LNSA 3OTQA 4EUSA 4DM7A 2QOEA 5T4FA 5AOAA 3P2MA 3W05A 4UFOA 1EHYA 3C70A 1LPBB 4X93A 2RI6A 4Q82A 3IUMA 4BDTA 4F60A 3W9UA 1XZJA 2HA6A 2DSNA 1DT5A 2XMRA 4G9EA 4FNMA 4B0PA 4JYMA 3WK8A 3IUJA 3ESCA 2OAEA 2XMDA 3WYNA 4BP9A 5AI8A 5A62A 4Y9SA 4ZXFA 1GKLA 3I6ZA 1U2EA 2JGKA 2XUQA 4QDTA 5JZ9A 2HRQA 5DWDA 5KWJA 1LLFA 3WMRA 3DKKA 2C0PA 5FRDA 3HLKA 1MJ5A 1QIMA 3EQ7A 2PSJA 5DLPA 3ZPXA 3WWEA 1WPRA 3WWDA 2PX6A 2XMGA 3HSSA 1ZJ5A 4UFPA 1C7IA 3U0VA 4D9JA 4H18A 2JBWA 4PQEA 1IUOA 3W9BA 2OXEA 2XT0A 2G5TA 1J07A 3FYUB 4X6YA 4XWGA 2YYSA 3H19A 3SK0A 1SFRA 2AXEA 1PJAA 4M0FA 1CUXA 5E4TA 3LLCA 4PF1A 5LLSA 1IZ7A 1LBSA 5AM4A 1W6RA 2Y6VA 3OG9A 4GECA 5C8ZA 3G0IA 5JAOA 5AK3A 1QO7A 4W1QA 1N8SA 2C5FA 1BEZA 1CUCA 5AI9A 3LCRA 5A7FA 3STXA 2XQGA 5AK5A 1QTRA 5ISMA 1EH5A 3H2GA 2W6CX 5ALQA 5A7HA 1EVEA 3STWA 4GEGA 1IUNA 3TEJA 3T52A 1XZCA 5JD4A 2G5PA 2CUTA 3ILSA 3BF7A 1HPLA 4EBBA 2JEZA 2B4KA 5K3DA 1K5PA 1K8QA 4BVKA 2RONA 3G9XA 5ALNA 4OD0A 2ONCA 4ZV7A 5I9IA 1XZIA 3O0DA 4KAJA 3AUKA 2XLBA 4NZZA 5CTAA 5F4ZA 1MT3A 1ZD3A 4OYYA 4UHEA 3WIOA 3WL7A 3PE6A 2ZSIA 1EVQA 1YAJA 3IVMA 4UHCA 4K6GA 2IITA 1E5TA 2OQIA 4B9EA 4H7KA 5DNUA 2GZRA 5CH8A 5IVIA 2JF0A 1CIJA 2GBIA 1NX9A 1WHTA 1ISPA 2XMBA 3IDAA 5EGNA 4BP8A 1RYYA 2FX5A 1CUHA 2AJLI 5CT4A 2ZJFA 2GBGA 5HKBA 4W9RA 1F8UA 5HF5A 5HF6A 3SC2A 1TCBA 1K4YA 2D5LA 5BWBA 1UOPA 4QEKA 1H2YA 1MU0A 5KBYA 5HF8A 1LGYA 1JMKC 1XRLA 2XUFA 1J2EA 3FSGD 1Q83A 3LP5A 4RGYA 3IA2A 2BGNA 4E15A 4ZV9A 4AQDA 3WLAA 4DNFA 5C81A 5ALHA 5IVHA 4G8CA 1DWPA 3K9BA 4G1FA 2XDWA 4K6KA 3DNMA 3HZOA 4HS9A 1YAHA 1ZI8A 4HTAA 4ITVA 4GW3A 4ZRDA 3F96A 3H18A 1CUBA 3UMJA 1ZIXA 3BIWA 3WK6A 3TRDA 5A2GA 1BCRA 3PI6A 3WKEA 3DYVA 3HJUA 4E46A 5C7YA 1EB9A 2ZYRA 5AOCA 1J1IA 3WJ1A 3A2LA 4X85A 1DX4A 3DLTA 3ZLTA 2J4CA 3H2IA 3QPDA 1EB8A 3WQHA 2XLCA 2AJCA 3OOSA 4B83A 3MUNA 4WY8A 2B61A 5IVKA 5ALVA 3C87A 4FLFA 3C8DA 2H9YA 2XUIA 1Y37A 4N5IX 1IZ8A 4PW0A 1XRPA 5EHXA 3VJKA 1H2ZA 5CURA 1VJ5A 2HFKA 2JGLA 5C8VA 5LP1A 3NUZA 4DMHA 4LXHA 3I2KA 5K3BA 3AIKA 2C58A 4B82A 1MNQA 1XRMA 2RIPA 3ZI7A 3G8YA 4L3WA 2GBFA 4ZWNA 2XUHA 1GQRA 3QH4A 5AKXA 1YB7A 3HABA 5ALTA 4K6HA 1XZMA 3BE8A 1VE7A 3H2HA 2HA4A 3JW8A 3QMMA 1W75A 1GKKA 4KE6A 2W22A 2OCKA 5FKJA 2VJAA 1E8MA 5FV4A 4KACA 3JYHA 5ALFA 2OPHA 4H77A 4WJLA 1LZLA 1CQZA 1YB6A 2Y2UA 1CUIA 2PKYX 2WHRA 2BGRA 2H7XA 1C4XA 1ODSA 5HQ3B 3BDIA 1CUZA 1H2WA 2DQYA 3EIOA 5AM1A 4NS4A 5EIHA 1YS2X 1OCEA 5AI0A 1E89A 4BZWA 3VDXA 3G0GA 1DQZA 1VKHA 4LYEA 4B9AA 4BCDA 2O2HA 2BUAA 5D3KA 4RPCA 1T2NA 4B0OA 3M83A 3FCXA 4Y2UA 2HU8A 3RK4A 1Q0RA 2HM7A 2QVBA 2X76A 4G4IA 4J0GA 4J0IA 2VTVA 4WDRA 3WL8A 5ALWA 2WUFA 3O9VA 4BVJA 3VISA 2LIPA 1ZOIA 2GYUA 3NOXA 4EB0A 3A2MA 4MXDA 4U2EA 4UHBA 3ANSA 3PICA 1O6GA 2EDCA 2GBCA 5JD6A 3KWJA 5AI5A 5D7BA 1THTA 1X70A 5H3HA 3W04A 1VZ2A 4P92A 4MJ3A 2OGTA 2QXUA 1WOMA 4G9GA 1LBTA 2XUGA 4N5HX 4EHBA 1XZFA 4X90A 2QM0A 2Z3ZA 4FLEA 4F0JA 4QDUA 2Z5GA 1IMJA 1XKLA 4CCYB 2CEKA 2WJ4A 4WDQA 3FLAA 1G4HA 2PSDA 3ED1A 4QA9A 5ALJA 5FDFA 5ALOA 4CG1A 2ZJ6A 2WIJA 4RE6A 5AK4A 5EHQA 2OCLA 3I2JA 5ALGA 2HA2A 2PM8A 4Y2SA 3BL8A 3F9CA 5JATA 4W1RA 3N0TA 3R3WA 1ZICA 3WWPA 5ALKA 1UT6A 4UUQA 1G42A 2OLEA 1EDDA 3CXUA 1XQWA 1H22A 1USWA 1IUPA 1QLWA 5K3FB 2XMSA 5LKAA 2WHPB 2BUBA 4BE4A 4DGQA 4U2CA 3C6BA 2WU3A 4KAAA 1CUSA 3HXKA 5I7UA 4X71A 4AN0A 3QPCA 1Y7IA 2YH2A 2XUOA 3F98A 2XUJA 3D5EA 3WIBA 4BVLA 4AO7A 2PVSA 5E4JA 1XLWA 1T4MA 5AO9A 1IVYA 1KEZA 4QLOA 3CN9A 4C87A 1ZD5A 5LZ4A 3N2ZB 3V9AA 3YASA 2O2GA 1DINA 2RHWA 3IUNA 3L1HA 5HQ3A 1E66A 3PF8A 2WU4A 3AINA 1U65A 1K63A 2VAXA 3BJMA 5JIBA 1QIKA 3PDCA 2JGIA 3WL5A 4U2FA 5AKEA
chains in the Genus database with same CATH superfamily
