3IVMA

Appep_wt+pp closed state
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
682
structure length
682
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords prolyl endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase/hydrolase inhibitor
total genus 210
structure length 682
sequence length 682
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3ivmA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ivmA01
1F6WA 1EINA 1F0NA 4BBZA 3LLCA 4RPCA 5ALOA 1ISPA 4G4GA 4GBGA 4ZV7A 2V9ZA 1GXSA 3WL6A 1UT6A 4H77A 3N0TA 1VJ5A 4AZ3A 3U0VA 2OQVA 4UHBA 5EHQA 2FX5A 4DTCA 1GPLA 4Y2JA 2XUHA 4W1SA 2XUDA 4FLEA 2VT7A 2ZJ6A 2QKYA 2PPLA 4QE3A 4X95A 5CT9A 4DSZA 2XB6A 4QWMA 5D3KA 2ZSIA 2BGRA 1QZ3A 3D2AA 5AM4A 4U2EA 4A16A 1CFJA 3R3UA 1QFSA 1VE6A 3R3YA 1QONA 3I2KA 1VXRA 1HDEA 5AIBA 1K6EA 1U8EA 1A8UA 1G5FA 2HRQA 2OLEA 5CTAA 1ZJ5A 3WI7A 4DMKA 2C0PA 1R3DA 3WA7A 3VJLA 3MUNA 3H2HA 2E3JA 5IH7A 1CUIA 2XMBA 3ESBA 4J7AA 4EHBA 2WIFA 1WM1A 1XZCA 2VJCA 4FOLA 5ALZA 2YH2A 3G9ZA 4HRYA 1MO2A 4IH1A 3BXPA 5LZ5A 1XKTA 5K3FA 2HHAA 4B0PA 5AP9A 5AI4A 2CEKA 1R9NA 4QDTA 1BEEA 1GKKA 2CJPA 2JGKA 5ALJA 3DL7A 4FFVA 5CT5A 4J03A 2GYUA 2HA3A 1T4MA 3T52A 4OPMA 1XQXA 2I03A 4G4IA 5HF8A 4J0JA 4HXEB 1U4NA 4DYHA 3BJMA 3RLIA 3IULA 1ACJA 1MU0A 3NOXA 3O95A 1F8UA 2ZYSA 3DDUA 3WQHA 2QUBA 2HA4A 5EFZA 3SK0A 1VOTA 5JARA 2HL6A 2XI4A 3R3WA 1EHYA 1EDBA 3FYUB 5AM2A 1CR6A 3WJ1A 1XROA 4RE5A 1XZGA 1HQDA 3WA6A 4BCBA 1DTEA 4G1FA 1XZIA 4UBOA 2XMQA 1MPXA 2EEPA 4CG1A 1N5RA 4OYYA 5ALUA 1DINA 2H1IA 4B82A 2VAXA 3BDIA 5C8VA 4PSDA 3H1AA 4EZIA 1AGYA 5CMLA 5T4BA 1CUHA 2H7CA 4HVTA 4W63A 4BTVA 1E5TA 3R3VA 2XQJA 3O0DA 3I2GA 3H1BA 1UXOA 1UKBA 3H18A 5DNWA 1EA5A 2QR5A 4H35A 3BJRA 4N5IX 3I1IA 1EXWA 1DQZA 4FDMA 5CT6A 2H7XA 4K6GA 4YK7A 2ONCA 2VAVA 1VZ2A 5AOBA 2BGNA 5AKEA 5FPPA 5EIEA 3JYHA 1WHSA 1XRQA 5D6OA 3C70A 1JU3A 4DM7A 3D3NA 2GYWA 1TCBA 1UFOA 2DHCA 1VA5A 5BWBA 4Q82A 4L3WA 1K5PA 1AQLA 3C8HA 1D07A 3STUA 3DYVA 4HTAA 2VTVA 4NVRA 4C89A 2RONA 4K2AA 4EBBA 1GGVA 1FFCA 4JYPA 3W2TA 7YASA 1CUWA 4YASA 5IVDA 2XUPA 1CLEA 2ACKA 4UPDA 4QEKA 2AJDA 1UZAA 3D5EA 3AZPA 2XUIA 4KE7A 3G8YA 3AFIA 1QLWA 2XQGA 3MGAA 1DT3A 3STTA 4D9JA 2FJPA 2C5FA 1E8MA 1JMYA 1DX6A 5DTJA 1EB9A 2JIDA 1UK7A 5LZ4A 4HXGA 1UOOA 4JYMA 4AX4A 5AK3A 1WB4A 1VE7A 1LBSA 1W1IA 2PU5A 5FPQA 3ZPXA 2JGJA 4IH9A 3DL4A 2XE4A 5AKIA 1EDEA 3WKBA 4GECA 2RAUA 5FP0A 2I78A 1DWOA 1WB5A 2GBFA 2HFKA 3IA2A 4LXIA 3BL8A 1Q84A 1SCQA 4CIBA 2JEZA 3WWDA 2PSFA 3STWA 2PSJA 3V1MA 2WJ6A 3H2JA 5ISMA 3K9BA 4RE6A 4BP9A 3EQ7A 4G9EA 2FJ0A 2Z5GA 2OCIA 3DKRA 4HRXA 1G4HA 1VA4A 4W1QA 2V97A 2BJHA 5ALXA 4IHAA 3A2LA 3D2CA 4BVLA 1Y37A 4GEGA 5DNVA 3WK5A 4GXNA 4BRZA 4LYEA 3FLBA 2X5XA 3WK8A 5CW2A 3IUQA 1N5MA 3BE8A 4F60A 2WHRA 4QLOA 3DJYA 4KR0A 3B3QA 1PFQA 2JGLA 1CV2A 5JZSA 1ODTC 3HLKA 3FWHA 3WMRA 1QO9A 1YASA 3G7NA 3UMJA 4J0HA 3X3HA 2DR0A 3R0VA 3QM1A 2WG2A 1M33A 5CXXA 2WHPA 4UHFA 1EH5A 4OB8A 1W52X 2Y1KA 3DYIA 1FFEA 3RARA 3GA7A 4WDQA 4AXBA 2VQ6A 4E15A 4DMHA 1JJFA 1LPAB 5HF5A 5HFAA 2C4HA 1EDDA 4BZZA 1CUFA 5FXMA 3ICVA 1BN7A 2CMFA 4X90A 2DSNA 2OGTA 3PUHA 4FHZA 5A6VA 3GELA 1CEXA 1XQVA 5ALTA 5AM3A 1DU4A 2B9VA 1JJIA 1H22A 1Q0RA 1HLGA 5I8PA 4KAAA 5CH3A 1Y7IA 5LP1A 2OCGA 2XQKA 2QMQA 2OG1A 5ALFA 4DNPA 4BZWA 5BV7A 3FAKA 1EI9A 3QPDA 2WG0A 2XUGA 2UZ0A 4XIIA 4H7DA 5EHXA 2B20A 4Q1VA 1CUZA 1W6RA 1C7JA 4JEIA 3HXKA 2WJ4A 4MWTA 4LXGA 4X94A 5AOAA 1PV1A 3G0BA 5K3DA 4UFOA 1TCAA 1QIMA 1EVEA 1UOPA 3QH4A 1Q0ZA 4BE4A 1LPBB 2H9YA 2WFZA 2WM2A 3GUUA 4QWWA 2IITA 3ZV7A 2RHTA 3JW8A 3ZLTA 4Y2RA 4X97A 4BCCA 1LBTA 5JZBA 4EUSA 1O6FA 3WZMA 1CUSA 5C7YA 2IIVA 3H0CA 4LIPD 5C8XA 3PUIA 3RKSA 2BAGA 4H0CA 5FRDA 3H2GA 2H7YA 4DNFA 2WIDA 5DYYA 3V9AA 2AJ8A 1T2NA 2OGSA 3F8SA 1TIBA 5LLSA 4B6GA 5I7UA 2G4LA 4NS4A 2Y2UA 2HA7A 2QJRA 3C8DA 3LIPA 3WK4A 3DOIA 4U2FA 3C6ZA 3C45A 4M0MA 3PE6A 5JANA 4AN1A 5EHNA 2XT0A 3TJMA 2ZVDA 1MTZA 5HFNA 2WG1A 4GW3A 5JD6A 4N8EA 2WJ3A 4N8SA 1DWQA 1JT2A 2EDCA 3C6XA 4K6HA 5YASA 4DIUA 2J4CA 1TKRA 4B80A 2XMGA 1A8SA 1TQHA 3WL5A 4Y7DA 4C4XA 3G0DA 4WFJA 4E46A 5CH8A 5A7HA 2DQYA 4RNCA 1P0PA 2HU5A 1E8DA 4Y2YA 3LS2A 5ALKA 1UOQA 3LP5A 2HA2A 4G9GA 3ZLVA 1CUBA 5AH0A 3CCBA 1J06A 3R3XA 5C81A 5JASA 4U2DA 1E8NA 1YR2A 4NMWA 1LLFA 3PF9A 3IDAA 4IH4A 4UFPA 2D0DA 1MN6A 5IVIA 3Q8WA 4DNOA 2VJAA 4MQMA 1XZAA 4FLMA 2I3ZA 4UHHA 1CIJA 3MUOA 2D5LA 3QZUA 3UUEA 2BUAA 1YA8A 4PSCA 4PNZA 1BN6A 4C4YA 2WTMA 5DWDA 4CCYB 5JD4A 2WFMA 2VEOA 4X92A 4KAJA 3ESDA 3G0IA 3V1NA 1CPYA 1R4ZA 2HIHA 4B83A 1IUNA 1W4LA 4X6XA 3M81A 4ZV9A 3A6ZA 1L7QA 5E2IA 1J07A 4AO7A 1CUUA 1BROA 4G4JA 3DCNA 1CUGA 1EK1A 1TRHA 3M82A 2J4FA 5T4EA 2XMRA 5JAUA 1ZIXA 5AKXA 1SCIA 2XMSA 2QXTA 5JD5A 1DT5A 4A5SA 4KRXA 1EK2A 1H23A 1Q83A 4U2BA 1YAHA 4UBJA 2C7BA 3KDAA 3T4UA 4M0EA 1CVLA 1ORVA 1GQSA 3O4GA 4BVJA 1G66A 3O4JA 3A2NA 1LPOA 4EA6A 2YXPX 1LZKA 2PUJA 1PJAA 4AMYA 4FBLA 5CRIA 3I2IA 4AMZA 5AJHA 5EHZA 3K2IA 4CCYA 4OU4A 3AILA 4X7BA 1QIHA 3NWOA 1MAAA 3TEJA 1C7IA 4L0CA 3FLEA 2GZSA 2I3DA 3F97A 1YCDA 4G8BA 3H19A 3F96A 1IUOA 5K3EA 4OB7A 2RGUA 2QM0A 3VVMA 5AO9A 1FJ2A 3FVTA 4K6KA 5IKXA 3V1KA 1GT6A 1XZLA 1ZD3A 3G9XA 