3IVMA

Appep_wt+pp closed state
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
682
structure length
682
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords prolyl endopeptidase
total genus 210
structure length 682
sequence length 682
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3ivmA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ivmA01
4B0PA 5JADA 4YK7A 5JAOA 2P8SA 2BGRA 1EDEA 3DYIA 5SYMA 5H3HA 2HL6A 1MAAA 1QO7A 4B82A 5C8VA 1YAHA 5HQ3A 1XZJA 4EUSA 2K2QB 3DJYA 4BAZA 3DKRA 1MNQA 5EIHA 4O08A 5LZ2A 1QTIA 3O9VA 2ZJFA 3KWFA 2QM0A 1R1DA 2WUGA 4B83A 4X6XA 5ALFA 3NGMA 2JBWA 2WFLB 4AQDA 5ESRA 1QLWA 5JD4A 5LZ5A 3WQHA 5FUMA 2WIJA 5D3ZA 2QUAA 5T4EA 1XKLA 2QXUA 2BUCA 5LZ9A 1L7RA 5LKRA 2HFJA 4G9EA 4YX9A 1Q84A 5FP0A 5K3AA 1WHSA 2OQVA 1X70A 3UUEA 2B9VA 2QJRA 4FLFA 3WK7A 3C6YA 2J3QA 1XQYA 2XLCA 3BDIA 1RP1A 4C6HA 4X92A 4BTLA 4BVLA 3LP5A 5CW2A 4BC1A 1QTRA 5KWIA 4HXFB 4V2IA 3O9MA 3SX4A 5HCUA 2OG1A 3W9UA 1ISPA 1CQWA 1ZGCA 1QIGA 2VF2A 1W6RA 4FTWA 3FLBA 1BROA 5D6OA 5AI9A 5AKEA 5AH0A 2FX5A 1MX9A 2OLEA 2W22A 1ZD4A 3ESAA 1XZBA 1MX5A 1CUEA 2H9YA 4BCBA 3VVLA 4J7AA 2HM7A 1WHTA 3B3QA 4G1FA 4C4ZA 1BS9A 2Y6VA 3UMJA 2OAGA 2WG1A 4AO7A 3RKSA 1UKAA 2QVBA 1ZI6A 4YPVA 3D59A 4G8CA 4B84A 3WYNA 4J0IA 4B81A 2XUIA 1JI3A 3G9UA 2XLBA 2XQIA 5AKGA 2PSDA 3AJAA 4Q3OA 1CUFA 3NOXA 2ACKA 2IX9A 5CT8A 3H2HA 2WIFA 3G9TA 5ALXA 2O7VA 1YB6A 2VJCA 1O6GA 4KEAA 2XUQA 3P2MA 4Q05A 1J1IA 4OYLA 5F4ZA 1SCIA 5A7FA 4WY8A 3H2IA 3C8DA 2JF0A 4FFWA 1ZI9A 1AX9A 3FSGA 5CRIA 1J2EA 1RWQA 5E4TA 1IUPA 4HXEB 3G7NA 3FYUA 4H77A 4AN1A 3G8YA 5FPPA 5ALSA 1QIJA 3VVMA 1BU8A 3WK9A 5HKBA 2OCIA 5HF6A 3R3ZA 1XRMA 3AFIA 1MNAA 1H2WA 3D3NA 3FCYA 4BAGA 1XKTA 4HAIA 4PSCA 3LLCA 4C4XA 5BWCA 3C6ZA 2PPLA 4GEGA 5LYYA 1UFOA 3HJUA 5DJ5A 3ZWQA 4K2AA 1ZGBA 2WJ6A 2LIPA 2Q0XA 4QEKA 1ORVA 5AKXA 3I6YA 4NS4A 5IVHA 5EHQA 5AKYA 3W06A 2XB6A 4LYEA 5AM3A 1QIKA 1QFMA 1XZEA 3L1IA 5DLPA 1TQHA 3E1GA 4OPMA 2ZSHA 4BVJA 1MT3A 4XJVA 1VE6A 2ZJ7A 5DYTA 3WJ2A 3V1KA 5J3JA 3JWEA 2PSJA 1XFDA 3O95A 2XUAA 5AI0A 1CPYA 2XMBA 1QO9A 4XX1A 4AXBA 3LCRA 3QYJA 3OTQA 4C01A 4HTAA 1ZIXA 4Q3LA 1I6WA 2VQ6A 1QIIA 5LZ7A 2XMCA 3I2HA 1IUOA 5JAPA 4JNCA 1LLFA 4OYYA 1BCRA 1ZD2P 1TCCA 1BRTA 1LGYA 2BGNA 1GQSA 3C8HA 5AM0A 4ETWA 1XLUA 4MXDA 5T4HA 3H2JA 1BCSA 4UBIA 2C5FA 5K3FA 1CUVA 2G5PA 1IVYA 4HRYA 2OGZA 2C7BA 3EQ8A 4UHBA 5K3CA 5I8PA 3M83A 4ARBA 1SCKA 2PVSA 1NU6A 1ODTC 4B6GA 2AJDA 2VAVA 4N5IX 3FOBA 3VXKA 1ZICA 3C6BA 4J0CA 3O4IA 4GI1A 4PV7A 1Q0RA 1G5FA 1L7QA 5LZ4A 4ZREA 2XQFA 1WB5A 2XUGA 5AIBA 3QH4A 3WZLA 1OXMA 4J0KA 4B85A 3ICVA 4XVCA 3WL8A 1S8OA 5AOBA 5JATA 4BZZA 1MO2A 1WPRA 2HFKA 4AB1A 5ALZA 3IVMA 2VAXA 3HC7A 1E5TA 4MYSA 1VXRA 3WIOA 3FBWA 1H2XA 2PU5A 2WIGA 1Z68A 1X2EA 4Y2JA 3WWPA 2DFPA 5DTIA 4C87A 2HRQA 5AICA 3QMMA 4DMCA 4FDMA 2VA9A 2FJPA 3A2NA 4KE8A 4U2CA 2FJ0A 2PUJA 3PICA 2VJAA 3G0BA 4BDSA 4GXNA 4X6UA 2YXPX 4ZV9A 4DMFA 2ZSIA 2AJ8A 4U2BA 1XRLA 3BXPA 3C70A 1T2NA 1AKNA 2V97A 1XRNA 1H23A 2XQKA 1IMJA 2IITA 3RK4A 3U0VA 1EB9A 1PJAA 5DYWA 1DWQA 1BN6A 2QT9A 3BJRA 5HF5A 1OCEA 2WKWA 5DNVA 3I28A 3D0KA 3DQZA 4AO8A 2CJPA 1NU8A 4FLMA 4ZV7A 4CIAA 2WU3A 1YR2A 4N8DA 4A5SA 2GBFA 3SC2A 3IULA 5T4FA 5ALYA 1EA5A 1OILA 4QDXA 3HYSA 2D0DA 2WM2A 3EQ9A 2E3JA 4H18A 5C81A 4E11A 1O6FA 1YCDA 4IHAA 3LIPA 3PFBA 4KAJA 2PL5A 2WLSA 4Y2QA 5JD6A 2RGUA 5FV4A 3QVMA 1GT6A 2QKYA 2HDWA 3WL7A 4HXGA 2XMZA 2QTBA 4FNMA 4H7IA 3O4HA 2IIVA 2JEZA 4RNCA 4Z49A 2RI6A 5AK3A 1SC9A 2OAEA 2ZYSA 2WQZA 2Y2UA 4CG3A 4KAFA 4K6HA 1K4YA 4BAUA 2HA4A 3WZMA 3CN9A 4IH1A 4ZWNA 4J0DA 2XUKA 4BE9A 4X6YA 4EY7A 3ZLTA 2CZQA 2I78A 3EBLA 4IO0A 3W9BA 4UHFA 4PQEA 5JZBA 2PSHA 1ACLA 4UBOA 5AM4A 1TCAA 3BWXA 5AM1A 1TCBA 3WJ1A 4BBZA 3KOOA 4OD0A 3IUJA 3HEAA 3BIWA 5E2IA 3WMRA 1U8EA 1DX4A 2WHPA 5AK5A 4LIPD 5AO9A 1EHYA 2BCEA 4RE6A 2CEKA 3G0DA 5EIEA 3F8SA 1E3QA 1GKKA 1VOTA 1FFBA 4CIBA 4QDTA 1TKRA 2C5GA 1YASA 4KE7A 1VKHA 3R40A 3RARA 1JU4A 4QLOA 2G4LA 4N8EA 3QZUA 2WUEA 4QWWA 5FKJA 4J3JA 4CCYB 3CXUA 5AM5A 3F97A 4IH9A 1TK3A 4BATA 1W76A 3VKFA 4GECA 4K6KA 5AKLA 4WFJA 4EHBA 2V9ZA 2VSQA 4RE5A 2WTNA 4C88A 1LBTA 3WA6A 5KREA 1W4LA 1TRHA 1E8DA 5ISMA 4Y2UA 1W75A 3FVTA 3WL6A 1YS1X 4FWBA 4MYDA 3V9AA 2R8BA 1LPNA 4OB8A 1VE7A 3HACA 1C7IA 3N2ZB 1XZFA 4F21A 1CUDA 1THTA 5IH7A 4PSUA 2I3DA 3PDCA 4I3FA 4BVKA 5IKXA 2DHEA 1CQZA 1XLVA 2WHQA 1Y37A 4JEIA 3STTA 4DMHA 2XMSA 1QJ4A 2YASA 1R3DA 4MQMA 4TPKA 4G4IA 4I4CA 3UUFA 2DCMA 1XZAA 3WI7A 3H19A 1B41A 4DSZA 1ZJ5A 3A2MA 1J06A 4HS9A 1PFQA 4UFPA 3G9XA 4L3WA 4QDUA 4FBLA 2O2GA 1EK1A 2JGJA 5CXXA 2HA3A 4F5ZA 4XIIA 2VJDA 5D3KA 4KRYA 2WIKA 5EIAA 3FLEA 4H7FA 4GW3A 3F96A 2DR0A 5E4YA 3C45A 3Q8WA 4CI9A 1GGVA 3FAKA 3IA2A 3EF3A 2XMRA 1JU3A 1H2YA 2XQJA 1R50A 3TJMA 2J3DA 5IVDA 4B7ZA 4B0OA 5JZ9A 5CBKA 2Z3WA 1JJFA 4B9EA 3W05A 3V1MA 4ZRDA 5ALOA 5JANA 2B4KA 5ALHA 3D2BA 3H0CA 4OU4A 2CMFA 3M82A 3G0CA 4ITVA 3V48A 3S2ZA 5HK8A 1FSSA 4OU5A 3ANSA 5ALQA 3STXA 3HXKA 2J4FA 3O0DA 3PUHA 1UK6A 4L72A 1CUJA 3IUNA 1LNSA 1A8QA 1CLEA 3FCXA 4UHEA 2OCGA 1FFCA 4KACA 2VEOA 1EXWA 2WFLA 4CG2A 5AIAA 3FYUC 5AOAA 4A23A 1LPMA 3BJMA 5CMLA 4H7EA 4LKOA 2WJ3A 