3HO6A 3VC2A 3JQAD 4F1WA 1KETA 1PZFA 3KZKA 621PA 4RPLA 3MN1A 1SEPA 3HO8A 3FB4A 3V1LA 3RABA 1G19A 1RC1A 3OEYA 4MKXA 1SVNA 4NE7A 1A7AA 1TAHA 4UCQA 3K3PA 4PR0A 2OGWA 2CYBA 4G6ZA 2XNKA 1HYGA 1SBZA 3RIMA 1I3OA 2HHCA 3BKXA 1C9YA 2PCJA 2YDYA 2VYCA 5FNVB 1O58A 1UAAA 1M0EA 1VCIA 2I1WA 2I6SA 3BKWA 3KLNA 3P2JA 2CWDA 1DKNA 4FINA 2G7ZA 3G0DA 2DLCX 3O93A 1X7ZB 4GKJB 1Z6GA 4NCXA 2YYZA 3HVIA 2Q21A 1NP6A 4PAQA 3IEKA 1FTWA 3TOCA 3KXIA 2BFEB 4AP9A 1SXJE 2VF4X 2H4WA 4MLZA 2SKDA 2BM9A 3CG4A 5JYCA 3LYHA 2IYTA 2W2LA 4YFYA 1YR1A 4XM1A 2H0RA 1JR3D 3F5DA 1YWGO 3PDWA 2EFJA 4BRSA 1BQ3A 3C1TA 3I7PA 4A5SA 2XW6A 1CP3A 4ZT2A 3N0XA 5FI1B 5HPYB 2FNAA 5F73A 4H17A 3U37A 4LJ7A 3K9LA 4MVJF 1QHYA 4ZCQA 4EGQA 1LDNA 3FPKA 2YHUA 2GZ1A 3WHLA 5JS1A 3ZU4A 1F7UA 4D9FA 2GBLA 1DKUA 2PJUA 4R83A 1EEHA 5REQB 2V4UA 3UOWA 4HFJA 2WYWA 2V96A 1Q1GA 1H2EA 5C7OO 3K32A 4NQRA 2H6QA 1DBSA 4UCFA 4J84A 2XA1A 4QAMA 4AMYA 5BNFA 4YXFA 4UDNA 4IUBS 4HNSA 1N5MA 4EQZA 2BCJQ 4J6EA 3OX3A 4XM0A 1QAMA 4W1SA 3OZTA 5DM60 5CX4A 4JJ7A 4UI9R 1ODTC 2O3RA 2MR5A 3DMTA 2J5RA 3V46A 3W77A 1VYUA 2X5NA 4Q9AA 1DIAA 2IOHA 4RTMA 4YCBA 3ZE6A 5K0SA 2HUPA 3H1FA 1BN6A 3PYXA 3U7HB 3HKDA 4XYMA 4XGKA 4ZQFA 4NR0A 3DVAB 5JROA 1A95A 1FS5A 4BO5A 2GXQA 1JQEA 1JXOA 4C7XA 3QKRB 1XDUA 1PUJA 1Q7TA 4XYGA 1I94B 3EGOA 4YK7A 3VH3A 4QDJA 2IE8A 2IPXA 2D59A 2PMKA 1OC4A 3JVUA 4U2BA 4HYTA 3S70A 3RQIA 4F3TA 3OKCA 3BOSA 1FYXA 2ASEA 2P0EA 3AJRA 1DEXA 5G1NA 1V8PA 4C3VA 4LAFA 2VYVD 4Z2AA 2I03A 1QQAA 2VJKA 4P1ZA 3VM6A 4INZA 1JA9A 5AVUA 4UKDA 4RENA 1DCFA 1G16A 2Q07A 3SEAA 3N2GA 3RASA 4UHFA 1XYYA 4UD2A 4BMNA 1Y6FA 3HRHA 2BSQA 2ZAOA 4FM9A 2E3JA 3DONA 4OPMA 5LN1A 4MUGA 2WW8A 3Q9NA 3IBYA 2OO3A 3CKKA 1MO2A 4PXWA 4O3FA 4G24A 1UMBA 1UCFA 1KARA 1T9BA 5JNLA 3ZHZA 3L6BA 2Y68A 1PWZA 3WXMA 1YJ8A 3BDVA 4JSRA 2CB9A 1E7YA 1ZD1A 1U8UA 3SICE 1J4AA 4HJXA 2GD2A 3M34A 3BK1A 3NGXA 3IPLA 3NONA 7MDHA 4XWTA 2H7CA 3F8SA 1J8MF 1V3TA 3B3JA 2PQMA 3CHYA 1XCOA 3G5AA 4KR9A 1IXKA 4G0YA 3TL2A 3B1XA 1XZPA 1RMYA 4JUCA 3CRW1 5CT9A 2NZ2A 4IXWA 4MR7A 2GO1A 5JH7A 4NENA 5F76A 3LT1A 4TXLA 3D0KA 3SCZA 3VU1A 4HDJA 1JALA 3LFTA 1JEDA 1U4NA 1LI5A 4CHTA 3KEOA 3N2EA 3N8NA 1T8YA 2A0FA 3BWMA 3ESAA 3QK7A 4XLTA 5B3KA 4EI8A 1E6CA 1IJKA 2H0AA 3OA2A 4QQEA 4B76A 3FBGA 1EXVA 2AUMA 1HLDA 5AK0A 2NMVA 3DDCA 2DQ4A 3VV2A 2W4MA 4OHXA 3IQWA 1C9KA 1QCCA 1KFJB 4MVJH 3DP9A 1DAOA 5J2UB 2YJNA 4RW0A 3ROMA 5DT2A 3DW3X 3DMDA 4I1IA 3SBEA 2FG6C 2QUKA 3R7LA 3KYCA 4MW5A 3O91A 4F3CA 2YBDA 2QV0A 4TMWA 4RD2A 3KUUA 4AQYB 3ZH2A 5EP2A 5EAMA 1Q50A 2WIGA 3ZY4A 1LX7A 2ZRQA 3DCJA 1ORVA 2C4KA 1S4UX 2F8SA 3GD1I 3NNNA 3RJ9A 1ZHFA 3ZKWB 5TJHA 1SOWA 1NIPA 2YMQA 3BB3A 2ZBVA 3WE7A 1D04A 4X60B 1T1JA 3OQVA 1H5QA 3MT0A 2QENA 1PG2A 5G3YA 5AVJA 3GJ6A 1XUOA 1ZYUA 2IIVA 2PSHA 4Y2RA 3JQBC 2AH0A 2Z1DA 1QQ5A 3N58A 2Q8QA 4JYAB 4JYCA 5BUZA 2OSBA 4KTVE 4ZXPA 1T8WA 4FFVA 1RLUA 4EVIA 3ORRA 4FS8A 4RA6A 2ESRA 2P65A 5CYFA 2HJ4A 1G8JA 4FZJA 5DI3A 1ZIDA 3LJKA 1LPSA 2IXTA 2FPLA 1KORA 3UV6A 1LS6A 5MFZA 1OXVA 4G0ZA 5F21A 3L7AA 1RRMA 3ND8A 4CY3A 4HNRA 1L1QA 4HDAA 1MGOA 3IJ5A 3P2IA 2XWPA 5EPUA 1S8OA 3O3OB 4AIIA 2LTAA 3MPOA 3ETEA 1P5RA 3IVAA 2BFBB 2HYEA 5TT1A 1T9AA 1BJKA 4JMLA 2OJYA 4EHHA 3STTA 4CUJA 2B7CA 4KQGA 1U3FA 4UFNA 1FFGA 4D44A 3RUFA 2UKDA 4FQ8A 5CFOA 2YVLA 4D9KA 1WB9A 2BI4A 3TDNA 3QYJA 2OBNA 3MQ2A 5EESA 4KDRA 3OURA 4PZZA 2W6ID 3MWJA 4BO2A 5HFJA 5BSMA 1JJIA 4QJBA 4CG3A 2HPZA 3KEQA 4UE6A 3IAAA 3F9RA 2JKVA 2X86A 4ECEA 2IHNA 4EDFA 5TF0A 3RUHA 3R3UA 4UHHA 3CWQA 3IDSA 4BJ1A 3NOVA 4JJZA 4NCIA 1ORIA 4Y7DA 4YMIA 4RK1A 3CNOA 4IS2A 4J0JA 5ALZA 2PMEA 1PJSA 5CB8A 1UJCA 2JFQA 4IUYA 5FO1A 1ZQ9A 5K8LA 2H6NA 4MRAA 3VA7A 2MSNA 4TVSA 4U6QA 3DXZA 3RF7A 1M74A 2YQZA 3AT1A 1D0VA 3FROA 2OCPA 1L4HA 2HREA 5LWHA 2FB9A 3H1GA 1G66A 4PO3X 2PO5A 2G83A 2CMHA 1D8TA 4CFSA 5FNVA 3FCCA 1FK8A 4Q3LA 3VPBA 3FZEA 5EJIA 1SVSA 1DLJA 1QU3A 4CI1A 2ODQA 3OIFA 4DLNA 1KS9A 4WV3A 3PWZA 2X0DA 1LB1B 1CX9B 3PUZA 2XDAA 4GMKA 1XVTA 3A36A 1CEXA 1M1ZA 2QQ0A 5FBZA 1DHRA 1CUUA 4E09A 3I72A 2HSWA 2FWAA 5LQMA 1G63A 3ZDYB 1CQIB 1DXYA 1G6HA 1ZD9A 3WVNA 4U5QA 5DTJA 1US8A 3B78A 1BJTA 2YWJA 3MAJA 1H1LB 3TZCA 2JLSA 3RNLA 1MB9A 4PANA 2GZ3A 3RAEC 3GP5A 3E9RA 5JPCA 2ZE8A 3VJRA 4MTCA 4LOLA 1VPTA 1GLVA 3C5CA 2IZ7A 4Q15A 3KB8A 3O8RA 1UQTA 3MJRA 3OE1A 5REQA 2QU7A 4KODA 1VLZA 1TVEA 3L8MA 2WSLA 3R3ZA 3KZNA 5LB4A 4LRQA 2P9JA 2GVZC 2C1XA 4EITA 1ZHOA 1NFFA 4UHDA 3R3HA 5B1HA 1RHUA 3DOCA 5ADWA 5AM3A 3A2KA 1GARA 3TW0A 3QXGA 1A27A 3INYA 2ZSBA 4BRWA 7GPBA 3NDBB 5LR6A 2QRMA 4FFSA 1JYFA 3SJLD 4LV8B 1EUCB 2V7QA 3L46A 2BFOA 3LX6A 3ZN2A 2FQQA 1PGOA 4GFDA 4BHTA 2AHRA 2UYHA 3VJMA 1Z63A 4Z53A 3ZDZA 1MPTA 4E5ZA 1K4MA 1Y7PA 2H52A 2ZQYA 1R5NA 2E4YA 4LYDA 3VZBA 3W7BA 1ZGJA 