1LPNA 4FTWA 4C6HA 3QITA 3ICWA 3ILSA 3ANSA 3D7RA 4XJVA 2PSHA 4QDUA 2Y6VA 4ZI5A 4DGQA 4F5ZA 3MVEA 3C5WP 3LCRA 2Z3WA 2ECFA 3FYTA 4AO8A 5LIPA 3FYUA 1LNSA 5EIAA 2VA9A 5ALGA 4B85A 5K3CA 4Q3OA 4ARAA 1XRRA 3BWXA 4X85A 5AKGA 3WYNA 3WK6A 5HK8A 3AJAA 3HJUA 3DKKA 4K5QA 4G8DA 5A71A 5HF9A 3WZLA 3U1TA 3WYDA 3D0KA 5LZ9A 2HA6A 2AJLI 2JGEA 5E4TA 2OPHA 3QPCA 5H3HA 5K3BA 1P0IA 1XZDA 4KEAA 4N5HX 2AXEA 4CG3A 4TGLA 4H7JA 5KWJA 1R1DA 4C88A 4HS9A 2PVSA 4B81A 3B5EA 4J0CA 5ALVA 2QS9A 1LPMA 5ALWA 1SFRA 2HA5A 5LZ2A 3FYUC 2XDWA 3M83A 1K63A 2X76A 3FSGA 3WKAA 5JZ9A 3O9VA 2OAEA 3ESCA 5T4HA 1MNQA 5KREA 3SC2A 1YSCA 3W9BA 3WL8A 3NGMA 2PU7A 3A2MA 5JIBA 4CI9A 5LKRA 1QIIA 4ETWA 1XRMA 2V96A 5JAPA 1CUEA 3PFCA 4EY7A 4BATA 1DWPA 4GDMA 2WIJA 2B4KA 2ZYRA 2QRUA 3VISA 3E0XA 5JYCA 2WKWA 3G9UA 1ZI9A 2QVBA 3YASA 3WL7A 4KE6A 5LKAA 4B0OA 1VKHA 4J0DA 4B9EA 2WUEA 1FFBA 1DX4A 3WWEA 4UHCA 1UK9A 4ITVA 2VJDA 4E11A 3KXPA 4MEAA 3H2KA 1TK3A 3M3DA 1O6GA 2XMDA 2O7VA 3N2ZB 5LZ7A 4P93A 2PUHA 3AZQA 5ALSA 4S0XA 1QJ4A 3DEAA 3PF8A 3FVRA 3R40A 3VVLA 1ORWA 4M0FA 1ODCA 3D4LA 4Q3LA 4OCZA 5DJ5A 2O2IA 1B6GA 3WIBA 3G0CA 4PSUA 5AK6A 1XZKA 1BRTA 1RP1A 1BCSA 2O2HA 1QO7A 4Y2TA 5AM1A 1QTIA 1LPSA 2JEYA 2WU4A 1LZLA 2JBWA 2CZQA 2Z8XA 3KD2A 4XWGA 4GHWA 5AKJA 1SC9A 2BKLA 1RWQA 1FFDA 3G02A 1XRLA 3IUNA 1MX5A 4FMPA 2ZYIA 3UUFA 5ALQA 3PFBA 3STYA 4FFWA 3FBWA 2P8SA 1CQZA 1ZD4A 1ZD5A 2WU3A 4QLAA 3I2HA 1QIKA 4UUQA 3BF7A 4CIAA 5AKKA 3IUJA 2RIPA 4BDTA 4F21A 4J0KA 1KU0A 2DHEA 4EY5A 2GBCA 3WKEA 3SX4A 1KEZA 2OCKA 2VF2A 4X00A 1QE3A 1L7RA 1JFRA 2YYSA 1SCKA 1YA4A 4BE9A 3TRDA 4IO0A 5LZ8A 1ZI6A 3AIOA 5JAHA 3WK7A 4MJ3A 1THGA 1ETHA 4HXFB 1NU8A 2PKYX 1QFMA 1WPXA 5A62A 3BF8A 1ACLA 3DNMA 3DQZA 5FOQA 4L72A 3WK9A 3HC7A 1USWA 3DS8A 4B84A 1IUPA 1NU6A 5FLKA 4WCVA 5JAOA 3HI4A 2QTBA 1N1MA 4GWLA 2RHWA 3AINA 4PO3X 1BEZA 2WFLB 5HQ3B 3CN9A 5FDFA 3CCCA 4TVKA 4FNGA 2ZYHA 2YASA 4BP8A 2DCMA 3F67A 4PQEA 3I6YA 3C5VA 5D7BA 1NX9A 1A7UA 3AZOA 5IVKA 1YS1X 1TAHA 2XUFA 4BAUA 4OU5A 5CT8A 5DYTA 1MNAA 4H7HA 3VDXA 4W1PA 3ZWQA 1CQWA 4L9AA 1UK8A 1ODSA 5FUMA 2B61A 3FOBA 3HRHA 3R41A 4H7KA 4EB0A 4P92A 4G8CA 4Q05A 4IQ4A 2WTNA 4J0IA 4BC0A 5ALNA 3PI6A 2DQZA 5I9IA 5AM0A 1EB8A 4X3CA 2QUAA 2DFPA 4HAIA 5D3ZA 1AZWA 3PICA 4UBLA 2CKMA 5HCUA 1EX9A 4Q3KA 2WUGA 2OQIA 3WLAA 4DNQA 2QOEA 4JUIA 4LKOA 1MX1A 1AUOA 4GI1A 2PBLA 5EGNA 4QA9A 1GPNA 1JJBA 5CH5A 1A8QA 4N8DA 3IB3A 1RYYA 2WLSA 1G42A 2GBIA 3OURA 2JGIA 4YPVA 4X93A 4UFNA 5ALYA 4I3FA 1P0MA 1ZGCA 1CUVA 4Z49A 4JH0A 3F98A 5E4YA 5HF6A 1S8OA 2XMCA 3W9UA 1GZ7A 4X91A 3HYSA 1I6WA 5K3FB 3KSRA 3OM8A 5CURA 4WJLA 3CN7A 1K8QA 2NW6A 3I1YA 1H2ZA 2HADA 3CXUA 3HEAA 2XMZA 4ARBA 5DLPA 4B7ZA 4KE9A 3STVA 1XZMA 3OOSA 1DQYA 4YX9A 5CXUA 5LYYA 3O9MA 4DSAA 3KWJA 1MAHA 2Y2VA 2ORYA 2WIKA 2BFNA 1K4YA 2XQFA 1X2BA 4Y2QA 5JADA 3JWEA 2PX6A 2XUAA 5CT4A 5DTIA 2G5TA 4QDOA 4PF1A 1EVQA 1XLWA 4AQDA 1YS2X 3C87A 4MQLA 4V2IA 3I2FA 2C58A 5C8ZA 1MX9A 3L1JA 3D2BA 2CUTA 2OXEA 4LHEA 3O4HA 1Z68A 3D59A 2AJCA 2PM8A 4DMCA 4MWSA 2JGMA 4AB1A 3VJMA 1WOMA 2PL5A 2OAGA 3DD5A 1R9MA 1CUXA 3GBSA 4Y2SA 1OCEA 5AIAA 4W1RA 4OUKX 3O4IA 2WSLA 3QPAA 3FSGD 4LYDA 1JI3A 1X70A 4KRYA 3ZI7A 1ZOIA 3KOOA 3OG9A 5HZGA 5A2GA 4OB6A 1E3QA 3QMWA 1QIGA 5F4ZA 3GZJA 3BDVA 1IZ7A 1WPRA 1XFDA 2QXUA 3W06A 3K6KA 4DMFA 1AX9A 2QZPA 5AK4A 1N8SA 5ALLA 4A23A 4CFSA 5CBKA 3WWOA 4X6YA 3EQ8A 2Q0XA 2AJBA 2EDAA 5ALMA 3ED1A 1FSSA 2WILA 1UK6A 1XRPA 2GZRA 2K2QB 1R50A 5DYWA 3OTQA 3ZLUA 1KU6A 4J3JA 1XKLA 3H04A 2O7RA 2HFJA 3AIMA 3WJ2A 3HABA 1H2XA 4BVKA 2JF0A 2CB9A 3I6MA 1R88A 3RK4A 4FBMA 2VT6A 3DLTA 2HU7A 3RM3A 1VXOA 1YB7A 2BUCA 5DNUA 2WQZA 2ZSHA 1YB6A 1MJ5A 4KAFA 1AMNA 1J2EA 2HU8A 4H7FA 4OYLA 1CUYA 3H2IA 2PSDA 2VJBA 2WIGA 5HK9A 4AN0A 1HL7A 1X2EA 4X71A 2BCEA 4NZZA 5JATA 1AC5A 1QOZA 3IUMA 4AO6A 1Y7HA 3STXA 4X6UA 5BWCA 4ROTA 5K3AA 5AI5A 4FNMA 1C4XA 1QIJA 4EY6A 3F9CA 2G63A 1JU4A 1ZGBA 5AOCA 5IVHA 2RI6A 1OILA 1E66A 1OXMA 4FKBA 4O08A 4QNNA 4QDZA 5ALEA 4BCDA 4MXDA 4UBMA 1HBJA 1UKAA 2HDWA 4INZA 4ZGBA 1XLVA 4B9AA 3FCXA 3HZOA 3IIIA 1XZHA 1B41A 4J0GA 4E14A 3WIOA 4GLBA 3OC0A 2VSQA 2ZJ7A 4I19A 5ALIA 1SOMA 1H2YA 5J3JA 1XQYA 5ALRA 4C01A 5SYNA 3QMVA 4HZGA 5AI9A 3Q0TA 4F0JA 2DHDA 3QBJA 1H2WA 4FWBA 4UBKA 1HPLA 3IBTA 1F0PA 1VLQA 2W22A 3LIIA 2WUFA 6YASA 3EQ9A 2X8BA 1XZFA 3GFFA 1U2EA 4OSEA 2XUOA 4ZREA 4U2CA 3AIKA 2LIPA 1QIDA 3V48A 5ALPA 3QMMA 1L7AA 1BS9A 1IVYA 3E1GA 1XZJA 1W75A 2HRRA 2C5GA 3S2ZA 4CG2A 5EI5A 1P0QA 4KJXA 3I6ZA 2R11A 4PV7A 3W05A 1UKCA 4C87A 2XLBA 2WHPB 1JMKC 5HKAA 1MT3A 1XZEA 4H7IA 1QGED 3ESAA 3WKCA 4PW0A 3HACA 4LXHA 4P9NA 4MYSA 1JKMA 3R3ZA 1GPKA 1VZ3A 2G5PA 5FKJA 5JALA 4MYDA 3QYJA 4WY8A 5SYMA 5AKHA 2OCLA 1ZJ4A 3WWPA 4BAGA 1XZBA 5E4JA 3BIWA 4BYMA 2XQIA 4FLFA 2R8BA 2J3DA 4H7EA 3NUZA 4CCWA 4QDXA 4P08A 2OGZA 3EBLA 3BIXA 2XUJA 5AI0A 1BU8A 4BRSA 2ES4A 3C6YA 5K5EA 1CUCA 1W76A 3PDCA 1ZIYA 1TCCA 1GKLA 1BE0A 4XVCA 1WHTA 3S8YA 1GQRA 3C6BA 3L1HA 3I2JA 2W6CX 1ZD2P 2FUKA 4UHEA 2ACEA 3VJKA 3WKDA 4ZRDA 1U65A 4XX1A 5AK5A 3TGLA 4C4ZA 5AKLA 1AURA 3ANTA 3A70A 2Z8ZA 2J3QA 2HM7A 4Y2UA 5AM5A 5T4FA 1CRLA 1AKNA 3IVMA 4BDSA 2HA0A 1E89A 3E4DA 4ZWNA 4Y2PA 1XLUA 