3IVPA

The structure of a possible transposon-related dna-binding protein from clostridium difficile 630.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
KKEDKYDFRALGLAIKEARKKQGLTREQVGAMIEIDPRYLTNIENKGQHPSLQVLYDLVSLLNVSVDEFFLPASSQVKSTKRRQLENKIDNFTDADLVIMESVADGIVKSKEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a possible transposon-related DNA-binding protein from Clostridium difficile 630.
rcsb
source organism Clostridium difficile
molecule tags Dna binding protein
molecule keywords Putative transposon-related DNA-binding protein
total genus 33
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18430 DBD_HTH Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3ivpA01
3OMTA 3HZIB 2XIUA 1JFSA 2IUOA 2A6CA 2KEKA 1ZZ8A 2EWTA 2HINA 4GHJA 2ICPA 5A7LA 4Z59A 3OQNA 3S8QA 1RZSA 3CECA 3BDNA 2LYPA 2LYLA 1B0NA 4PU7A 1O4XA 1NEQA 1BDIA 1QP4A 1QPZA 2D5VA 2L8NA 3RZZA 3EUSA 5K98B 2B5AA 2XCJA 4GQMA 1R69A 2GZUA 1ZZCA 3TRBA 3F51A 1CJGA 1VPWA 1LMB3 3OP9A 2HSGA 1RZRA 3O9XA 4MCTA 2H8RA 2BJCA 2LYRA 4YBAA 4IVZA 2ICTA 4FN3A 3SCHA 3CLCA 2XJ3A 4YG4A 3CROL 1SQ8A 1E3OC 2BNMA 1X57A 1PRUA 4X4FA 3JXCL 1WH6A 1OSLA 2OR1L 2PUBA 3F52A 3FYAA 1LCCA 1HF0A 3FYMA 4J1XA 2JCGA 1DW9A 1QP7A 4X4DA 2IVQA 2O49A 2WUSR 1RPEL 3OQOA 2O38A 4OB4A 4IWRA 4MCXA 3SCFA 1JH9A 3GN5B 3F6WA 3L1PA 2PUAA 2BNOA 1POUA 4X4HA 3PXPA 1UXDA 1X2LA 2KZ8A 3FMYA 1ZZ7A 1NERA 2KPJA 3ZHIA 4F8DA 1ADRA 4IA8A 2PUDA 1CQTA 3LFPA 1LCDA 3OQMA 1OCTC 1XWRA 2WIUB 4O8BA 4PU4C 1ZAYA 2R63A 1EFAA 2LYKA 1PERL 4Z58A 2BNNA 4X4BA 3ZKCA 2PUFA 4JCYA 2AUWA 1ZZ9A 2PUCA 4Z5CA 4JCXA 1GT0C 1JWLA 4X4GA 2OFYA 2MQKA 2IVBA 3JXDL 2AWIA 3BD1A 4I6RA 4JQDA 2L49A 1PRVA 2PUEA 3GN5A 3VK0A 2LYQA 4FBIA 1YSEA 3U3WA 4X4IA 1S7EA 2XSDC 4I8TA 1RIOA 1WETA 4YG1A 1LLIA 3GBFA 3KXAA 2KEJA 3R1FA 1ZZBA 2AXZA 2XI8A 4J1WA 1JFTA 1UTXA 1WIZA 2PUGA 4PU3C 2R1JL 1LQCA 1QQAA 3H5TA 4NDWA 4YG7B 2KEIA 1AU7A 1QQBA 3QWGA 3JXBC 1DWKA 2FJRA 3KJXA 3UFDA 1ZVVA 2IV1A 2LYSA 3QQ6A 2MEZA 1RZRD 1ZUGA 2PIJA 2PE5A 1R63A 2CROA 1BDHA 2AXUA 2AW6A 3G5GA 1PNRA 2LCVA 3QF3A 3D1NI 3BS3A 1PRAA 4I6UA 1QP0A 1ZZ6A 2LYJA 3SCGA 3MLFA 4Z5DA 2O4AA 3QYXA 2GRMA 4I6TA 4X4CA 3B7HA 3LISA 1ZS4A 1Y9QA 1WH8A 4Z5HA 2IU7A 3IVPA 2JVLA 2IVGA 4X4EA 1IC8A 2CSFA 4PU8A 3G7DA 3ZHMA 2EF8A 2PPXA 3KZ3A 2EBYA 4YARA 3DNVB 2GRLA 4Y42A 1UXCA 1ZPQA 1Y7YA 1L1MA 2AXVA