2X8AA 4CFYA 3QKRA 3DSMA 2IEDA 2UYGA 2I33A 4ZICA 1COWA 1NJFA 1TQDA 2XT6A 1JN0A 4FS3A 1FC0A 3UA4A 1UZLA 3IR6A 4G4JA 3OPNA 1EK0A 3R44A 1OAAA 1FNNA 4NU0A 4FTWA 4EIWA 2B83A 3N75A 3D2CA 3HG7A 2L2QA 1VSUA 2VEOA 2R6HA 3H11A 1XTPA 2V59A 1A4XA 4C29A 2YWDA 3KZVA 1TYBE 3FPSA 2GN8A 2AOUB 2XKJE 1V43A 5I7OA 2YCBA 2DHQA 3SLKA 5EYPA 2I4IA 1ZSNA 4J90A 2QM8A 2CZQA 1HOTA 2BP7A 4N5LA 3W5SA 4QYXA 1YZ3A 4MCJA 4MW0A 3O8NA 1NRJB 4YWHA 1RM4A 2NTNA 3MYRA 4TKVB 4CIDA 4G1VA 3EQZA 1NYTA 1JG7A 3BZUA 4AEZA 5BSVA 3RVRA 1VCOA 2FF7A 3BQNB 1T13A 2QAIA 1ABFA 1YR6A 2IW1A 3VPCA 5HJ7A 2J6IA 3ZZ1A 2EQ5A 4DF3A 3CS3A 4RC9A 3HY3A 3OTQA 1G5IA 3QLJA 4XX0A 3A28A 2ATXA 3FZGA 2YWCA 2DKOA 1F12A 4A03A 3WLLA 3FUCA 2G0AA 4J75A 1LI4A 3TTXA 1DBRA 4HFRA 5G0UA 5EZ5A 3FA2A 4CL0A 5I47A 3RYFA 3LUPA 4UNSA 5MN4A 1WZNA 2HRQA 4UM8A 3GEMA 4IDAA 4TT8A 4MVJM 4JBYA 1O6ZA 2IXGA 5IW8A 1UC5B 1JJVA 3EXG2 3QOXA 3TF5A 1OI4A 4C21A 3A1EA 1NM5A 3IAM1 4F92B 4GI3A 1TUEA 2N9UA 1DCKA 5B7NA 3QLUA 5E4TA 5LUAA 4C30A 1GZ4A 5JJCA 5JD3A 4UM9D 2CCKA 1JUDA 4WN9B 5AK3A 1BXGB 4B4VA 3M6MD 1N8SA 3IKLA 1RDFA 1YZUA 2Q62A 1CS0B 1M6VA 1V48A 3P96A 3GGSA 3ELDA 3GJ8A 3TQFA 1T5IA 2B6NA 1DZ3A 3NCHA 1C3LA 2B78A 3EVNA 3STWA 3TEJA 1Z8DA 4O1IA 4EBBA 2TYSB 5K3DA 1Y42X 4JGBA 3RSQA 4P81A 2VQ3A 3G9XA 2IUQA 1W36D 4MX8A 3UNXA 5I45A 1NZDA 4KAJA 4MWCA 2EKQA 3M6UA 3IAUA 4KGVA 5F4ZA 3RSSA 3SYNA 3LPLA 1H9CA 3EXEB 4TYNA 1CHDA 3PC7A 3SQWA 5GIOE 1YE8A 1PFWA 5B4TA 4IG4A 4RZ2A 1V3VA 4RIFA 2W98A 3IDAA 2BV3A 2FX5A 1CUHA 4QOEA 1FMCA 1F8UA 5HF5A 4FYXA 3S7TA 3IUEA 5DBHX 4BBAA 3OLVA 1RI5A 4ZOXA 3IEIA 1QNFA 3QSGA 4D81A 4YBRA 2B4AA 1MD9A 5IC7A 1F17A 4H3VA 2CBXA 1DDGA 3K9BA 4TV9B 1DC7A 2D00A 1EG2A 3HZOA 4HS9A 3SYKA 2EJWA 1R8XA 5AQ1A 3BIWA 3WK6A 3ZBTA 1F14A 4I1UA 2Z4SA 3DE6X 4QGBA 1KJIA 3LVFO 1M2HA 2NIPA 2NXJA 3ZD9A 5A5DA 2N1BA 2JAUA 3MB8A 4IKEA 4C6SA 1G21B 1SG9A 3ZCVA 3GFTA 3OL2A 4TQAA 4B31A 1BMFD 1UL1X 5KNBA 3ZWWA 1OBHA 4YVDA 5CBPB 3VJKA 3LUHA 1BAPA 1AQJA 2AFVA 1SQ0A 3C99A 2R00A 3RSLA 4E2ZA 3ZI0A 3KAJA 4YDHB 4L3WA 2OYCA 2F55A 3AR5A 2Q9BA 1G55A 4BX8A 1DRWA 3T8YA 2AGWA 3C97A 2VPIA 4F4FA 5HE3B 3RHFA 4NP6A 5B7QA 2IEZA 2PA0A 2CLLB 2O57A 3D02A 4O4JB 1W85B 1T1SA 3TAUA 2V4ZA 1Y3AA 1Z25A 3OHSX 2DERA 1XDWA 4IBOA 4H4CA 1P4JA 1EBFA 1B1AA 2I0SA 4DHWA 1CCWA 4ETMA 2DQYA 5C52B 2E21A 2OAQ1 4UTNA 3GC6A 4L27A 3ZDQA 5IDVA 1T2NA 2WK1A 1GGFA 2GD1O 1VIDA 1OZGA 4E32A 2B6HA 3GD5A 1U0RA 1FDOA 2V6GA 3MT9A 4DTIA 3GPLA 3KSZO 4XQ9A 1JOFA 2IYUA 4L08A 4NSNA 4R71A 3R24A 2WUWE 2RGRA 5B6JA 4O0MA 3EWAA 7MHTA 1X70A 4KHZA 4WACA 3W04A 4ZVKA 1SKQA 1CQIA 2R5FA 5ANRB 2ZULA 1SMKA 3KPUA 1LLQA 4HFMA 4Z3KA 1LI7A 5TEVA 2Q0QA 1JTDB 4PC7A 5CM2Z 5BWMA 1NUSA 3T7SA 5HRCA 3A1NA 4QPDA 4DMRA 3C3AA 4IEIA 3TG8A 2EIHA 4NBMA 4IDHA 5ALGA 3E22B 1F2TB 1I14A 3UVLA 1RLTA 3IR7A 1A98A 3S1AB 4I1PA 1IUPA 4Q1AA 5TMPA 3L7YA 3ABSB 4KAAA 3RVOA 2NVUA 1JLHA 3P9KA 1ZR2A 5K3SA 5CB4A 3DZHA 3OOEA 4MINA 4PLHA 5ARCA 5HQ3A 3FWKA 1CSEE 1PEYA 3PF8A 3KB2A 3RBAA 4XRRA 1EUCA 4PLGA 1W5TA 1TA0A 3PDCA 3TFQA 5I51A 4GPD1 1AKEA 1GU7A 1XWFA 5EZYA 5LWQA 1PDOA 1MG0A 1IY2A 1CT9A 3EI4A 2C20A 5DWQA 3OE7A 3EPLA 1BE1A 5SZKB 1NSTA 2OV6A 3JVDA 4F6LA 4UBJA 2J46A 3O2NA 1R00A 4CF3A 4E14A 4OP2A 4EAQA 3DCNA 2YBEA 4J43A 4X54A 4HXYA 5KMGB 1QP4A 4FWWA 1R7RA 2YS7A 3NAGA 3HP4A 4DLXA 4Y98A 3FPJA 4B2YA 1QE3A 3LIPA 1KO5A 2XTMA 3FHLA 3KR2A 3ONFA 5FOXA 1DAIA 5ITZB 4LOKA 3WYDA 1KNQA 4AZTA 1YOBA 4J16A 2PU5A 2QMQA 2XAUA 3ISVA 1W35A 5KSZA 3V5NA 4IQ4A 3MSXA 4EG7A 3W8DA 4P7FA 4G0XA 4C4AA 1SQSA 4BGVA 3GAMA 3GJ7A 2AOUA 5DCWA 4OXKA 2H4HA 2BZ1A 2YB8B 3FCYA 4DANA 4HDRA 1JNYA 2I91A 2BEWB 3DH0A 1KMHA 4J4HA 5IMBA 4DPKA 1N0IA 1LH0A 3M49A 4YGXB 4TUYB 4TKVA 3I4CA 5AHOA 1UZUA 4DLLA 3UXHA 3HUDA 4QDKA 1Q6YA 1SCBA 4MJ7A 3AO0B 1SCKA 2GCOB 5CMLA 3A4VA 4M49A 3IT2A 2DCUA 1R88A 1UTCA 3L79A 3ITEA 2IX9A 2QC5A 4V24A 4N03A 2BEJA 3MRXA 1GL6A 4JUDX 4XD2A 3OJWA 1CUYA 4P5PA 3UJAA 2G9VA 1BHSA 3OBBA 4EFKA 2VATA 2ZBQA 4HWPA 3S1LA 4A8JA 4MI9A 2YJTD 5FWAA 5G02A 3T7AA 1LY1A 4R8SA 3QNUA 3JQ9C 4Q1VA 3N28A 2O3QA 1OVGA 1CNFA 3DL0A 1SC3A 3G9ZA 2YJ4A 4PRLA 5E7MA 4NU8X 1AB6A 4F96A 1YFKA 3EHEA 2YZGA 2PUDA 2VH1A 4NOKA 1GSHA 1XQ6A 1WBJB 2CLSA 2Z5FA 3GFPA 