2VATA 4WFIA 5AICA 4BTLA 4UBIA 4ZXFA 4BB0A 3H17A 3I28A 3EIOA 3DOHA 1YAJA 4WFKA 4U2GA 3C43A 1BCRA 3FLAA 1A88A 4Y2VA 4KYVA 5ALDA 4MEBA 2JGFA 1CUAA 4Y9SA 2WHQA 4WY5A 4WDRA 4TPKA 3E3AA 5AKYA 4KE8A 3FNBA 3SWWA 3GROA 1HKHA 1IZ8A 4UBNA 2CBGA 1QIFA 1CUDA 3IURA 2ZJFA 1FFAA 3WWCA 3P2MA 1XQWA 3HSSA 3FCYA 3QVMA 5AI8A 4DLNA 2C0QA 4JNCA 3B12A 3VKFA 3L1IA 1LPPA 5A7FA 2QT9A 1ZICA 4UHDA 2BUBA 1IMJA 3G0GA 2Y6UA 5AI6A 4EY8A 5ALHA 4AZ0A 4H18A 4W9RA 4EY4A 1QTRA 5AKZA 2GBGA 4RGYA 2Z3ZA 4Y2XA 2O2GA 1WCYA 5A7GA 2GYVA 4QZVA 5HKBA 2QJWA 5KBYA 4OD0A 3EF3A 3G9TA 1THTA 3VXKA 2IX9A 2PSEA 3W04A 1WB6A 4G5XA 2V98A 4BC1A 1LGYA 5EIHA 3KWFA 3V1LA 1XRNA 4Q34A 3AUKA 2ROQA 2XUQA 4BAZA 2WUDA 1J1IA 4I4CA 5BOVA 3OPMA 1ZI8A 5FV4A 5ESRA 1QIEA 2WFLA 5HQ3A 5KWIA 1CUJA 2XUKA 1UWCA 5AHXA 2XLCA 4KACA
chains in the Genus database with same CATH superfamily
3OPXA 4EDHA 3H65A 5FBQB 1V11B 2OQ2A 1V8ZA 3EEOA 5CJ2A 4RPCA 2ZB3A 4XFJA 1GXRA 1ISPA 2FR1A 4ZV7A 1GXSA 1C9LA 3DLBA 3E2IA 2C82A 2QPAA 2AQ8A 5E1MA 1RXVA 3HJTA 4FI3C 4GF5A 3KBBA 5LQNA 4W1SA 2XUDA 3KSZO 4L5AA 4X95A 3OQNA 2XB6A 3U4DA 5FA6A 3EC1A 5JRDS 2VDQA 1NONA 5DBOA 3U4AA 4V1CA 4YHBA 1M6VB 1KBOA 3SZ3A 4PSAA 1JWAB 2C0PA 5CCEA 3NWJA 4H6WA 4RH0A 4TXNA 1WUJS 2CNWA 4RXTA 2HRBA 3WFIA 5C2JB 1JPUA 1D0VA 4MRRA 4HRYA 4BNGA 3M4ZA 5I9SA 4EUKA 3TNFA 3H42B 3WLEA 2IYTA 1M1UA 3VR3A 1YI0A 4K6FA 1M9NA 4A8JC 1QLJA 1MGPA 2ZG6A 1GA6A 2QN8A 4RABA 4FA1D 4CKZA 2C5LA 1XJWA 3F6EX 3VGZA 1XVVA 1P1FA 4J0JA 4HXEB 1U4NA 4Y67A 1G18A 3FGBA 3P9SA 3VSCA 3PYLA 4L22A 1F8UA 2QUBA 4B40A 3W3ZB 4RTQA 1Z25A 1KVTA 5FADA 3E0CA 4RE5A 1WXEA 4AZWA 4AKHA 4A11B 1B15A 3D7LA 1XEWY 3C7TA 2H48A 3OU7A 5TQ2A 1GTMA 1U1CA 4QBHA 4D3XA 1EJ2A 3VTKA 4CG1A 5ALUA 8MHTA 2CFSA 4NE9A 3U60B 4TTRA 5F9FA 3U1BA 1O95D 3ET5A 4RFSA 1KIMA 2DKOA 3C3BA 2D74A 1Q17A 3NBUA 1QG0A 2EIDA 4P3YA 3GRKA 4BMCA 5CNJA 1VPLA 5WRFA 4R2LA 1R64A 2HREA 5B53A 1NIJA 1Z5WA 5CVDA 1C7FA 4ZOZA 3AV3A 1H3EA 2JFWA 5A9SB 3EFBA 1TYDE 3W5BA 1YE3A 1JXQA 3PHIA 1NBHA 3K16A 2I2AA 5TSDA 3UHPA 1GFWA 1LJ8A 4NCJA 3AM1A 4HQRA 4BBPA 4DM7A 4KQKA 3FDJA 3QKWA 5FUQA 4DLAA 1O3YA 1ISJA 3EPRA 2QL9A 2CUKA 1LBHA 1AQLA 3STUA 1XD2A 3NDPA 5EQTA 2IY7A 1Z5UA 2G88A 1KJQA 1GNQA 5TQ0B 3ODPA 1PZHA 4RTPA 2NPFA 3DHVA 2AH0A 4QEKA 5ABPA 1UC8A 2WK1A 3AFIA 4Q4HA 4D9JA 3TGWA 3OP1A 2P0AA 5C3MA 1LFAA 3E1SA 1K92A 5EAPA 4BMYA 3CFVA 1P7YA 4DHEA 4CHGA 3CF2A 2C4WA 2JD1A 3B70A 3AHEA 4MYUA 4LVNA 4QYMA 4CI2A 1Y33E 1C7QA 1N8NA 1E3WB 3AVYA 1WB5A 3QI7A 2HFKA 2OY0A 3IA2A 5TPWA 1N9GA 3K2EA 4CKWB 3TSAA 1I0ZA 1EESA 3VSAA 1C1HA 3UXEA 3V1MA 4R71A 4JVLA 2WJ6A 3CE9A 3GLIE 2JJ2D 1RD4A 1RE0A 3C98A 1QVZA 3EGXA 2OCIA 1U7OA 5FPSA 1U2QA 1IWOA 2ORWA 2V97A 3BOSA 4UC0A 4GI3A 3EG9A 3AJEA 1S1CA 3IR5A 4RYLA 3GJ8A 3K6JA 5TGTA 1YBVA 2WHRA 3SQNA 4V0ME 1PFQA 3A1WA 1ODTC 4HNRA 2IP2A 3IEXA 4B3XA 3CT6A 1FQJA 3ZD9A 3TZQA 2CGEA 2W00A 1F17A 4AJ1A 2OT3B 5IC7A 5NULA 3AW8A 4BX8A 1JHYA 1FDRA 2ZR7A 1M2NA 4OV6B 3QKIA 4ZAXA 2W83A 3ZU5A 3RAGA 4X1IA 4QU5A 1X38A 1EJBA 3ENVA 4JJZA 5DTMA 3GEGA 1MFPA 4HB2A 1BG6A 3ZK7A 3H75A 3EJ6A 3E3MA 3DAGA 4KX5A 3Q87B 1RHQA 3GELA 1F0YA 5AUQA 2AB0A 4PC0A 2Q3FA 2D5BA 1H22A 3SYKA 3IR7A 4TSKA 2E5FA 1BFKA 5CCXA 4GYKA 1O0BA 4HWSA 4BZWA 1KMQA 2ETVA 3LAWA 4H7DA 4YJKA 4A7PA 1F2UB 1PR3A 3FMOB 1V25A 4RL6A 4PRKA 1DTWA 4JYCA 1Q7CA 3WSWA 1NT4A 2NADA 4MVJG 4G9BA 2IS6A 4ZHQA 2G99A 4BLVA 3DM9B 1H2BA 3FDXA 1M2JA 3WNVA 4BNNA 3ZHCA 1CUSA 1FDTA 1PK8A 3DW1X 2IYZA 1ENPA 2R65A 4N3BA 2GRJA 4Z86A 2IYYA 4R2JA 3AKCA 1T2NA 1ZQ1A 2A86A 5BR8B 7ABPA 2G4LA 3KOWA 3LIPA 5EHNA 2C92A 1J7KA 3L7CA 1AGPA 3EASA 3I9JA 4UMFA 1DWQA 1YBMA 4F3CA 5BMOA 3CW8X 5CCDA 5JS2A 4N47A 5B7GA 3D8TA 2VFAA 2CSXA 4MITA 5CFOA 3C8MA 5FAXA 5KX5A 2HLNA 3MWLA 3V46A 4L28A 1KZ4A 4PNHA 1L4HA 1V8PA 4J9VA 5KDLA 3KXKA 3UTCA 3IDAA 1M8PA 3HB1A 3EMDA 5IVIA 1N5KA 4PIMA 4Y30A 4KGDA 1PS0A 1LF0A 1RAFA 5J2UA 3LDGA 3VUEA 2O23A 4DEYA 4B44A 1JXOA 3GP5A 2DTDA 5H81A 3PTLA 1UJCA 4BKUA 2AGYA 3V1NA 4HX5A 1EWYA 3UHAA 1C1DA 4IWXA 1B23P 2QN2A 1F5SA 1DJMA 4ZO9A 4ZZ2A 4DA9A 2FUG1 2VHZA 1C7RA 4F9EA 3UGJA 2AA3A 1USKA 1EUCB 5EM2A 2DLCX 4M7RA 4C20A 4L3GD 5L45A 2Q4DA 2UYCA 2L18A 4PRZA 4ZMBA 4QULA 5BW8A 1Z28A 1QVAA 1FRQA 2QT1A 3MSCA 4J2TA 1ONBA 3ZWYA 2FUNB 3MWDB 3E03A 2PUBA 4WGFA 2ZANA 5AJHA 4OU4A 2AXQA 5DBIA 3T54A 1MAAA 3CLTD 2QRNA 3TEJA 3QGMA 2ZIVB 2GTPA 1YK1A 1ENOA 5BNFA 1UF9A 4O2BF 1LTKA 1I80A 4BKQA 1TK2A 2JZNA 3TEFA 4WPGA 4DCUA 1IY8A 4MV0A 3IHTA 4F8EA 3GO4A 3HN7A 2PUEA 1ECGA 3IO5A 5JH7A 1AMUA 1KZ7B 2HIAA 3ABRB 2P2NA 1WZEA 5DCWA 3BG5A 4W6ZA 1NJ8A 3QTTA 1I5EA 4JT6C 3GHHA 3WGJA 2ECFA 2FDRA 2C9ZA 2E4UA 3HO1A 2FLKA 3FWPA 4KL8S 4CR7A 1OLSB 1W48A 2QRMA 5I9MA 2GD1O 3EG5A 4XCXA 2EWWA 3FIJA 1I2MB 4O0MA 3T0IA 2EX0A 3SE0A 4F7DA 4KTVE 1ZLYA 3BMXA 2OPHA 5IKPA 3MG9A 3F5FA 5AVWA 1MAVA 1XZDA 4LOHA 4KUEA 2HK8A 4BIMA 3CZPA 3SC3A 4O1IA 5CFRA 1O5IA 3RF6A 4NX2A 4HS9A 4YRQA 2J87A 2B5NA 4LKRA 1LPMA 1SFRA 4BU0A 3ZOKA 4LBZA 1YZTA 3M83A 3D1VA 3KZOA 3UT5A 1U3UA 4V0KA 4YRMA 1V37A 1M8GA 3C6QA 4CI9A 2DVMA 1OWPA 4ETWA 5CXQA 1NVXQ 3PFCA 1KE2A 3LSYA 5D5PA 1YDMA 3A7DA 3CZ5A 4NDZA 1GG5A 1PT5A 3ITNA 5B5SA 