3OURA 3DD5A 5LLSA 5E4JA 2HADA 4M0FA 1CUXA 3C87A 4KE6A 1EVQA 1UOOA 1N8SA 2OQIA 4QNNA 4UFOA 4BDTA 3TEJA 4W1PA 1W52X 4WCVA 3AZQA 4Y2RA 5HF8A 4PO3X 4BP9A 4CCYA 2RIPA 1R9MA 4F0JA 4JYMA 4FHZA 5A2GA 2O2IA 1LZLA 5JD5A 1AGYA 4WDQA 3W2TA 3G9ZA 4LYDA 4Y2PA 3GUUA 3DYVA 2WSLA 2BUAA 2VT6A 3Q0TA 3WKBA 4H7DA 2OGSA 2HA0A 5C8XA 2C0PA 3AZOA 2PSFA 1MJ5A 4DLNA 2QOEA 4F60A 1CUCA 2G5TA 2Z5GA 3ESCA 5AJHA 3L1JA 1L7AA 1CUIA 3STYA 4AMZA 1QIHA 4P93A 4NMWA 3DL7A 4KJXA 5HFAA 5LP1A 1QONA 4LXHA 3CCCA 1H2ZA 3FSGD 1MTZA 4EZIA 4MJ3A 3MVEA 2WFZA 2AJCA 1FFDA 4UPDA 2WG0A 3FNBA 1Q0ZA 1H22A 4X85A 4W1RA 5I9IA 4OUKX 4DSAA 5T4BA 2HA5A 3T52A 1DQZA 4DYHA 2EEPA 5CH5A 5AI8A 4Y2YA 1XZIA 4UUQA 4X71A 2EDAA 2C58A 1ZI8A 4UFNA 3YASA 5EGNA 3BDVA 4EB0A 3A70A 2PSEA 3M3DA 3WWOA 1GZ7A 3OOSA 1DWOA 4U2GA 1QOZA 1XZLA 4DMKA 1P0QA 4UBMA 4TVKA 2WU4A 1U2EA 3L1HA 5FPQA 3G0GA 2PX6A 3G02A 2DQZA 2H7YA 1KU6A 4YASA 1YS2X 1UWCA 1TIBA 4I19A 4AX4A 1CUHA 1G42A 5CTAA 3QPCA 4J0JA 3HZOA 1YA4A 1J07A 2JGMA 5AKJA 5ALEA 3K6KA 2RONA 3R3UA 3S8YA 3EIOA 3DKKA 3KD2A 1CUZA 1AUOA 1IZ8A 4KR0A 5HF9A 3BL8A 5FRDA 4DGQA 3VDXA 5ALWA 3R3VA 2BKLA 4FLEA 1QZ3A 2JEYA 1K5PA 4CCWA 2H7XA 3RM3A 2XQGA 4AZ3A 5K3DA 1MX1A 1MN6A 5ALVA 1EX9A 3H1AA 2ROQA 1MAHA 3H18A 3JW8A 5CT4A 3STWA 1F0NA 2WFMA 3E0XA 4G8DA 1F6WA 2QUBA 4JYPA 3HI4A 1G4HA 1CUSA 1AZWA 1DU4A 5CH8A 2QR5A 3GFFA 7YASA 5AOCA 3IURA 5FOQA 3I2FA 5AI5A 1SOMA 3M81A 1JKMA 1GPNA 1XROA 5AI4A 3OG9A 5K3EA 4BCDA 1ZD3A 3AINA 2DQYA 5AI6A 3QITA 1E8MA 5D7BA 3R0VA 5DNUA 4GDMA 1HLGA 1ODCA 3QMVA 1R88A 4G5XA 1AURA 4ZI5A 3WKAA 3C43A 5HQ3B 2WJ4A 1WM1A 1FFEA 1UZAA 4Y2SA 5K3FB 1YA8A 2GBCA 3W04A 1F8UA 3DL4A 4QLAA 4WFIA 2DHDA 2OPHA 4AN0A 5JAHA 1CEXA 2R11A 1DWPA 5EI5A 1WOMA 4UBNA 4M0EA 3D7RA 4CFSA 1CIJA 4W1QA 1ZJ4A 3QMWA 4BRSA 2HU5A 3AIOA 2QS9A 1RYYA 4EBBA 4DM7A 1U65A 5AK6A 4EY5A 3WK5A 5SYNA 5DYYA 1UOQA 1GQRA 1XQXA 4X3CA 1LPOA 4BYMA 2H1IA 4AZ0A 3VJMA 1MU0A 3LIIA 3AUKA 3BIXA 5BV7A 3GROA 5BOVA 1A8SA 1W1IA 3ED1A 3U1TA 2BUBA 5EHZA 3B12A 1JT2A 4H0CA 4L9AA 1CUUA 5ALPA 3WWEA 3R3XA 3RLIA 5HK9A 3ANTA 4DIUA 1ETHA 3WKEA 5A7HA 1KU0A 1CVLA 5IVKA 1BEEA 4X7BA 5K3BA 3PF8A 2JGIA 2OCKA 1LBSA 2ACEA 3I2JA 1EH5A 3GZJA 2XUHA 5KWJA 4Y7DA 2W6CX 1R4ZA 5JAUA 5ALUA 3KDAA 2VT7A 4OSEA 2XUJA 5ALTA 1QGED 5ALLA 3WK8A 3WYDA 4BC0A 2XUDA 3I6ZA 5HZGA 3KXPA 3AILA 1TAHA 2QXTA 1QIFA 4BTVA 3WLAA 1QFSA 5A7GA 2BAGA 4OB7A 3PF9A 2ZJ6A 4Q82A 2ZYRA 5DWDA 1C4XA 1DT5A 2HRRA 5ALNA 2X8BA 2RAUA 2WHRA 3WIBA 4AO6A 4RPCA 3ESBA 4P9NA 5EFZA 3HLKA 2ECFA 2XDWA 1QIDA 2JGEA 4DNQA 1Y7IA 2VATA 2J4CA 3NWOA 4P92A 4DNOA 4LXGA 4EA6A 1XRPA 2PUHA 1UK7A 4UBKA 3V1NA 2AJBA 5CT9A 1Q83A 3WWCA 4Q1VA 3E4DA 4FNGA 2G63A 5YASA 3FYUB 1CUBA 3IUQA 1AQLA 3OC0A 5ALJA 4QA9A 3PI6A 5EHNA 3I6MA 4N5HX 3D4LA 4ROTA 1ZOIA 2HIHA 1QE3A 2WUDA 4GBGA 5HKAA 2O7RA 4QWMA 4E14A 2Z8ZA 3AIMA 1HPLA 1QIEA 3ZPXA 4N8SA 1AMNA 4H7JA 5FXMA 4NZZA 2XMDA 1FFAA 3IIIA 2FUKA 1GXSA 5AK4A 1B6GA 1ZIYA 1BN7A 4KE9A 3I1IA 1A8UA 4BCCA 1GKLA 5CT5A 5ALIA 1NX9A 2CUTA 2YH2A 4QDZA 4FBMA 2QJWA 3PUIA 5CT6A 4B9AA 4QZVA 2BJHA 3SK0A 2HA2A 2RHTA 2JGFA 4K5QA 1DINA 3IUMA 1EDDA 4UBJA 6YASA 3WKDA 1EVEA 1UK8A 5ALKA 5A62A 1EI9A 3D2AA 4HRXA 2XUPA 3H2GA 4GHWA 3R3WA 3KSRA 1HDEA 3DCNA 3ZI7A 2DHCA 1AC5A 4MEBA 1WCYA 3VISA 4UBLA 1DT3A 5DNWA 5AHXA 4BRZA 5AKIA 2AJLI 3A2LA 1N1MA 3QPDA 3FVRA 1JMKC 3DLTA 1HBJA 3C6XA 2DSNA 5EHXA 3AIKA 3F67A 1WB6A 3WWDA 3QBJA 1XZCA 2UZ0A 2GYVA 4J0HA 2OXEA 3LS2A 4U2FA 2ZYHA 1CUWA 1XRQA 3FWHA 1CFJA 1WPXA 4DTCA 4QDOA 5AKHA 3V1LA 4X90A 2XT0A 1XQWA 3K9BA 1ZD5A 4GLBA 2GBIA 3GELA 3D5EA 5JARA 3STVA 4AMYA 3WK4A 3DOHA 1LZKA 2WILA 4FKBA 5BWBA 4PNZA 1IUNA 1XZMA 1HKHA 2VJBA 2X5XA 4MWSA 3JYHA 4P08A 3E3AA 1P0IA 5JIBA 1N5MA 3NUZA 3PE6A 1EINA 3T4UA 4J0GA 3IDAA 1XZHA 3R41A 1E66A 3DEAA 2Z8XA 4G9GA 2V96A 4GWLA 4HZGA 4W1SA 1CV2A 3DDUA 3WKCA 5A6VA 2CBGA 1XZKA 4C4YA 1VA5A 4KYVA 3IBTA 4MQLA 3MUNA 1WB4A 1USWA 2RHWA 2JIDA 4OCZA 3C5WP 1E8NA 3H04A 1GPLA 4UHDA 4Y2TA 4X93A 3HABA 1BE0A 2WIDA 1VZ3A 4JH0A 4BZWA 3BE8A 2JGKA 4EY8A 4Y9SA 2B61A 1XQVA 2WUFA 4TGLA 1MPXA 5LZ8A 4C89A 3BF8A 3N0TA 3PFCA 2Y2VA 3MGAA 4H7KA 3EQ7A 4U2EA 2Z3ZA 3D2CA 4W9RA 4CG1A 1JJBA 1K63A 4G4JA 2H7CA 1GPKA 4X91A 5C7YA 4NVRA 2BFNA 3OPMA 2PKYX 1ACJA 2ONCA 3QPAA 1XZDA 2XE4A 4WY5A 1F0PA 3O4GA 2QZPA 1UK9A 2CKMA 3I2KA 1Y7HA 4ZGBA 5CH3A 1VXOA 4Q3KA 3GA7A 1DX6A 4KAAA 1SCQA 4RGYA 4A16A 5DTJA 4X95A 5K5EA 5JASA 4EY6A 2XMGA 4H35A 2HU8A 1ORWA 4Q34A 1ODSA 1UKCA 2GBGA 2C4HA 2WG2A 2V98A 4UHHA 1KEZA 1VA4A 1EB8A 5ALGA 3G0IA 2HHAA 3TRDA 5JZSA 1HL7A 1YAJA 1IZ7A 1CUGA 4S0XA 4ZXFA 3DS8A 2I03A 2XUFA 3KWJA 2GZSA 1CR6A 2D5LA 3K2IA 3F98A 3I2GA 1P0PA 3OM8A 4INZA 4L0CA 4PF1A 5AKKA 4HVTA 4OB6A 1SFRA 5AM2A 2WTMA 4FFVA 2CB9A 2Y6UA 3ESDA 5A71A 3CN7A 5HFNA 1A7UA 1R9NA 4BB0A 4FOLA 3ZLUA 4M0MA 5KBYA 4G8BA 2WHPB 3C5VA 4JUIA 4EY4A 1E89A 1D07A 1G66A 3HSSA 1UT6A 3GBSA 2X76A 4UHCA 2XUOA 1K8QA 3DNMA 4QE3A 3IB3A 4WJLA 4E15A 3B5EA 2XI4A 3ICWA 5FDFA 3WK6A 3VJLA 4WDRA 5JALA 4PW0A 2GZRA 2C0QA 5ALMA 5LIPA 1CRLA 2Y1KA 2EDCA 1YB7A 3O4JA 1YSCA 2HU7A 3I2IA 3BF7A 3WL5A 4MEAA 1XLWA 2YYSA 2NW6A 1EK2A 2I3ZA 1UOPA 4B80A 1UXOA 1FJ2A 5ALRA 4W63A 1N5RA 5LKAA 2HA6A 3H1BA 2O2HA 2ORYA 3DOIA 3WA7A 3R3YA 1A88A 3CCBA 5I7UA 4Y2XA 2ZVDA 1DTEA 5CXUA 4DNPA 2OCLA 1PV1A 2PM8A 1XZGA 3SWWA 2AXEA 5AP9A 5JYCA 1C7JA 3H2KA 1XRRA 3F9CA 4K6GA 3HRHA 1EDBA 2VTVA 4Y2VA 3ZLVA 5ALDA 3ZV7A 1CUAA 1VZ2A 1VLQA 3I1YA 4IH4A 4X94A 2B20A 2PU7A 1U4NA 4U2DA 4X00A 2GYUA 2OGTA 1HQDA 1T4MA 1JFRA 1K6EA 3FLAA 1JMYA 5C8ZA 4BE4A 1P0MA 5AKZA 1VJ5A 2PBLA 4BP8A 4LXIA 5CURA 4KRXA 2XMQA 5IVIA 4DNFA 1THGA 1LPPA 4MWTA 4G4GA 4WFKA 1DQYA 4PSDA 3MUOA 4ARAA 3STUA 3TGLA 4J03A 3QM1A 3FYTA 3AZPA 2HA7A 4FMPA 4H7HA 1UKBA 1LPSA 5FLKA 1LPBB 1JJIA 3H17A 1QIMA 4XWGA 2GYWA 3ILSA 1CUYA 2JGLA 2QRUA 3X3HA 2ES4A 4D9JA 4E46A 1LPAB 3A6ZA 1X2BA 4LHEA 2QMQA 4IQ4A 1BEZA 3VJKA 1M33A 4X97A 2ZYIA
