3IWBA

T. maritima adometdc in processed form
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
55
structure length
55
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase
total genus 7
structure length 55
sequence length 55
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwbA00
3IWDA 3IWBA 3IWCA
chains in the Genus database with same CATH superfamily
2LUQA 1HNXE 1A1HA 3RMPA 5IV8B 3H09A 2NUEA 2MKNA 4LF9E 1X6FA 4LF4E 4DUZE 2Q8UA 2EMLA 2EMGA 1ZU1A 2EORA 1BB8A 4LFAE 3ADIA 2WCC3 5F3WA 4KWYA 2EL5A 2EMIA 5BR8E 2NA2A 1J5EE 4X8WA 4R2RA 1TN9A 3KZZA 2LCEA 2EM6A 4WYQB 5AC5A 1UHZA 2YRMA 3BF2A 4DV1E 5LMUE 1ZBTA 2VF1A 4RHBB 1NCSA 2YTPA 3VHTB 1ZR9A 4F6MA 2RS7A 3HPZA 2EQ1A 2GHFA 4DV5E 1AH5A 2EM7A 2V89A 2JYAA 5LMNE 2H36X 4DR3E 2EOMA 2E72A 2EMCA 4F6NA 2FTXB 4R2AA 1WHQA 2B7TA 3KWRA 2M4IA 3JTZA 2NUGA 2EM8A 1B69A 4GKKE 1MEYC 2EPRA 3L00A 2LTRA 3LMLA 1KJKA 4LFBE 1RQ0A 2EPUA 1O0WA 3VK6A 1YFHA 3BGHA 1A1LA 4AQYE 2V8QB 3LLHA 1DI2A 3EPKA 4NZVA 4DKKA 4JI5E 2MKDA 4BC9A 2F8BA 2L2MA 2L8TA 2YU8A 1PKPA 2EOEA 2MDGA 1N34E 1FJGE 2YTGA 2EOQA 2EN1A 4LF7E 4DV4E 3P1XA 4WPYA 4LF6E 2K7IA 2EMBA 2UUCE 4Q28A 4DR5E 3J80C 3MHHC 3J81C 2RSIA 1GQEA 5FLXC 2ODRD 1SR9A 2EN6A 4BHCA 4BMJA 2EM4A 2ADRA 2JY9A 2MC6A 1UN6B 2BBGA 1JK1A 2L2KB 2ZM6E 3T1HE 3OTOE 1XMOE 3EPHA 1HNWE 4RH8A 3C6KA 4MLQA 4NHRA 4GZNC 5IT9C 2L3CA 2EPOA 5LL6R 1EH6A 2DGCA 4LFCE 4NXNE 4O43A 2UXCE 4JI3E 2EM2A 4F2JC 4R2QA 4ZYEA 2DLQA 5A6KA 4HEIA 3HQ1A 1PDAA 1YYWA 4R2SA 2I9IA 2D9HA 2NABA 2DMIA 1X49A 3JAMC 4DV2E 4DV0E 2KONA 3F6HA 1DQ3A 2ENHA 1MGTA 1X6HA 4X9JA 1JK2A 3C4TA 4BC7A 2N8XA 1YUIA 1ZBQA 1T38A 4B3ME 1XNQE 5KL3A 4ZYDA 4LF5E 1A1FA 2LVHA 1A1KA 2R1FA 2B7VA 2KHXA 2JXPA 2WBSA 2DMYA 1LLMC 4I8OA 3IWCA 2EMAA 2EMYA 1DGCA 2EN3A 2WBUA 2EM9A 2YTJA 1XMQE 2N3HA 2LJHA 4O24A 2UXBE 4M0VA 2YTIA 4BS9A 4J8ZA 4LU9A 4R2CA 2JWOA 2RTXA 3AV0A 2YT4A 2YTNA 3VYYA 2EOXA 1YPNA 4O4KA 2EM3A 4WSPA 1ZAAC 2HGHA 2LMZA 1IQSA 3HPSA 3C4BA 2HC5A 1YYKA 2VQEE 2UXDE 2LUPB 1X6EA 2V87A 3ECRA 1YUJA 3T1YE 1N3GA 2DB2A 2EN7A 2EPNA 5KL6A 4BBYA 4K0KE 5LLQA 