chains in the Genus database with same CATH superfamily
2IUOA 2A6CA 2EWTA 5A7LA 4Z59A 1QP4A 2LYPA 4PU7A 1B0NA 1BDIA 2D5VA 5K98B 3TRBA 1CJGA 3OP9A 3O9XA 3NDBB 4FN3A 3QFIA 2XXPA 1X57A 4ER5A 1PRUA 4X4FA 3JXCL 3F52A 3FYAA 2JCGA 1QP7A 2WUSR 3M9LA 4IWRA 3L1PA 1POUA 4X4HA 2KZ8A 3FMYA 4F8DA 3OQMA 4O8BA 3QOWA 1EFAA 1PERL 4Z58A 2BNNA 3ZKCA 4JCXA 1GT0C 2OFYA 2IVBA 3JXDL 2PUEA 3GN5A 3VK0A 4FBIA 1YSEA 2JQEA 3KL4A 2KEJA 2J7WA 3LQXA 2R1JL 1QQAA 4NDWA 4YG7B 3JXBC 2PXEA 1DWKA 2J7UA 2MEZA 2AXUA 2AW6A 1QB2A 2PXPA 4I6UA 1QP0A 2V3CC 1ZZ6A 2XXQA 4DE9A 3GUUA 2GRMA 4X4CA 4ER0A 2PXBA 2JVLA 3OKZA 3KZ3A 2XXAA 2AXVA 2XIUA 4ER6A 2HINA 2ICPA 3TELA 5DRYA 1O4XA 3CECA 2PXKA 1NEQA 2B5AA 2XCJA 4GQMA 2GZUA 1VPWA 2VEOA 3VWSA 1LMB3 2H8RA 4MCTA 4IVZA 2ICTA 1SQ8A 2BNMA 2PUBA 4HRAA 1LCCA 1HF0A 1DW9A 2ODRD 3OQOA 2PXUA 3SCFA 2PUAA 3PXPA 1UXDA 3GZCA 4ER3A 4IA8A 4PU4C 2R63A 2PUFA 2AUWA 1ZZ9A 2PUCA 1JWLA 4X4GA 2PXTA 4I8TA 4YG1A 1LLIA 3OWQA 3GBFA 3KXAA 3NROA 3R1FA 2AXZA 1WIZA 4PU3C 3ZPXA 3H5TA 2KEIA 1AU7A 1QQBA 3KJXA 4Q2JA 1ZUGA 3GZDC 5DT2A 2CROA 3G5GA 2HCNA 5DTQA 4EKGA 3BS3A 5GAGi 3SCGA 2FFHA 2O4AA 3LISA 1Y9QA 1WH8A 4Z5HA 2PXFA 2PPXA 1U2ZA 4YARA 3DM5A 2GRLA 1NW3A 4EQZA 3ZHMA 1L1MA 4JCYA 3OMTA 4GHJA 3OQNA 3A9XA 1RZSA 4EK9A 1QPZA 1DULA 2L8NA 3RZZA 3EUSA 3PE5A 1R69A 1ZZCA 2HSGA 2LYRA 4YBAA 3CLCA 2XJ3A 4ER7A 3FYMA 3G0TA 1QZXA 1RPEL 4OB4A 4MCXA 3F6WA 2BNOA 3SR4A 1X2LA 3ZHIA 1NERA 2KPJA 2PXLA 2PUDA 5DRTA 1ZAYA 4X4BA 2HFZA 2MQKA 2AWIA 4I6RA 4DE8A 4EKIA 2L49A 2LLVA 3ME5A 3TEPA 4X4IA 5DTRA 1ZZBA 4J1WA 1JFTA 1UTXA 1LQCA 2LLWA 3QWGA 3UFDA 1ZVVA 2LYSA 3R09A 3QQ6A 1RZRD 2PIJA 4OBMA 1R63A 1BDHA 1PNRA 2LCVA 2MXDA 3D1NI 3A9YA 1PRAA 4WVLA 3SX0A 4I6TA 2PXVA 3B7HA 1ZS4A 3IVPA 1IC8A 2CSFA 4PU8A 3G7DA 2EF8A 3GZDA 1HQ1A 4Y42A 2M4HA 1ZPQA 1Y7YA 3HZIB 1JFSA 1MFQC 2KEKA 1ZZ8A 3S8QA 3BDNA 2LYLA 2LNMA 5JUWA 