5IC4A 3CINA 3WA6A 1OJ7A 5FADA 4RNCA 2NO1A 2EX1A 2Q4EA 3HLTA 5AVVA 2P2CA 3SJAA 2F17A 4AG5A 1XLTC 4BNKA 2R97A 4BLQA 1NFQA 2VP5A 2ST1A 2JEOA 3E7PA 1JIKA 2Z56A 1M76A 1M6WA 1PD0A 1TUIA 3NHFA 4FCTA 4YLYA 3F7OA 4WN9A 4KR3A 1BXGA 1FVHA 5LJIA 2Y4OA 4NV3A 4W5OA 2PZLA 2XVAA 4Q4HB 1YS1X 1H6AA 4BKMA 4DMCA 3NHAA 1GHTA 4FT2A 3E27A 3OQOA 1N6RA 4A0HA 2EWMA 1XD9A 1I2DA 1GG8A 3DTVA 4MVJE 4TMYA 4CMEA 1DV1A 4B8YA 5ED4A 3L0IB 2OO5C 3BJEA 4JLBA 4LX0A 5H0IA 2YHBA 2XYQA 1RRPA 4KQMA 1QJCA 5IC5A 5EERA 3UBMA 5F7OA 3NX4A 3KFVA 1QK4A 4A5OA 4OB8A 3O1HB 4BYMA 3KWFA 2XXAB 4TM8A 4ZCTA 3QUAA 4RDXA 2P9YA 3RUPA 3L5OA 3Q5DA 1SWVA 1U8FO 4EECA 4L0DA 4F71A 5D6OA 4CM7A 4B17A 3ZCSA 4D92A 1P62B 4IDDA 4BJ6A 1YI1A 4P98A 2C95A 3DXXA 2AX3A 4ZK6A 2F3RA 4RJLA 2ZG6A 2FTKE 3HADA 1KEEA 2FPWA 3IBGA 2OM6A 4IDBA 521PA 1W5FA 1T9CA 5SY9A 1NYLA 1Y5RA 4JVLA 3MEQA 4IR7A 4WFJA 4RZSA 3U31A 2XB9A 1VPWA 4Z7OA 3IAXA 4WLUA 4IXMA 1FDSA 1LJUA 1L8QA 5JCXA 2YRFA 3H4VA 5CVEA 1Z8FA 1PQUA 1AKVA 4YO7A 3OKTA 4GXTA 1XPJA 1C8VB 4ZDWA 4CL3A 2C0CA 4Q4JA 4QVIA 4JJKA 1KDTA 1L0BA 3LPMA 4D3FA 5CLHA 4C0XA 3EZXA 1QJ4A 4N6GA 1SGWA 4ACBA 3PA6A 2OESA 6GPBA 1GPMA 4AVYA 2VFAA 3CW2A 3G7SA 1VIYA 3JWGA 5DHRA 4NF2A 5CBPA 4CIBA 4KV7A 4G5XA 4FYVA 2YICA 2M6LA 2HRZA 3HWX1 1CYEA 1EFRA 3TLMA 5K8VA 1L4NA 1N9KA 1U6KA 2PS1A 1RRVA 3IEMA 3FUUA 2OL4A 3B1YA 4BL5A 4U2GA 2G1KA 2WIKA 4QGFA 2FSVC 3FWZA 1E4OA 3HPRA 5KJ1A 2OECA 4IF6A 1KDOA 1NAHA 1X87A 3OTWA 3CPJB 1V9SA 4XDGA 1D2EA 1N5IA 1PT7A 4O4JA 1W85A 2MIIA 1WLYA 1ODCA 2VSFA 2X2OA 4FHZA 3P9SA 3RV4A 4US2R 1OD6A 2I8LA 2NYRA 2BMAA 5C4IA 1Y6ZA 2Q1SA 1M8JA 1I7PA 4F2WA 1FYVA 5CEJA 4Q9LA 3F8TA 5A3SA 2PRSA 3OUUA 1JKJB 3LE8A 3LHDA 1ZEJA 3W79A 4JP5A 3HYLA 3I9V1 2ENUA 4ZU6X 1SUPA 2HPHA 1J70A 3WLNA 1D6SA 5KCMA 4PX2A 2ZETA 4N9QA 3PX2A 2OHOA 4XA8A 3K72A 3ED5A 2Q5FA 3W8RA 1Z4NA 2YY5A 2E0IA 1VHQA 3WKAA 4BU0A 5DM4A 2B5VA 1V5GA 1I3CA 4YPOA 1B14A 2HIMA 3IOYA 5CGZA 1RXUA 4ZYTA 3PE7A 1OU0A 3O4RA 3JYNA 3AEUB 2I22A 2C5BA 2RBKA 4MK4A 1REQB 1JGTA 1VGVA 4H1HA 1ZWLA 2ZJ2A 5H59A 3PJEA 4XARA 6AT1A 1QFSA 1KSHA 2B1IA 3QF7A 2PANA 3BE6A 2V55B 4IDQA 4J29A 4LBYA 3L8GA 5FA8A 2Q8PA 5L45A 2XB8A 1D9ZA 3E22A 1GG2B 2R8BA 4GOOD 5F7ZA 1PS8A 3N1UA 1SC4A 4MKRA 3WWZA 3S1AA 1PK8A 1Y1QA 121PA 1YGPA 5AMSA 3RG2A 4Z0NA 1Z83A 2DQKA 1IJFA 5LNK6 2ZJ0A 4FMBB 5C5CA 1XNQB 5THQA 3KKKA 4S0ZA 1LBEA 3TG2A 1DEKA 1X15A 1FSPA 1GGEA 2CMFA 5LQNA 1QMGA 1Q7RA 4GSYA 4UNNA 4HAWA 2FZWA 3PV0A 4B81A 3BD9A 4ASUD 3I61A 3IURA 1JQBA 1PWXA 4D0NA 2NAFA 1MB2A 3QTBA 3IIMA 3UPTA 3WQQA 2NWQA 4BVAA 1YU9A 5LJLA 3SC2B 5B1YA 3U7QA 3S8EA 2VPTA 2NTJA 3JWHA 5B12A 2PFKA 1TYEB 3ESBA 1G5RA 4BZQA 4ROTA 3OQ6A 5CA1A 3FJ1A 4Z49A 4DG8A 1S2DA 2FWMX 4K7JA 3WSTA 5CA0F 3DVQX 1DS6A 3TLBA 5GQSA 5DM70 4Z0HO 3TR5A 3P4XA 2ZRNA 5F2KA 1B0UA 5CH3A 4V0RA 1I9GA 3FCUB 3G9UA 2FDCA 1M0WA 4IZHA 3C3EA 5HZHA 3CC8A 1N9ZA 3E70C 4LV6A 3TRKA 1XLUA 5BSFA 1VRCA 5FX2A 5EJMA 1M1XB 2GEUA 1FU7A 1U7HA 1U5BB 5AKKA 3QJYA 5ITZA 3MRTA 1MAVA 5AICA 2JIRA 4IIDA 1JPVA 3MTQA 3R23A 1GXRA 4DCJA 4XVCA 2VSOA 3AFNA 3QMWA 1GGKA 2XE7A 2HD4A 3FM9A 3P4FA 1ZVJA 4E51A 1DSSG 5DYTA 1NLMA 4HG2A 1XFDA 1UJNA 1E3TA 5FTLA 4O4HB 1P2TA 1MX1A 4B73A 3OPXA 4TUYA 3P52A 1K6MA 3WGYA 1RRCA 3RRMA 3OKPA 4D98A 3NKFA 3TQRA 2GCOA 3GUHA 2VHUA 4D9HA 2AD1A 1FFWA 2F90A 3D2LA 2PH3A 4JSVC 4QHTA 5U4QA 2VL7A 3OX2A 1JIXA 4EZBA 3VX4A 4KKVA 1YU6A 3OOHA 5AJUA 3S8MA 4A0SA 4FCCA 4BU1A 1S1MA 2FWJA 1E0AA 1G9SA 2NUTB 4PPFA 1FNBA 3IP9A 2BMVA 5CXBB 3UMYA 1HNZB 3NHRA 1OX4A 2YFKA 4Z8YA 3R8XA 2Y6UA 1FFXB 5CB6A 4PLPA 2CDRA 3GFGA 1OXXK 1NNSA 1QHHB 2OOSA 1P0MA 2Z8ZA 1JG1A 1LSOA 2ZTMA 2J59A 4D9IA 3W34A 1BFKA 1E1CA 4DV5B 1GNLA 4KLNA 7ADHA 3ZEAA 4RTPA 3Q2OA 3JXEA 1M0TA 1KJYA 3KSRA 2QJTA 1U7DA 5FBHA 1E5QA 5SY6A 3FNQA 4YRQA 3F7MA 4OX9Y 5M5UA 5ALPA 2ZRLA 3EA4A 4Y2HA 3SQLA 2PZGA 4Q9KA 3ANMA 4L1KA 3MOIA 4FBGA 3FPAA 4Q4HA 3VH1A 3E03A 4KO4S 4C88A 2P9GA 2Z6VA 3VNVA 3P9CA 1GYPA 4E11A 1NBWB 3RKSA 2XMZA 1SUSA 1P0CA 3S2FA 4TSKA 4MI6A 2GD0A 4WECA 4CKYA 5B3AA 4CLRB 1ZZGA 4NE9A 3ZJ4A 1M75A 3BGOS 2XXAA 1R6UA 1UPBA 4F4HA 1GR0A 3L41A 3NTRA 4WK0B 3JRNA 4J0FA 3M8KA 1YE3A 4ZOBA 2WILA 5DCYA 1OY1A 3V42A 3WRYC 3T3HA 4OI1A 1JXMA 1H69A 2WJPA 