4IGEA 2H2DA 4BVGA 3OKCA 4MTCA 5IT9A 4PC3A 1XG5A 3AG6A 2R7KA 2RHOA 2AVNA 1WU7A 4HTFA 5M61A 2ZWVA 2O7VA 3G13A 4WESB 1BJKA 5B6PA 4N01A 5J4KA 5K45A 3LCVB 1MXFA 3CLRD 4X60A 3D4LA 1ZD8A 3DVRX 2QT0A 2P9NC 1I1QB 4MH0R 3TOXA 2AG0A 1HFJA 4IW3B 5HHTA 3RKRA 4D9NA 1F3OA 3L3BA 3ZCVA 5C5DA 3IUNA 2CLKB 4ZOCA 1LLUA 4FMPA 2NTEA 4DV5B 1ZY2A 4ZAYA 1TEVA 4HAYA 5FO0A 2C4NA 4JDUA 3WDKA 1NBMA 5GTDA 4I5FA 4R9NA 1AQJA 1E1QD 1KU0A 2DHEA 3U31A 1L7RA 1JFRA 2ZUSA 1E60A 1VBMA 3N0RA 4LAFA 3EI3A 4JBGA 1PEKE 1B16A 1JLKA 2IFTA 4RDCA 1ZD1A 2PK3A 3SXUB 2BVNA 1J2TA 3CS3A 2BBTA 2UVQA 3WK9A 3A26A 3HGTA 5ERXA 2GN4A 3QEAZ 5KOIA 2AJTA 3HI4A 1XAJA 4TTTS 1OOEA 3QEKA 3UQYS 3MT9A 1LA2A 4WA8A 4LDQA 3F67A 4EA7A 4PZZA 4OX9Y 3SHWA 4KDRA 4A0RA 4Q7KA 4I4TF 3G82C 2PMDA 1SHJA 2AWOA 4MV6A 4DXDA 3PDWA 5E9QA 3QY9A 2A9JA 4IQ4A 4BC0A 3PI6A 4HHEA 3QOWA 4EMSA 5I9IA 3MJ4A 2QUAA 4YROA 3WB0A 1F2DA 3HCDA 2YX1A 4CF5A 1NVMB 4R05A 4LKOA 1HORA 3IC5A 2XCTB 4C5AA 1N6RA 4IUDS 3ZWVA 3OURA 3CNNA 2KBFA 2JPDA 4FINA 1WDKA 4L8LA 5EE0A 3F98A 1IHDA 1NBEA 3DYBA 4MHSA 4X91A 2WAMA 2IE8A 1O5OA 4C30A 5FPKA 5DLPA 3AERB 3S1SA 2HEGA 2NU6B 3STVA 4GWGA 4JHNA 3IE2A 4RA6A 4E94A 4GSLA 1NX6A 2FQ1A 2IXEA 2ORYA 2WKQA 5CG1A 3EUAA 4Y2QA 2PX6A 2XUAA 1TDJA 3F78A 1EVQA 5HQTA 3VU1A 2Y8EA 4LDRA 1VI2A 3CLUD 3L1JA 1LTQA 2HJ4A 3HA2A 4BO1A 4YCBA 3D59A 4P34A 2Q3MA 2WJVA 1K7YA 1H05A 2A3NA 1Z33A 2HAEA 1JDSA 1CUXA 1G8HA 1QB7A 1R9MA 2JLVA 3SICE 3SYRA 1T4CB 3EI4A 5K05A 2YJZA 1JUDA 3Q3GE 4MS4A 3H83A 4OUKX 3TZLA 3QPAA 3TW4A 3CW2A 1IHYA 2W5UA 4OB6A 1L5SA 3EFHA 4DNUA 1XO1A 4QQKA 3LT1A 4HGPA 2YQZA 4KQIA 1EXNA 3N70A 1KHTA 4U7DA 3OLXA 3HFJA 2CLFB 5DT9A 3UAOA 1FSSA 4WNAA 1ZDMA 5KWSA 4A2WA 4F1KA 2GZRA 3FKSD 1UAAA 1D8TA 1GOGA 2XNHA 3NC4A 3ZZTA 3AIMA 2CNKA 4D6XA 2PNJA 4XR9A 3JY6A 3BGWA 3RM3A 2I67A 4D97A 3QVGB 4RANA 1O08A 1NUHA 4V0NA 2A35A 4KAFA 1X6VA 3LYHA 2ZULA 3O8NA 3TQCA 2R60A 2PVPA 4XEUA 3OCXA 3MAAC 4KXLA 1PT8A 4M8LA 4PYKA 2ID4A 3KTDA 4X6UA 2WP8J 3PUWA 5A06A 3O90A 1QHFA 3JAMg 1N8KA 3AFCA 4HL6A 3IT3A 3O1HB 3SBQA 2BEWB 2IZ7A 5FI5A 1RHMA 3V34A 3AFNA 3FCXA 4WVFA 2D6FA 5U4QA 1XA3A 2O8DB 3BMQB 3SX0A 1CHNA 1KR5A 1WZIA 2C2GA 2H5JA 4KWHA 1FU7A 2EIEA 3H5WA 2FMKA 4ML3A 4N76A 4UBKA 1QF7A 2OC9A 3OTOB 1N0WA 1YR7A 1JZSA 1T91A 2UAGA 2FRVA 3VM6A 2VP6A 5C1PA 3GFOA 2DQSA 3M4JA 2QWXA 2IELA 4O1QD 4JA0A 2H57A 3AUXA 7ADHA 1G8YA 3VHRA 1XJ0A 4EATA 4IHJF 3V8PA 1KZ1A 3WAKA 4M76B 1RRCA 4HH0A 1VHQA 4IIUA 5K3SA 4PW0A 2NG1A 4Z8YA 1IEXA 4P9NA 1J1UA 3A6GA 1GPKA 4FFBA 4G0YA 2O2DA 5SYMA 3F0TA 3IKVA 2J48A 2COKA 3L5KA 3OICA 4D81A 4DLLA 4US1R 2RJNA 1E5DA 3ZCPA 2OGZA 3MZKA 2JGRA 4ZO6A 4DV6B 2PXHA 4OEHA 5GOTA 2P65A 3C6YA 1EJ0A 4A15A 1E9VA 4LJLA 1E9SA 1ZIYA 5HIMA 1BE0A 5BSUA 1B00A 3PNOA 3RRBA 3KVYA 3IMEA 2GD6A 2VWPA 2VP4A 1ZD2P 2W2NA 5L3SA 4MAAA 5D1HA 4XX1A 3OQMA 4O2WA 2R1TA 2AGZA 4H5JA 4AZ0B 2VDRA 1RCUA 2JARA 3OQOA 4I55A 1U8AA 3D6AA 3U4CA 1ENZA 1ID1A 1NUTA 2HMUA 2X0KA 3DOHA 4NABA 2Q6VA 4AY3A 3GUYA 3E15A 4XARA 3WE7A 3PHHA 4F9TA 1KBQA 2BD0A 3I9NA 4MO9A 3GA0A 3NHMA 4BP1A 4X84A 4DVJA 2WNSA 3QLEA 1E1MA 2H06A 4KK4A 3WHLA 1M7GA 3N39C 5FF9A 2W2QA 1QVRA 1X74A 2H1LA 3NW9A 3OZEA 4DE5A 2HWUA 1D4FA 3AL3A 5FNVB 1YZVA 2H4YA 2BDTA 4RMJA 3UCFA 3ETJA 5L3ZA 1QTRA 3OUUA 2YV3A 3IAM1 1B8PA 4NOKA 1Q19A 1R0RE 2AH1A 1OGYA 5JBQA 2QRQA 1IH8A 4KWIA 4GR5A 3W04A 2B2CA 1WB6A 4F5EA 2ZUBA 4C2AA 4KLZA 3EXIB 5EZYA 2RBGA 2CNOA 5J5VA 1JTEA 3K5WA 3UBTA 1T5LA 1ZI8A 1JTVA 3W5UA 4NBTA 2X14A 5FH9A 2AFIA 2DUJA 4DCTA 2GJ9A 1C9DB 3QQ5A 4TUYA 1OV6A 1E7SA 1F6WA 4FXOA 1T35A 1EINA 2IBMA 4HS4A 3NNSA 3C3JA 1VCHA 4KXWA 3EFOB 1JR4A 2AVDA 4KRFA 4IRUB 4XD7A 5JNSA 4J1QA 5E7IA 4DTCA 3H8VA 2IEAA 1NC3A 1TIKA 2H4JA 1Y1PA 3X44A 3BZBA 2CCGA 1H6DA 2ZSIA 2IYLD 2WJYA 5EMJA 4FHGA 4R2KA 4D7AA 1NZJA 4H15A 3OD5A 1ZJ5A 4YUWA 3QEMA 4RJJA 4HWRA 3ZW7A 1RFLA 1YZQA 4FGKA 5DGTA 2J1LA 3W8FA 1U0SY 1R5OA 2IUPA 1A9RA 4GP7A 3AP1A 1URPA 1CYEA 3ACBA 1XMVA 1SUDA 2FG5A 4KBFA 4DR6B 5AP9A 1F06A 1G60A 4QDTA 2O8EB 5IMBA 4NOJA 4AG5A 1S2IA 1U3CA 2CJWA 3MYYA 4OPMA 2C5AA 2Z6QA 2QW1A 3BH7A 4CKBB 3IULA 2P9TA 4OSOA 3I7NA 3ADBA 1PIWA 4ETIA 2QXYA 3LXRA 1G5RA 4WXEA 2O07A 2CW5A 4CI3A 1PFUA 3K9CA 13PKA 4IZOA 3N86A 1IWBB 1MDAH 2PBIB 1EAMA 2YUTA 4XQEA 5A4JA 2J3LA 4Q3BA 1EP9A 4DBLC 3T1NA 2ZBVA 3PDIA 2AX4A 5KB3A 3QVVA 2GZ3A 4EUFA 4L6IA 1VL2A 3ZHQA 2IBTA 3SBOA 1FB5A 4PM4A 4UVHA 4QUHA 3DOFA 3HP7A 3CZCA 1PSWA 4Q93A 3Q9UA 1MOSA 1UXOA 3KM0A 3CNQS 2AG8A 1JI0A 1NG1A 2OE2A 4XE5A 1VIDA 5CD1A 1E5LA 4FA4D 3JATA 2QV7A 2LGJA 1X9HA 3WB9A 5IK2D 4AY2A 4QUIA 1WHSA 4FIDA 1MBZA 1NBWB 4LV8B 3M8KA 3JARB 1G2PA 2DHQA 2GYWA 4BGIA 3WIVA 3PE3A 2DHCA 1LVGA 2Q29A 1IQPA 1M2OB 1B1AA 1IBRA 4NJOA 2VTVA 4C89A 1E59A 2CHQA 2E4AA 3HBJA 1LQUA 4HWPA 1UXHA 4KU4A 3LY5A 2ACKA 3PTAA 3O6VA 2PZKA 1W73A 1T8RA 1YTUA 3KDPA 1HI9A 7MDHA 1B74A 3I09A 1JMYA 3MF4A 2ZIZA 5L53A 5DGCA 1MT0A 3AM5A 4K9QA 4WV3A 2D2VA 2QAIA 4RZUA 1R0XA 2EC5A 2GXAA 4B74A 4LTMA 4N6NA 3PA6A 4F1JA 1BCSB 3RUHA 1KERA 2VJLA 4MLCA 4P98A 3B1KA 3LPNA 3TLBA 2FEAA 2C07A 1Q84A 1SCQA 621PA 2BGJA 4KNVA 5BOSB 1C50A 1GCUA 4B4WA 3VOSA 4ZVQA 2X7JA 4RV4A 5F5XA 5C7OO 3LUKA 2IXDA 