3IWBA

T. maritima adometdc in processed form
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
55
structure length
55
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-adenosylmethionine decarboxylase
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 7
structure length 55
sequence length 55
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwbA00
3IWCA 3IWDA 3IWBA
chains in the Genus database with same CATH superfamily
2LV2A 4ZYHA 3C4BA 4BMJA 1UILA 2FTXB 2YTQA 4P7DA 1Z1BA 1DGCA 3J80C 1BBOA 4HTGA 2WBTA 2EOEA 2HC5A 3L00A 4JI1E 3BF2A 4DR6E 2EM7A 2EOYA 3F6HA 2L8TA 2RTXA 1IBKE 1STUA 1AAYA 4P78A 4B3ME 3ADJA 3EQ1A 1RC7A 1RQ0A 2EORA 1BB8A 2EMXA 2DSYA 3JU0A 1X49A 1A1LA 2A25A 2E5LE 2RSIA 4LFCE 1ZBQA 4WPYA 3JAMC 2YU8A 4IS1C 2YWQA 3KZZA 2K4VA 2H36X 3EPJA 4LF5E 2EM3A 2EZ6A 2EN8A 4DV6E 4IJDA 1XNRE 1X47A 3EPLA 2RS7A 4I8OA 2R1FA 2K7IA 1WHNA 1N33E 4WSPA 1GZ6A 1EH8A 2HJJA 1TN9A 2DIXA 2EMBA 2EP3A 4ZYDA 2N3HA 4DR1E 2JXPA 2EMIA 2V89A 1N36E 4R2SA 3ZOQB 2NUEA 1ZAAC 5IXMB 4LFAE 1T38A 4JI4E 3IWCA 2DB2A 2M7QA 4J8ZA 1IBLE 4DV0E 4JI3E 3BGHA 1A1FA 1A1JA 1PJSA 4DV1E 4JI6E 2N8XA 4TUIA 4OX9E 1X48A 4LU9A 4K0KE 3VK6A 2MKNA 4KHPE 4KWYA 3JTZA 1PDAA 3J81C 1T4LB 4DR3E 2I13A 4X66E 4O5GA 4TUGA 1GTKA 1LLMC 2UUAE 5KL7A 5AE2A 2DGCA 1WJPA 2LTRA 3OTOE 2LE2A 1A1KA 4GKKE 1X5WA 2EMCA 2UXCE 1XMOE 5AC5A 4R2AA 4B3TE 2EMYA 3HTXA 2EPRA 2L33A 5A6JA 3THOB 3QG5C 2CSHA 1YUIA 2F8BA 4O43A 4LF8E 2EL5A 4JI0E 4M9VC 4F9CB 2EMGA 3MHSC 1YPNA 2EPZA 2UU9E 2BB8A 1I94E 1G2DC 4GZNC 2LCEA 2ODRC 2MKDA 2MC6A 4DMIA 1XNQE 1YFHA 5LLQA 4BCAA 2EOOA 2WBUA 4F6MA 1TF6A 2YSOA 4MLVA 4X62E 4BC9A 2LRSA 4DUYE 4WSGA 2KONA 1QU6A 1PJTA 1T4NA 4YHHE 4F9AB 3IWBA 4F6NA 1YUJA 1IQSA 2LO3A 3BBGA 2EOXA 2EN7A 2V8QB 2EPLX 2EOMA 4R2CA 1J26A 2GHFA 3BIDA 1AH5A 2UXBE 4M2ZA 2EN6A 5LL6R 3ADLA 4R2PA 1ZR9A 1WXRA 1YSAC 3ECRA 2RQLA 1DQ3A 4X65E 2EJ4A 2FV4B 1ZBTA 4M0VA 4X9JA 2KHXA 2ELZA 2EN3A 4AQYE 2YTGA 4BHCA 2ADRA 4M30A 1KJKA 1RMDA 2DLKA 2LJUA 4YY3E 2EQ0A 