1F2IG 2G7HA 2LO3A 2VRDA 2FV4B 1TF3A 4P78A 5ADZA 2YRKA 2EN4A 1TF6A 2ENAA 1YZ9A 1AAYA 4X62E 2EOZA 1Z1BA 4DR4E 1KYQA 2RSMA 4M30A 4X64E 3K6QA 1RMDA 4GEQB 3TQMA 1STUA 2CSHA 4Q35B 1A1JA 2EZ6A 2YTQA 1WRJA 2DLKA 2EOYA 2HHHE 1X48A 4ZYGA 2YSOA 2EPXA 2LV2A 2MDRA 1P47A 2I13A 2EOIA 2EQ3A 2EPCA 1A1GA 4DR6E 2JOBA 5AE1A 2EN2A 2EPLX 2MC5A 2PRTA 2ENCA 5A69A 3MSWA 3EPLA 4DV6E 4JI7E 1HR0E 1EH8A 2M7QA 1T4LB 4JI0E 4JI6E 3JU0A 2NUFA 3IWDA 3BBGA 4JV5E 4F9CB 2JP9A 2WBTA 4B3SE 1T4OA 2A25A 2FGGA 4R03A 5A6AA 1IBME 2L33A 3QG5C 1UBDC 3ADGA 3C6MA 3IWBA 4KZSA 2V86A 3FIGA 4WFTA 1PJSA 4F54A 4M9VC 2EM0A 5AE2A 5CFFE 2JOXA 1PJTA 2ELZA 1IMUA 3MHSC 4ZYHA 4YHHE 4DMIA 2CPNA 4MLVA 2VE7C 5A6BD 2UUAE 1BBOA 2VQFE 2RQLA 3UK3C 2RS6A 4IJDA 1X3CA 3EPJA 2L3JA 5KL5A 2EE8A 1EKZA 4DR1E 4DV7E 5IXMB 2EPAA 4F9AB 4DV3E 4FK5C 4L5NC 1WHNA 2YZTA 2EPZA 4O5GA 4JI4E 2CT1A 4R2DA 3THOB 2EOOA 1GTKA 2DSYA 5AC4A 2V88A 3THNA 2UUBE 2F4VE 1BBGA 2GLIA 2RPCA 4JYAE 3BIDA 2BB8A 4M2ZA 2EMFA 2EM5A 2EN8A 2YTDA 3AUZA 4WXCA 2EL4A 2EL6A 5IWAE 3J7AG 4X65E 2EMXA 2LE2A 2EMZA 2GPIA 4JI8E 3HTXA 4R2PA 4B3RE 1L4SA 2M1SA 1EH7A 4WXDA 2IHR1 5AASA 3ADLA 5KL7A 2EOJA 4LF8E 2DIXA 5A6JA 1T4NA 1J26A 2EMKA 1HNZE 2L6MA 4GKJE 4JI2E 4YY3E 2EPMX 2EOFA 4BCAA 1IBKE 3DJWA 1A1IA 5DNYA 5A6BA 1WJPA 2B9DA 2V85A 4OOGC 4L8NA 2HJJA 3M99B 4WSGA 3F6GA 4TUGA 1FKAE 4LTYA 1YYOA 2EMHA 4DR7E 3ZOQB 2LRSA 2DRPA 2EOSA 1N33E 2EWLA 4DUYE 4IS1C 2LTSA 4R2EA 4JI1E 3J7Yp 2K4VA 2YTEA 4BHBA 2CTDA 4OX9E 4KHPE 1SFEA 1WXRA 2EP3A 2YTOA 2JR1A 2B3TB 2L2NA 4DR2E 2ODRC 2YSPA 2KOUA 2EJ4A 2EOHA 5KL2A 2N3GA 2YPNA 4X66E 1NEIA 2JVAA 2E1MA 3DF6A 3OMLA 2JPAA 1N32E 3HXLA 2YWQA 5T6JA 2R76A 1UILA 1PJQA 2EMWA 1X5WA 2L92A 2YRHA 2UU9E 1GZ6A 3ADJA 5KL4A 2LT7A 2YTFA 1QU6A 4F9BB 2WZOA 5A2QC 4B3TE 5TSEA 1I94E 2ELYA 2E5LE 2EPKX 4TUIA 4N4RB 1G2DC 2M9AA 4WX9A 4NXME 1YSAC 5AE3A 1T39A 4HTGA 1IBLE 1N36E 1IQOA 2EPPA 4R8OA 3EQ1A 2LBSB 4P7DA 2J7JA 2YU5A 2LJUA 1G2FC 1X47A 1XNRE 3KZYA 2V83A 1QNTA 2EQ0A 3VYXA 1RC7A
chains in the Genus database with same CATH topology