3BWSA 1UP6A 2ZT8A 2IXDA 4DSTA 4D9NA 4M0KA 2JKZA 3K5HA 2ANBA 2C78A 1Y4DE 3LLVA 1O5OA 4LDAA 1ZONA 2UZ1B 4INJA 3AL8B 2E87A 1ZNYA 2J5KA 4GZ5A 2J5QA 2FZLA 4L0CA 2V3WA 3GA0A 4NCAA 1A9YA 1ISGA 1KFCB 4CDGA 2W2XA 4UFOA 3QXSA 5B6IA 3PSLA 4DQ0A 1UDXA 5EXSA 3LP8A 2OLKA 4Z7JA 4JBLA 3SWSD 1YDMA 4G9EA 1I01A 2Z2YA 4JYMA 3IUJA 1PSWA 2P3QA 3RBZA 4RV9A 1KZHA 4R8MA 2Q5JA 5AI8A 3HRKA 3UO8B 2RHMA 2WJHA 1VE5A 3ZVNA 1LA2A 3QXJA 1FYEA 2FG5A 2E18A 4OLJA 1CIPA 2GARA 1L5QA 5TRTA 2RGGA 1WCIB 3ZPXA 2R6FA 5EFOA 3WWEA 4AY4A 5I9LA 5HBGA 4M21A 3FPLA 2R2AA 3H19A 3THOA 3CZRA 4JIMA 3ANYB 1RI2A 1WMSA 4CMHA 3PLAE 1JWLA 4UM7A 4DLVA 3EPRA 4I50F 1XKSA 5TMEA 3HA3A 4DLRA 3STXA 3I92A 3QYAA 3UZUA 1EVEA 3SEQA 4F2DA 1Z6AA 2Z0MA 3HA2A 5M5TA 3WTBA 3CX3A 3K26A 4YP6A 2QU8A 5EA2A 4CMKA 2NZUG 1FPMA 4G1UC 1SIWA 1A9QA 1QFJA 2BGUA 4RZHA 4BFLA 4JXZA 1DBQA 3FRJA 3MNFA 2G5CA 4XJXA 2BGTA 1NXWA 1X7YB 4OYYA 1HQYE 1M6YA 4XVUA 3ZDDA 4J0XA 2D1FA 4PGGA 3K1AB 4LTNA 5CH8A 5FEUA 3PIDA 4GZ6A 1WHTA 3E3MA 4FKZA 1UM9B 3NW9A 1PEVA 4Z8XA 1QH9A 2ZJFA 5HIMA 2JI8A 1W30A 5HKBA 4CNQA 2PHZA 4KYUA 5BVHB 2WABA 1SVKA 3AHHA 1YBVA 3OSUA 3A32A 3WISA 5EMHA 3LO8A 2P67A 5K09A 4G67A 1OFHA 1V26A 1UH5A 5TPWB 3RD5A 4XGRA 1GP2B 5L3QA 3BE5A 1PJTA 2DPYA 3RLFA 4K6KA 3VX3A 1AXGA 1REQA 2CL7X 1O5TA 3PWKA 3DWGA 2QLLA 2UUCB 2FDRA 4PHCA 1C3VA 1CUBA 3UMJA 1VRVA 2FCAA 3BIJA 3PI6A 4QUIA 1WMFA 2P1ZA 2OM2A 2JIMA 4XFDA 1U3CA 5AW5A 1BG6A 4CPDA 1PR4A 1GG2A 1E7QA 4FA4D 4I0WB 4OZUA 1XDBA 3DLTA 4CHGA 4NU5A 1CJBA 2Z2JA 1Z82A 4B83A 3NVDA 4FYMA 3QEAZ 1ANKA 3QUSA 4QHSA 2C7RA 1Q20A 3X2FA 3BXHA 5L3ZA 5L7TA 1YK1A 4EW1A 3G8YA 3HL0A 5ELLA 3QE0A 5ER6A 4CMIB 1SCAA 1XA4A 3BE8A 3PR2B 5A4FS 1JAZA 1GNTA 2VLIA 3RK0A 5FKJA 2QZJA 4PLWA 1KI4A 4P32A 3CTPA 5ENDA 1TB4A 2C03A 5K45A 2H7XA 1C4XA 4PZLA 4DV1B 1JB9A 2GBPA 5AM1A 3U09A 1U5CA 5EIHA 1YS2X 5CLFA 3EI1B 4ZT4A 4WJKB 3NI2A 4BZWA 1VKHA 1KAMA 1IZYA 4F2HA 3G79A 4LYEA 1FP6A 1EPUA 2PJRA 2JJ2A 4JROA 3U7JA 4RSHA 1PQ4A 3C1OA 4IX9A 4WPGA 5EJGA 2NUAB 4G1CA 3VAYA 2QTMA 3CE6A 2HU8A 1GQQA 3GJXC 3FNRA 2X40A 1T9KA 1A3CA 1M1XA 5BMOA 3HCRA 2D2XA 4OGWA 2NO0A 3WMFA 4MXDA 5IXYA 4U2EA 4UHBA 1BMTA 3VR0A 2WYVA 2G7MC 1UDWA 2EL9A 1FYWA 3WC4A 1KE2A 4NBUA 5D7BA 4MKHA 1W1UA 3CVVA 2C00A 5BQXA 4COKA 3LQRA 2XUGA 4N5HX 4AC9A 1MIOB 2ZVJA 4EB6B 4F0JA 4LHWA 3QJ5A 1I4DD 3UKJA 3OIDA 3PUKA 5LXTB 1RWBA 4O4HA 2OB2A 2WC1A 5EWLB 3UJ6A 2I4RA 5F1PA 2Q28A 2EZTA 4L16A 3GFRA 4ALKA 3HY6A 3VI4B 3GGDA 1EDDA 4CLXA 1H22A 3LQ2A 4U2CA 3TK1A 4H9GA 1O3YA 2SICE 3QPCA 5EWMB 1XX6A 1JHVA 5JS7A 4W99A 4YJGA 4QLOA 3CN9A 4NYMQ 2YXLA 2NUTA 5LZ4A 3I8SA 4V0NA 5C8YF 2VRNA 4G89A 4U63A 5CXBA 3N3BC 3R9XB 5GZ3A 3V00A 3FMOB 4PG5A 3MWGA 2NOAA 5ECGC 5TT0A 4FHEA 3HA7A 2B7BA 3K9CA 2VNIA 1YQGA 1FFXA 3I2GA 4B33A 1KMCA 3IJ1A 3RRBA 1QYWA 1O0CA 4J76A 2XF2A 2CV2A 4AJKA 5I4KA 4A0GA 1MFZA 5KTRA 1OGJA 4EMBA 5ESXA 5KX5B 2NO9A 3H6HA 4UXHA 1XTQA 3GFBA 1G5HA 2P9QA 2H1LA 4X91A 1RQGA 1C0LA 1LF0A 2H6EA 3IAS1 2FHSA 2B4RO 3EULA 1ML4A 3KPJA 1OWOA 4C20A 4IIFA 3O3NB 5JLAA 2RGDA 4NOJA 5IRCD 3FI0A 3HVKA 1UQUA 4GBJA 1AKRA 3LQ4A 1LXCA 3HDTA 4EJFA 3CVXA 1BVYF 2YYAA 1TF5A 3IJRA 4ME6A 4TKMA 2AZXA 5B6PA 4KLCA 4MUNA 2OY0A 3TDMA 2X4GA 2ZSAA 5FOSA 1E6KA 2IBMA 3L9WA 1GQ2A 1GGHA 1IJEA 4CLRA 4O3UB 2YXBA 3VZSA 1U04A 1NXXA 2EP8A 3AR9A 4OU4A 4PX3A 5CDUA 4DADA 4DYVA 5C9ZB 4UE3S 2R6R1 1A8QA 3KDSE 1GPH1 1GAXA 4KIUA 2XL2A 1XZBA 4OXIA 4FEEA 2VDMB 4GLLA 3TBFA 1PX0A 5EPOA 5IVDA 1FJHA 4KV9A 2G4CA 2VPZA 4IZ6A 4NZ9A 1OYVA 1ECLA 1E6LA 1CJMA 2DXIA 1U2DA 3AL8A 3CJQA 5G0SA 1KZ7B 3Q5GA 5EXEA 3J80A 3HQ4O 1RCFA 3Q7TA 1X92A 1K6XA 4I4IA 2CVFA 4KXNA 1P5ZB 4URFA 4QNRA 5EE0A 4NZMA 4J91A 4UNIA 4CBVA 3ME5A 2HQOA 4KZKA 1ZWKA 3AM3A 3DEKA 1J7KA 1X1AA 1M6NA 3WJ2A 1QPZA 2LW7A 2P2ZA 3IXQA 1YS6A 3CNBA 3C7AA 3Q2IA 4XIYA 2QX6A 3H04A 3SKVA 4XTRA 3KXDA 3OY2A 2HAEA 3NEJA 3A3PA 3KSMA 4DA4A 3KUKA 4EUKA 2K2QB 1JDUA 2VZ9A 1EIWA 1C4OA 1IH8A 5AHRA 2WF8A 1WB4A 1C7JA 2W58A 2C42A 1X7ZA 4QNMA 4KWTA 3NC4A 4WZAE 4J94A 3CIFA 3NBXX 1WMAA 2HU7A 3FM0A 2VP6A 4DDVA 2BFEA 1N0UA 4EA9A 4HQFA 1RHMA 3K9GA 2PGXA 4BWGA 1WL8A 4N3AA 1UZNA 4XUGB 3GA7A 4JASB 5DHFA 1XZNA 2JIPA 1Q95A 1R2QA 3PVUB 1FBTA 5FFNA 4GVLA 1R50A 4Z54A 