chains in the Genus database with same CATH superfamily
4BVFA 2WJYA 1KI8A 1UXJA 1ZNXA 2BTEA 4DLRA 1BVYF 2G72A 5IH3A 2VPTA 2P8SA 1BVUA 1I14A 1XQ6A 4QGFA 5EGSA 5C3UA 1UPBA 3BRSA 1IG0A 1NC3A 4O45A 2IY9A 3DYIA 3HJRA 4X1IA 3ZZ0A 5SYMA 3ZDZB 1DO0A 2P5SA 3EVBA 4BO8A 1V2HE 4HYTA 5KNCH 3JSXA 4F7WA 4ZIRB 1TTQB 2WWHA 4GWKA 1FRZA 3A6JA 1GV0A 3QA3E 3LC1O 2AEMA 2QRMA 2RDMA 3SVZA 2R6R1 1A5BB 2YCBA 2RHOA 3GDFA 3JAKA 4I6JA 221PA 1XZJA 3ZXYA 1CY1A 3DJYA 5A03A 2QRNA 3QI2A 1Y3DE 2DQ4A 3DKRA 3D5TA 3RRBA 1YL6A 1QLJA 1M0TA 2EG5A 2EX1A 4WERA 3KTDA 3TVTA 2HESX 4JSXC 4GGPA 3LPLA 5BUQA 1CNFA 3ZE0B 4C2UA 1FRNA 2QM0A 3QIAA 5DIFA 4G5QA 4TKUB 3EULA 1AQ6A 1FQKA 1E5VA 3AMVA 3CRNA 3TVDA 1J25A 4TMWA 4GM0A 1A95A 2O9KA 4R71A 4ZMBA 4B83A 1H9BA 3OFSA 4FCCA 1OFUX 3QFRA 4Z9YA 3ZEAA 2DTDA 2DY0A 3WYGA 3EVAA 1TT7A 3I62A 1QLWA 3IIWA 1NUPA 1DXYA 2BDTA 2EXXA 3N3BC 1BDBA 4IHJB 1M10A 1P9LA 1OIWA 4PFKA 1I3CA 4QJIA 3G6KA 1R0XA 5MFPA 4KP7A 4WX2B 4HOYA 2I7TA 1X3SA 5T4EA 1G63A 3WGQA 4NBNA 1BA3A 4EGCB 3DMPA 2BUCA 3FNIA 4NYIR 2O7QA 5LN1A 3X2EA 3OMLA 1YZLA 4YJKA 2ZETA 3QTTA 1CLUA 1AHHA 3C7AA 3GH3A 4IZOA 5K03A 3D6FA 4LOAA 2JLVA 2HFJA 4RKRA 1GFWA 3DGEC 4G9EA 3MD0A 5LD2C 1ECLA 4BO5A 4BFZA 2AE2A 1IAVA 1DDIA 4XJTA 1YZQA 2C2WA 3VYRB 2R4TA 5FP0A 4MPTA 4DYVA 1TAUA 4YYZA 3C3PA 1C0KA 1OI3A 1PWHA 2POQX 3AJ9A 3IQDB 3R44A 5ILGA 1IOLA 3KFVA 3UJ7A 5DEIA 4IOJA 4E09A 3PPYA 2J3QA 1UMBB 1W8DA 4ZHQA 3Q3HA 2XLCA 1A4XA 3QVSA 3L46A 2HJHA 1DO8A 1FDRA 1SB8A 2I3BA 2J85A 1RP1A 3QQPA 1NTRA 4HAVA 2IYQA 3C6QA 4BTLA 2PD3A 5CD1A 3LT0A 3LP5A 4BC1A 2W7TA 2AOTA 5EUCA 2CL7X 4A26A 4XUEA 1NLFA 4RD3A 3VH1A 1FW6A 1DPGA 5CLGA 3UVKA 4V2IA 2IHKA 5GVSA 1DFIA 3I05A 1TE2A 3O9MA 1ZMBA 2XUZA 4HTFA 1DC5A 1M2GA 4N3CA 2QZZA 4BNHA 4BO9A 3I9OA 4Q48A 1VYHC 1E3SA 2B37A 3PVCA 2AD1A 1WABA 2VK1A 3R7SA 4K9QA 1JFFB 2VF2A 3PDIB 3RSQA 4DLTA 5K0EA 3WL4A 1M2FA 1XN4A 3ORYA 4ZU1X 3ZCRA 4ZQCB 4DDUA 2AEFA 5FEMA 4R0VA 3SNHA 3ZU2A 4A8JC 1JDBB 4AF7A 5A4KA 5K8CA 4RTMA 4XIJA 2P2CA 2QMHA 3E7FA 3ZU5A 2FX5A 4KQ2A 1GSOA 2CXSA 2YXNA 4J1TC 1XLTA 3WLPA 1YULA 5ED0A 2F3SA 2ZTMA 3H1FA 4P7KA 4NR0A 2FLWA 3GRPA 4JD5A 2DXIA 4AYWA 2NSYA 3FA2A 2X2EA 3KU4A 1CS0A 2I1LA 3L8MA 2B99A 1J8QA 4RY8A 5DP2A 4ZAGA 3KQKA 2H9YA 4E2ZA 1T1EA 4Q4HA 3VVLA 4J7AA 3OSZA 2O9JA 3CLSC 4ZRMA 3TAUA 3USZA 2JHCA 3GLGE 3BSSA 2ZSFA 2BFBB 1Y5MA 2GSDA 1YE5A 3NBMA 3P4XA 4G1FA 4QGGA 2LP4Y 4ZVSA 3UHAA 3K6SB 1GPUA 2Z2JA 1KS9A 2GZ1A 2J3LA 3H9UA 3L02A 1T0BA 3PGMA 3UICA 5BN3A 1FJGB 3B9PA 2VXOA 4P22A 1NXXA 4TL8A 4OBEA 1VJ1A 5CHYA 1UDWA 1CDDA 1CNEA 3A05A 2W6PA 5MN6A 1UKAA 2VF4X 4YPVA 1LJUA 2GZDA 2H1VA 2IEBA 3D59A 4JUFA 4KOAA 5D5PA 1SUBA 2WT9A 1W35A 2O5RA 1K89A 2CXNA 2XT6A 3BQNB 3Q85A 4J0IA 4JJ7A 5TGTA 4WVFA 2XUIA 4D3ZA 4C7OB 1BC5A 4FYYA 4IUYA 1W9MA 2FR8C 4RPKA 3PUXA 4UMVA 3RG8A 5JPCA 1U80A 3G9UA 1ZVJA 3HVRA 2XLBA 5FA8A 5FPTA 1UJ4A 1EZ1A 1FEZA 1FFWA 3T3EA 4BU1A 4L5AA 3RADC 4DLXA 2O8FB 2VP4A 5IU6A 5AHOA 1REQA 1UPUA 2VP5A 2B5VA 2FMXA 4WT7A 1WBJB 2X1LA 4EG8A 2ISCA 1G7RA 3AR2A 4S1WA 3HA3A 3B3AA 5CT8A 1EU1A 2IX9A 3KUKA 3L7DA 4CMEC 3OWXA 2JAXA 4LDPA 5KJ1A 1BX1A 5ALXA 2VJLA 4A2WA 5HKKD 1YQ9A 6REQB 4RENA 5CA0B 5JXJA 1RHRA 1ZL2A 2I6SA 1U0HC 4R4JA 3DWEX 2P4QA 4KEAA 1HWYA 4AWAA 4KVZA 1VB3A 3NVKI 1J1IA 2Q5LA 1P44A 1U7HA 3DXFA 3KHTA 3QTBA 4HK4A 3VC3A 4C08A 3B1XA 5A7FA 1HLPA 3MUEA 5FWYA 4WY8A 3H2IA 3DKPA 1MW8X 4KVFA 4M7RA 3PUVA 4HG2A 4DKJA 2PKEA 2RAPA 3NVDA 2HREA 4FFWA 5D6NA 3WTBA 3VA7A 1E98A 1M74A 5KOJA 1Z6ZA 3MCVA 1GU0A 3TTTA 1AX9A 2V5UA 3NTQA 4KPUA 1R0LA 4QELA 4Z9AA 3SIPA 3U7RA 1RWQA 5E4TA 1I3OA 5EIFA 3AI1A 2VJOA 4RJJA 4I8DA 3AKCA 3K9WA 4I36A 4ENWA 3TKLA 3GJRA 5F73A 1FLVA 2PLRA 4O2AB 1MXFA 4HXEB 2R8XA 3I34X 4AN1A 1BYUA 1R6TA 1YVUA 3G8YA 3IQFA 4QXMA 5KVAA 5ALSA 1IQRA 3CLRC 4NMHA 4F9EA 1E3WA 4DSNA 4M0UA 5K0LA 4BPRA 2GUWA 1XRMA 4MUMA 1FX1A 1KFEB 2GHTA 5AUOB 1CB7A 2HO5A 1H2WA 4A8TA 4TQAA 4BAGA 1ADFA 1R2QA 3TK1A 4D79A 2FMTA 4CLHA 3KB8A 1TMYA 5JHGB 2G40A 4CM9A 2VDNB 1Z45A 2YNPA 2IU6A 1S2NA 2R84A 3A27A 2FRDC 3BXGA 3KO8A 3LRTA 3C6ZA 4UJ5A 2BZGA 3WGVA 5CYGA 5J5CA 1ZZEA 5KHAA 4N0DA 3IDSA 1AUVA 1EJBA 5LYYA 3LCMA 5TVGA 3I52A 1Q14A 2Z1MA 3C41J 4HQNA 2ZOSA 2ZUUA 3PKZA 2EQ5A 2ZRKA 4WVLA 4KLZA 1Z2EA 3CWQA 2N3ZA 5IVPA 2BLNA 2RI1A 2FN4A 1PFKA 1GPWB 1SOAA 4CG0A 1YB5A 3TIVA 4IGIA 1X38A 4YRZA 4QEKA 2IHVA 2NM0A 2REOA 4XDGA 1VIYA 