2LUQA 2LE2A 5LL6R 4NXNE 4LFCE 1HNXE 4JI8E 3HTXA 3RMPA 2UXCE 4JI3E 3H09A 4B3RE 2NUEA 2M1SA 2HHHE 4LF9E 1X48A 2IHR1 5AASA 4DUZE 4LF4E 3ADLA 4LF8E 2DIXA 3HQ1A 1T4NA 1J26A 1YYWA 1HNZE 2L6MA 4GKJE 4JI2E 4YY3E 2MDRA 4LFAE 3ADIA 1X49A 4BCAA 3JAMC 4DV2E 1IBKE 3DJWA 5F3WA 4DV0E 2KONA 5DNYA 2B9DA 2V85A 4DR6E 3F6HA 4OOGC 1DQ3A 2JOBA 4L8NA 5BR8E 5AE1A 3F6GA 4TUGA 1FKAE 2NA2A 2MC5A 4LTYA 4X8WA 1YYOA 1J5EE 4DR7E 3MSWA 3ZOQB 2LRSA 3C4TA 4DV6E 1N33E 4JI7E 1HR0E 2EWLA 4BC7A 4DUYE 2LTSA 4JI1E 2M7QA 1T4LB 3J7Yp 4JI0E 4JI6E 3JU0A 1ZBQA 4WYQB 2NUFA 2K4VA 3IWDA 4B3ME 1XNQE 1UHZA 4LF5E 4JV5E 4F9CB 4DV1E 5LMUE 1ZBTA 2VF1A 1T4OA 2FGGA 4R03A 4B3SE 4OX9E 4KHPE 2RS7A 2B7VA 2KHXA 3HPZA 1WXRA 2DMYA 2JR1A 1IBME 2B3TB 2L33A 2L2NA 3ADGA 4I8OA 2ODRC 3IWBA 4DV5E 4DR2E 3IWCA 4KZSA 2V89A 2V86A 3FIGA 2KOUA 4WFTA 4F54A 5LMNE 1XMQE 2H36X 5AE2A 4DR3E 5CFFE 2JOXA 2N3GA 4X66E 2FTXB 2JVAA 1WHQA 2B7TA 3KWRA 2M4IA 4DMIA 4YHHE 2CPNA 2E1MA 2N3HA 2VE7C 3DF6A 3JTZA 2LJHA 3OMLA 1N32E 3HXLA 2NUGA 4GKKE 5T6JA 2UUAE 4M0VA 2UXBE 2VQFE 2LTRA 1UILA 4J8ZA 4BS9A 4LU9A 3LMLA 2JWOA 2RTXA 2RS6A 4LFBE 1RQ0A 3AV0A 1O0WA 3VK6A 2YT4A 2L92A 3VYYA 2L3JA 4AQYE 2V8QB 3LLHA 1DI2A 1EKZA 4DR1E 4DV7E 4WSPA 1GZ6A 2UU9E 4DKKA 4F9AB 4JI5E 3ADJA 4DV3E 2LMZA 4L5NC 3HPSA 4BC9A 2F8BA 1WHNA 3C4BA 2L2MA 2L8TA 1QU6A 1PKPA 4F9BB 2WZOA 5A2QC 2YZTA 4B3TE 1N34E 1FJGE 1YYKA 2VQEE 2UXDE 2LUPB 1I94E 2V87A 2E5LE 4LF7E 4DV4E 3P1XA 4WPYA 4JI4E 4TUIA 3T1YE 4LF6E 4NXME 2UUCE 2DB2A 5AE3A 4Q28A 4DR5E 2DSYA 3J80C 2V88A 4BBYA 3J81C 1IBLE 1GQEA 2UUBE 5FLXC 4K0KE 2ODRD 1SR9A 2G7HA 1N36E 2FV4B 2F4VE 4R8OA 4P78A 5ADZA 4JYAE 4BMJA 1YZ9A 4M2ZA 2JY9A 2MC6A 2LBSB 4P7DA 4X62E 2L2KB 2ZM6E 3AUZA 3T1HE 4DR4E 2RSMA 5IWAE 3OTOE 4M30A 1XMOE 4X64E 1X47A 3J7AG 3K6QA 1XNRE 1HNWE 4GEQB 1STUA 2V83A 2EZ6A 5IT9C 2L3CA 4X65E 3VYXA 1RC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWD A;  3IWB A;  3IWC A; 
#chains in the Genus database with same CATH topology