4ARZB 1LPNA 1MJHA 4URWR 1WXFA 3M3DA 2YZMA 1AGYA 2WU0A 1PT5A 4D02A 3A1DA 2P6NA 4OVKA 3TBHA 5KS2A 2IZ1A 1ZUHA 3ADKA 3R7DA 2Y71A 2A4MA 5CFQA 4DC9A 1QHIA 4L0MA 4U5XA 2WZQA 3FOCA 1NJGA 3FVWA 3T6KA 3MCTA 3K1AA 3VXKA 2QX8A 4EHDA 1Z2AA 4QULA 5C2WB 1USIA 4X8HA 4QXOA 1UM9A 4LDPA 4H3KB 4UOEA 2EL7A 1U3UA 1JQ5A 4PZAA 2XOKA 2NYAA 5BVHA 4AO6A 2XGOA 5TVGA 2Q4DA 1SKYE 5F3RA 4O3MA 1MVNA 1ZUWA 4TTTS 1IPFA 3N5KA 3BRWA 5JPIA 5TPWA 5B2EA 4HDKB 1Q12A 1OWLA 1A5BB 5D2CA 2PFGA 4OOEA 1RKXA 4J86A 5A1TA 1YZYA 3D81A 2PBRA 4I1YA 1U7OA 2EQAA 2QAJA 2CXUA 3DVAA 4BE9A 4GPEA 4YV0A 2ZDGA 4RAQA 5JBQA 4C43A 4EJSB 3R1IA 2JGNA 5GINE 4EF4A 2XVMA 1Y81A 1FRZA 3C98A 3IMKA 1C50A 4P93A 2R7LA 3F4BA 2G63A 5EIAA 1WEKA 5AKLA 2B4TO 4EENA 3THWB 1J8YF 2L69A 5AJHA 3DE2X 4F85A 5DX1A 5KTYA 3PUHA 3NVQA 3RB8A 1FTYA 2G09A 4CMIA 3D1LA 4QWMA 2WDPA 3T1YB 1KMNA 4HMQA 1X8LA 4XPZA 5BN3B 5BO5A 4JLUA 1QIEA 1MXFA 4RKEA 4YR9A 1ZI9A 3CB4A 2WVHA 1P5FA 4MP3A 3DE7X 2ZUWA 1E2BA 1C4KA 5IM4A 2UU9B 5K20A 5LC1A 1QO0A 5HK9A 3H2JA 3C41J 4A2WA 4WJKA 3D7SA 2BFCB 2PUVA 2TSYB 3E9NA 4TLEA 2A5LA 2ZJ4A 2I3BA 3G2KA 1IN4A 1NSYA 2X3FA 4N0MA 3AKCA 3DULA 4BKQA 2NUAA 2J8ZA 3LHKA 3MJSA 2LNDA 3S2EA 1YCGA 4ZGWA 2P6UA 4G0UA 5JU6A 1T3ZA 4ZO9A 2B5LA 1J9GA 4C6TB 3VPHA 3Q7RA 4YC7A 1OAKA 3G2JA 1QGYA 2ZRHA 3HCFA 3DOUA 1HDIA 3IP5A 4FFMA 1D2AA 4A2CA 1CC1S 1MAHA 1AN9A 1ONSA 4NLLA 4EB6A 1TIBA 4F3YA 3KR0A 3KLOA 4Q1BA 3NNDA 4ND6A 4LMBA 1CEYA 4L3VA 3HU5A 2V8OA 5JAHA 5F78A 4U0KA 3DBIA 3FWHA 2DFNA 3UB3A 5J2UA 4U7PB 2Q3LA 5AKYA 2IDMA 5M7EA 1ITZA 3SBDA 4C2BA 4IIJB 3VI4A 1ENZA 3QPBA 2QAGB 1T9GR 4Q3DA 1C1DB 2EARA 3K20A 4YYZA 4IIUA 4B6JA 2R11A 1ZOLA 4EVRA 2QB5A 4G3XA 5JAZA 1Z2DA 2WAOA 5EWMA 4P7JA 3JRWA 1S2IA 1WXIA 5J4HA 3MXXA 4YAFA 2A67A 3KJGA 4KKXB 4HQOA 2D7JA 1GO2A 1R0SA 3B7PA 3ZKWA 2HADA 3BL6A 4ZI7B 5K0BA 4IVRA 3EMVA 2AQ5A 4X60A 4Z3OA 2PM7B 2P9HA 3H5TA 3OTGA 3WBBA 3VZRA 4RM3A 4YJHB 1W36C 2Z5LA 1ZGBA 4CZYA 4R8RA 2WWTA 4PBTA 3N0EA 1ULSA 1N77A 4FZ3A 3QG5A 3WFIA 5KX5A 3WB1A 3DS8A 3DUFB 1NVMB 4HPJB 4OFWA 2Q5CA 2B37A 4D8XA 1TM4E 2B82A 1J9ZA 3R6WA 2JFVA 5HQJA 3D2BA 2PM9B 4QPPA 4QTZA 3N0RA 2QGNA 1YUNA 4UAGA 1I7LA 3I45A 2QLTA 4HT3B 3D6FA 4UD6A 3AUYA 2J1LA 1NL3A 1F8XA 4R1SA 3JSAA 4CZVA 4FGJA 5F3DA 5A9TA 4GPIB 4O5OA 4W7IA 3FGZA 4R69A 2O2XA 1U8AA 5FTJA 4JKOA 2BFBA 3VNAA 4M8SA 3WK7A 4DC1A 3BX1A 2NT3A 3U7RA 4YO8A 2IKSA 1JXQA 4PC2A 1YIDA 3ENQA 4FONA 5JCOC 5GADl 3DL2A 2R8RA 2ERXA 5P8WA 4BBZA 3D1JA 3TKAA 4R1PA 1DIRA 2C61A 4DHEA 2L0XA 3MXTA 3QJGA 5GMKn 4BQRA 3OTHA 1SQ5A 4CEIB 3AFMA 3K6JA 2YV3A 1J0CA 2IH4A 4MUEA 5GV8A 4KGDA 5IG2A 4OM7A 4CODB 3B7FA 4TOIA 4HDMB 3SYMA 2H17A 3IRUA 5CG1A 3EGXB 2J9GA 3GR6A 2P2SA 4BAZA 2IY7A 3H8SA 3AV3A 5K9ZA 4B3XA 1N2GA 1R0RE 3TLYA 3OFND 2B2CA 3CN7A 3I9MA 5BUCA 4TYPA 4F21A 4Q1CA 3MTJA 4K9LA 3R0VA 4JD5A 2ATVA 1V47A 5I3ZA 4IHJF 3GGJA 2MSDB 2I2XB 2BGLA 4QLBA 2QLNA 1C8BA 4OWRA 3AV0B 4R81A 1PW7A 3OKFA 1RMTA 5I9SA 1HM5A 3K2IA 1WKVA 5K6AC 2J3EA 2WTAA 5AHWA 1D9XA 3WIDA 2IELA 3GU3A 4GPBA 5FLYA 5EUMA 3L07A 2AR0A 3QUTA 1U7ZA 2HO4A 3AR2A 4QTTB 1IPHA 4UPVA 2CFIA 3EFEA 3N7UA 3C7TA 4P6VF 2M98A 3F5SA 2PMBA 2CVOA 4LVCA 2QTGA 4FFDA 2GGSA 3NHLA 3ZDYA 1N3IA 4TWRA 1RMQA 4AO8A 1ZPDA 3O8QB 4ARZA 3KD3A 2DFLA 1KJWA 4O4LB 1H1LA 1CY8A 4DRYA 3DA8A 1RBMA 5JXIA 3CCCA 4TS9A 3PGVA 5HA5A 1ZRHA 4EHAA 3DDOA 1VGRA 3DC2A 1AA9A 5H3LA 3AL3A 1ACMA 3BGSA 3MFYA 1DJQA 4DRXB 5DK6A 1QHGA 1EP2B 3SHVA 4CMJA 4LYJA 1RLOA 4ESGA 3ETNA 2J3JA 3R7NA 1OW3B 2JG3A 1FLAA 4HZIA 5LZ2A 1BE0A 2FWNA 2NG1A 2VHQA 2B0JA 3LBYA 1D07A 5AUNB 3T3GA 4RHCA 2P4HX 5G40A 4RFLA 2ZB7A 3KEGA 4TTIA 5EIFA 3KPYA 2VDJA 5FPQA 5JDIA 5DLYA 2K4MA 1AV7A 1XRJA 2ZB2A 2DLDA 1N25A 3MCAA 5HS4A 1PFQA 4PIMA 2I1VB 4QUGA 4EUSA 2CV0A 2OTCA 3JAKB 3M7IA 4HNHA 5LPNA 3C70A 5AW4A 2D13A 3PBKA 4L4SA 1OI3A 3EY9A 5B7PA 3L3BA 4MUKA 4DDKA 4EUHA 1QM5A 1L1FA 1BD3A 4ZGGA 3BDAA 2XMDA 3COPA 4J87A 1BXKA 4X7PA 3DAPA 4ZTZB 3ML1A 1L4BA 1X13A 4XAQA 1ND5A 4DCCA 4EHKA 3F90A 3DKKA 5FRDA 1QIMA 1UM8A 1RADA 1WPRA 2XMGA 5D00A 3V97A 4K81B 2AI3A 1IUOA 5A4KA 2W83A 4YFVA 2FMUA 1ZCFA 2NGRA 4N5NA 2EJCA 3K1JA 3UG6A 3F78A 3C39A 2E7ZA 1EAMA 3I5YA 4R3WA 3JRPA 3AKEA 2PWYA 1VHJA 3WDKA 4UATA 3IHLA 