1AXGA 2RG1A 4B33A 2W6MA 1I4TD 2WYVA 3R2JA 4CV0A 3HKEA 4IMRA 2A4KA 3PRHA 4NL4H 3HXPA 2TMDA 1GXSB 3C3CA 3LC7O 4TXNA 5AW2A 4PLTA 2XB6A 3U7QB 1ZWLA 3G5AA 2BTQA 1ITZA 2AFRA 4ND2A 1QIKA 4YLGA 2VDPA 2QN6A 2D3WA 2PYZA 1KY4A 3L1IA 3GZNB 1D2NA 1H3NA 5FL7D 2Q9BA 4E5DA 5ICSA 1KMQA 5CR9A 2D1SA 2ZSHA 4EJSA 1MT3A 1VE6A 2ZJ7A 4QJ5A 3WJ2A 4DANA 1H6DA 4A7JA 3UB3A 2P0EA 4B6QA 4M9UA 2AFVA 3GP8A 5BR7A 1WAMA 1FWXA 1AG9A 5EUMA 3QY0A 4X7RA 3TTUA 3JWEA 3UMSA 3CVJA 5MDHA 2WTUA 3HFGA 4JVNA 1N0WA 2QU8A 2WTBA 3RVOA 2VTBA 4E70A 2PM7B 5AI0A 2E87A 2WPDA 3L4OD 1CPYA 1PT5A 2OP1A 3HU2A 2CXPA 2QVYX 2XMBA 3LY9A 4TWZA 1WDLA 4FGKA 4G0NA 4CEIB 4YONB 3R9IA 3IDQA 4JT5C 5FBLB 4D0NA 3K71A 2KSQA 1RZRA 4KQWA 1VLJA 2F3TA 3ZI0A 4NKRA 1K6XA 3DMRA 1E1QD 2J3HA 1MOZA 2LKCA 2Y0CA 3FMFA 3H9EO 3IQEA 4RPIA 5REQB 4ZJZA 5L8VA 2F3RA 1U0OC 2YVLA 3NDIA 3THOA 1ZIXA 5SICE 2P77A 1I6WA 1NW3A 2VJMB 2WF7A 1AHNA 1U8ZA 3ED5A 1A72A 4OSPA 3RVNA 2JW5A 2PKQP 3QU4A 4JD2C 4M0LA 1BA2A 1NSFA 1QIIA 2BKXA 5LZ7A 4C0SA 3ZDDA 3WB1A 2XTMA 2FWIA 5AUQA 3SR4A 1YTUA 3OSUA 3I9JA 4CCSA 1PD0A 2JFGA 1IUOA 2V6BA 4I4TF 2PBIB 3HB5X 3ET4A 3HM9A 3DFUA 3UMRA 3VR3D 1BCRA 2BTOA 4HEA6 3W5AA 1LTHR 3F4LA 3NV9A 4L9WA 1ZD2P 2FRXA 1BRTA 3GUYA 5IJ8E 3H9JA 4Z54A 1GQSA 4F6CA 1ZIDA 1JYEA 2ZATA 1XLUA 2WB4A 1AKYA 3S2GA 3UPTA 1KSHA 1E1KA 1NMQA 2AUNA 4J6FA 2XWPA 2MTBA 3W3AA 2YWCA 1N7IA 4K3VA 2ABWA 4V0MA 3V8QA 1C7EA 1SQGA 2HK6A 2PBFA 2B30A 3P2EA 3PGKA 3WS7A 3NETA 4RAQA 5C46F 2F55A 3GDHA 1CUVA 1I7LA 2XDQB 4INAA 1IVYA 4HSGA 5CIQA 3ZWAA 4BNUA 2OGZA 2QHXA 3CVXA 1ZM7A 4GMHA 4P86A 1U1CA 4RA9B 4D92A 4K3JB 1OAAA 1ZH4A 2EWMA 3UJPA 5TGZA 5D84A 2AOTB 5BY2A 1CW2B 2WUVA 2OD9A 2DFVA 1YGPA 1Y9DA 1UBGA 2C9MA 2JEOA 4M8IA 3SC4A 4CT0A 1WVGA 4RBNA 1B0UA 5K3CA 3QHQA 3BRQA 1XEFA 1K8XB 1MXHA 1JKXA 1FW8A 1NU6A 2H16A 2WHEA 1IBLB 1ODTC 2GK6A 4Z0TA 1A7KA 2VKQA 3ET5A 3UA4A 1JKIA 2HEGA 4YRIA 2A0XA 5B6IA 2AJDA 4OAQA 3BMNB 3HRIA 1JLRA 3EW7A 2F9LA 5CLHA 2Q6LA 4ENQA 4AY6A 3H05A 5JYDA 2I4OA 4TN5A 1PG2A 4ZCMA 4WADA 2REBA 5E3JA 1BDJA 4XQEA 1IE3A 1YNOA 3RD5A 3UWPA 3R5KA 3RJTA 1Y0BA 2ISQA 4P35A 4LQCA 4AWBA 4K28A 5JBQA 4LF9B 3JB9L 3K27A 1L9XA 1V11B 4LZZA 3MK31 3ZI4A 1X1RA 4ZC8A 4BNDB 1L7QA 3OQOA 3QP9A 4XFJA 3VR4D 1PQYA 4AKSA 1AV6A 2B2NA 1E3IA 4HC4A 5I9NA 1E1CB 2JHGA 3GI1A 1WB5A 2VPXA 2XUGA 3HVKA 3LW7A 4IGKA 4F8JA 3RFUA 5KOYA 1VI2A 4H1UA 3NYRA 3KQPA 4BQFA 3DC2A 4GX1A 4IEIA 1C1HA 5DIZA 1GRVA 4YMVA 3IEXA 3WZLA 1XC7A 3NEJA 8LDHA 3OC6A 5GGXA 2GPJA 1IM2A 5D00A 3IRVA 1R6UA 2H1HA 3AB7A 3ABSB 3TLEA 1M5RA 3WL8A 4DRYA 3MAJA 1WEKA 1RLIA 1KJIA 1XEWX 2H5EA 3G1WA 4AJIA 3HKDA 3AWDA 4BZZA 4DOMA 1MO2A 3W7AA 2Z08A 3USES 1SZPA 3ZY2A 3PQ5A 1QQTA 1TIPA 2YNMD 3KKZA 3RSOA 4AB1A 1O4VA 1I1QB 3TPCA 4MYSA 3CX7A 1Z8DA 3AL2A 1F9AA 2QG6A 5CB0A 2EZUA 5ENDA 3TMYA 4ZJYA 5HZHA 3HK2A 1N6LA 1ZRNA 2X3UA 3C0KA 3O26A 4N01A 4EYEA 4ZN6A 4FOTA 4I4LA 5JISA 1EPUA 3VHXA 1GU1A 2HUPA 4NOJA 2CXUA 5GV7A 5DTIA 2EJUA 1PK7A 2BEVA 1FNBA 1F2UB 1DBPA 3FUWA 4L3HD 1XHEA 4R54A 3W6OA 1QANA 1Z83A 3GMIA 3H4VA 1Z0UA 1LBHA 4KODA 3A1SA 4DMCA 3RYFB 4L4YA 5JXWA 3Q9NA 4U2CA 3EGXB 2FJ0A 2PUJA 5HE1B 2YWJA 3G0BA 1J0AA 3PNOA 3MSXA 4TS9A 4GXNA 2CDBA 3Q7IA 2B7LA 3LCUA 3KD3A 2IH2A 4DMFA 2YHIA 3E48A 2D7JA 1JXAA 3O1HB 1FSPA 4OA8A 4BQOA 1IPFA 3NWEA 3QVXA 4U2BA 3EIWA 4MVYA 4G3XA 4CNBA 1C9LA 4NLLA 1OTYA 1T2NA 3IUSA 1NASA 4DLBA 2Q2QA 2HH9A 2XQKA 2W48A 2IU4A 5TMPA 3DBHB 2XCQA 3TZEA 3KQTA 2IITA 4FN5A 3RREA 3WLLA 4G5HA 3U0VA 4M22A 2PUBA 2QRVB 1KO1A 2IVZA 3GT0A 1AUXA 1LX6A 2GFHA 2RGAA 4A1FA 3UWKA 4BMPB 2B36A 2WKWA 3QY9A 5DNVA 5HEKA 3RQIA 5L4SA 3I53A 3TOSA 4DIFA 4TLMB 2Y1FA 4JL5A 2AMVA 2FWPA 2HSZA 2AX4A 3NRCA 3PYXA 1NJ8A 3IAHA 4HF7A 2JFHA 2CGEA 2I8LA 4LCBA 4AJ9A 3LPNA 4MW0A 2XF2A 1E9CA 4ABTA 4FLMA 4BMDA 4ZV7A 2X4DA 4NI5A 4RMNA 3A4NA 3R77A 1WCXA 2WU3A 1YZGA 1O3YA 3G89A 1YMQA 4LYYA 4QFMA 4V0NA 3RSZA 3WLEA 4RADA 1R6DA 5LNK6 1R3UA 2X1MA 2EX4A 3W6NA 5FUXA 1TYZA 1X7HA 4C05A 3T0FA 1N5DA 1XJQA 3H11B 5DSTA 2GJ9A 1GFZA 3O84A 5FTLA 4A2LA 1XZ8A 3GFQA 4BLVA 4CMKA 1UXIA 1DJNA 1DMSA 3CNHA 4FGJA 3HYSA 4IMMA 4HEA1 4JLMA 4Q4CA 1S4UX 1M2VB 1VHDA 3HBFA 1P33A 3OX1A 1E3LA 2E3JA 4HDSA 1GSHA 4M9RA 1U8YA 2NQTA 4H18A 5C81A 3TNDA 3PSHA 4UPVA 2CXRA 1RQNA 2IK8A 4D6VA 4BGEA 1IL0A 2EFYA 2RGDA 3A31A 4YMSA 2Y0BA 4G41A 5J2TA 5IAAA 4Y2QA 1PG5A 3LM8A 2OCBA 3BIJA 3T3GA 1R37A 4DLYA 2CL6X 2OSBA 3IIJA 4GUAA 4M1EA 4E5SA 4V1CB 3QSYA 1GCOA 2I2FA 3KE9A 2QKYA 1QVAA 3PD1A 3HHEA 4CIWA 3WL7A 5IC4A 4QTXA 2XMZA 3KOMA 1X77A 1WO8A 3GVPA 4FI3C 4KGVA 2HPHA 3L8DA 1V45E 1PJ4A 3E1KA 2RI6A 4Z49A 3L4JA 5IK2A 3TQSA 4F72A 1IDN1 3KT8A 4L6AA 4IG4A 1RRKA 3P94A 3OF7A 2GF2A 1A9PA 1YHZA 2I2XB 2Y67A 3O8LA 4MAFA 3TLKA 4KR7A 3PGLA 3GJZA 3HJNA 3V46A 1ENYA 3B48A 2IYFA 1DAOA 2WQZA 3CUTA 4CG3A 5C9ZB 4OGGA 2ZI9A 1TJ3A 2RHDA 4KAFA 3PEVA 4LEIA 4TVBA 1EFUA 2MSWA 2HA4A 5CB8A 3EWAA 1NMXA 5FEUA 1MDFA 1MDAH 1C41A 3WLFA 4NU6A 2PMEA 1MABB 3GG2A 4O02B 4BE9A 3WGIA 1WSDA 5FBHA 3ZNQA 1ENZA 3EC7A 1L7MA 1ABEA 2H9IA 4UE2A 4YJ3B 3DD1A 4PRZA 2I78A 3MCTA 4S1VA 2JKZA 3TEMA 3KTAB 4UU7A 1N36B 4LJLA 3O4RA 4GSLA 1LI7A 1NVWQ 1PRYA 1SIBE 3IA7A 1TM3E 