 2LUQ A;  1HNX E;  1A1H A;  3RMP A;  5IV8 B;  3H09 A;  2NUE A;  2MKN A;  4LF9 E;  1X6F A;  4LF4 E;  4DUZ E;  2Q8U A;  2EML A;  2EMG A;  1ZU1 A;  2EOR A;  1BB8 A;  4LFA E;  3ADI A;  2WCC 3;  5F3W A;  4KWY A;  2EL5 A;  2EMI A;  5BR8 E;  2NA2 A;  1J5E E;  4X8W A;  4R2R A;  1TN9 A;  3KZZ A;  2LCE A;  2EM6 A;  4WYQ B;  5AC5 A;  1UHZ A;  2YRM A;  3BF2 A;  4DV1 E;  5LMU E;  1ZBT A;  2VF1 A;  4RHB B;  1NCS A;  2YTP A;  3VHT B;  1ZR9 A;  4F6M A;  2RS7 A;  3HPZ A;  2EQ1 A;  2GHF A;  4DV5 E;  1AH5 A;  2EM7 A;  2V89 A;  2JYA A;  5LMN E;  2H36 X;  4DR3 E;  2EOM A;  2E72 A;  2EMC A;  4F6N A;  2FTX B;  4R2A A;  1WHQ A;  2B7T A;  3KWR A;  2M4I A;  3JTZ A;  2NUG A;  2EM8 A;  1B69 A;  4GKK E;  1MEY C;  2EPR A;  3L00 A;  2LTR A;  3LML A;  1KJK A;  4LFB E;  1RQ0 A;  2EPU A;  1O0W A;  3VK6 A;  1YFH A;  3BGH A;  1A1L A;  4AQY E;  2V8Q B;  3LLH A;  1DI2 A;  3EPK A;  4NZV A;  4DKK A;  4JI5 E;  2MKD A;  4BC9 A;  2F8B A;  2L2M A;  2L8T A;  2YU8 A;  1PKP A;  2EOE A;  2MDG A;  1N34 E;  1FJG E;  2YTG A;  2EOQ A;  2EN1 A;  4LF7 E;  4DV4 E;  3P1X A;  4WPY A;  4LF6 E;  2K7I A;  2EMB A;  2UUC E;  4Q28 A;  4DR5 E;  3J80 C;  3MHH C;  3J81 C;  2RSI A;  1GQE A;  5FLX C;  2ODR D;  1SR9 A;  2EN6 A;  4BHC A;  4BMJ A;  2EM4 A;  2ADR A;  2JY9 A;  2MC6 A;  1UN6 B;  2BBG A;  1JK1 A;  2L2K B;  2ZM6 E;  3T1H E;  3OTO E;  1XMO E;  3EPH A;  1HNW E;  4RH8 A;  3C6K A;  4MLQ A;  4NHR A;  4GZN C;  5IT9 C;  2L3C A;  2EPO A;  5LL6 R;  1EH6 A;  2DGC A;  4LFC E;  4NXN E;  4O43 A;  2UXC E;  4JI3 E;  2EM2 A;  4F2J C;  4R2Q A;  4ZYE A;  2DLQ A;  5A6K A;  4HEI A;  3HQ1 A;  1PDA A;  1YYW A;  4R2S A;  2I9I A;  2D9H A;  2NAB A;  2DMI A;  1X49 A;  3JAM C;  4DV2 E;  4DV0 E;  2KON A;  3F6H A;  1DQ3 A;  2ENH A;  1MGT A;  1X6H A;  4X9J A;  1JK2 A;  3C4T A;  4BC7 A;  2N8X A;  1YUI A;  1ZBQ A;  1T38 A;  4B3M E;  1XNQ E;  5KL3 A;  4ZYD A;  4LF5 E;  1A1F A;  2LVH A;  1A1K A;  2R1F A;  2B7V A;  2KHX A;  2JXP A;  2WBS A;  2DMY A;  1LLM C;  4I8O A;  3IWC A;  2EMA A;  2EMY A;  1DGC A;  2EN3 A;  2WBU A;  2EM9 A;  2YTJ A;  1XMQ E;  2N3H A;  2LJH A;  4O24 A;  2UXB E;  4M0V A;  2YTI A;  4BS9 A;  4J8Z A;  4LU9 