2JPAA 1PJQA 4O4KA 1N32E 2LTSA 4R2QA 3M99B 4DUZE 2LUPB 2FGGA 2LT7A 3K6QA 3VYXA 2YPNA 1NCSA 4KZSA 5KL6A 2CT1A 2LUQA 4WXCA 5CFFE 5AE1A 1A1HA 4R2RA 2L6MA 4DV5E 1TF3A 2EMFA 1NEIA 2GLIA 3H09A 1O0WA 2EQ3A 2EOSA 4HEIA 2G7HA 2RPCA 2V83A 3OMLA 1F2IG 2EMWA 2YT4A 2MDGA 4F2JC 2LBSB 2PRTA 1ZU1A 2LVHA 2VQFE 2YTPA 2EM6A 2L2MA 1HR0E 5KL2A 2EPAA 2YTIA 2V87A 2DLQA 2KOUA 4BS9A 3UK3C 1YYWA 4JI5E 2EPMX 4LTYA 2BBGA 2YRKA 2B9DA 3MSWA 4R2DA 4LF4E 2B3TB 5KL3A 2UXDE 1BBGA 2MC5A 3KZYA 3MHHC 1FJGE 2EPOA 4DR2E 2V88A 2ODRD 1A1IA 1HNXE 1GQEA 2DMIA 3IWDA 4GKJE 5F3WA 1A1GA 2YU5A 2UUBE 2EPPA 1X6FA 1KYQA 2L3CA 2MDRA 4O24A 5IWAE 4BC7A 3AUZA 2RSMA 4GEQB 3T1HE 2JP9A 4Q35B 2EMAA 1IBME 2YTFA 2EOFA 4NXME 5ADZA 1SFEA 3VYYA 3RMPA 2B7VA 3LMLA 1JK2A 2JR1A 2DRPA 4BHBA 1PKPA 5KL5A 2JWOA 4OOGC 3HQ1A 1IMUA 2ENCA 1YYOA 2EN1A 4DV4E 4DR5E 1G2FC 2B7TA 4WFTA 4N4RB 2YTJA 4R2EA 4BBYA 5T6JA 2JOXA 2NA2A 2M4IA 4ZYGA 5AASA 4DV2E 2JYAA 3DF6A 4MLQA 4NXNE 2WZOA 2YZTA 2EM0A 2CTDA 2I9IA 3KWRA 3T1YE 1WHQA 2ENHA 4LFBE 2NUGA 4B3RE 4RH8A 2WCC3 2EPCA 2EOQA 2EMKA 4L5NC 2EPUA 1HNWE 2EPKX 2L3JA 4DR7E 2EM5A 2J7JA 2Q8UA 1UN6B 4WX9A 3LLHA 2EMZA 5A2QC 3J7AG 2EL4A 2EN4A 2EL6A 5LMUE 1J5EE 2LMZA 4R8OA 3EPHA 2JY9A 1MGTA 4LF7E 3HXLA 2EE8A 5A6AA 2L2NA 4DR4E 2V86A 2EMHA 2EM2A 5AE3A 5A6BA 2EWLA 4WXDA 4RHBB 1X6EA 2EQ1A 3ADGA 2VQEE 4NHRA 1YYKA 2YTOA 2HGHA 1FKAE 5LMNE 2EN2A 2EPXA 2EOHA 3P1XA 2RS6A 4L8NA 1XMQE 3AV0A 5TSEA 5KL4A 1N3GA 2CPNA 5IT9C 1WRJA 2EPNA 3C4TA 2YRHA 1DI2A 3EPKA 3C6KA 3C6MA 3DJWA 4X8WA 2E72A 2ELYA 1EKZA 2JVAA 1B69A 4JI7E 2E1MA 4R03A 2UUCE 2V85A 5IV8B 5A6BD 2VE7C 1JK1A 2N3GA 2YTDA 2HHHE 2EOJA 1UBDC 2YTEA 2WBSA 3ADIA 4JYAE 2EM4A 4JV5E 3TQMA 5DNYA 1SR9A 1EH7A 1X6HA 2EOZA 2F4VE 3VHTB 1L4SA 2L2KB 1P47A 4Q28A 1UHZA 4B3SE 4LF9E 4NZVA 4F9BB 2DMYA 2EMLA 4X64E 2ENAA 2VRDA 2YSPA 4FK5C 1QNTA 5FLXC 1EH6A 2NUFA 3F6GA 1N34E 4ZYEA 2D9HA 2VF1A 1HNZE 1YZ9A 3HPSA 1MEYC 1T39A 2M9AA 5A69A 2GPIA 5AC4A 4JI2E 2EM8A 4F54A 2ZM6E 1X3CA 4DKKA 2JOBA 4LF6E 2NABA 3J7Yp 4DV3E 5A6KA 1IQOA 3HPZA 4JI8E 2YRMA 4DV7E 2LJHA 2M1SA 3FIGA 5BR8E 1T4OA 2IHR1 2L92A 2EOIA 3THNA 2YTNA 2EM9A 2R76A 4WYQB