3OZRA 1BCRB 1CBUA 2QENA 4PQEA 4RD0A 3TD6A 5CDSA 3GP3A 1NBMD 4Q21A 1NEXB 1JGTA 1Z2AA 2VA8A 2RE8A 4LNAA 5A04A 2GAFA 3O8QB 1JIJA 3BWXA 3QXCA 5AM1A 1WU7A 1KYTA 3TSZA 3DHEA 2ZI6A 3CINA 2E85A 1MTOA 4D6XA 1SG0A 2ILVA 2Q07A 3ELUA 2Q7OE 4HNRA 1FJXA 3KEOA 4IQGA 5IYZF 1KZ4A 4CKXA 2LCQA 2AMJA 2ZM6B 3HY3A 2R7NA 2WYOA 1YUNA 3M9WA 5H82A 1JR3A 1NBME 1W2WB 2PTHA 2JFWA 2Q8QA 4KG7A 5HIJA 5JMPA 3F1LA 2Y1WA 2J32A 2PH7A 5D2CA 1Q0SA 1T0HB 4EYQA 4RH1A 1KVQA 1YOVB 4UCXA 1OQAA 2EL7A 2W11A 4BBAA 4DWJA 2WHPA 4ZVMA 5AK5A 2HBYA 2J0UA 4BB6A 3GGPA 5IX8A 4PEVA 1EHYA 5JH7A 4M3NA 1MJGM 1S7GA 3C74A 4Z2YA 1E6EA 2OCYC 3M6VA 1ND5A 4F56A 2JLWA 4ND1A 4P53A 4LGCA 1R4NA 2V5AA 1NUHA 4M83A 4MRRA 1HTBA 4IWXA 1TT5B 3S40A 3C8ZA 4ADSG 5IJAA 5JC1A 3BMNA 2QRPA 1QNFA 2GNPA 3ZV6A 1DKPA 1RYEA 1NXPA 3KVYA 4BV8A 3EWNA 2HQ1A 3P97A 4HGPA 4QDTA 4G0OA 3SF8A 1ONOA 4REMA 3WLMA 1KDRA 1VKHA 2WTXA 3R40A 1JU4A 1H0SA 1WKVA 4MVJF 1OWMA 4RZUA 1HMYA 5FBWB 2I80A 4B4KA 4OXRA 3FPKA 3OICA 1Y89A 2ZB8A 3DF7A 3OOEA 2ZAYA 1L5ZA 2R1TB 1PEVA 2C7VA 4N0QA 4A2QA 4LJ5A 5SZKB 1WD5A 3RB8A 4B35A 2DHRA 2E6KA 4A36A 1SUFA 5JJKA 1SKAA 1YKGA 2E4XA 3UG7A 1E5QA 4KB5A 4LPSA 2CE2X 2GGSA 2XITA 3RBAA 4ZT5A 1IY8A 2IXFA 1R18A 4UOQA 1HI9A 2J6CA 3R5JA 5D3QA 2VUTA 4PANA 1G41A 1YC2A 2YWGA 3D6TB 3M4YA 3AUAA 4OO3A 4D46A 3EFHA 3GUVA 4AU1A 4B8ZA 4EMSA 3QOXA 2V9ZA 1OR8A 2P91A 2PRIA 3VR4A 1B1CA 1IOZA 1NM5C 3TQCA 2WTNA 4R1MA 1H69A 4IO1A 4M54A 5EZ5A 3ZKAA 4RDXA 3NX4A 5B4UA 1MC8A 3RRJA 1W4LA 1YNSA 4D0GA 3DAOA 3FHOA 3SYTA 3GMDA 1PCXA 1E8DA 1X19A 4FNOA 1PZMA 2EL9A 1NX6A 2HO4A 3LDFA 3ELYA 4XGNA 4OP2A 1ODJA 1W75A 3FVTA 1N7GA 4J2OA 3VU3A 4DV5B 1G59A 3EQZA 4R8VA 5MN5A 3BMCA 5BNFA 1TYDE 2HYIC 1K88A 1F14A 1EUZA 1QR2A 3CSDA 3KPWA 4MYDA 2DLNA 2R8BA 4F7DA 4BO0A 3HKBA 4YP0A 4OBWA 1QGAA 1TO1E 4K3ID 2P2GA 2V6GA 3TMKA 1VE7A 5FJJA 5L3ZA 1PR2A 3LF1A 3RIMA 5BSTA 5J23A 1O89A 4D9SA 1SQ5A 1VTKA 4XFKA 3DMTC 3LI2A 4YJ2B 1XZFA 1Y5IA 1A5AB 1B2LA 2GXUA 3L77A 3RT9A 2PQ2A 4A73A 1H65A 1VP9A 3PJFA 1ABFA 5LL6P 2AG5A 4LXXA 1FX0A 2WPNA 5B37A 4TS3A 2VAMA 1C1XA 2CLIB 3JTEA 4MRPA 5FNVB 4GWGA 3TQIA 2EJWA 3PDCA 1UJBA 2IOQA 4QIHA 4TLCA 2W6IA 4ESOA 2Q0HA 4L0MA 4OQLA 4LVUA 5IAGA 1ESDA 3T5BA 1YFJA 1Y6FA 3V6LA 2DHEA 1N34B 5AHWA 3AM5A 1BD4A 4DREA 2GPYA 1DIAA 1CQZA 3AW8A 4KQ1A 4WSOA 2WHQA 4EA8A 3IEVA 4H1WA 5B58C 1GRCA 1H8ED 3JAWA 1ULZA 4B2IA 2CN1A 4R1OA 4C0HA 3V4SA 1E59A 3GAZA 3VNVA 1QJ4A 3NVNA 1A9ZA 3AX6A 2YASA 1WSBA 2ZP1A 3B9QA 5KCMA 2AFHA 3HFQA 3DONA 1RC8A 1VYTA 2PUTA 1Z73A 3LC0A 121PA 2PK3A 4QPDA 3PXGA 3C9CA 2IYRA 4G4IA 1SUPA 4I4CA 3UUFA 4ERXA 4MVJH 5KTOA 1XMIA 2A9VA 2F9MA 3K3PA 4FW9A 2Z6QA 1N2CB 4P5EA 1GJRA 1AN0A 1V95A 4DIBA 3X1DA 4LF6B 1CQIB 3U4YA 3HH8A 5AW4A 4DSZA 1ZJ5A 2QLNA 2V3VA 4HNQA 4DE5A 4ZKEA 4XB2A 4GMBA 1J06A 2EP5A 3NKLA 2I29A 3AKEA 2Q8PA 5DRTA 5CM2Z 5G4KB 4W8HA 1NOIA 5B7PA 3K8YA 2NYVA 2BY4A 4HATA 4FT4A 3PZBA 1QWOA 3AVOA 1WW8A 3PDHA 4FR5A 4X63A 4BX8A 2HBZA 2WMNB 2P78A 5KHOC 2YZ7A 4UU8A 2ZTSA 2FW1A 1P1RA 3RV4A 1B9XA 2OCDA 4RORA 1OX4B 1M6YA 1OA1A 1ST2A 2O0MA 3LV8A 3PT5A 1QHIA 4RACA 5KYVA 4LRYA 5L3SA 2JGJA 4GLLA 4NFYA 4IIJF 1VPWA 1POWA 2JBAB 5KNCD 4JOBA 1QHNA 2HA3A 2HJVA 3HB1A 4OZUA 4UUNA 4F5ZA 1MRNA 2P2SA 4JXMA 1EX6A 1SKUA 3Q3JB 1LQUA 4I5DA 4WN9B 4C4TA 2COEA 3O94A 4PYMA 2VJDA 5I7WA 3I0NA 3KR0A 5CB4A 1S6YA 1W7AA 3HGMA 4GW3A 4V2UA 5CA1F 1V9CA 2GARA 3I9NA 1IN1A 1QM5A 1VHWA 3GC3B 5G0WA 2Q1SA 1YDHA 2WP0A 4DEXA 1K5GA 3VGPA 1JTVA 1P29A 2ZTUA 1QYRA 4CI9A 3MRSA 1Z6TA 2YMLA 2Z8YM 3TW8B 3MXXA 3AQ4A 3BXHA 4YXWA 1L8OA 1CQXA 1EGVB 2P9JA 4FJ0A 4J4TA 4DZZA 2ECKA 2WJIA 1EWVA 1PLJA 2Q4OA 1KH3A 3KKLA 4TKZA 4BFWA 4BFSA 1V6CA 1EXNA 2XMRA 4ZCLA 3SNKA 3CLVA 1JU3A 1F2DA 5KQSA 5FKRA 1AMOA 3AY6A 4YMIA 4PIMA 2PS3A 4UVIA 5GZ3A 5JZ9A 5CBKA 3IEMA 1T9DA 1P7YA 3HNRA 1K6JA 3NM4A 4LBVA 3WQQA 1KKUA 4JBNA 5C9ZA 1ZOPA 2DRIA 4BNNA 3KCNA 5FQOA 2PCLA 5M2QA 5EQDA 5AXCA 5CTJA 2O5VA 2HPAA 1ULHA 2GJ4A 1G9XA 3U4DA 2BLLA 1IVNA 3DOCA 1A9YA 2I2AA 3CT4A 4LRTB 3FRXA 3D02A 3OMXA 3KCIA 5EJGA 3WYEA 4BZPA 3VTKA 1COWD 3W7BA 5KJEA 1GKUB 4QU0A 2B2CA 3MIIA 1V3QE 3PP8A 4LRSB 5CAEB 3EW9A 3P71T 4IX9A 3WLRA 3V48A 4ZVUA 3R0QA 3TPZA 5E0OA 2P9BA 3JAKB 2ZQZA 4NNOA 4UAJA 2C9OA 1XMPA 1FSSA 5IBPA 1QFXA 3TQTA 4YUXA 4RDCA 1MA0A 2CDAA 2JK0A 1WKCA 3P9ZA 2ZRIA 2ZQ5A 3CH4B 2YR0A 4K2HA 5IJ9B 1TJYA 1HH4A 4O2BB 2I66A 1V8ZA 5AOVA 3RJ5A 2IHUA 1A1VA 2A1TS 2H17A 3PUHA 4BQSA 4Y1FA 2XR1A 3ETJA 3L4EA 4W9MC 3ENWA 2NUPB 4ZARA 2C2HA 2XGGA 1FRVA 2FN9A 5LOVF 3GRRA 2YXBA 1YF3A 1J56A 2XWQA 1GIAA 2C1EA 2D5AA 5IARA 5IRCD 4ZA2A 2VHTA 3RF7A 4DSUA 4DDWA 1HURA 1DBVO 4A11A 2IYAA 1LBQA 1J90A 3D0QA 3PRJA 4GGOA 4OQZA 4LFBB 1Y3FE 1CRQA 2QP3A 2WT4A 4NABA 3ZHBA 1X15A 2O8NA 1CR1A 4YALA 3A36A 3EPKA 1U9CA 4U8GA 4LC1A 1EXWA 1WIWA 1B0ZA 2JD0A 2Q29A 3HV0A 5BSUA 1NE2A 4CG2A 1Y7LA 4EB3A 4ZCRA 4U1EI 5K6RA 5LMUB 3FYUC 2IYVA 1IY2A 1U6JA 4IOMA 2P5TB 1ID8A 1GT91 4EJFA 4ZAVA 5CMLA 1SNYA 3P2IA 4H7EA 5B1HA 5C5IA 2WJ3A 3BK2A 3OI7A 2C3OA 3Q15C 1XQ9A 2PL3A 3OURA 3NBXX 5DSXA 5JW6A 2IDJA 3DM9B 3TXAA 3AR6A 3VHRA 4KQKA 4EUKA 3R3HA 5A5FA 5LLDA 3KLOA 5DHFA 3KYCB 1KFJB 4CR6A 1G8JA 