A;  4R2C A;  2JWO A;  2RTX A;  3AV0 A;  2YT4 A;  2YTN A;  3VYY A;  2EOX A;  1YPN A;  4O4K A;  2EM3 A;  4WSP A;  1ZAA C;  2HGH A;  2LMZ A;  1IQS A;  3HPS A;  3C4B A;  2HC5 A;  1YYK A;  2VQE E;  2UXD E;  2LUP B;  1X6E A;  2V87 A;  3ECR A;  1YUJ A;  3T1Y E;  1N3G A;  2DB2 A;  2EN7 A;  2EPN A;  5KL6 A;  4BBY A;  4K0K E;  5LLQ A;  1F2I G;  2G7H A;  2LO3 A;  2VRD A;  2FV4 B;  1TF3 A;  4P78 A;  5ADZ A;  2YRK A;  2EN4 A;  1TF6 A;  2ENA A;  1YZ9 A;  1AAY A;  4X62 E;  2EOZ A;  1Z1B A;  4DR4 E;  1KYQ A;  2RSM A;  4M30 A;  4X64 E;  3K6Q A;  1RMD A;  4GEQ B;  3TQM A;  1STU A;  2CSH A;  4Q35 B;  1A1J A;  2EZ6 A;  2YTQ A;  1WRJ A;  2DLK A;  2EOY A;  2HHH E;  1X48 A;  4ZYG A;  2YSO A;  2EPX A;  2LV2 A;  2MDR A;  1P47 A;  2I13 A;  2EOI A;  2EQ3 A;  2EPC A;  1A1G A;  4DR6 E;  2JOB A;  5AE1 A;  2EN2 A;  2EPL X;  2MC5 A;  2PRT A;  2ENC A;  5A69 A;  3MSW A;  3EPL A;  4DV6 E;  4JI7 E;  1HR0 E;  1EH8 A;  2M7Q A;  1T4L B;  4JI0 E;  4JI6 E;  3JU0 A;  2NUF A;  3IWD A;  3BBG A;  4JV5 E;  4F9C B;  2JP9 A;  2WBT A;  4B3S E;  1T4O A;  2A25 A;  2FGG A;  4R03 A;  5A6A A;  1IBM E;  2L33 A;  3QG5 C;  1UBD C;  3ADG A;  3C6M A;  3IWB A;  4KZS A;  2V86 A;  3FIG A;  4WFT A;  1PJS A;  4F54 A;  4M9V C;  2EM0 A;  5AE2 A;  5CFF E;  2JOX A;  1PJT A;  2ELZ A;  1IMU A;  3MHS C;  4ZYH A;  4YHH E;  4DMI A;  2CPN A;  4MLV A;  2VE7 C;  5A6B D;  2UUA E;  1BBO A;  2VQF E;  2RQL A;  3UK3 C;  2RS6 A;  4IJD A;  1X3C A;  3EPJ A;  2L3J A;  5KL5 A;  2EE8 A;  1EKZ A;  4DR1 E;  4DV7 E;  5IXM B;  2EPA A;  4F9A B;  4DV3 E;  4FK5 C;  4L5N C;  1WHN A;  2YZT A;  2EPZ A;  4O5G A;  4JI4 E;  2CT1 A;  4R2D A;  3THO B;  2EOO A;  1GTK A;  2DSY A;  5AC4 A;  2V88 A;  3THN A;  2UUB E;  2F4V E;  1BBG A;  2GLI A;  2RPC A;  4JYA E;  3BID A;  2BB8 A;  4M2Z A;  2EMF A;  2EM5 A;  2EN8 A;  2YTD A;  3AUZ A;  4WXC A;  2EL4 A;  2EL6 A;  5IWA E;  3J7A G;  4X65 E;  2EMX A;  2LE2 A;  2EMZ A;  2GPI A;  4JI8 E;  3HTX A;  4R2P A;  4B3R E;  1L4S A;  2M1S A;  1EH7 A;  4WXD A;  2IHR 1;  5AAS A;  3ADL A;  5KL7 A;  