1I3OA 2HIGA 3OA2A 3AOEC 3K73O 5GIOE 2BPOA 1HOTA 2BJHA 1U3TA 4E51A 1J21A 2Q7OE 4BVLA 3R5TA 1NVBA 3LVBA 2ABWA 1OQAA 1BE6A 5DBFA 2BMAA 4BWFB 2ZM6B 1G21A 2V6FA 1BKYA 3QXSA 2XXAA 4S1TA 3F1KA 3FWHA 2ZJ2A 4OHWA 2JASA 3IOBA 3C85A 3EISA 4K03A 2M6LA 2VPPA 4EG0A 4WK0B 3C3EA 4QYWA 1U1FA 3DZHA 5FKTA 1KYVA 2IEYA 2WTEA 4F5WA 3BCRA 4JWKA 3UB3A 4Q0MA 4BVFA 4FHZA 2JLAA 4RZIA 3KTAB 4UVEA 3WBBA 4RD4A 6NULA 5I8PA 1BWQA 4MIEA 1DKMA 2FPSA 1TGVA 3BZWA 3FNGA 2WG0A 2XUGA 3A14A 3PNYA 2BFCA 1Z4QA 5IARA 5BSEA 4JEIA 3HXKA 2V54A 4DSNA 3UFXB 2EW1A 3F4LA 3Q12A 1PTJC 2F67A 2I3TA 4BLPA 4JXZA 3WOHA 5EJ2A 4BPBA 2I76A 1FMTA 1HF3A 3FYSA 3ZLTA 4XGQA 1QYDA 1L1EA 5TF2A 1DCTA 2FA9A 3N2NA 2FFQA 2VF4X 5KVCA 4EQ6B 1YQ9A 3LVQE 1B2LA 2PV7A 3W6PA 4A08A 1ORDA 1SC6A 4JB3A 3GRCA 4ZZ3A 3UW1A 5E0OA 4DDTA 2W6NA 3VH4A 2X5NA 4PR0A 4GKVA 1Z0DA 4O4IA 2QA5A 5I4IA 3TJMA 1OT5A 3PL1A 4MUEA 4DA6A 4JBYA 1RVV1 2VDKA 2GETA 1B73A 3WL5A 1EUDB 1GN9A 1C80A 5KTSA 1NZDA 3DDWA 3H3XA 5AUOB 5CYGA 4RSMA 3QXXA 3MTQA 1ZHHA 3WGOA 1XV5A 1QQ7A 5G0TA 5AJAA 5EXTA 4PICA 4LOAA 4NMWA 4Q7QA 1LCIA 3ONNA 4NULA 5HE1B 3O1IC 4JLAA 4RD0A 3IO3A 4UW9A 3Q8WA 4C08A 2B7BA 1PLKA 1XZAA 5DLDA 1JYEA 2XKAA 3P97A 3Q88A 1RWNA 4O4HF 3UUEA 3ZGVA 4TWAA 5DWDA 4J9UE 4CCYB 4H3VA 4EM6A 3SYNA 3KWMA 2XOKA 4KAJA 1U99A 4ZA2A 2MR6A 4B3FX 4DR2B 2CE8A 4ZJYA 2O8NA 1RYZA 3NT2A 4FC7A 5IDVA 2JFNA 5BYBA 5KOYA 4BVHA 4C22A 4GICA 3RIHA 3EULA 2VBCA 2HJBA 4UASA 4PPFA 1DB3A 3M82A 3GFTA 5T4EA 1BIFA 1ES9A 2QAGA 1A82A 4YP1A 2JBAA 2CLDX 3ZE2A 3CG4A 4URUR 2GOYA 3EOBI 2EL9A 2VWGA 2PRIA 2DAPA 3FUCA 4V24A 1SRRA 1VG9B 5DOVA 3KJQA 3TPCA 1G66A 1EP1B 2IH2A 2YRWA 5E1OA 2X0DA 1MVLA 5KVQA 1V7PC 1AKWA 4JKIA 4LQ4A 4KQHA 2Y27A 1JWLA 1YCDA 3K8QA 4G8BA 1AKQA 3QNMA 4GGDA 2FFAA 1Z4OA 4HDKA 2DH5A 4OB7A 3LA8A 3L8YA 4MWZA 1GAXA 5DK4A 1ZQ9A 3A4TA 1ZM2A 1VMIA 5IKXA 1J0DA 3RUDA 1UWVA 5TF0A 4J6EA 3HDVA 4J7CA 4MUKA 3DT8A 2XJ4A 4Z4QA 3KUKA 1T0BA 4AT1A 5IN4A 1IZ0A 2IS1A 3E2PA 1NOIA 4QBFA 4JCOA 3C5WP 4M21A 1CRZA 1Z2PX 2G7MC 4OXRA 1F60A 3DMTC 5BN3A 1USUA 3H2ZA 1QNIA 2NXNA 1MV5A 3DZFA 4ARCA 3BM5A 3P26A 2HCFA 3HJUA 2P78A 3O75A 4XASA 1N92A 4C0HA 2LDBA 3HM9A 2R44A 3D0KA 4GR9A 3SMQA 2VHEA 4ESOA 2HA6A 4P5EA 4PX5A 3DE4X 1NA5A 3S3TA 5BYKA 3SN6A 5E2AA 4R3UC 2C4KA 1ZU5A 1CY4A 3Q6NA 1E2EA 2CVFA 5JNRA 3FM0A 5INTA 2LCFA 3ENNA 3K71B 2QU7A 3ILXA 2YIJA 4HWKA 4AY4A 4HEA1 1Q6ZA 2F4VB 2EYUA 2F8LA 3DLAA 2FMXA 2XNKA 1TUGA 1VL1A 4XUCA 3K5HA 2C98A 2WKWA 2M98A 2O3RA 3G2OA 4C6TB 3IBSA 3U7QA 2QVBA 4MYHA 1EYZA 4MLPA 1HYEA 3QLJA 4MUAA 1MCZA 3ZS8A 3CPJB 3U5ZB 2VRNA 4I1IA 3TUZC 2NM0A 5LZ7A 2CLMB 2EJUA 4ENQA 2A1IA 5I51A 2H1FA 3U62A 3DEAA 3GN2A 1R4NA 2LCQA 5DJ5A 3GP8A 1SUAA 5HE8A 1XZKA 2HLHA 1SG0A 5AM1A 4DG5A 1LPSA 1DUIA 2NUBA 1VGRA 4GHWA 4JOQA 4K3VA 5AKJA 2PUWA 3T5AA 4WUTA 1ECPA 4LFBB 4CF6A 4KNYA 3DZBA 1PEYA 3SQDA 1HX7A 4JAVC 2P8SA 2X6TA 4B48A 5KNDD 2XIQA 5F5NA 2H1CA 5EHGA 1JA1A 4EG1A 4B4VA 4BJ1A 3L6UA 2PV0A 1TXGA 4IXTA 2FWAA 4IO0A 4BLWA 4HNAB 3TF5A 3CW9A 1T0PA 1AE1A 3QW4B 4MKHA 4OH7A 4PS1A 3PEUA 1ACLA 3OL2B 3DQZA 4OAPA 4D4MA 1SVUA 3SBPA 3AUYA 1NTRA 1ND5A 3R77A 3T3PB 4OJNA 3MRSA 5JAOA 5G02A 1QYXA 1AUVA 1RRGA 4TM7A 4P53A 4GL2A 5FDFA 3CCCA 5F1KA 2O2YA 2WKPA 2DCMA 5A3QA 5A3RA 4JUAA 2P9KC 4N3GA 9ATCA 1IOZA 2PZJA 3ZEAA 2J6HA 1E2MA 1HEIA 3NTVA 4ZT2A 3L8EA 3FPAA 4J43A 4YJ2B 4RO0A 4MV4A 2H2GA 4TRJA 2IS2A 3B2QA 4Q05A 4XCVA 2PX8A 1YDHA 1RJ9B 3DLPX 1X87A 1NFFA 1L4YA 3BWEA 3GLKA 4AMUA 4DG9A 3C3XA 4L9OA 3X1KA 1P2BA 3QY0A 1AKVA 5JS8A 1HFWA 4JUIA 4RS3A 5THXA 5TQVA 4U7WA 3JZMA 3IP1A 4JH0A 4UMVA 3BH6A 1LV7A 2XMCA 4I4IA 5DASA 4GZMA 3L49A 1CBUA 3WGMA 2PQ6A 4R41A 2CVZA 2C2HA 4ERQA 4C0WA 2IC5A 4PAWA 1NVTA 2OVPB 1E4VA 2P6NA 3GT0A 3AY7A 4MK4A 4MARA 5JDCA 1JEYB 2REQB 4MK0B 3EXHA 2V45A 2CJXA 3J80g 1UBGA 1VE3A 3HHPA 4D5GA 2A88A 2GF2A 1MPTA 1ONSA 1ZONA 1K4YA 2RHRA 3KUUA 3AF4A 4WZZA 4J1TA 4YT2A 2YWBA 2BHSA 2CLEB 1R8YA 3U44B 5B55A 4OMFG 2H16A 4OH1A 5LUAA 5BSWA 5TRTA 1KFCB 1YR9A 4M38A 2E5LB 4WOKA 5DFAA 2LVBA 2PGLA 2MDTA 4K28A 2I6SA 3QNWA 5ITWA 4CTJA 2HTFA 3AEQA 4CT5A 3KVNA 4K3ID 5M5TA 2AEEA 2HDHA 3TLAA 4WA7A 3ZOZA 3FSGD 1M66A 4XGRA 4QGAA 4WK4A 4UCWA 5FULA 1VP3A 2ZYAA 2GF0A 1NN0A 4YRFA 4M6WA 2VK8A 2JJ1D 1EGVB 3M5CA 1AX9A 1UFKA 1NXWA 2PCLA 4M55A 5DW3A 4QRHA 3TCXB 3CRNA 4J86A 4ZODA 4LY9A 4Q03A 1XD9A 3AEYA 3PQ3A 4OIMA 4I1SA 3FF1A 3AV0B 2Q99A 3NC1C 2R00A 3A3NA 1RPNA 5ADUS 3S40A 2MR5A 1RYBA 5LP6F 3U0BA 1QXSA 1W6UA 3F7MA 2DWCA 4BKMA 2A9QA 2B25A 3IUYA 1AMNA 6LDHA 1Z0FA 2YHAA 4BNDA 4GD3Q 4WBNB 1X2EA 3WADA 2H1RA 1BDJA 3LG2A 1J2YA 3L8CA 3HXOA 1YTLA 3LNTA 4TTQA 2V4MA 1Z15A 1NW5A 5JC8A 1CEEA 1ZGBA 3HN6A 1XAHA 1QH9A 5CEFA 3EHEA 1QOQB 3SHOA 3Q7EA 5GAJA 1UKAA 4REQB 1XPRA 5LUBA 4B9AA 2DQ4A 4HN9A 1YRWA 1K4KA 5EWJB 3GF4A 4E14A 3I4CA 4GLJA 4HF7A 4N6GA 2GXQA 2CNNA 1MQ8B 5KO2A 4F4JA 3M4XA 5JFTA 3Q3IA 2AOWA 4M83A 4GAEA 2WJJA 3ORSA 3IBTA 3LIIA 3GLTA 5BO5A 4TKZA 2I62A 3D8SA 1J2JA 1LUAA 4QQEA 4X20B 4KSCA 4BASA 2E4WA 3ZCTA 1XTPA 3NNNA 1P2TA 2X3YA 3S2ZA 1KP2A 1RXIA 1JXAA 1UDWA 3NIGB 1FP2A 2O0JA 1UKCA 1W88A 3ZHUA 3BIOA 4N0PA 3QE0A 4C87A 4O9DA 4MGKR 2F4NA 4QJBA 1NXPA 3P9QA 