2K2WA 3W0LB 3KHUA 2CLFB 3C87A 2P9FA 3EAQA 1NAHA 3T1HB 5TDHA 2HXYA 2PGOA 3SE7A 1KL7A 3BTSA 4QD3A 4G84A 4AJEA 2ZYGA 4ABYA 2ATXA 5TF0A 4PZ0A 1S2IA 1W36D 5DX1A 4IIFA 3SIRA 5TEFA 1QYIA 1ML4A 2KWIA 3Q5DA 4E32A 3EEFA 2ZCVA 3AZQA 3VSEA 3L8CA 4X45A 3VI3A 1XKXA 1YQWA 4GGAA 5C0OE 1EM6A 1WF3A 5HF8A 3SQDA 4BP9A 4B47A 4GE0A 1CRPA 3CLUC 1KBZA 3QV1A 1M7HA 1W85B 2J6IA 3FROA 4JYMA 3U81A 2FGJA 4F0JA 3D6AA 5EMMB 1P2DA 2FPLA 3CF0A 5A2GA 5LP6A 3N86A 1PYDA 3T35A 4N9QA 4WECA 2AFHE 4HH0A 3ZVKA 2R2GA 1HYBA 3W2TA 3TAHA 5A3JA 1XHFA 3OBBA 2HCRA 1Q20A 1GGKA 5CLIA 3WRWA 4DCMA 1LDEA 2Z5VA 3C3WA 4LYDA 3WSVA 4I6EA 3EWSA 3H1EA 1INLA 3DYVA 5CDFA 2PRYA 4Z0PA 3NYQA 1LBEA 4BWFB 2PSSA 2VT6A 3QE9Y 1I5RA 1MMFB 3C48A 3K1AB 1U2GC 2O2EA 2Q4DA 3LOUA 4N76A 1J4AA 1ZXXA 2F1JA 1GA4A 2TMGA 4HAZA 3V4PA 1BMQA 1ZUIA 4CMJA 4KH1A 2G6BA 5DH9A 5K8VA 1OXKB 2W71A 5LVAA 1NJ6A 5A3RA 2IV7A 1FE8A 4Q00A 4IKOA 1RKXA 1HT3A 2C4WA 5K0ZA 2QOEA 4QFCA 2EQBA 4RZ2A 4TQ9A 3FDIA 5FT9A 1CUCA 2YN2A 5EXTA 2IZ7A 2VDWA 3STHA 5GXIA 1DEHA 1KWGA 4O1QD 5A2Qg 4F04A 2YJ4A 1GP2A 1L7AA 2GTHA 3P4YA 1KY3A 1N0VC 4TRRA 4URZR 1CUIA 4PZZA 4AMZA 4FWIB 1QIHA 4HWOA 1G4AE 3RH0A 4RVFA 4KXVA 4WNYA 1I3KA 3PVWB 1Z0SA 4OMFG 2CFSA 4ALLA 5LP1A 2Y1DA 2C31A 4MZDA 5JG7A 3VTFA 1X1CA 4QYIB 5K45A 1SKBA 2DCUA 2YKGA 1Q92A 1UFVA 3NYIA 4P0QB 2EYUA 2PV7A 1WXDA 4MJ3A 2ENWA 1SG6A 3BCHA 3CMCO 4QQNA 5BN3B 4FWTA 4MUBA 4WLUA 2SKCA 1N1GA 4X60A 4G56A 4EG3A 4YRPA 2VVTA 3JRWA 3E8MA 3EXG1 1Q0ZA 5ICCA 3TQQA 5IYZB 4JNKA 1XL1A 3SM9A 3OCVA 2J3EA 1TJPB 3HUTA 4G97A 3Q11A 2WWTA 4W1RA 5FAKA 4DQXA 4HN9A 5J58A 1XXHE 4G63A 1OIXA 2I1VB 3DZJA 3OEEA 4QX6A 4DSAA 4AP9A 2P75A 1O8CA 2CJFA 3ZTWA 3B6ZA 3T52A 2MSKA 1CRWG 3D1JA 3WSWA 1JDSA 4MP3A 1BU5A 1SOWA 3KSMA 4X44A 2ZRBA 1DDGA 1ORRA 1HEIA 4Z7OA 4C3UA 4PLPA 3ZXUB 1LTKA 3MM4A 2FQXA 1TKCA 1LSOA 4N7BA 4DC9A 1XZIA 1HG0A 1VBKA 4M1OA 1RRMA 1ZLXA 4MDFA 4Q9LA 3DPSA 4GMXA 4HDNB 3LA6A 4JLWA 1WR8A 5B1SA 4W9NA 3QPBA 1D2MA 2H5JA 4P33A 4NX2A 1YR1A 4NFLA 3DAPA 4JXJA 4YCAA 3EF0A 1SKQA 3FSJX 2WSBA 1PGPA 3DBLB 3W8NA 2FW6A 4CZXA 1OX4A 4X3OA 3BAFA 1T2DA 2XXJA 3KP1A 2HD4A 4QXOA 4RV4A 3ZUPA 2PKRA 3DQQA 1P0QA 4UBMA 4C0LA 3O8RA 2EQAA 3PFWO 4MVJG 2BISA 5HG0A 4D9HA 4EA9A 4QVKA 5A4DA 1N6DA 4RXTA 4URXR 1G2PA 4UMDA 2AGLA 3ND6A 3PFHA 4CV3A 5FNZA 1XWWA 4IPTA 3D4BA 3NCTA 2D3TA 3KSUA 3G02A 4IINA 5CB4B 1Q1AA 5JSUA 2O6HA 2IUVA 1OC4A 1KRHA 3D6MA 4YASA 4AL4A 3GLFA 2QL5A 4M1ZA 1W88A 4L3OA 1GUFA 2CMDA 3P0IA 4ASUD 4QRJA 3EXHB 4PCUA 3VR5D 2ZT7A 3D6JA 3L7YA 4RMIA 1QX4A 2O1XA 3GQBB 1PNTA 1SZDA 1M2OA 3E9YA 4A5OA 4J0JA 3GLUA 2HT6A 3HZOA 1XMXA 1APBA 1IB6A 3ROQA 1OI4A 1ZXLA 5TQ0B 3SSOA 2JGMA 4BKPA 4KFUA 1FP7A 4MUHA 2XL3A 3R3UA 2BKVA 3S8YA 3W2FA 4BFXA 2J3IA 2GVDC 2KM1A 3DKKA 4K9KA 4ML3A 1N6OA 4NDNE 3LUHA 1L5MA 3R8FA 2L82A 1GRRA 2A4MA 1IZ8A 4IBOA 1UMCB 3MAGA 1E2KA 3BL8A 4LZWA 1ANKA 4C2TA 3I9LA 4O4LB 2FPGA 3I7NA 1U3CA 5C32A 3R3VA 2BJVA 3UOWA 4MB0A 4OMDA 2BKLA 2XB4A 1ZESA 4HDOB 1Z47A 5DOVA 4A4DA 1E0SA 2K4MA 4JLVA 4X20A 1FS5A 2COUA 3RS0A 4D4LA 1NVEA 4PTYA 2XGSA 4QOEA 5CXQA 5JNWA 1M73E 3BWDD 3GRAA 1RSZA 1NW8A 3AJ8A 4ZZ2A 4JU8A 1O6ZA 2DGDA 1S0UA 3DB2A 3BTVA 3DDCA 3M33A 3LWBA 4XYGA 1SEVA 4QUHA 1MN6A 2X7JA 4RK4A 4EX6A 4BO1A 3GLFB 2UZIR 4DNXA 2Y0PA 4LSMA 3OQ6A 4WCFB 1S7CA 3M49A 3T3MB 2UZXB 3NR2A 3BKWA 3IJ1A 2YHBA 4Q9IA 1DUSA 2C4MA 2NVUA 3CA8A 3PBKA 1TF5A 2WFMA 1PI3A 3E0XA 3KNZA 1ULTA 2H5IA 4EVQA 4YT2A 1ZH8A 2QUBA 2HWYA 3QLVA 4V0KA 1G4HA 2D2VA 1CUSA 3QBDA 1DS6A 1KVTA 1OYYA 5HKOA 1X9HA 3KS9A 4TVOA 1HYQA 1N0UA 3D4NA 2VNIA 1O95C 4PZLA 3H3FA 1QR6A 1SA0B 2UYHA 4UREA 2FZGA 5AK0A 1XNRB 1PR3A 3A0RB 1V8DA 1RXCA 4QL3A 2EF1A 4HDMB 2X0IA 5FHQA 3IURA 2V6MA 3PXCX 5FOQA 1XIVA 1ZR4A 2JLYA 1QK3A 3H86A 3I2FA 5BQ5A 1NG1A 3T6KA 5JU6A 4UM8A 2BFFB 4US2R 2V58A 2TMYA 1N5JA 4YHBA 5AI4A 13PKA 2H3XA 1XYVA 4HJXA 3RABA 3HMQA 1O5IA 3QVOA 2BHRA 1ZD3A 1Y80A 3I76A 2QJFA 5DMXA 1RRFA 5FTWA 4C0XA 4D99A 4RZSA 3B2QA 2C9DA 4FB1D 2UV8A 3ZWKA 4ZGWA 4H3VA 3D8HA 2A9QA 4DLUA 4GSYA 4FSXA 3AVUA 5KTTA 3ZQUA 4CTOA 5A3SA 4M9XA 1IEQA 3AEXA 3PFFA 3NJ8A 2QLTA 1HLGA 1ODCA 2AI2A 1WCV1 4DNWA 3KAPA 4G5FA 5C2JB 1OMOA 1R88A 4NP6A 4AMGA 3A4VA 4PNHA 3TUJC 2ERCA 2ZIEA 1KQFA 3SQLA 4F1WA 5DV9A 4LCEA 2Q27A 3IQXA 3THYB 1RKBA 3SXTD 4RJKA 2FW7A 2H6NA 2E4VA 2GAIA 3KOXA 4IYJA 1T3SA 4ZOQI 2J57G 2FPWA 1WM1A 3DT9A 1T8WA 5HYNB 4XTCS 3P0RA 4GOND 1R00A 5FTKA 3KUCA 5K3FB 2PGDA 2IE0A 5J2TF 4DBLE 1WA5A 6LDHA 2GBCA 2VUHB 5KTKA 3HSKA 1N9GA 1E5LA 2TMKA 5CNKA 4WFIA 2DHDA 4I9GA 4DUPA 1Q11A 1NNUA 1MVOA 1Q22A 3TBKA 3RFGA 1LSSA 4GEKA 2H0RA 5CCDA 1ABBA 5T64A 1WUKS 3UCEA 3WGLA 3EU7A 4IRMA 4RFSA 1PW5A 3ZVLA 4BNGA 1ZA1A 2BP7A 2HTFA 1WZ2A 2C61A 3G85A 2R11A 4M9QA 5EI5A 2P2DA 4R1SA 5EM2A 1EP2B 4IIGA 3BB3A 3U3DA 3CURA 2G71A 2XGOA 5AT1A 4KQCA 1XBTA 5DGTA 3DFFA 1QP0A 1ONBA 1X8XA 3U5ZB 1O5OA 2P9SC 4NCHA 1Z28A 3T5MA 4FOSA 2RGBA 3L7BA 4CFSA 3R7LA 4NE2A 3FXAA 3OM0A 4LVNA 5KNCA 3A9CA 1M6VB 4W1QA 2ZRQA 1PUIA 2LKDA 4IHKA 2QAJA 2F90A 2GRUA 4RLHA 2IYUA 4JYCA 3QMWA 5IKEA 3MLAA 2H68A 1P77A 3TIFA 3VAYA 3ML1A 4LDAA 5ITSA 1E7YA 3LOQA 1V11A 1V41E 3RSEC 2HCTA 3EVEA 1NBWB 4MV7A 