chains in the Genus database with same CATH topology
4JI5E 2EWLA 3HTXA 4LTYA 2L33A 3C4BA 2B9DA 4BMJA 1UILA 2F8BA 3ADGA 2FTXB 3MSWA 4P7DA 2VQEE 4LF4E 2B3TB 4LF8E 1YYKA 2UXDE 3J80C 1FKAE 4JI0E 2MC5A 5LMNE 1FJGE 4F9CB 4DR2E 2UU9E 4JI1E 4DR6E 2V88A 1I94E 2ODRD 3P1XA 2ODRC 2RS6A 3F6HA 4L8NA 2L8TA 2RTXA 3AV0A 1XMQE 1GQEA 2MC6A 4DMIA 1IBKE 1XNQE 1STUA 2CPNA 3IWDA 5IT9C 5F3WA 4P78A 4GKJE 4X62E 2UUBE 3C4TA 4BC9A 2LRSA 2L3CA 3ADJA 2MDRA 4DUYE 1RQ0A 1QU6A 2KONA 3AUZA 1T4NA 4BC7A 5IWAE 4F9AB 3IWBA 4YHHE 2RSMA 2DSYA 3JU0A 1X49A 4GEQB 2E5LE 3T1HE 2V8QB 1J26A 3DJWA 4X8WA 1ZBQA 4LFCE 1IBME 4WPYA 3JAMC 4M2ZA 1EKZA 2UXBE 4NXME 2JVAA 2K4VA 5ADZA 2H36X 4JI7E 4LF5E 2EZ6A 3VYYA 5LL6R 4DV6E 3ADLA 3RMPA 2B7VA 2E1MA 3LMLA 4R03A 2UUCE 2JR1A 3J7AG 1RC7A 2V85A 1YYWA 1XNRE 1X47A 1PKPA 2VE7C 2N3GA 2RS7A 1WXRA 2JWOA 4I8OA 4OOGC 2HHHE 3HQ1A 1DQ3A 1WHNA 4B3ME 1N33E 4WSPA 1GZ6A 4X65E 2FV4B 4DV4E 4DR5E 1YYOA 1ZBTA 2B7TA 4WFTA 3ADIA 4M0VA 4JYAE 1DI2A 2DIXA 2KHXA 2N3HA 4JV5E 4DR1E 4AQYE 2NUEA 4BBYA 5DNYA 1SR9A 5T6JA 2V89A 2JOXA 4M30A 2NA2A 2M4IA 2F4VE 4YY3E 1N36E 5AASA 2L2KB 4DV2E 1N32E 2LTSA 1UHZA 3DF6A 4Q28A 3ZOQB 4B3SE 4LF9E 2WZOA 4F9BB 2DMYA 4DUZE 4LFAE 2LUPB 4JI4E 3IWCA 2DB2A 2YZTA 2M7QA 4X64E 4J8ZA 2FGGA 3KWRA 5FLXC 3K6QA 3T1YE 3VYXA 1WHQA 3F6GA 1IBLE 1N34E 4DV0E 4KZSA 2NUFA 4JI3E 2NUGA 2VF1A 1HNZE 4NXNE 2LUQA 1YZ9A 4B3RE 3HPSA 5CFFE 5AE1A 4DV1E 2L6MA 4JI6E 4TUIA 4L5NC 4OX9E 4DV5E 1X48A 4LU9A 4K0KE 1HNWE 4LFBE 3H09A 1O0WA 3VK6A 2L3JA 4JI2E 4DR7E 4F54A 2ZM6E 3LLHA 4KHPE 3JTZA 4DKKA 5A2QC 3J81C 2G7HA 2JOBA 2V83A 3OMLA 4DR3E 1T4LB 2YT4A 4X66E 3J7Yp 4DV3E 2LBSB 4LF6E 4TUGA 2UUAE 5LMUE 2VQFE 1J5EE 2LMZA 4R8OA 3HPZA 5AE2A 4JI8E 2LTRA 1HNXE 3OTOE 4DV7E 2L2MA 2LE2A 1HR0E 2JY9A 2LJHA 4GKKE 2M1SA 3FIGA 3HXLA 5BR8E 1T4OA 4LF7E 2L2NA 2IHR1 2L92A 2V87A 1XMOE 2V86A 2KOUA 4DR4E 2UXCE 4BS9A 4BCAA 5AE3A 4B3TE 4WYQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWC A;  3IWD A;  3IWB A; 
