3IVZA

Crystal structure of hyperthermophilic nitrilase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
261
structure length
260
Chain Sequence
VKVAYVQMNPQILEPDKNYSKAEKLIKEASKQGAQLVVLPELFDTGYNFETREEVFEIAQKIPEGETTTFLMDVARDTGVYIVAGTAEKDGDVLYNSAVVVGPRGFIGKYRKIHLFYREKFFFEPGDLGFRVFDLGFMKVGVMIFDWFFPESARTLALKGADVIAHPANLVMPYAPRAMPIRALENKVYTVTADRVGEERGLKFIGKSLIASPKAEVLSMASETEEEVGVAEIDLSLVRNKRINDLNDIFKDRREEYYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of a thermoactive nitrilase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase
molecule keywords Nitrilase
total genus 87
structure length 260
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.5.1: Nitrilase.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 3ivzA00
4GYLA 2PLQA 5H8KA 3SEZA 5H8LA 4HGDA 3WUYA 3SZGA 4IZTA 4IZVA 4HG5A 4CYGA 2VHIA 3KI8A 3SEQA 4H5UA 2W1VA 1FO6A 2E2KA 2UXYA 1J31A 2VHHA 4KZFA 4F4HA 2DYVA 1UF7A 4LF0A 1F89A 3ILVA 1UF8A 3DLAA 3IW3A 3P8KA 2E2LA 1UF4A 3KLCA 1EMSA 3IVZA 3N05A 3HKXA 4CYYA 4GYNA 2E11A 5JQNA 4IZSA 4CYFA 1UF5A 5H8IA 5KHAA 4IZWA 2GGKA 4HG3A 4IZUA 2DYUA 3SDBA 1ERZA 5H8JA 3SYTA 2GGLA
chains in the Genus database with same CATH superfamily
4GYLA 2PLQA 5H8KA 3SEZA 5H8LA 4HGDA 3WUYA 3SZGA 4IZTA 4IZVA 4HG5A 4CYGA 2VHIA 3KI8A 3SEQA 4H5UA 2W1VA 1FO6A 2E2KA 2UXYA 1J31A 2VHHA 4KZFA 4F4HA 2DYVA 1UF7A 4LF0A 1F89A 3ILVA 1UF8A 3DLAA 3IW3A 3P8KA 2E2LA 1UF4A 3KLCA 1EMSA 3IVZA 3N05A 3HKXA 4CYYA 4GYNA 2E11A 5JQNA 4IZSA 4CYFA 1UF5A 5H8IA 5KHAA 4IZWA 2GGKA 4HG3A 4IZUA 2DYUA 3SDBA 1ERZA 5H8JA 3SYTA 2GGLA
chains in the Genus database with same CATH topology
4GYLA 2PLQA 5H8KA 3SEZA 5H8LA 4HGDA 3WUYA 3SZGA 4IZTA 4IZVA 4HG5A 4CYGA 2VHIA 3KI8A 3SEQA 4H5UA 2W1VA 1FO6A 2E2KA 2UXYA 1J31A 2VHHA 4KZFA 4F4HA 2DYVA 1UF7A 4LF0A 1F89A 3ILVA 1UF8A 3DLAA 3IW3A 3P8KA 2E2LA 1UF4A 3KLCA 1EMSA 3IVZA 3N05A 3HKXA 4CYYA 4GYNA 2E11A 5JQNA 4IZSA 4CYFA 1UF5A 5H8IA 5KHAA 4IZWA 2GGKA 4HG3A 4IZUA 2DYUA 3SDBA 1ERZA 5H8JA 3SYTA 2GGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYL A;  2PLQ A;  5H8K A;  3SEZ A;  5H8L A;  4HGD A;  3WUY A;  3SZG A;  4IZT A;  4IZV A;  4HG5 A;  4CYG A;  2VHI A;  3KI8 A;  3SEQ A;  4H5U A;  2W1V A;  1FO6 A;  2E2K A;  2UXY A;  1J31 A;  2VHH A;  4KZF A;  4F4H A;  2DYV A;  1UF7 A;  4LF0 A;  1F89 A;  3ILV A;  1UF8 A;  3DLA A;  3IW3 A;  3P8K A;  2E2L A;  1UF4 A;  3KLC A;  1EMS A;  3IVZ A;  3N05 A;  3HKX A;  4CYY A;  4GYN A;  2E11 A;  5JQN A;  4IZS A;  4CYF A;  1UF5 A;  5H8I A;  5KHA A;  4IZW A;  2GGK A;  4HG3 A;  4IZU A;  2DYU A;  3SDB A;  1ERZ A;  5H8J A;  3SYT A;  2GGL A; 
#chains in the Genus database with same CATH topology
 4GYL A;  2PLQ A;  5H8K A;  3SEZ A;  5H8L A;  4HGD A;  3WUY A;  3SZG A;  4IZT A;  4IZV A;  4HG5 A;  4CYG A;  2VHI A;  3KI8 A;  3SEQ A;  4H5U A;  2W1V A;  1FO6 A;  2E2K A;  2UXY A;  1J31 A;  2VHH A;  4KZF A;  4F4H A;  2DYV A;  1UF7 A;  4LF0 A;  1F89 A;  3ILV A;  1UF8 A;  3DLA A;  3IW3 A;  3P8K A;  2E2L A;  1UF4 A;  3KLC A;  1EMS A;  3IVZ A;  3N05 A;  3HKX A;  4CYY A;  4GYN A;  2E11 A;  5JQN A;  4IZS A;  4CYF A;  1UF5 A;  5H8I A;  5KHA A;  4IZW A;  2GGK A;  4HG3 A;  4IZU A;  2DYU A;  3SDB A;  1ERZ A;  5H8J A;  3SYT A;  2GGL A; 
#chains in the Genus database with same CATH homology
 4GYL A;  2PLQ A;  5H8K A;  3SEZ A;  5H8L A;  4HGD A;  3WUY A;  3SZG A;  4IZT A;  4IZV A;  4HG5 A;  4CYG A;  2VHI A;  3KI8 A;  3SEQ A;  4H5U A;  2W1V A;  1FO6 A;  2E2K A;  2UXY A;  1J31 A;  2VHH A;  4KZF A;  4F4H A;  2DYV A;  1UF7 A;  4LF0 A;  1F89 A;  3ILV A;  1UF8 A;  3DLA A;  3IW3 A;  3P8K A;  2E2L A;  1UF4 A;  3KLC A;  1EMS A;  3IVZ A;  3N05 A;  3HKX A;  4CYY A;  4GYN A;  2E11 A;  5JQN A;  4IZS A;  4CYF A;  1UF5 A;  5H8I A;  5KHA A;  4IZW A;  2GGK A;  4HG3 A;  4IZU A;  2DYU A;  3SDB A;  1ERZ A;  5H8J A;  3SYT A;  2GGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...