3UPDA 4DEVA 2QXVA 4RMJA 4AMBA 3PQ7A 4FHEA 2PKWA 5ILQA 1MHTA 4YWHA 1LB1B 1VLZA 4O5AA 1BXGA 3NGLA 3BGIA 5SYNA 4FZ3A 4D4JA 2RC5A 4H1HA 5CA1A 2NU6A 3A9TA 1L5VA 4GMKA 4GGCA 1NVFA 1Y98A 2FPIA 2YS6A 2Y27A 3JZFA 3W6UA 1SJ9A 4X3CA 4WBNB 3Q3GE 5DLDA 3ENNA 3RC8A 2RSLA 3Q40A 5IT4A 3L0CA 3VJMA 2LCIA 5LQMA 4F91B 1J70A 1GG9A 2C5EA 5GADl 3KCQA 3RMZD 3LIIA 2WWWA 5JVDB 1Z07A 3UUGA 5AQ1A 3RYCA 3F0TA 2DLCX 4RANA 3OAAA 1F8GA 4C3ZA 1VM6A 3BG0A 1D03A 4BEVA 2F4NA 1IBRA 3K05A 3U1TA 1J49A 1GM5A 3RS4A 5H16A 2BCJQ 3S1AB 4PHFA 2CCGA 4X3EA 3E5NA 3HWWA 1HTTA 1T1SA 3AF6A 4IFEA 1EFRD 1WY5A 3IIMA 3I4FA 3C7CB 3KLBA 2YWFA 1JDNA 4H0CA 2IIQA 4L9AA 4OJKA 4NFHA 4KVGA 2I4IA 2JFFA 4XEUA 2PX8A 1U7PA 1Z22A 4NBSA 4E6PA 5KINB 3RLIA 2ZE6A 2BEVB 2XDAA 1QGUB 4LSGA 1Z12A 1TK9A 1XD2B 2X6QA 3UV6A 3ZX4A 2CNOA 3ANTA 3H9BA 1PNVA 3P9RA 4MLZA 3CNOA 3RYFA 5LSAA 2A67A 4DB2A 2H5LA 3U44A 1A0OA 3NHMA 1H05A 3GPCA 1KU0A 4FYPA 1ZCAA 3BXXA 1Q91A 5FNVF 1TTPB 3QEMB 4RF2A 1QVZA 2P1ZA 5E7QA 2P9GA 4D4KA 3W4JA 2JGIA 2ZW9A 5DW3A 3SJCA 3OHMA 2PZ8A 3OPXA 2QVXX 3CZMA 1LDNA 4A0BA 7AT1A 1ZYUA 3ZVMA 3AF5A 4V38A 2XUHA 2YBAA 1X42A 1SMKA 3ZV3A 3SBXA 4F9TA 2WVAA 4NF2A 3DTVB 4QM6A 3VHLB 1UJNA 4FE4A 1R4ZA 4WK4A 3EXIB 3SIXA 4L73A 5A6SA 3DBHA 3C39A 1IUKA 1UXHA 3L6DA 2C9BA 1J2TA 2B1IA 3KDAA 3OA2A 2VT7A 2VZ0A 4KQIA 4O2RA 2YN4A 3FTCA 2XUJA 1SVIA 3R7NA 3UFBA 3WFJA 5GINE 4H15A 3FWKA 4WKNA 1DQSA 2NU9A 1KMMA 3AJEA 5ALLA 4EGJA 2CXHA 4FILA 4RKQA 3CKYA 3JYOA 1U94A 3WYDA 1Y8CA 1BTOA 4BC0A 4YUZA 1M2NA 5J4KA 3I8XA 3M34A 3P52A 3URMA 1W88B 1U0SY 3P4UA 3QWIA 1TAHA 1E7MA 4EFDA 1U2QA 2CDNA 1VMAA 5EKTA 2NYAA 4AAYA 1K8KC 2XMPA 5E9WA 4XM0A 2IDKA 4OB7A 1EVJA 1MO4A 3LRXA 3PF9A 2R6DA 2ZBFA 4WKBA 2C84A 3V7WA 4EB6B 3GRCA 1U3UA 3UAWA 2NZJA 1KZGB 2J6HA 1FVHA 4MVJM 1QPBA 2HRRA 5BRNA 3CEMA 2NZUG 1N32B 5TQVA 1HR0B 1REQB 3CZQA 3L0IB 2FAXA 2R00C 5DHTA 3GVCA 1G3MA 4HRVA 1EGQA 1WE2A 4TLAA 2GN0A 5E38A 3DTYA 3CUSA 3N6XA 3MQFA 4P9NA 3PXXA 1XZPA 1ZX1A 2YOGA 5AD1A 4KN8A 1ZN7A 1IQUA 3HDTA 4GMDA 4DC1A 3PPXA 2P62A 1SUDA 3A4IA 2O7NA 3HLKA 2ECFA 1AK2A 2XDWA 1VJ0A 4DNQA 1NV9A 1LLCA 2Z4SA 3PC4A 1KERA 4N6GA 2VATA 3AU9A 1YHYA 3TLXA 1GTRA 1PVOA 1T6BY 2C1ZA 3M6LA 1H0KA 4P92A 3QFCA 5EMJB 1YB4A 4G1CA 1HE1C 4EABA 5KB3A 2V3CC 4LXGA 1E69A 2PUHA 3GJ7A 5J2TB 5HJ2A 3PLAE 1ILEA 4BMVA 3MS4A 4EO4A 3HXQA 4WCFA 3RAGA 1MQ9A 3KVOA 1ONPA 3NHZA 5CT9A 2QRQA 1S8NA 4F2HA 9LDBA 3BAZA 3NGXA 5KTMA 3WWCA 4QGHA 1CE8B 3HEBA 5TT0A 3UMMA 3E4DA 2FPKA 1W94A 2HLDA 1QS0B 2ZIVB 1TVKB 3E9NA 3FKSA 3NBAA 4FNGA 4FYWA 1CUBA 2CLKB 4TMXA 3HKCA 3PD7A 3OC0A 3C4JA 5FO1A 3OE7D 1DKRA 2EARA 1D2CA 3K96A 5CFMA 3BWSA 3AJDA 1YRQA 4JB8A 1A9OA 4K9RA 3L7JA 1U63A 4YAOA 1G38A 1T6XA 1P7WA 1OLXB 2CLEB 2ZRNA 3F6BX 1TUBA 4P4SB 3S70A 3TR5A 2VO1A 1A3CA 4R9SA 1GL7A 3NKVA 2GASA 4DHEA 1JX6A 1KYYA 2XVZA 2HIHA 5BV0A 3CGWA 4JITA 3RN0D 4ND8A 4U5XA 1UJMA 5HKAA 1UR5A 3EGCA 3IODA 3UANA 1CRZA 2C07A 2PKCA 4FX2A 4IYRA 4G5SA 1J2YA 4OMCA 5KYWA 3ZHRA 3UBTA 3RWOA 1JHYA 4YJ3A 3RHFA 1M3SA 3ELWA 4OHXA 3U9TA 4RAOA 1KJQA 2ZWAA 4WZAE 5TARA 3VV2A 1O96B 1TJNA 4P58A 2VC2A 1TMGE 4CL3A 3SF0A 4H7JA 3TRHA 2WQ8A 1B73A 4RV5A 1G1AA 1VMEA 2FW9A 4Z4IA 3LK6A 1JEYA 1YBMA 1P60A 4OA5A 1PR0A 4FVTA 4O4IB 4C4SA 3DMDA 5GJVC 4DMLA 4CTMA 1ZVVA 3RC7A 1B6GA 1YONA 4UM5A 1E4EB 4BJHB 1QV7A 5BVGA 4KE9A 2JI6A 3GEEA 3HXMA 4AY5A 1LD3A 2KYRA 2OGUA 5ALIA 4XA8A 1NXSA 4EF4A 2AVNA 5BRJA 2GRJA 1SKYE 2W2OA 3SKXA 3MUFA 4PZ9A 1ODKA 1PJZA 1T9GS 1WRBA 4B4VA 5FBRB 3UWMA 3V2UA 4CETA 3V3TA 2WRZA 1X7DA 1L3IA 4K6FA 3DB1A 2QJWA 3RYIB 4B9AA 2WK1A 4G81A 3CT6A 5IEJA 4ZEMA 4YEDA 4CI1A 2GH1A 3IT1A 1OROA 2D8AA 1YOVA 2HA2A 2RHTA 5DT2A 2QVZX 2W2LA 3X44A 3CCFA 1UZLA 1OB2A 1MB9A 5JYEA 3IE0A 4ZZIA 2YUIA 4A2MA 1DINA 3JZAA 3K4PA 6YASA 1QRSA 3DWGA 2MDTA 3K6JA 4L4XA 1NNSA 1PL7A 3MB5A 5IBRA 3RJMA 4ZVVA 1WLSA 2GM9A 1RAGA 2EHJA 2HF8A 3KV1A 1EI9A 3RSFA 3CKLA 5FPYA 1L7NA 2YNOA 3MWYW 5I47A 2XUPA 3OIVA 1X3LA 3I2NA 4H1TA 3GJ0A 3NBQA 4AF8A 1W4AA 3QBTA 1W29A 1EUCB 4DG8A 4TZTA 1HNXB 2E1PA 3U40A 4GX5A 3A14A 3KHSA 4IILA 4DA0A 1MZPA 2XNHA 3ZDRA 1ZGJA 3TOCA 4YRBA 1JLMA 3K2EA 2Z2PA 2W0SA 2B34A 5ITWA 4JZYA 1AC5A 3FNRA 5C2WB 4MEBA 4W5QA 1F17A 1OREA 5BQOA 2JFVA 4UBLA 2HCFA 1U7UA 5BSFA 4ER3A 1UP4A 3TPFA 5B7GA 1JG6A 2AJLI 5CVEA 3T5CA 3CPJB 3IYLW 4JQOA 1FL9A 2PNFA 3D0RA 3ETCA 4RA6B 4R0MA 1UBCA 1BWRA 3GLKA 3INGA 4J16A 4TZ0A 3HJAA 1TLTA 3BSFA 5CBPB 1G4UR 2YL2A 1HTWA 3C6XA 3VU0A 2GCPA 4AZ0B 5EHXA 4X1YB 2ZRCA 2YV4A 3C4VA 1FFGA 4UTOA 5HR5A 1WB6A 3A1NA 3AHCA 3KL4A 3MS2A 3B6MA 2Y3IA 4TUYF 2YJTD 2J5BA 2ZSAA 3T4EA 2GYVA 3AW9A 5FR2A 3SKVA 2F8TA 4Y5RD 1ML3A 1JQDA 2GC4A 5FH9A 4WUVA 1GTJ1 3EZ7A 4LNUB 3SG0A 3BT7A 2ZYHA 1N92A 3RVSA 3BL5A 4FYVA 5AVUA 3FWHA 2XEXA 3PCRB 1SZJG 3WLTA 5CM9C 3SZMA 1WPXA 1Z2NX 2OK6A 1SVUA 2WD8A 3I6IA 4OHOA 4BJ1A 1VRWA 2A84A 3QU9A 3IDZA 1B3RA 5AKHA 2XZTA 3F2VA 4A92A 2OXFA 4BX9A 3DHVA 4F9FA 4YMTA 4BVHA 4PG4A 3GWZA 5C4GB 1ZNYA 4GZ5A 3HXLA 3JAMA 3V1LA 1KQGA 2PH1A 2WAMA 2OXCA 2XRYA 3OF2A 4F6LA 2A9JA 1SQ6A 2BGMA 4RJTA 3U44B 4RHUA 3OCXA 1H66A 1U0LA 2GPBA 4PC1A 3K9BA 4Y6GB 1L1FA 1U0NA 1N2GA 2QI9F 3G9QA 4WOPA 