5IF3A 2ZS7A 3VNVA 3DDNA 1Y4DE 2PUDA 3G5MA 1E92A 4MCAA 3QF4B 3ZDDA 5KAMA 3N8KA 3VZQA 3F90A 1RIFA 1XAGA 4R69A 4JZKA 4HXYA 5K19A 5IAEA 4GL4A 5KVVA 4QFDA 4D6YA 2DLNA 1NDHA 1TTHA 4Z51A 1QKKA 3K7EA 5D3MA 1BX1A 4TMWA 4HLDA 1Q11A 3DR3A 5HUQA 2ZRNA 1Y3CE 3OQBA 3GDHA 4IZHA 4XOUA 4Z7NB 3TGLA 3HTXA 4RORA 4MPTA 5AM5A 3H4TA 4LRUA 5F5LA 1XCLA 1V4VA 5REQB 4R0VA 4ZWNA 4TV8A 3EGIA 4CM1A 1X1BA 4CHTA 4AJ4A 4UBIA 4MS3B 5A9RA 2FJUA 1PJ2A 3MS7A 4ZXPA 2YFYA 5ALDA 5DXJA 4R1UA 4XYHA 4QICA 2XTNA 4LGMA 3HJAA 4URVR 4IDDA 2YXEA 2M32A 3EODA 4D0LB 4RKWA 4ZHSA 4BMSA 3EY4A 5J4LA 4YV1A 3QVMA 1O94D 4J1NA 4KPUA 2OSBA 3QI0A 4E2ZA 3T7KA 1E1CA 3FPJA 1I3KA 1R8JA 4EYSA 3IIMA 4CEHA 3L06A 2W6ID 3S8MA 1QRTA 4EITA 3N76A 5C8YB 3Q7TA 4JUCA 1OBVA 4CG0A 3E9YA 3H87A 3U4GA 2YNMA 4K9OA 2VJMA 1B3BA 1MJFA 1Y4ZA 3OIYA 3OOHA 1F7VA 4W8GA 1ZS9A 3MCTA 3OCJA 1MOPA 4IJMA 5GM1A 2CMHA 2Z9BA 5E38A 3ZWWA 2XUQA 3UWSA 5DE3A 4QRIA 5EMLA 2G25A 3H1GA 3FRXA 3O9ZA 4HNUA 3QJ5A 4GEKA 4LXTA 3KB8A 1MA0A 4FZ5A 2PAAA 5AHXA 1P60A 2UKDA 4DKXA 1SAYA 3Q3VA 3UHFA 5CXBA 1F0NA 2P5YA 3GGDA 1M8KA 3WP0A 2O0HA 4QOEA 3LLCA 2A7QA 2Q1WA 2IV2X 3BTOA 2IE0A 1SK8A 4G4GA 4ENWA 2XSZA 1M1YE 2VZEA 2A57A 3OUTA 5BV2P 2V9ZA 4X9XA 3AHGA 3DD1A 3B3FA 4GE3A 2IF2A 3RIMA 1NMYA 1SGWA 1Y5LA 4QGSA 3UVMA 1C3XA 5EMNA 2OR3A 5CK4A 1DJPA 2QQFA 2OG2A 2CY0A 5KYGA 1VGVA 3RQSA 2GEKA 4RVOA 4KR2A 4D44A 4J84A 2BMVA 1KEEA 3RVJA 3WA7A 4M1QA 3MUNA 1N34B 2JLSA 1GO2A 4RTKA 3PNQA 2RGEA 4S04A 1UWKA 1F7UA 1VYHC 2IZ5A 1UZNA 4PFKA 3ETEA 2ATIA 4OMUA 1XKTA 4YWJA 4UTVA 4B0PA 2W2PA 4RH3A 2OHHA 4RF2A 4NEQA 1OH5A 1DAKA 1KI1A 1SR8A 1JQDA 2TRCB 1TB4A 2I0SA 1RXCA 4MJXA 3QIVA 4KI7A 4XSGA 3ZDFA 2NX2A 2HMWA 4S35A 5L6MB 2JW5A 3RLIA 2QX4A 3HVHA 1Z5OA 1LH0A 1ODLA 3KSAC 2RGWA 3JVDA 3HCNA 3HKDB 4N1AA 5IS2A 3RYFB 2W11A 1I0IA 3V4FA 4GQBA 4F4DA 5I8WA 1MPXA 1JECA 2H8KA 4OYYA 3RROA 3G5AA 4NK5A 1AXEA 2JCYA 4RKYA 5FL7A 3HR4A 1IQ0A 2BRUA 3HR8A 4XSVA 3LWNA 1YQTA 1A9XA 4GKBA 1SOAA 3F1LA 4Z7JA 2VOEA 3MXXA 3N8HA 3W34A 3ICOA 1EXWA 1DJQA 4FFDA 2FGKA 5HGXA 1FYWA 3T9DA 1JFFB 4JU9A 3ABSB 1FNDA 2BY4A 4PXSA 3NPMA 3A7EA 1Q92A 4I4LA 5DH9A 4HFRA 1IULA 3F3YA 2BOVA 1W4ZA 2GARA 4NOMA 4UM5A 3F46A 1UFOA 4KLAA 4I1OA 1D07A 3KYCB 1ODKA 1CF9A 1PZXA 1Z0KA 5IVDA 4CM4B 2E85A 1WNFA 2XUIA 4KE7A 4RZHA 4AJPA 1USVA 2FWBA 2VL7A 5GXIA 3AVWA 3MMSA 1T3GA 1OLUB 1WS6A 3OIWA 1OVGA 3RVSA 3RVLA 1L5OA 4UQOA 1VE7A 4D80A 2ZRKA 4M0LA 2QLBA 4ESHA 4O1MA 4LHXA 1OLZA 4JI2B 4FD3A 5IPFA 3UWDA 4Z0PA 4JX9A 2HJRA 4QXMA 3NRCA 4OUDB 3S7TA 2XWPA 4ILKA 1NQUA 5A1JA 3E9ZA 1B0PA 3CF4A 2HRCA 5C8DA 1NWHA 4WZAE 3T7EA 1JDBB 3QE4A 1TVMA 2WPNA 1Q44A 1ZUHA 3P0FA 5HJ2A 1NFRA 4BP9A 2OK6A 4MAFA 4IF6A 3CE6A 1J6UA 5EG5A 4ZHQF 3C8ZA 3AT1A 4OLAA 1E6EA 5ALXA 4AWBA 2I8AA 4J07A 3ZJVA 5CB4B 2BSXA 3FLBA 3FRIA 4AMGA 3IUQA 3LPLA 4IQ0A 3GZNB 4JSXC 2J9RA 3K9GA 2G07A 3HLKA 2PS3A 3PD1A 4GBJA 3WMRA 3WIUA 4F84A 2DR0A 5L3QA 1OHHD 3DBLB 1HZZA 2WG2A 4R1SA 5LA6A 3Q1LA 2FFBA 3JQGB 3D31A 4MI3A 4X1YA 4AWXA 3DUWA 4IJ6A 1SUSA 1T24A 4AX8A 2AZDA 3NJ4A 4JI8B 4V02A 3KX2A 5DYNA 1A5AB 2ZI7A 3D02A 1QGOA 4TMZA 4YLEA 3GJ4A 4RC9A 1E2HA 2G4CA 3QUAA 5KX5F 1E0JA 2VDNA 3OKYB 3A04A 2IPXA 4JJGA 3GLHB 4JUBA 4UEWA 2H1HA 1KH1A 3A25A 1A0RB 2CUZA 3FAKA 5JO0A 2VYNA 2H08A 4BUCA 3IEVA 5IJ0B 1TZJA 3LOPA 1VE9A 1C7JA 2C96A 1SC3A 5GQSA 2BM8A 5J2UF 1QIMA 1MEJA 3HRIA 4IDPA 4EABA 3QH4A 2IPAB 3I23A 2QN1A 3DKIA 3VNAA 1TZBA 2CFOA 1KI7A 5HYNB 3JU3A 5C53B 4F5DA 1RM0A 4EUSA 3SVTA 1ZAKA 4Y1RA 1VJGA 4RACA 4B6FA 3WB1A 1K27A 4PZPA 3KCQA 5C8XA 2YIMA 1L6RA 4RIIA 4V0SA 4AYWA 2VQ3A 3U81A 3MVDK 2G7ZA 4FCWA 2P9EA 4PPGA 1KFKB 4BVBA 3DFMA 4IDHA 5DP1A 2HA7A 3Q15C 4LSZA 5TS3A 1WDWB 2QYHA 2LTAA 3C6ZA 4NFHA 1ODJA 4GXRA 1A76A 3HCFA 4IIHA 4GW3A 2QRKA 4N8SA 1JDPA 2P4QA 5YASA 1QX3A 4ZVRA 4NAUA 1ZK1A 1ZBDA 1P0PA 1CZNA 2HU5A 4KODA 4WAUA 4MV5A 1GNPA 4I50B 8AT1A 1QFXA 4RHFA 2A0KA 3UJDA 1R00A 3RJTA 2FX3A 3IB6A 1X8KA 3UQZA 2HXSA 4K0RA 3RYCA 3SVWD 1ZUNA 3KSBC 5JH7F 4ZYVA 4QM6A 1MO4A 3QZUA 3TQSA 3S2YA 2JHFA 1XVLA 1S2MA 5LJIA 1Q5PA 1L6IA 4NFSA 3B78A 1QTQA 3H13A 2O3JA 3LUPA 1GZDA 1VIYA 2XT6A 2LPMA 4AMBA 4DSTA 2PWPA 4I8IA 3CCFA 4LI0A 1TRHA 3OEHD 4PE5B 1HNWB 4K0KB 1EWRA 1I1OA 2XWJI 1Q83A 1HMPA 1C9EA 2NYVA 1KMCA 1CVLA 2IYAA 2R68A 4BVJA 4PONA 3Q8XB 3TTVA 4G1CA 1IN8A 2IOQA 2QTVB 3JD4A 1RSZA 4ENPA 2H31A 4B7CA 3Q9NA 3VDMA 3LA6A 2I3DA 3F97A 5A5GA 4ZZIA 4G09A 3LPAA 4P4SA 3BXGA 4R2MA 5LYJA 3T5CA 3VI3B 1I5RA 1HTTA 3AIIA 3VVMA 2BTEA 2JLUA 2G9NA 2CLHB 5DHQA 3MGGA 3D7SA 1MOQA 3DAFA 2JD2A 1N6EA 2IW1A 4YYZA 5BSGA 1J8MF 4I1VA 3FZNA 2I4NA 4RAQA 3M6UA 1CWUA 4M9ZA 1UC5B 1TM1E 3HI6A 1N5JA 1DC5A 1XCJA 4FMDB 3H99A 1IQRA 4R3NA 4B6JA 1L0QA 1GGNA 3NH6A 1RC1A 2VDMB 2WM3A 1D1QA 2EP5A 4ECAA 5ALGA 1FLVA 1I14A 2JK0A 3AR5A 2C20A 5HZKA 4YDSA 1ULUA 3C8UA 4ZOBA 4LWPA 2W2OA 3JQ7A 1KTVA 2APJA 1A9OA 4NDNE 3WYDA 2PBRA 3RUFA 4RJ2A 2Z2IA 5C52B 5K8IA 1XHMA 3VPFA 4CMBA 2DBYA 4H4CA 3QXCA 4WZBA 3Q5EA 4C6SA 1DPFA 4PSXB 1T3ZA 1PN3A 4H7JA 4X5OA 1AH2A 1SXJB 3NP7A 4AICA 2XDWA 2J5KA 4JN6B 5SZIA 4RPIA 3WKAA 3QG5A 5JZ9A 3ULEC 1UAYA 2D4AA 1H1DA 3NGMA 3PFWO 1Q1GA 2ACVA 4Q4DA 2RGCA 4ZDIA 