3NOQA 1VE3A 1UXHA 1QKJA 4MWBA 3KLPX 5DSZA 5L7WA 4P86A 1Q6ZA 4RXMA 1QTRA 1CE8B 4DGSA 4DMGA 3CFYA 1AY0A 3L1VA 1R66A 3N8KA 3QLEA 4FEYA 3T0IA 1NVEA 5FBRB 1D1PA 2ONCA 4LSGA 3LOPA 3RFVA 2BFCA 4ND3A 2WJWA 3QFTA 4MYHA 2R84A 1ZCJA 2P9PC 3QLTA 4NZZA 3P5BA 3K9QO 4LYAA 1BA2A 2FN8A 3VSCA 2AH5A 2MSKA 5FR2A 5GVSA 4CEJB 1N32B 4MQ5A 3M4XA 2W71A 1XP5A 1Y5IA 1Y48E 3NETA 5BWBA 3NVMB 2D4AA 2GZDA 3GDWA 4AMVA 5JVDB 4IOJA 3JZMA 4N5DA 2BGNA 2QUHA 4EDHA 2CO0C 3WLAA 3V1TC 4W5WA 1TLFA 4Q03A 3GJRA 1FX1A 4PICA 4F72A 4RACA 2IWKA 3GEEA 4DE5A 1NR5A 4DQLA 1TEZA 4XYLA 5AFSA 2KJQA 4GKKB 1PUIA 1SXJB 2YDXA 4C0BA 1P9WA 4F97A 1RWPA 2FLWA 4TWAA 4N9WA 1K8ZB 2O5VA 1H4QA 4Q7KA 4J2OA 3A11A 5BWNA 1HNWB 2QAGA 3TI9A 4DAEA 2FZGA 2XLCA 3OOSA 1VMKA 4XUCA 1CS0A 1DFHA 2H9YA 3U4GA 1SD2A 1Q1ZA 2HBQA 2WJAA 3NBFA 1ISFA 4CIXA 4KFMB 1W88B 3U81A 3OPVA 2JFUA 3KQHA 2PL3A 3OIYA 4CLHA 1IOZA 1LDGA 1UJ4A 2W90A 5M5SA 1NF2A 2J56H 3AXSA 3ZU3A 3ZCPA 1JIJA 4JUBA 3SIWA 5AQEA 4YJHA 2WYUA 3DDZX 4C03A 2C96A 3RODA 3S2YA 5KTNA 3ON5A 3D4IA 3TINA 3EXEA 2OPHA 3MVDK 1NJ6A 1XJQA 3ANNA 1G59A 1DOZA 1ORHA 4N6NA 1DVRA 1KTIA 2PKYX 3DUFA 1L4FA 4YUYA 3F74A 1AKWA 3OLXA 3DE0X 1N2SA 1KR5A 1TXGA 2PM9A 1H42A 1B7GO 1ICEA 4HDNB 3Q0EA 1UFQA 3A06A 4BCDA 3KR1A 4P2BA 2V6JA 3EZ2A 3M9WA 1N2EA 3M83A 3OOJA 2ZB8A 4ODIA 1GLGA 1AS2A 4TV9A 2J09A 3ITNA 4JKIA 1E1MA 3NPAA 2ZAIA 1DFGA 2G9AA 1RCUA 3LWNA 4WLOA 1J90A 3F3PA 5EP1A 3KT0A 4ALNA 4JI8B 2P9LC 4U7WA 2OV1A 4PNHA 1THMA 4KG7A 3AI3A 4YIHA 1Y98A 4EI9A 2CEKA 4FQ5A 1G21A 1U8YA 4PBZA 1DCMA 4GOLD 4S35A 3MCUA 3MWFA 4X7RA 5ALJA 4K05A 2EZ4A 3OIUA 4CEIA 4PHTA 4MS3B 2GEFA 3GEGA 3ZE1B 4YP0A 5KNDD 2G6TA 3LLUA 1UXGA 4ZHQF 1EBBA 1CZOA 3SPXA 3AEKB 3PCTA 3DYBA 4TXNA 3FKQA 1KKLA 5EUBA 4K9SA 1GUBA 1OXTA 5E2AA 1FWXA 3CWZA 2YZ2A 1KL7A 1H5NA 1T2XA 3HB0A 1RJ9B 5C0OE 5E95A 3EMKA 2KB0A 4HNUA 3LP6A 2XUZA 5EJFA 2IEAA 2Z83A 4C87A 3V9AA 3EB9A 4NFYA 5LSAA 3WLFA 2BGKA 4ZO7A 2PR2A 3DFZA 3A1VA 3SYLA 2AG1A 1WETA 2HLDA 4IDGA 2PXAA 2XZGA 3TXYA 5K03A 1KYIA 4JD2C 3QENA 5J2TF 2D1RA 1FRVA 4JVNA 3MIZA 1FBNA 5J59A 1FU8A 2VDVE 1E2FA 4NHEA 1EDZA 2ZZKA 3WA7A 4MV6A 5D84A 3USES 2HJVA 3PC8C 3TQIA 1EX9A 3LPNA 1LWOA 1YB2A 1L5OA 5DYYA 4GI7A 2PLAA 1W29A 4KDCA 5F12A 3OX4A 4B4KA 3REOA 3JASB 4EL5A 4GGAA 1N8TA 1IN8A 1E2LA 4Q34A 4DLAA 1Z2EA 2I7CA 3MQFA 1Y3DE 1UAGA 1CNEA 3QWFA 3SS7X 3CNNA 3EYAA 4R8LA 2X5OA 1FP4B 4RVGA 1BOFA 4DJEC 1OAOC 4O4LA 3DL4A 4CQMB 4QDZA 2QQEA 4MA4A 1L7AA 1TCVA 3NVAA 2EHJA 4MIEA 4TLMB 1TDJA 1NGSA 2MSWA 4BJHB 3OQJA 2PBZA 1QIFA 1VCMA 4LC1A 1Z75A 4OFXA 1HX7A 2XR1A 3SE0A 2O8BB 1O8CA 1XQVA 4B3JA 1F2TA 5JNWA 4DRXA 3V8BA 1M8GA 2I7XA 2GPBA 4ND7A 5EKDA 2CBGA 4I7EA 4HLQB 2E2WA 4MGYR 5AMXA 3WZMA 4GOJA 1RYHA 4DLYA 4YUXA 1M5UA 2K87A 4I4LA 3KE9A 3HV2A 4WL0A 3OQHA 3HFJA 3UKDA 2Q9UA 2Q45A 5KYTA 2RJOA 4OIFA 3DXYA 4UC0A 3TE7A 4A9AA 4OEHA 2R7NA 4YAIA 4NX2A 2CV1A 2EBHX 3PCRB 4YAUA 3RRXA 3TL6A 3KFLA 3COYA 4K40A 4AL4A 2F4VB 3FDXA 1U7WA 1PL6A 2W4QA 3JAKA 1H2XA 3AF1A 1PTJA 2V6MA 4V39A 1PDVA 2H8KA 4TTVA 3B6IA 3AY3A 4RX1A 3PHJA 3E0QA 3LYLA 4L07A 2ORIA 1XHEA 3QE3A 3MAAC 2PDAA 1I32A 4G5FA 1GPKA 2ICAA 3FPFA 3DKIA 1Y82A 5KMGA 2NSLA 2QVYX 4OJMX 3LY5A 4CCWA 1NW7A 1PZMA 3SBRA 1G9TA 3C8MA 1Z6XA 3AVPA 4UOQA 2YQ4A 2G70A 3TOVA 1X3LA 3KJFA 2YVKA 4NCJA 2QUIA 1KH1A 2VF2A 5HTKA 2R751 3DQZA 3AB7A 4CV2A 5DM1A 4UEQA 1D6JA 1LPMA 3PEUA 5CLJA 4GI1A 4FE7A 2HNBA 4ARVA 2Z30A 1KRWA 1AF4A 3PNVA 2W6NA 3C1AA 5JOQA 1CE8A 3O4VA 3EWIA 4DVJA 4OI2A 5SZHB 2BEWA 3AC0A 2I2WA 5C51B 4JT9A 4ZDKA 3AG6A 3GJYA 4CIWA 2V6IA 3IP1A 5ESWA 4JNKA 3NNSA 2YXEA 2QGFA 5JADA 5G2OA 1VSTA 4H5IA 4U39A 5K19A 4LXUA 1AKMA 4G07A 1B9XA 4P5DA 5HTOA 1ZMOA 4LRSB 2OP0A 4WVLA 5F7JA 4PSVA 1MNAA 4YUVA 5LQJA 3W5DA 4JENA 4ERQA 4KFTA 4CEJA 4RPIA 4AY3A 3E4CA 4KO2S 4ZAWA 1NDHA 4J79A 2WQ8A 3L77A 3LQFA 4O2AB 5G3ZA 4FMDF 3KD2A 2Z1MA 2IURA 3CZ4A 3HP7A 2R85A 3AVVA 2G08A 2VWPA 1WMBA 2GVNA 2HFJA 2FPOA 1C3XA 3FKSA 4ZZ0A 3NORA 4WZAB 2CHEA 3MXOA 1WOYA 5IT9g 1JVBA 3HFRA 5KREA 1E60A 4RVFA 4LZJA 1T2AA 3W90A 1NF8A 1SXJA 2C5LA 4O29A 2HHHB 4GRAA 2PQ2A 1R0KA 4JJEA 2G1PA 1K6JA 4N8SA 1YGYA 2ORED 4KI0A 2WNSA 4WJZA 2VCYA 3KUDA 3O4IA 4RAOA 4IJWA 1N6EA 1ONNA 2QJRA 4FNAA 2XCOA 