#chains in the Genus database with same CATH topology
 2LV2 A;  4ZYH A;  3C4B A;  4BMJ A;  1UIL A;  2FTX B;  2YTQ A;  4P7D A;  1Z1B A;  1DGC A;  3J80 C;  1BBO A;  4HTG A;  2WBT A;  2EOE A;  2HC5 A;  3L00 A;  4JI1 E;  3BF2 A;  4DR6 E;  2EM7 A;  2EOY A;  3F6H A;  2L8T A;  2RTX A;  1IBK E;  1STU A;  1AAY A;  4P78 A;  4B3M E;  3ADJ A;  3EQ1 A;  1RC7 A;  1RQ0 A;  2EOR A;  1BB8 A;  2EMX A;  2DSY A;  3JU0 A;  1X49 A;  1A1L A;  2A25 A;  2E5L E;  2RSI A;  4LFC E;  1ZBQ A;  4WPY A;  3JAM C;  2YU8 A;  4IS1 C;  2YWQ A;  3KZZ A;  2K4V A;  2H36 X;  3EPJ A;  4LF5 E;  2EM3 A;  2EZ6 A;  2EN8 A;  4DV6 E;  4IJD A;  1XNR E;  1X47 A;  3EPL A;  2RS7 A;  4I8O A;  2R1F A;  2K7I A;  1WHN A;  1N33 E;  4WSP A;  1GZ6 A;  1EH8 A;  2HJJ A;  1TN9 A;  2DIX A;  2EMB A;  2EP3 A;  4ZYD A;  2N3H A;  4DR1 E;  2JXP A;  2EMI A;  2V89 A;  1N36 E;  4R2S A;  3ZOQ B;  2NUE A;  1ZAA C;  5IXM B;  4LFA E;  1T38 A;  4JI4 E;  3IWC A;  2DB2 A;  2M7Q A;  4J8Z A;  1IBL E;  4DV0 E;  4JI3 E;  3BGH A;  1A1F A;  1A1J A;  1PJS A;  4DV1 E;  4JI6 E;  2N8X A;  4TUI A;  4OX9 E;  1X48 A;  4LU9 A;  4K0K E;  3VK6 A;  2MKN A;  4KHP E;  4KWY A;  3JTZ A;  1PDA A;  3J81 C;  1T4L B;  4DR3 E;  2I13 A;  4X66 E;  4O5G A;  4TUG A;  1GTK A;  1LLM C;  2UUA E;  5KL7 A;  5AE2 A;  2DGC A;  1WJP A;  2LTR A;  3OTO E;  2LE2 A;  1A1K A;  4GKK E;  1X5W A;  2EMC A;  2UXC E;  1XMO E;  5AC5 A;  4R2A A;  4B3T E;  2EMY A;  3HTX A;  2EPR A;  2L33 A;  5A6J A;  3THO B;  3QG5 C;  2CSH A;  1YUI A;  2F8B A;  4O43 A;  4LF8 E;  2EL5 A;  4JI0 E;  4M9V C;  4F9C B;  2EMG A;  3MHS C;  1YPN A;  2EPZ A;  2UU9 E;  2BB8 A;  1I94 E;  1G2D C;  4GZN C;  2LCE A;  2ODR C;  2MKD A;  2MC6 A;  4DMI A;  1XNQ E;  1YFH A;  5LLQ A;  4BCA A;  2EOO A;  2WBU A;  4F6M A;  1TF6 A;  2YSO A;  4MLV A;  4X62 E;  4BC9 A;  2LRS A;  4DUY E;  4WSG A;  2KON A;  1QU6 A;  1PJT A;  