3F51A 1RZRA 2BJCA 3A9ZA 3SCHA 2YBDA 3CROL 4YG4A 1E3OC 1OSLA 1WH6A 2OR1L 4J1XA 4X4DA 2IVQA 2O49A 2O38A 1JH9A 3GN5B 1ZZ7A 2L1PA 1ADRA 1CQTA 3LFPA 1LCDA 1OCTC 3NXHA 1XWRA 2WIUB 2LYKA 4Z5CA 3UWPA 2PXQA 3BD1A 4JQDA 4EZIA 1PRVA 3MEJA 2LYQA 3U3WA 1S7EA 2XSDC 1RIOA 1WETA 5DTMA 2XI8A 2PUGA 3TFLA 3NZLA 2FJRA 2IV1A 2PE5A 3QF3A 2HCSA 2LYJA 3MLFA 4Z5DA 3QYXA 5DSXA 3QOXA 2IU7A 2PXDA 2IVGA 5GAHi 4X4EA 2EBYA 3DNVB 1UXCA
chains in the Genus database with same CATH topology
3OMTA 3HZIB 2XIUA 1JFSA 2IUOA 2A6CA 2KEKA 1ZZ8A 2EWTA 2HINA 4GHJA 2ICPA 5A7LA 4Z59A 3OQNA 3S8QA 1RZSA 3CECA 3BDNA 2LYPA 2LYLA 1B0NA 4PU7A 1O4XA 1NEQA 1BDIA 1QP4A 1QPZA 2D5VA 2L8NA 3RZZA 3EUSA 5K98B 2B5AA 2XCJA 4GQMA 1R69A 2GZUA 1ZZCA 3TRBA 3F51A 1CJGA 1VPWA 1LMB3 3OP9A 2HSGA 1RZRA 3O9XA 4MCTA 2H8RA 2BJCA 2LYRA 4YBAA 4IVZA 2ICTA 4FN3A 3SCHA 3CLCA 2XJ3A 4YG4A 3CROL 1SQ8A 1E3OC 2BNMA 1X57A 1PRUA 4X4FA 3JXCL 1WH6A 1OSLA 2OR1L 2PUBA 3F52A 3FYAA 1LCCA 1HF0A 3FYMA 4J1XA 2JCGA 1DW9A 1QP7A 4X4DA 2IVQA 2O49A 2WUSR 1RPEL 3OQOA 2O38A 4OB4A 4IWRA 4MCXA 3SCFA 1JH9A 3GN5B 3F6WA 3L1PA 2PUAA 2BNOA 1POUA 4X4HA 3PXPA 1UXDA 1X2LA 2KZ8A 3FMYA 1ZZ7A 1NERA 2KPJA 3ZHIA 4F8DA 1ADRA 4IA8A 2PUDA 1CQTA 3LFPA 1LCDA 3OQMA 1OCTC 1XWRA 2WIUB 4O8BA 4PU4C 1ZAYA 2R63A 1EFAA 2LYKA 1PERL 4Z58A 2BNNA 4X4BA 3ZKCA 2PUFA 4JCYA 2AUWA 1ZZ9A 2PUCA 4Z5CA 4JCXA 1GT0C 1JWLA 4X4GA 2OFYA 2MQKA 2IVBA 3JXDL 2AWIA 3BD1A 4I6RA 4JQDA 2L49A 1PRVA 2PUEA 3GN5A 3VK0A 2LYQA 4FBIA 1YSEA 3U3WA 4X4IA 1S7EA 2XSDC 4I8TA 1RIOA 1WETA 4YG1A 1LLIA 3GBFA 3KXAA 2KEJA 3R1FA 1ZZBA 2AXZA 2XI8A 4J1WA 1JFTA 1UTXA 1WIZA 2PUGA 4PU3C 2R1JL 1LQCA 1QQAA 3H5TA 4NDWA 4YG7B 2KEIA 1AU7A 1QQBA 3QWGA 3JXBC 1DWKA 2FJRA 3KJXA 3UFDA 1ZVVA 2IV1A 2LYSA 3QQ6A 2MEZA 1RZRD 1ZUGA 2PIJA 2PE5A 1R63A 2CROA 1BDHA 2AXUA 2AW6A 3G5GA 1PNRA 2LCVA 3QF3A 3D1NI 3BS3A 1PRAA 4I6UA 1QP0A 1ZZ6A 2LYJA 3SCGA 3MLFA 4Z5DA 2O4AA 3QYXA 2GRMA 4I6TA 4X4CA 3B7HA 3LISA 1ZS4A 1Y9QA 1WH8A 4Z5HA 2IU7A 3IVPA 2JVLA 2IVGA 4X4EA 1IC8A 2CSFA 4PU8A 3G7DA 3ZHMA 2EF8A 2PPXA 3KZ3A 2EBYA 4YARA 3DNVB 2GRLA 4Y42A 1UXCA 1ZPQA 1Y7YA 1L1MA 2AXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMT A;  3HZI B;  2XIU A;  1JFS A;  2IUO A;  2A6C A;  2KEK A;  1ZZ8 A;  2EWT A;  2HIN A;  4GHJ A;  2ICP A;  5A7L A;  4Z59 A;  3OQN A;  3S8Q A;  1RZS A;  3CEC A;  3BDN A;  2LYP A;  2LYL A;  1B0N A;  4PU7 A;  1O4X A;  1NEQ A;  1BDI A;  1QP4 A;  1QPZ A;  2D5V A;  2L8N A;  3RZZ A;  3EUS A;  5K98 B;  2B5A A;  2XCJ A;  4GQM A;  1R69 A;  2GZU A;  1ZZC A;  3TRB A;  3F51 A;  1CJG A;  1VPW A;  1LMB 3;  3OP9 A;  2HSG A;  1RZR A;  3O9X A;  4MCT A;  2H8R A;  2BJC A;  2LYR A;  4YBA A;  4IVZ A;  2ICT A;  4FN3 A;  3SCH A;  3CLC A;  2XJ3 A;  4YG4 A;  3CRO L;  1SQ8 A;  1E3O C;  2BNM A;  1X57 A;  1PRU A;  4X4F A;  3JXC L;  1WH6 A;  1OSL A;  2OR1 L;  2PUB A;  3F52 A;  3FYA A;  1LCC A;  1HF0 A;  3FYM A;  4J1X A;  2JCG A;  1DW9 A;  1QP7 A;  4X4D A;  2IVQ A;  2O49 A;  2WUS R;  1RPE L;  3OQO A;  2O38 A;  4OB4 A;  4IWR A;  4MCX A;  3SCF A;  1JH9 A;  3GN5 B;  3F6W A;  3L1P A;  2PUA A;  2BNO A;  1POU A;  4X4H A;  3PXP A;  1UXD A;  1X2L A;  2KZ8 A;  3FMY A;  1ZZ7 A;  1NER A;  2KPJ A;  3ZHI A;  4F8D A;  1ADR A;  4IA8 A;  2PUD A;  1CQT A;  3LFP A;  1LCD A;  3OQM A;  1OCT C;  1XWR A;  2WIU B;  4O8B A;  4PU4 C;  1ZAY A;  2R63 A;  1EFA A;  2LYK A;  1PER L;  4Z58 A;  2BNN A;  4X4B A;  3ZKC A;  2PUF A;  4JCY A;  2AUW A;  1ZZ9 A;  2PUC A;  4Z5C A;  4JCX A;  1GT0 C;  1JWL A;  4X4G A;  2OFY A;  2MQK A;  2IVB A;  3JXD L;  2AWI A;  3BD1 A;  4I6R A;  4JQD A;  2L49 A;  1PRV A;  2PUE A;  3GN5 A;  3VK0 A;  2LYQ A;  4FBI A;  1YSE A;  3U3W A;  4X4I A;  1S7E A;  2XSD C;  4I8T A;  1RIO A;  1WET A;  4YG1 A;  1LLI A;  3GBF A;  3KXA A;  2KEJ A;  3R1F A;  1ZZB A;  2AXZ A;  2XI8 A;  4J1W A;  1JFT A;  1UTX A;  1WIZ A;  2PUG A;  4PU3 C;  2R1J L;  1LQC A;  1QQA A;  3H5T A;  4NDW A;  4YG7 B;  2KEI A;  1AU7 A;  1QQB A;  3QWG A;  3JXB C;  1DWK A;  2FJR A;  3KJX A;  3UFD A;  1ZVV A;  2IV1 A;  2LYS A;  3QQ6 A;  2MEZ A;  1RZR D;  1ZUG A;  2PIJ A;  2PE5 A;  1R63 A;  2CRO A;  1BDH A;  2AXU A;  2AW6 A;  3G5G A;  1PNR A;  2LCV A;  3QF3 A;  3D1N I;  3BS3 A;  1PRA A;  4I6U A;  1QP0 A;  