3W8FA 3WFIA 4RD6A 3P4FA 1FTSA 5AW8A 3KWMA 3NNDA 4MWZA 4CM4A 4EQ6A 1DX9A 1KMHA 3D5EA 4RTNA 3W5SA 2B5WA 1L8AA 2QR3A 3CJRA 1OPXA 2F7SA 3I92A 4IJUA 5HIMA 4E5NA 3IJPA 3DEZA 3WK4A 4XJXA 5EJ5A 1ID1A 4NMLA 1WZEA 1GV1A 1UBEA 2WILA 4MKRA 1H2HA 3F7MA 3VR1A 4DCNA 5DE3A 3H5RA 1U5BB 2XCUA 1JSZA 5FLEX 3UYLA 3FI0A 1IUNA 1PSDA 2M32A 2XA1A 1H5QA 3M5WA 1AA9A 1AVTA 3GFBA 4UDNA 3TNFA 3SHVA 5DHQA 4GR5A 5KWEA 3FB1A 2Q6KA 1M54A 3GRVA 3O4VA 4B45A 3GFSA 4X84A 4L7QA 1EM8B 2X5XA 5EZYB 4KCGA 2QQ5A 4TMVA 5D1HA 3RO7A 3I5AA 1D09A 4P08A 1AE1A 1JW9B 3KT3A 2OB2A 4MV0A 4XUCA 4ND7A 5LB2A 3T3PB 3PE6A 4F2GA 1A27A 5F1PA 1WTAA 2HNAA 1EQUA 1ODFA 3L4KA 4ZCPA 3JPXA 4LY3A 4OV6B 2G76A 4KW7A 1NQOA 3QXSA 1TCVA 2VH1A 4KFTA 4O1MA 1GG2A 3U7JA 3KTFA 3KJGA 1XDDA 2OVRB 2Z8XA 3NHSA 4JYBA 4KN5A 4LFCB 1N3LA 4DTIA 3VZBA 3CQ9A 1II0A 2Q4TA 4Q19A 4B43A 4GQ1A 2H00A 3JVVA 1K68A 3PC2A 4FMDF 4FQ5A 4GWLA 4WXPA 3ZG6A 3FCSA 4W5HA 3VV3A 2GEDA 4PSAA 5EMLB 1AF7A 2ZYAA 4RMHA 4ERYA 5IXJA 3DCYA 2EKZA 4M49A 4JB0A 5IXYA 2WD7B 3DDUA 2XAAA 3T3OA 4YCDA 4PYKA 2IOYA 5A6VA 3F3FA 1U7OA 1DV1A 3RRMC 1XZKA 2BEWA 1WUYA 2V7PA 3BE4A 3IJ5A 2SICE 3PHCA 3TL3A 4B8YA 2R6ZA 1S1MA 1CFZA 1EP9A 1O9HA 3N7AA 4OYRA 1CG6A 3U7IA 1PTJA 2G0NA 1QZTA 1QSGA 3EAFA 3JD1A 1GAJA 1T0UA 1T9BA 5ELMA 4ALIA 4BUJA 5JECA 4O4JF 2JIDA 4CN8A 2ZUWA 5E6UA 3C3BA 3QXHA 2GOYA 2W4QA 3H04A 5BQPA 1NLZA 1BEUB 1ZM3A 1GPLA 3MF4A 3WP1B 3K9QO 2FFAA 1VZ3A 3SIWA 1PJTA 2BWJA 3BE8A 3UB4A 5HQTA 1QAMA 3HR7A 4H27A 1GQYA 2SCUA 4V0LA 2NU7A 1T35A 4XWTA 1BJKA 2OKGA 4QFDA 4EY8A 1RXVA 2V0GA 4K9NA 3AFOA 3ROKA 5KSWB 4EGFA 1SUIA 4CY5A 1UBUS 1XQVA 2B61A 4JQSA 4OXKA 3VR0A 1NWHA 1RQPA 3K0CA 4YRCA 5ES3A 5F9FA 4DRXA 2OHVA 4TGLA 1QRDA 3EOBI 3KQUA 1I2CA 1E0KA 4GZ8A 1K3FA 1N75A 2XEDA 3G79A 4CKWB 4C89A 5BNIA 2C7RA 1W0JD 1AS0A 3BF8A 2KPOA 1OLXA 4NYIQ 1J9EA 1LS1A 3N0TA 4MOWA 5DWQA 3WE7A 5K8UA 2J0SA 3T5AA 3H8SA 2KJQA 5LA6F 3ABZA 3W34A 5CCEA 1NBAA 1PHRA 3MGAA 2FTKE 1UM8A 3Q98A 4ND8B 1U4SA 3FGOA 3I3SR 3ODTA 4TM8A 5DOZA 1V1RB 3WIUA 4M76B 4DV4B 4HZUB 3KYJB 1H5UA 3SR0A 3LXUX 1M0SA 3OPYA 4CG1A 2OO5A 3DVAB 5TXGA 2XNDD 1CSEE 4Q6WA 5A1JA 4YDQA 5AXAA 4G4JA 2Q3FA 3FVVA 1L5YA 1LQ2A 1MO6A 3H87A 4TTVA 1ACJA 1XYGA 3QPAA 1E5XA 3MTIA 2NT4A 4CMAA 4Q7QA 1LWNA 2Q3LA 1NDUA 1H0RA 1K0FA 4QT8A 1XXHB 2JLRA 3FN4A 4GD3Q 3OA0A 1E2DA 4JC4A 4E4RA 4CQLA 2GDZA 1UK9A 4F5EA 2J6BA 3NW9A 1CJTC 1JIIA 1Y7HA 2B92A 4IXDA 4LBWA 4DCGA 1J97A 4JJ8A 4A9AA 5K2MA 5DX0A 3GIWA 4Q3KA 5JY6A 3E3MA 1SCQA 2OV4A 1AIPA 4A7PA 2EJVA 2OY0A 1JVSA 4A16A 3V8VA 1S96A 4WY2A 3DUWA 4G65A 5DTRA 3GNLA 3SQXA 1N2BA 1VKJA 2WQ6A 4RELA 1ZWKA 1U31A 1E2HA 3QX9A 4TMTA 3CRW1 3AVYA 2WWRA 3R6LA 2XMGA 3SYLA 5J1SB 2QAIA 5IT0A 3FNEA 2C4HA 2R96A 3I12A 2HV8A 2V98A 1Z5OA 1FUIA 1KEZA 4GNKA 4KFSA 5KNLA 5KQGA 1FYXA 2H13A 1EB8A 1PQWA 3LPAA 5ALGA 2JCYA 1B42A 5FPKA 4HGRA 2B21A 4HQLA 2V7QA 4BO6A 4QFBA 4CTNA 1E9RA 3QI7A 4O63O 4BX3A 3LSYA 1X8KA 4MQEB 2A9OA 2VRCA 5DK6A 4B1FA 4PSVA 1HL7A 1I32A 4US1R 3HBAA 2DHQA 5TMEA 3P9PA 2JCXA 3GFTA 1HKUA 4FFOA 4EGQA 1CUGA 1XB2A 3NDBB 4AUEA 2ETXA 4JN6B 3LUAA 4RDIA 3DS8A 1YKSA 1CDOA 1V0JA 2XUFA 2IDMA 3QHPA 3HDHA 1E7RA 3QX7A 1YRBA 1TF7A 5HILA 1QO0A 3HPRA 3R8CA 1OU4A 2ZSKA 1XDBA 4GOJA 4LHZA 4P5DA 1X94A 3K2IA 3K0EA 3I2GA 4L0CA 3L4BA 4TV8F 4ZYZA 2ZJYA 1UM9B 2J08A 3A1EA 3EHDA 1CR2A 4FA9D 1IWOA 1YTLA 4PF1A 4WNAA 4U4AA 3OJOA 2PJRA 1SFRA 3BE5A 5CDUA 1J7JA 2ZQYA 1KDPA 1LW6E 1ZUWA 3FCEA 2Z3VA 2IXAA 4M0DA 3SC6A 3UC9A 5LDDC 3UJBA 4JU9A 3CN7A 3NP9A 1R5NA 3OX3A 4G1MA 1QYXA 2FPPA 2G08A 4NBKA 4PLHA 1D2HA 1R9NA 4MAMA 4QULA 4FOLA 1DELA 3BBPA 3PFIA 4LNUA 4LTNA 4TKUA 3ZLUA 5THAA 2W2LD 3X2SA 5AJYA 4CKYA 3BK1A 5M3BA 1RXWA 3WYFA 3JQGA 1FRQA 4GIBA 4LF8B 2RGXA 1M1ZA 4B6EA 7GPBA 1QH8A 3NHWA 3CMMA 4A0FA 2IC5A 4I3GA 1W4RA 2ESRA 3JWJA 3AFHA 4J2HA 1GR0A 2GHRA 3JQ8B 4RHXA 2PWZA 4UHCA 4UUPA 4KUGA 4H17A 3E53A 3TZ6A 1DKUA 2O5CA 3LGXA 3CVVA 3ZWLB 1W0CA 4E15A 2IX3A 3OEYA 5BUSA 2PBRA 3EI3B 4AJ2A 3L9XA 5LXTA 2B4TO 5IM4A 3M3PA 1AGPA 3PDJA 4WDRA 1DKNA 1U7XA 5L3VA 1EUDA 2NVBA 1KBQA 3JQ9C 3RTGA 5HCNA 3PUWA 5KSPA 3X1JA 4EKGA 3GX1A 4JBGA 3TNLA 4UD6A 3OE7A 2QUHA 5LIPA 2Y1KA 4NFSA 3L8YA 1WHSB 2A92A 4B5LA 3FLMA 3RVQA 5IUNC 5BV2P 4OI1A 2EDCA 3E18A 1YB7A 4RL6A 2ON6A 2AMFA 2I0SA 3O4JA 1O77A 4J29A 1EDZA 2GBPA 1KI6B 1V4BA 2HMYB 2QXYA 3AL9A 5DM1A 2B6NA 2I0FA 5DB4A 5LYJB 3CH7A 1P75A 2QLFA 1EM8A 3QKTA 4MVCA 4WNIA 3T7RA 3VU1A 3JQ7A 4C4OA 3OTTA 5CB6A 1B7GO 4PVCA 1OLUA 4WEQA 4B80A 4LJ9A 5IT5A 2DFKB 1M7GA 2GCIA 2YW2A 4RK5A 1FP2A 4E54A 1PNOA 4YXWD 1TTTA 1N5RA 4RYDA 4Q1AA 2O2HA 3DOIA 2QWXA 4WKOA 4FI3F 1A88A 2IQ5A 2BR3A 5DF1A 5HCIA 1O0BA 4OIMA 4B3MB 4UM9B 2VKTA 3ER8A 4Q9DA 4U7PB 1DLIA 5I7UA 1XMJA 1SIUA 3FCSB 3EXEA 3IGFA 3T3DA 1E4VA 1YL7A 2ZVDA 3UMCA 4DJEC 1BSVA 5JY1A 2AG8A 4R01A 1ONSA 4Z8YA 4KQHA 4X6LA 1PV1A 2FR0A 2PM8A 5FBKA 3KAJA 4UQLA 1XN1A 1T2FA 2HQRA 1A9TA 3BGWA 4L27A 3WO0A 1U28A 1S3SA 3N1UA 4LGVA 4KNYA 4X65B 3ADCA 1ZHOA 2WWYA 4Z86A 1L5OA 4CKZA 5EKXA 1CS0B 4ER6A 1LFDB 3QENA 1RJ9A 2Z43A 4RHCA 5K0FA 3SFVA 5FWAA 4XYBA 1JF8A 2CLSA 1HZZC 4MA4A 1NJSA 1QF6A 3F4KA 4FFPA 5TQ2B 4C0WA 2O1WA 1L7XA 2BBT