3GREA 3TVDA 2QRUA 3CT4A 3UMSA 4YP6A 5A4KA 2BZGA 4UUOA 3BG0A 1WMFA 4L1QD 1Z6QA 3QKSA 4KLNA 3T1YB 3KOXA 3NWEA 1O6GA 3EPPA 2PUHA 5JZMA 4FZJA 3CWCA 3IA7A 2P9QA 3R40A 5F78A 3JQ8B 1A72A 2ADMA 3O3CA 4OCZA 2ANCA 1U9IC 1YZ3A 5K0FA 5K2MA 2AD5A 3WIBA 3KSMA 4A0SA 2CNXA 3T1VA 2H68A 1E3MA 1U8UA 4EA9A 1FFDA 2XYGA 5B1YA 3IYLW 1TADA 2DSTA 4NU6A 1VJ0A 1YB2A 1JQ5A 3KL4A 3N5CA 4ER3A 3B82A 1S2DA 3GAFA 1RXUA 1E3SA 3BF7A 1EP3B 2P30A 3Q40A 4UVGA 4OQYA 5BYAA 1RQXA 2FMTA 1C81A 1AUXA 3FN4A 3ZDXA 1V8DA 1DBPA 2GPAA 3GCWA 4CM6A 3SE7A 1G8GA 1IPHA 4KOAA 2YWGA 1L4EA 4TVOA 3VC1A 1WBBA 3BZUA 1GDTA 1ETHA 1SKUA 1XTZA 3K0KA 3HY4A 1G59A 3BF8A 1DAIA 2W6QA 4L72A 1UUFA 1J5EB 2ECKA 2YS6A 1USWA 2OZKA 3ER6A 4ZCLA 2NZJA 2B1GA 4IUYA 2ZWOA 3PSAA 1ZWKA 4NJEA 4M1YA 3SYLA 2GILA 4BNIA 1XDSA 3JALB 5K1CC 5TEEA 3AEKB 1NVAA 2MCFA 1PKEA 1APBA 1T26A 1BVHA 1T3SA 1Z5NA 2XA9A 2PAFA 2P4UA 4H7HA 2BBKH 1SHZA 2ZRIA 4CY2A 3HKEB 3OOYA 4J16A 3HU5A 5BV1A 1HQKA 4CLOA 1RPJA 3FR7A 4Q3KA 2PTGA 3EUEA 3KVRA 4BFCA 1R5JA 2C7RA 1IC6A 6GPBA 1RYYA 1AQ6A 3TIIA 1XXHB 2ONJA 2JGIA 1P1HA 4AYXA 1S3IA 4UFNA 4D2IA 3RJ5A 3TAHA 3F3FA 3GNQA 1KYXA 3T06B 3AK4A 2Q9CA 3M4YA 3LKVA 4MMZB 1NOJA 3ZDZB 1OGJA 1TUEA 3HYSA 3WGGA 1UPCA 3W90A 4Z2AA 3MRTA 2D59A 2Y1LA 4GT1A 2P9IC 1RKVA 2CN3A 2IYNA 2XIJA 4YI3A 4REMA 3DBVO 5H17A 2X1VA 1GPH1 4QC2A 2Y1WA 1A77A 3CB4A 3RH0A 3ROTA 2QE7D 3HUTA 2C97A 3ME5A 1IB6A 1DXYA 1RTTA 4YRIA 2WJGA 1JKJA 3SIWA 3GJYA 4LXXA 2I1LA 3G2NA 2EGGA 4IQ8A 1EZZA 2ZRFA 1JKIA 5CA0B 2HO4A 3DNPA 1FU8A 2C2YA 2Z30A 3HL0A 3EUWA 1Z4KA 4G07A 1XALA 1TU0A 1SH7A 4ISCA 2DUNA 4QJ4A 1ZJJA 3X1JA 4JC8A 3A6KA 2WB2A 4J82A 2QDKA 3C41J 2B8WA 2GZAA 3GZJA 2D54A 1IZ7A 4KJZA 3R9XA 2QXUA 2VZ1A 4A10A 1F1BA 2X19A 2VTEA 2LUOA 3NTXA 3EQ8A 1ZMBA 3T9AA 3OD1A 1MG0A 4ZI7B 1ZUIA 3ZE0A 2BI8A 2AQ5A 3PHBE 3PEFA 1XRPA 4C0BA 1OBCA 1TLFA 3B8EA 1O6CA 2JI6A 2V8BA 3O8OA 1KAOA 2PRJA 3G5LA 3VOTA 3WJ2A 1N1GA 2HMVA 3LQQA 1SG6A 1DCKA 4W6QA 3R1IA 1G41A 1QFYA 1H6BA 3FFXA 5DNUA 2UU9B 1TAQA 1JP7A 3H9EO 1MJ5A 4LMPA 2PSDA 1RM3A 2Q4BA 4NATA 2CHEA 1KY4A 3JAWB 1FUIA 1V16B 5BNZA 4NZZA 3PI7A 2GFHA 3IUMA 3NJ8A 3PC3A 4AO6A 2O1WA 4F72A 3GT3A 1I13A 1U7XA 4Q7JB 2Y68A 3OHPA 5FOSA 2P1RA 1E66A 1OC4A 4IG4A 4TYYA 4D96A 3H5NA 2C5SA 2VOJA 2K4MA 4B2PA 3GLFB 4EX7A 1KK2A 4MKFA 3EIEA 3F6SA 5EKTA 3TMAA 4X24A 5FLXg 4ZGBA 4B3HA 4KYTA 3HZOA 3HUEA 3BFJA 3IIIA 2EFHB 4J0GA 2R96A 1VJCA 3H5RA 2DZDA 1CS0A 2XNDA 1X1CA 2G76A 2YQ4A 1D1PA 1LWOA 4EAAA 2B0JA 3MINA 4MICA 2BFPA 2B0CA 3SDSA 4FWBA 1C41A 1DEKA 5DM0A 1Y7PA 4Q48A 4I55F 3MWFA 5DN9A 2QI9F 3N0WA 6ADHA 4O3MA 1DO0A 2ZTLA 4RD1A 2PS9A 3ZGXA 1ZJWA 5I5JA 3WP1B 1OKKA 2O0KA 1B93A 4GM8A 1PJSA 3VSDA 1CY7A 2B99A 3ROFA 4ATNA 2XE6A 1JMKC 4JFAA 2FWRA 2I8CA 3ESAA 4FFSA 1TM5E 1XMXA 3F3GA 4MW0A 2WZQA 5JALA 3JVEA 1ZISA 4UUNA 3BIWA 1A8HA 4R84A 1NBAA 1OX6A 1FY2A 1U6IA 5G0VA 3AI1A 1W4BA 3A37A 2XUJA 1SXQA 2H1OA 1E6WA 3Q3EA 5EZYF 3UUWA 4LZWA 4EOGA 2Y0PA 1GKLA 3BHIA 4GVLA 3WOVA 1X8XA 5B1IA 4NYMQ 4EYGA 4GZ6A 4FFOA 4V1CI 1SVWA 4Q4JA 3E7FA 5AK5A 1JE0A 4TUYF 3MD9A 5T4FA 1A12A 2P9SC 4ANFA 4L50A 2B35A 3MQ4A 3LXUX 2HA0A 1GILA 2EGUA 1T1GA 3LSTA 4C76A 4IGIA 2Y1XA 3BK7A 3MTBA 2WD7A 4BB0A 3KEGA 1OE0A 1YAJA 4L02A 4EYKA 1A5ZA 1BCRA 1R37A 2QVGA 1Q1NA 1X8LA 1NQVA 1ZCJA 2BEKA 1N0VC 3GH1A 4FW9A 4DOMA 3GROA 3ZH2A 1M5TA 1OTYA 4CM8A 1R6TA 4D8UA 4J2HA 1RI6A 1I7NA 3VH3A 1Q21A 1F2TB 1R6VA 1PCXA 5FPYA 2VJOA 3RS9A 3L7MA 2WD9A 3I2YX 1K75A 1V6AA 2JDID 5KDOB 1SU4A 3SR3A 1PYOA 2GLTA 1O9HA 2DY1A 2XTJA 2RHDA 2JGDB 4HH3C 4DPKA 2IGTA 3ZE1A 4UDYX 2ECPA 2EF1A 2AHRA 4UHDA 4AZSA 4PXAA 3OZDA 4EY4A 4R1MA 5A7GA 2QJWA 3PFNA 5JAQA 2B2NA 3GQBB 3ND5A 2QJTA 2FP4B 1JEJA 2V98A 4KHZA 1PZNA 4KPGA 3TVYA 5JI3E 4ME6A 3BRSA 4AKSA 2QRLA 4EF6A 3CO0S 5ESRA 3EAGA 1GPUA 3EIUA 4KACA 3NETA 1I94B 1PYDA 4WNIA 4W5NA 3VHXA 2DUWA 1QU3A 3R5JA 3OT1A 1TI7A 1I4TD 5DTEA 3SC6A 3GFRA 2E82A 3I5YA 5BNTA 4HSEA 4EFMA 5CDHA 4DCJA 2BE7A 4DV1B 3WLKX 3ZDBA 1NE7A 1TMYA 3PVCA 5BT8A 4CKCA 1K6JA 4Z3OA 2IX3A 3NFRA 4YUXA 4QYIB 3UICA 3QEJA 2HF2A 5KYWB 4KFUA 4QO7A 4NP6A 4A16A 5AD1A 4L75A 3I2KA 4U8HA 4XXHA 3VHLB 3TQHA 4LJRA 1A9QA 4EG6A 3U61B 1F9AA 4BGUA 5HDBA 2NO9A 2Q4EA 1PFGA 5JZOA 2PLRA 3NV9A 3FTFA 4QGBA 5GZ6A 3A6JA 5FORA 1GZSA 1XZCA 5A4DA 3KZMA 4YRGA 1O54A 4XVHA 1S1MA 4R5HA 4RA9A 4F4UA 4RMHA 3QBVA 5LZ5A 4MI9A 3NIWA 3WNZA 1RPTA 3WAJA 4QFBA 4HWOA 3Q0EA 5DISB 3ZXUB 4E4YA 3VR6D 1M6YA 4YJGA 4L2IA 3BRWA 4AVYA 5K8UA 2REOA 3EGEA 4TYMA 4KP7A 1XVUA 1OAOA 1MQSA 3CH5A 3WYFA 3NOXA 5EEHA 3GLGA 1LNZA 2FMHA 1YJ8A 4UM8A 5D1NA 2QTWB 2X8LA 3WFJA 2FQYA 3W7BA 4DBZA 1YUBA 5JI2E 4M1MA 1SKQA 4ZU1X 2V55B 3LZCA 5FR1A 4EI2A 2BFFB 4I6EA 1YWGO 2ZI3A 1CR2A 5HDQA 1TC1A 1HY3A 3HA3A 2I2XB 4B82A 1YJ5A 2GHTA 4Q21A 1GPBA 1YKFA 4UNSA 2VNHA 4PGGA 5T4BA 4I1YA 1O1YA 4IHKA 1Y6ZA 2VRCA 1OB5A 5BNWA 4RVSA 3W4KA 3OPYB 5DNWA 2HQ1A 2C3MA 4IRZA 2HN9A 4U7GA 4FFLA 2F64A 4W5OA 1HSZA 3F3KA 4DUZB 1PG5A 2XZOA 4CNQA 2P2ZA 4XWWA 821PA 4Q3EA 3ZLJA 4MJLA 1KVRA 4JD2C 4BYGA 4D3ZA 3IDQA 2QBYA 3KZKA 4EHKA 2VPWA 5ESDA 5EUCA 4C4SA 1E32A 1UJMA 2TMYA 4DIEA 4UDXX 4GKKB 1KNXA 4HNSA 4LV6A 3UV3A 1TYQC 3ZXIA 2FE4A 2AEFA 