1ZZ6 A;  2LYJ A;  3SCG A;  3MLF A;  4Z5D A;  2O4A A;  3QYX A;  2GRM A;  4I6T A;  4X4C A;  3B7H A;  3LIS A;  1ZS4 A;  1Y9Q A;  1WH8 A;  4Z5H A;  2IU7 A;  3IVP A;  2JVL A;  2IVG A;  4X4E A;  1IC8 A;  2CSF A;  4PU8 A;  3G7D A;  3ZHM A;  2EF8 A;  2PPX A;  3KZ3 A;  2EBY A;  4YAR A;  3DNV B;  2GRL A;  4Y42 A;  1UXC A;  1ZPQ A;  1Y7Y A;  1L1M A;  2AXV A; 
#chains in the Genus database with same CATH topology
 2IUO A;  2A6C A;  2EWT A;  5A7L A;  4Z59 A;  1QP4 A;  2LYP A;  4PU7 A;  1B0N A;  1BDI A;  2D5V A;  5K98 B;  3TRB A;  1CJG A;  3OP9 A;  3O9X A;  3NDB B;  4FN3 A;  3QFI A;  2XXP A;  1X57 A;  4ER5 A;  1PRU A;  4X4F A;  3JXC L;  3F52 A;  3FYA A;  2JCG A;  1QP7 A;  2WUS R;  3M9L A;  4IWR A;  3L1P A;  1POU A;  4X4H A;  2KZ8 A;  3FMY A;  4F8D A;  3OQM A;  4O8B A;  3QOW A;  1EFA A;  1PER L;  4Z58 A;  2BNN A;  3ZKC A;  4JCX A;  1GT0 C;  2OFY A;  2IVB A;  3JXD L;  2PUE A;  3GN5 A;  3VK0 A;  4FBI A;  1YSE A;  2JQE A;  3KL4 A;  2KEJ A;  2J7W A;  3LQX A;  2R1J L;  1QQA A;  4NDW A;  4YG7 B;  3JXB C;  2PXE A;  1DWK A;  2J7U A;  2MEZ A;  2AXU A;  2AW6 A;  1QB2 A;  2PXP A;  4I6U A;  1QP0 A;  2V3C C;  1ZZ6 A;  2XXQ A;  4DE9 A;  3GUU A;  2GRM A;  4X4C A;  4ER0 A;  2PXB A;  2JVL A;  3OKZ A;  3KZ3 A;  2XXA A;  2AXV A;  2XIU A;  4ER6 A;  2HIN A;  2ICP A;  3TEL A;  5DRY A;  1O4X A;  3CEC A;  2PXK A;  1NEQ A;  2B5A A;  2XCJ A;  4GQM A;  2GZU A;  1VPW A;  2VEO A;  3VWS A;  1LMB 3;  2H8R A;  4MCT A;  4IVZ A;  2ICT A;  1SQ8 A;  2BNM A;  2PUB A;  4HRA A;  1LCC A;  1HF0 A;  1DW9 A;  2ODR D;  3OQO A;  2PXU A;  3SCF A;  2PUA A;  3PXP A;  1UXD A;  3GZC A;  4ER3 A;  4IA8 A;  4PU4 C;  2R63 A;  2PUF A;  2AUW A;  1ZZ9 A;  2PUC A;  1JWL A;  4X4G A;  2PXT A;  4I8T A;  4YG1 A;  1LLI A;  3OWQ A;  3GBF A;  3KXA A;  3NRO A;  3R1F A;  2AXZ A;  1WIZ A;  4PU3 C;  3ZPX A;  3H5T A;  2KEI A;  1AU7 A;  1QQB A;  3KJX A;  4Q2J A;  1ZUG A;  3GZD C;  5DT2 A;  2CRO A;  3G5G A;  2HCN A;  5DTQ A;  4EKG A;  3BS3 A;  5GAG i;  3SCG A;  2FFH A;  2O4A A;  3LIS A;  1Y9Q A;  1WH8 A;  4Z5H A;  2PXF A;  2PPX A;  1U2Z A;  4YAR