2ZRAA 1YD7A 3IO3A 1KU6A 2JGEA 4U7DA 4M1OA 3EFBA 4CYMA 1Q0ZA 1N75A 1YRLA 3H9GA 3RQSA 2YWHA 1QF7A 2OG1A 2OVFA 4RLHA 1I13A 1D8AA 1LPOA 5JANA 1Z39A 4RD6A 4BQSA 1YNOA 5DPMA 3SAJA 1IWBB 1PCXA 4EYKA 3IT0A 3GNQA 1XRRA 3R3XA 3D6HA 2DC1A 2B20A 2XE6A 1SBTA 3R5HA 5F5XA 2OAP1 4OQEA 5JJKA 5T64A 5BQPA 4E4RA 1NAIA 4N0PA 1H3NA 5CHEA 4FC7A 3C1UA 4N4AA 5DN6A 1CJCA 3T15A 2VAWA 3RAGA 2NW6A 4HDNA 3R5SA 4JI7B 4XEHA 2B4QA 4KQHA 5DTIA 5GIPE 3K8YA 1RWQA 3HHPA 4TMXA 3JZGA 4H7JA 4GNRA 2BE9A 3GRKA 3LQYA 1CJVC 1V11B 2QZZA 4P58A 4BPBA 5K3AA 1RYEA 1Z0IA 4UBNA 1ZD4A 2C5HA 2O07A 5H80A 3VGJA 2NLOA 2ZWPA 4Y6LA 2B1GA 2BCEA 3IJ0A 4BVBA 1T5HX 3UW1A 3R3VA 1QGUB 5AHKA 5H4HA 2HGZA 3WZLA 3U0BA 2QZSA 4IJVA 3GEPA 1IONA 3SLED 5AIBA 5AM2A 4UOZA 3B70A 3SF0A 3ZIUA 2PMCA 4IJMA 3H97A 1HMYA 4DCVA 2XVYA 2DMRA 5KOIA 3T3PB 4B6RA 1JX6A 2CN1A 1Z7BA 4ZOEA 2X77A 3AB8A 3V8MA 4GGPA 1TU0A 5A2Qg 2CE2X 2QTNA 3RRFA 3TTTA 3NYQA 5JXGA 2A0WA 2PZAA 2JGFA 3ZJTA 2PE5A 1CTQA 1YDEA 2XYRA 1O94D 1K86A 4B46A 1PT8A 2WQZA 2R86A 1KEWA 5EOVA 3VFDA 3UTDA 3OZVA 1O94C 5T6MA 1X39A 2WFAA 1MJFA 1ZH6A 3RT1A 3MD9A 5FTWA 3NP9A 1RWNA 2Y2VA 4C7KA 2NU8B 1UWKA 1NURA 4MWSA 1GD1O 4Z86A 5JCPA 4GPAA 3EXAA 3Q0IA 1RKQA 4L3GD 2LV8A 3ZVKA 3EW7A 2MJLA 1UC9A 3F6BX 1QG6A 2A0KA 3GX1A 3OC0A 4QDXA 2JANA 3U44B 5CJPA 1N7HA 4ND8B 1PGUA 1WXQA 2JIDA 1WBDA 4YRRA 2ZUVA 4OHOA 4JK3A 1JKJA 1PVVA 2XJ4A 4WCDA 1EWQA 3G5LA 5E6SB 2JIOA 1QIJA 3PQ4A 5C4GB 5CCEA 4CM8B 2NSHA 2E6KA 5IZCC 1D2NA 1MDAH 2OAGA 4EYEA 2GC4A 3TQQA 2RHTA 2A88A 3TE6A 3TWOA 3RKUA 1WS6A 3FOWA 2GM3A 3ECSA 2FGJA 2GJ9A 4UTRA 2JFZA 4F11A 2XGGA 1OIWA 5KNCH 2J41A 3EC1A 2OKGA 3WBFA 4MK0B 2FK7A 3FETA 1U1IA 5LCXA 1X9IA 2ZCVA 3S27A 2GLUA 1JAHA 4ZVLA 3AEUA 2QVGA 2R8ZA 1V2HE 4FYHA 3Q10A 2A5YB 2PYIA 3AUJB 1VG0B 5EE5B 4OG2A 5BPFA 4ZAXA 2XSZA 3K1TA 5JISA 4B3BA 2O8BA 3PHHA 1P45A 2X2FA 3UV3A 3V6LA 3KSBC 5B3JA 3AR7A 3T4UA 2DM6A 3EEFA 2C2MA 3OZFA 3TLCA 2J4FA 1FDRA 4XJSA 4MARA 4JXXA 3LDHA 1JDPA 1U0BB 4AJHA 5JTTA 4TKUB 4Z3DA 4FOTA 2RAVA 3F1LA 2DPLA 4JSYA 2QRQA 4Q4LA 3RTEA 1JFRA 3GFFA 5ITVA 4RZUA 2R6JA 3MOSA 3V3TA 4UVEA 3TIIA 5I5JA 4PTLA 3QF4B 3CCBA 3SC2A 2IGTA 2QTLA 1FFSA 3BJRA 4QODA 2BMWA 1ZKMA 3KTFA 1MUUA 2B8TA 5EUCA 3N8DA 4LY6A 1QRUA 1TYEA 1DC6A 2OCIA 2VF7A 2YCLA 1GVNB 4C78A 3R20A 4X7MA 2RHBA 1FNCA 3LRXA 5ED0A 3IH5A 1IAVA 4AULA 4XOIA 4QU8A 1PJLA 2C2ZA 4Z1OA 1PJBA 2ECPA 3C3BA 4YQEA 2EJTA 3DZFA 5T57A 2X58A 4JOCA 3OCCA 1TO1E 2H9NA 1PFVA 3FCUA 1HDYA 3C7DB 2X9VA 5EJ7A 1LD3A 3ZTTA 3BCHA 2H4JA 4O0LA 2XGJA 1P31A 2PUEA 4EYOA 5LZ8A 3H2KA 4EGJA 3Q7EA 2P5SA 3NBUA 1U5BA 1OV6A 4YRDA 5BNTA 3GELA 1PBNA 5AFU3 3MIIA 2P9BA 1EVKA 5DMHA 2WIDA 1F2UB 1MVOA 2GM4A 2QUJA 4TYWA 4PYRA 1XEXB 1I2AA 4ENWA 3TGPA 2QD2A 1O6FA 2Q2VA 3W2FA 2OUKA 2ROQA 5CDYA 1RAGA 1E0SA 4IIGA 3WLQA 4DBLE 2JI9A 5JMWA 3DFKA 5HE1B 3QRWA 5CT5A 1N3LA 4HP8A 3N2YA 4QDOA 5CVVA 4LYHA 5SV2A 3K70B 1WTCA 1GOFA 1PT6A 3GRZA 1JDBB 2ZBRA 5AXCA 4EHFA 3M4ZA 2FEOA 2JDID 4C4XA 4TRMA 2AC2A 3I05A 2FUNB 2DVMA 3OZWA 1B6SA 3EASA 3QITA 4HLNA 3PD1A 1EUYA 4PYQA 1X14A 3FFXA 4ERXA 2FW7A 2F3UA 5GM1A 3UAXA 3BN3A 2ZVDA 1DU4A 4F9GA 4L0QA 2HDHA 2XB4A 4NU6A 5F9FA 3BRQA 1N0WA 5DP2A 4FYWA 1N1EA 1TD1A 5GV7A 5BW4A 3UAWA 4P4UA 1AZWA 5IAEA 1KBQA 2YNNA 2JIZA 5WRFA 3O31A 4V1CI 4IDEA 3LVBA 1KP9A 1RT9A 4JC0A 3MRSA 2VXYA 3F2IA 3JYOA 3DEJA 2ARKA 1ISHA 4I8XA 1PJ8A 5I3CA 3BJZA 4WZAA 1ORWA 4WKNA 1LNSA 3SU8A 1GQYA 1QHHA 3PWTA 3W05A 2Q50A 3FHOA 4AOWA 2YMPA 5AVZA 2PTGA 3CPSA 4FNMA 4XCQA 4B0PA 5FEMA 1SKBA 4LGCA 2OD2A 1MQAA 4RYLA 4II7A 5EQTA 2EW8A 2QP4A 4IVQA 3HJFA 5KWEA 1BXRB 1W96A 2JI4A 3CU5A 1MW8X 3AM4A 4R9SA 1C5KA 5IAJA 1CR0A 4TL9A 3DM5A 1DC5A 1GTRA 2JARA 3QFFA 5JDCA 1A2QA 4BS9A 1KDZA 3FE2A 2O5RA 4R1MA 2OGUA 4LQDA 3IILA 5FPTA 1WWKA 1W6RA 4PFSA 1BEZA 4FK8A 2XKBA 1H2RS 1BMDA 1JSLA 3TR6A 3E7XA 4RFVA 4D96A 3K2EA 5ALQA 2H47A 2X7JA 1YB4A 4WK0A 2YNOA 3AR6A 1C3JA 4ERNA 1GA1A 1R18A 1QV6A 4DMMA 5ALNA 1OTHA 3I0MA 4JX9A 4ZV7A 5BV0A 3QHYB 4DNWA 3DDSA 3RSFA 1GITA 2E82A 1EUZA 4YAWA 4DLKA 1NASA 3FUTA 3MAGA 2UZ1A 1HKUA 3RT9A 2OQIA 2PGJA 1FQKA 3C85A 1NI5A 3VPGA 2HK7A 4QC2A 1ZMTA 1W19A 1TL7C 1ULZA 1V11A 2VPPA 5JCZA 2AJLI 4DCGA 1DIBA 4HYYA 1NPTO 3BSWA 1F4PA