2EOJ A;  4LF8 E;  2DIX A;  5A6J A;  1T4N A;  1J26 A;  2EMK A;  1HNZ E;  2L6M A;  4GKJ E;  4JI2 E;  4YY3 E;  2EPM X;  2EOF A;  4BCA A;  1IBK E;  3DJW A;  1A1I A;  5DNY A;  5A6B A;  1WJP A;  2B9D A;  2V85 A;  4OOG C;  4L8N A;  2HJJ A;  3M99 B;  4WSG A;  3F6G A;  4TUG A;  1FKA E;  4LTY A;  1YYO A;  2EMH A;  4DR7 E;  3ZOQ B;  2LRS A;  2DRP A;  2EOS A;  1N33 E;  2EWL A;  4DUY E;  4IS1 C;  2LTS A;  4R2E A;  4JI1 E;  3J7Y p;  2K4V A;  2YTE A;  4BHB A;  2CTD A;  4OX9 E;  4KHP E;  1SFE A;  1WXR A;  2EP3 A;  2YTO A;  2JR1 A;  2B3T B;  2L2N A;  4DR2 E;  2ODR C;  2YSP A;  2KOU A;  2EJ4 A;  2EOH A;  5KL2 A;  2N3G A;  2YPN A;  4X66 E;  1NEI A;  2JVA A;  2E1M A;  3DF6 A;  3OML A;  2JPA A;  1N32 E;  3HXL A;  2YWQ A;  5T6J A;  2R76 A;  1UIL A;  1PJQ A;  2EMW A;  1X5W A;  2L92 A;  2YRH A;  2UU9 E;  1GZ6 A;  3ADJ A;  5KL4 A;  2LT7 A;  2YTF A;  1QU6 A;  4F9B B;  2WZO A;  5A2Q C;  4B3T E;  5TSE A;  1I94 E;  2ELY A;  2E5L E;  2EPK X;  4TUI A;  4N4R B;  1G2D C;  2M9A A;  4WX9 A;  4NXM E;  1YSA C;  5AE3 A;  1T39 A;  4HTG A;  1IBL E;  1N36 E;  1IQO A;  2EPP A;  4R8O A;  3EQ1 A;  2LBS B;  4P7D A;  2J7J A;  2YU5 A;  2LJU A;  1G2F C;  1X47 A;  1XNR E;  3KZY A;  2V83 A;  1QNT A;  2EQ0 A;  3VYX A;  1RC7 A; 
#chains in the Genus database with same CATH homology
 2LUQ A;  2LE2 A;  5LL6 R;  4NXN E;  4LFC E;  1HNX E;  4JI8 E;  3HTX A;  3RMP A;  2UXC E;  4JI3 E;  3H09 A;  4B3R E;  2NUE A;  2M1S A;  2HHH E;  4LF9 E;  1X48 A;  2IHR 1;  5AAS A;  4DUZ E;  4LF4 E;  3ADL A;  4LF8 E;  2DIX A;  3HQ1 A;  1T4N A;  1J26 A;  1YYW A;  1HNZ E;  2L6M A;  4GKJ E;  4JI2 E;  4YY3 E;  2MDR A;  4LFA E;  3ADI A;  1X49 A;  4BCA A;  3JAM C;  4DV2 E;  1IBK E;  3DJW A;  5F3W A;  4DV0 E;  2KON A;  5DNY A;  2B9D A;  2V85 A;  4DR6 E;  3F6H A;  4OOG C;  1DQ3 A;  2JOB A;  4L8N A;  5BR8 E;  5AE1 A;  3F6G A;  4TUG A;  1FKA E;  2NA2 A;  2MC5 A;  4LTY A;  4X8W A;  1YYO A;  1J5E E;  4DR7 E;  3MSW A;  3ZOQ B;  2LRS A;  3C4T A;  4DV6 E;  1N33 E;  4JI7 E;  1HR0 E;  2EWL A;  4BC7 A;  4DUY E;  2LTS A;  