A;  3DM5 A;  2GRL A;  1NW3 A;  4EQZ A;  3ZHM A;  1L1M A;  4JCY A;  3OMT A;  4GHJ A;  3OQN A;  3A9X A;  1RZS A;  4EK9 A;  1QPZ A;  1DUL A;  2L8N A;  3RZZ A;  3EUS A;  3PE5 A;  1R69 A;  1ZZC A;  2HSG A;  2LYR A;  4YBA A;  3CLC A;  2XJ3 A;  4ER7 A;  3FYM A;  3G0T A;  1QZX A;  1RPE L;  4OB4 A;  4MCX A;  3F6W A;  2BNO A;  3SR4 A;  1X2L A;  3ZHI A;  1NER A;  2KPJ A;  2PXL A;  2PUD A;  5DRT A;  1ZAY A;  4X4B A;  2HFZ A;  2MQK A;  2AWI A;  4I6R A;  4DE8 A;  4EKI A;  2L49 A;  2LLV A;  3ME5 A;  3TEP A;  4X4I A;  5DTR A;  1ZZB A;  4J1W A;  1JFT A;  1UTX A;  1LQC A;  2LLW A;  3QWG A;  3UFD A;  1ZVV A;  2LYS A;  3R09 A;  3QQ6 A;  1RZR D;  2PIJ A;  4OBM A;  1R63 A;  1BDH A;  1PNR A;  2LCV A;  2MXD A;  3D1N I;  3A9Y A;  1PRA A;  4WVL A;  3SX0 A;  4I6T A;  2PXV A;  3B7H A;  1ZS4 A;  3IVP A;  1IC8 A;  2CSF A;  4PU8 A;  3G7D A;  2EF8 A;  3GZD A;  1HQ1 A;  4Y42 A;  2M4H A;  1ZPQ A;  1Y7Y A;  3HZI B;  1JFS A;  1MFQ C;  2KEK A;  1ZZ8 A;  3S8Q A;  3BDN A;  2LYL A;  2LNM A;  5JUW A;  3F51 A;  1RZR A;  2BJC A;  3A9Z A;  3SCH A;  2YBD A;  3CRO L;  4YG4 A;  1E3O C;  1OSL A;  1WH6 A;  2OR1 L;  4J1X A;  4X4D A;  2IVQ A;  2O49 A;  2O38 A;  1JH9 A;  3GN5 B;  1ZZ7 A;  2L1P A;  1ADR A;  1CQT A;  3LFP A;  1LCD A;  1OCT C;  3NXH A;  1XWR A;  2WIU B;  2LYK A;  4Z5C A;  3UWP A;  2PXQ A;  3BD1 A;  4JQD A;  4EZI A;  1PRV A;  3MEJ A;  2LYQ A;  3U3W A;  1S7E A;  2XSD C;  1RIO A;  1WET A;  5DTM A;  2XI8 A;  2PUG A;  3TFL A;  3NZL A;  2FJR A;  2IV1 A;  2PE5 A;  3QF3 A;  2HCS A;  2LYJ A;  3MLF A;  4Z5D A;  3QYX A;  5DSX A;  3QOX A;  2IU7 A;  2PXD A;  2IVG A;  5GAH i;  4X4E A;  2EBY A;  3DNV B;  1UXC A; 
#chains in the Genus database with same CATH homology
 3OMT A;  3HZI B;  2XIU A;  1JFS A;  2IUO A;  2A6C A;  2KEK A;  1ZZ8 A;  2EWT A;  2HIN A;  4GHJ A;  2ICP A;  5A7L A;  4Z59 A;  3OQN A;  3S8Q A;  1RZS A;  3CEC A;  3BDN A;  2LYP A;  2LYL A;  1B0N A;  4PU7 A;  1O4X A;  1NEQ A;  1BDI A;  1QP4 A;  1QPZ A;  2D5V A;  2L8N A;  3RZZ A;  3EUS A;  5K98 B;  2B5A A;  2XCJ A;  4GQM A;  1R69 A;  2GZU A;  1ZZC A;  3TRB