3SYTA 4FHLA 2GRAA 1ISGA 3TOCA 4LDNA 2JAOA 1K8KC 1UZAA 3VYWA 3I12A 7AT1A 1DT3A 2ZCVA 5JNVA 3N2GB 3E22A 3OIVA 4ABTA 3UPDA 3SF8A 4H59A 5BMVB 4MMXA 4P54A 1SBZA 2BE9A 4IVNA 3OZCA 4LFAB 4XJSA 4CT0A 4JSRA 3GYBA 5IBPA 3F8TA 4ERNA 4RK0A 1HG0A 2H5EA 3UVNA 3DWIA 4B73A 1EWQA 1FMCA 1REQA 3OF7A 4LNUB 2TMDA 3B1WA 2B8JA 1TJ3A 1EAYA 1OI4A 1PW7A 3EQ7A 1COZA 2FEWB 2EARA 2HUPA 1WMDA 1Z0JA 3UH1A 4ND8B 1RNLA 4QL1A 4PCUA 4BBJA 2X5XA 4AKTA 4D8TA 1W5BA 2BFDA 4CY3A 4XA8A 2ZRBA 2B21A 3KYDB 2OAP1 1CIPA 5FOXA 4MR9B 3NAMA 3L7NA 5DRTA 2WHPA 4QATA 4FR2A 3DYIA 2G5GX 3DMGA 4O4IF 1E2IA 3WHIA 1JJFA 4QQRA 4Y6SA 4ZYYA 4Y6QA 2R6DA 5GY7A 4D8YA 1MORA 2E4YA 4WW0A 4N9WA 4ID3A 2B5MA 4Q9AA 3DC7A 5B58T 2NSJA 4XVRA 1ZD9A 1TEHA 2ZIFA 3HYRA 4NFYA 1V48A 4QBTA 2VRWA 5JQGB 2FEXA 1VJDA 3IVAA 1EX7A 3GAMA 4BVEA 4HH4A 5EJIA 3E9RA 4FZVA 3LHDA 1F6DA 2TRSB 1OYVA 1QCYA 4J90A 5JVDB 3MELA 3H3FA 4S2UA 1UOPA 1P29A 1LPBB 2H9YA 1K88A 1HEYA 3KQQA 3R0ZA 3VR3D 1IEQA 3L77A 3QU9A 2G6TA 1DARA 5JZVA 2VRBA 1NUPA 5EIBD 4I9HA 3CIFA 4X97A 4BCCA 5LDDC 2ZUWA 5IZ4A 1KSFX 3WZMA 3QX7A 2WWTA 3K1TA 3H0CA 3OKWA 5EQDA 4ECEA 1N0HA 2P3OA 3HS3A 2A9OA 5BQFA 2SHKA 3RIEA 4BU1A 4CLHA 5M5SA 3TFWA 1M2FA 2WIDA 3V7UA 2IUTA 3R4VA 1D9ZA 2ZR0A 3R6GA 4NS4A 2CK3A 3WFZA 2G09A 2NQTA 2CLCX 2R8OA 4QHYA 3GP3A 3CVVA 1YUNA 4RETA 4ZN4A 3AUFA 4U7AA 3Q2IA 4NCAA 3TQFA 4K1LA 2RSLA 1D6NA 5FYDA 3HVJA 1PFWA 1JALA 4A2PA 2ZI6A 1Y8AA 1I2DA 4IGAA 4YUAA 4XAQA 2AF4C 3BGVA 2KWIA 4RSRA 5LXTA 3T5GA 4IH4A 2XY4A 3I8CA 3BICA 2XBLA 3FJYA 2WJAA 4JJIA 3QE3A 3FUTA 2BUAA 4PNZA 1ZOLA 4TYNA 3G0IA 4YT8A 1Z0SA 3IUSA 5AOVA 1I2ZA 2CYBA 2PFSA 3UW3A 3H6GA 1FUYB 2PXCA 1NYRA 2ACWA 1Z22A 2ILTA 4R0MA 4AJ9A 2HB6A 1R15A 4WHMA 3RFXA 1CUUA 2Q7QA 1VL5A 1SQJA 4KGVA 3ID6C 5D84A 1QNFA 5FFGA 2OZLB 5EP1A 3PC8C 1UT8A 2HKIA 4NZYA 3W1VA 3DTYA 1IDN1 3N0DA 1Y5MA 1U0LA 3LY7A 1NAIA 5EMMA 4KR3A 4QTYA 4DR3B 3HWRA 4A7JA 3OQIB 3FCSB 1ADCA 1OBHA 1T1EA 4MKIA 1SQ9A 2MSWA 1QGZA 3VV3A 2CDBA 1T9BA 4AMZA 1N2IA 3AILA 3DE2X 4CKYA 1G4UR 3H19A 5FWNA 4ZD6A 1IL0A 3DF9A 3KDSE 4RD3A 5TF4A 4OA5A 4K6KA 3RF7A 4P7KA 1IJFA 1GL6A 1G2OA 2W70A 5FUBA 2O8CB 4NC9A 3D7RA 1C9IA 1UJBA 3MLBA 4TQGA 4QNRA 2P3SA 1DAPA 4BZXA 2O8FB 1OJ7A 1GVHA 2B6HA 4XX0B 3S27A 1MXHA 2Q5EA 2H9NA 5CU7A 5C1BA 1V45E 2R7LA 1S8NA 2Z57A 2TECE 4CN9A 4R1OA 2IHTA 3V32A 3PLRA 5FOVA 2O5EA 1YCHA 4CEIA 3ONVA 3ZXXA 4H1WA 1NXXA 4G1EB 2H3XA 4UTZA 1YR6A 4G8DA 2W2MA 3ILYA 4QPZA 3R7LA 2PM9B 1OH7A 5LZ9A 4TRNA 4RADA 5DGIA 4KXVA 1YACA 2HHCA 2FPPB 3DZIA 421PA 2Z43A 3L04A 1JAHA 3MPUA 5CGQB 2EVWX 2ECOA 1XZNA 3NHPA 3IALA 4DMGA 3PIDA 1AVTA 1PJ8A 3TXYA 3VSBA 3KALA 2H0AA 1PJCA 1JVBA 2OAEA 5BR1A 2UZXB 2VDLA 5DT2A 3KOYA 3QSGA 1GUAA 1TOAA 4E5MA 3PG5A 1QH8A 1R7RA 4MV9A 3R9KA 4IRXA 1MO6A 3E8XA 2W2KB 2IKSA 1ZI9A 4W99A 4BEVA 3WL7A 3UG6A 5DGDA 1PAUA 1L1RA 1UK9A 2CWDA 4Y7RA 3AETA 1FRFS 5DCYA 3PF8A 1J2UA 3K3PA 3GG2A 2VPYA 4Q3LA 2D0IA 3G0OA 2Q5OA 1BGVA 5LL6P 1RP1A 2F9FA 1DDOA 1T3HA 3U3MA 4L07A 3KD2A 4XWGA 3CRVA 2QN9A 1PNVA 1FZTA 1VLZA 1JH8A 3U7FB 3M6VA 4OHRA 2XGOA 2JA1A 2H5LA 1WRBA 4TL8A 1ZHOA 4ZTZB 3GCXA 1E9AA 3UFBA 3TIVA 2AX3A 4HMOA 1CQZA 4CMJA 5HCIA 2Q6IA 1KFBB 4UUQA 3LX5A 3NBYC 5JXGA 4L9SA 1Y5NA 3WMWA 1JLHA 1I33A 3RGWS 3TLXA 1RAHA 1DEHA 4X00A 1FMJA 3GEEA 4RXMA 3MXOA 1RMYA 3DFZA 4UREA 1NI3A 3S68A 3IJEA 2QTRA 4JVMA 1GGFA 5LZ8A 1B6RA 3HCOA 3LT5A 1U4OA 2F48A 3FFAA 3NBMA 4GC5A 1K3IA 4BO2A 1J2RA 2JKVA 3KQWA 4D0RA 3VU9B 1Y34E 1KMMA 5TT1A 4NH0A 1E2NA 1JDBC 1DIAA 3GVHA 2NV6A 4ZK6A 1JYFA 1OUMA 1GZVA 4PO8A 1D5WA 4HD8A 4X64B 4QARA 2YY7A 2V3VA 3NVXA 1DHTA 2ZZMA 5IVKA 1COWA 4KN5A 1KK1A 2CYAA 3GDFA 5CT8A 1VJTA 5MF6A 1MNAA 5BRJA 2P3QA 1W44A 3PQ8A 2PL9A 1DQRA 1XN1A 4LZJA 3CO5A 3DV0B 3HBAA 3R41A 1Q57A 1NBME 4EZEA 5ALNA 5C9ZB 2AG5A 4ZCTA 1KYWA 4KXUA 1BVUA 4EG7A 3QV1A 3IPRA 4GPEA 5KNCA 1ZAYA 4BFYA 3EA4A 3PGKA 5D3QA 1VL6A 5ESXA 4X7MA 1VHTA 2AD1A 1KJZA 4B32A 3NM6B 2G70A 1NGSA 3EIWA 3UJPA 1ELOA 2YW2A 5GIPE 1LDYA 3OM8A 2P40A 2VTBB 4ILEA 1ADJA 1AZLA 1CX9B 4CQMA 5AXBA 1A5SB 1NR1A 3HEAA 4D45A 1YB4A 2F3QA 4JLJA 3NYQA 4IHQA 2MSEB 4Q9JA 1KAHA 2FWJA 1HEUA 4WJKB 1E2BA 3WLMA 3FMGA 4LJKA 2GLUA 3KWJA 1JBEA 1TVKB 5K6AC 2I7DA 3N9IA 2OCAA 1O4WA 2WAAA 3PE7A 1A95A 2EX1A 4PN7A 3BFPA 2XJ9A 5KYUB 1WUIS 1HH4A 4FJ0A 1FDSA 2IT1A 4QO8A 5HJEA 1QS0A 3NHLA 2OJYA 3U37A 2OXEA 2XE7A 2BEUB 5ITZA 3O4HA 2BH9A 3T9BA 4B6RA 4N5LA 4MUFA 3DO5A 3IXQA 2FZ5A 2K7ZA 1OV4A 1H94A 1YULA 1M2EA 4A0BB 2H92A 4LJYA 3O4IA 1IN7A 4LYDA 1TAUA 2HYDA 3NRJA 1Y4UA 3ZH9B 1L7BA 1ZOIA 3LRTA 1C4OA 5ICSA 5BUCA 3KOOA 2WBLC 1XSEA 2FVYA 3OG9A 5KTNA 2CWWA 1XT6A 4Z54A 3MXTA 5MN4A 1DTSA 1XEXB 3UAWA 1Z74A 4F9FA 1EFHA 3WGKA 2VJYA 1C1YA 3SBEA 1Z4MA 4ZVKA 2XL2A 4K46A 4UHJA 3TRHA 4RQBA 3R7BA 5I7HA 4GGMX 3TR6A 3JTMA 1S7GA 3NCTA 4HN4B 3I9V1 3T4EA 1PF7E 1DFHA 3ZLUA 4G5YA 1NLFA 3DM5A 3LUJA 3WLJA 4LTDA 3ZWDA 4DQVA 2CB9A 4R1TA 2YZ7A 3E4CA 4EENA 4QGGA 2ZPAA 4OHMA 2HU7A 3JTEA 4TLEA 1YB7A 2BFBA 4X44A 3KXIA 2RG7A 1SVOA 2WWGA 4H7FA 5D5HA 1CULC 3KTFA 2GK4A 1HDGO 4W82A 4CM3A 1U0TA 2LD4A 4ZVPA 1XEFA 5JYEA 2H3EA 2ZRMA 3U4HA 2AEMA 3K5IA 3STXA 5BWCA 4D6PA 3OZBA 3PIRA 2EFJA 4ZAWA 1QIJA