4JI1 E;  2M7Q A;  1T4L B;  3J7Y p;  4JI0 E;  4JI6 E;  3JU0 A;  1ZBQ A;  4WYQ B;  2NUF A;  2K4V A;  3IWD A;  4B3M E;  1XNQ E;  1UHZ A;  4LF5 E;  4JV5 E;  4F9C B;  4DV1 E;  5LMU E;  1ZBT A;  2VF1 A;  1T4O A;  2FGG A;  4R03 A;  4B3S E;  4OX9 E;  4KHP E;  2RS7 A;  2B7V A;  2KHX A;  3HPZ A;  1WXR A;  2DMY A;  2JR1 A;  1IBM E;  2B3T B;  2L33 A;  2L2N A;  3ADG A;  4I8O A;  2ODR C;  3IWB A;  4DV5 E;  4DR2 E;  3IWC A;  4KZS A;  2V89 A;  2V86 A;  3FIG A;  2KOU A;  4WFT A;  4F54 A;  5LMN E;  1XMQ E;  2H36 X;  5AE2 A;  4DR3 E;  5CFF E;  2JOX A;  2N3G A;  4X66 E;  2FTX B;  2JVA A;  1WHQ A;  2B7T A;  3KWR A;  2M4I A;  4DMI A;  4YHH E;  2CPN A;  2E1M A;  2N3H A;  2VE7 C;  3DF6 A;  3JTZ A;  2LJH A;  3OML A;  1N32 E;  3HXL A;  2NUG A;  4GKK E;  5T6J A;  2UUA E;  4M0V A;  2UXB E;  2VQF E;  2LTR A;  1UIL A;  4J8Z A;  4BS9 A;  4LU9 A;  3LML A;  2JWO A;  2RTX A;  2RS6 A;  4LFB E;  1RQ0 A;  3AV0 A;  1O0W A;  3VK6 A;  2YT4 A;  2L92 A;  3VYY A;  2L3J A;  4AQY E;  2V8Q B;  3LLH A;  1DI2 A;  1EKZ A;  4DR1 E;  4DV7 E;  4WSP A;  1GZ6 A;  2UU9 E;  4DKK A;  4F9A B;  4JI5 E;  3ADJ A;  4DV3 E;  2LMZ A;  4L5N C;  3HPS A;  4BC9 A;  2F8B A;  1WHN A;  3C4B A;  2L2M A;  2L8T A;  1QU6 A;  1PKP A;  4F9B B;  2WZO A;  5A2Q C;  2YZT A;  4B3T E;  1N34 E;  1FJG E;  1YYK A;  2VQE E;  2UXD E;  2LUP B;  1I94 E;  2V87 A;  2E5L E;  4LF7 E;  4DV4 E;  3P1X A;  4WPY A;  4JI4 E;  4TUI A;  3T1Y E;  4LF6 E;  4NXM E;  2UUC E;  2DB2 A;  5AE3 A;  4Q28 A;  4DR5 E;  2DSY A;  3J80 C;  2V88 A;  4BBY A;  3J81 C;  1IBL E;  1GQE A;  2UUB E;  5FLX C;  4K0K E;  2ODR D;  1SR9 A;  2G7H A;  1N36 E;  2FV4 B;  2F4V E;  4R8O A;  4P78 A;  5ADZ A;  4JYA E;  4BMJ A;  1YZ9 A;  4M2Z A;  2JY9 A;  2MC6 A;  2LBS B;  4P7D A;  4X62 E;  2L2K B;  2ZM6 E;  3AUZ A;  3T1H E;  4DR4 E;  2RSM A;  5IWA E;  3OTO E;  4M30 A;  1XMO E;  4X64 E;  1X47 A;  3J7A G;  3K6Q A;  1XNR E;  1HNW E;  4GEQ B;  1STU A;  2V83 A;  2EZ6 A;  5IT9 C;  2L3C A;  4X65 E;  3VYX A;  1RC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...