A;  3F51 A;  1CJG A;  1VPW A;  1LMB 3;  3OP9 A;  2HSG A;  1RZR A;  3O9X A;  4MCT A;  2H8R A;  2BJC A;  2LYR A;  4YBA A;  4IVZ A;  2ICT A;  4FN3 A;  3SCH A;  3CLC A;  2XJ3 A;  4YG4 A;  3CRO L;  1SQ8 A;  1E3O C;  2BNM A;  1X57 A;  1PRU A;  4X4F A;  3JXC L;  1WH6 A;  1OSL A;  2OR1 L;  2PUB A;  3F52 A;  3FYA A;  1LCC A;  1HF0 A;  3FYM A;  4J1X A;  2JCG A;  1DW9 A;  1QP7 A;  4X4D A;  2IVQ A;  2O49 A;  2WUS R;  1RPE L;  3OQO A;  2O38 A;  4OB4 A;  4IWR A;  4MCX A;  3SCF A;  1JH9 A;  3GN5 B;  3F6W A;  3L1P A;  2PUA A;  2BNO A;  1POU A;  4X4H A;  3PXP A;  1UXD A;  1X2L A;  2KZ8 A;  3FMY A;  1ZZ7 A;  1NER A;  2KPJ A;  3ZHI A;  4F8D A;  1ADR A;  4IA8 A;  2PUD A;  1CQT A;  3LFP A;  1LCD A;  3OQM A;  1OCT C;  1XWR A;  2WIU B;  4O8B A;  4PU4 C;  1ZAY A;  2R63 A;  1EFA A;  2LYK A;  1PER L;  4Z58 A;  2BNN A;  4X4B A;  3ZKC A;  2PUF A;  4JCY A;  2AUW A;  1ZZ9 A;  2PUC A;  4Z5C A;  4JCX A;  1GT0 C;  1JWL A;  4X4G A;  2OFY A;  2MQK A;  2IVB A;  3JXD L;  2AWI A;  3BD1 A;  4I6R A;  4JQD A;  2L49 A;  1PRV A;  2PUE A;  3GN5 A;  3VK0 A;  2LYQ A;  4FBI A;  1YSE A;  3U3W A;  4X4I A;  1S7E A;  2XSD C;  4I8T A;  1RIO A;  1WET A;  4YG1 A;  1LLI A;  3GBF A;  3KXA A;  2KEJ A;  3R1F A;  1ZZB A;  2AXZ A;  2XI8 A;  4J1W A;  1JFT A;  1UTX A;  1WIZ A;  2PUG A;  4PU3 C;  2R1J L;  1LQC A;  1QQA A;  3H5T A;  4NDW A;  4YG7 B;  2KEI A;  1AU7 A;  1QQB A;  3QWG A;  3JXB C;  1DWK A;  2FJR A;  3KJX A;  3UFD A;  1ZVV A;  2IV1 A;  2LYS A;  3QQ6 A;  2MEZ A;  1RZR D;  1ZUG A;  2PIJ A;  2PE5 A;  1R63 A;  2CRO A;  1BDH A;  2AXU A;  2AW6 A;  3G5G A;  1PNR A;  2LCV A;  3QF3 A;  3D1N I;  3BS3 A;  1PRA A;  4I6U A;  1QP0 A;  1ZZ6 A;  2LYJ A;  3SCG A;  3MLF A;  4Z5D A;  2O4A A;  3QYX A;  2GRM A;  4I6T A;  4X4C A;  3B7H A;  3LIS A;  1ZS4 A;  1Y9Q A;  1WH8 A;  4Z5H A;  2IU7 A;  3IVP A;  2JVL A;  2IVG A;  4X4E A;  1IC8 A;  2CSF A;  4PU8 A;  3G7D A;  3ZHM A;  2EF8 A;  2PPX A;  3KZ3 A;  2EBY A;  4YAR A;  3DNV B;  2GRL A;  4Y42 A;  1UXC A;  1ZPQ A;  1Y7Y A;  1L1M A;  2AXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...