1T4N A;  4YHH E;  4F9A B;  3IWB A;  4F6N A;  1YUJ A;  1IQS A;  2LO3 A;  3BBG A;  2EOX A;  2EN7 A;  2V8Q B;  2EPL X;  2EOM A;  4R2C A;  1J26 A;  2GHF A;  3BID A;  1AH5 A;  2UXB E;  4M2Z A;  2EN6 A;  5LL6 R;  3ADL A;  4R2P A;  1ZR9 A;  1WXR A;  1YSA C;  3ECR A;  2RQL A;  1DQ3 A;  4X65 E;  2EJ4 A;  2FV4 B;  1ZBT A;  4M0V A;  4X9J A;  2KHX A;  2ELZ A;  2EN3 A;  4AQY E;  2YTG A;  4BHC A;  2ADR A;  4M30 A;  1KJK A;  1RMD A;  2DLK A;  2LJU A;  4YY3 E;  2EQ0 A;  2JPA A;  1PJQ A;  4O4K A;  1N32 E;  2LTS A;  4R2Q A;  3M99 B;  4DUZ E;  2LUP B;  2FGG A;  2LT7 A;  3K6Q A;  3VYX A;  2YPN A;  1NCS A;  4KZS A;  5KL6 A;  2CT1 A;  2LUQ A;  4WXC A;  5CFF E;  5AE1 A;  1A1H A;  4R2R A;  2L6M A;  4DV5 E;  1TF3 A;  2EMF A;  1NEI A;  2GLI A;  3H09 A;  1O0W A;  2EQ3 A;  2EOS A;  4HEI A;  2G7H A;  2RPC A;  2V83 A;  3OML A;  1F2I G;  2EMW A;  2YT4 A;  2MDG A;  4F2J C;  2LBS B;  2PRT A;  1ZU1 A;  2LVH A;  2VQF E;  2YTP A;  2EM6 A;  2L2M A;  1HR0 E;  5KL2 A;  2EPA A;  2YTI A;  2V87 A;  2DLQ A;  2KOU A;  4BS9 A;  3UK3 C;  1YYW A;  4JI5 E;  2EPM X;  4LTY A;  2BBG A;  2YRK A;  2B9D A;  3MSW A;  4R2D A;  4LF4 E;  2B3T B;  5KL3 A;  2UXD E;  1BBG A;  2MC5 A;  3KZY A;  3MHH C;  1FJG E;  2EPO A;  4DR2 E;  2V88 A;  2ODR D;  1A1I A;  1HNX E;  1GQE A;  2DMI A;  3IWD A;  4GKJ E;  5F3W A;  1A1G A;  2YU5 A;  2UUB E;  2EPP A;  1X6F A;  1KYQ A;  2L3C A;  2MDR A;  4O24 A;  5IWA E;  4BC7 A;  3AUZ A;  2RSM A;  4GEQ B;  3T1H E;  2JP9 A;  4Q35 B;  2EMA A;  1IBM E;  2YTF A;  2EOF A;  4NXM E;  5ADZ A;  1SFE A;  3VYY A;  3RMP A;  2B7V A;  3LML A;  1JK2 A;  2JR1 A;  2DRP A;  4BHB A;  1PKP A;  5KL5 A;  2JWO A;  4OOG C;  3HQ1 A;  1IMU A;  2ENC A;  1YYO A;  2EN1 A;  4DV4 E;  4DR5 E;  1G2F C;  2B7T A;  4WFT A;  4N4R B;  2YTJ A;  4R2E A;  4BBY A;  5T6J A;  2JOX A;  2NA2 A;  2M4I A;  4ZYG A;  5AAS A;  4DV2 E;  2JYA A;  3DF6 A;  4MLQ A;  4NXN E;  2WZO A;  2YZT A;  2EM0 A;  2CTD A;  2I9I A;  3KWR A;  3T1Y E;  1WHQ A;  2ENH A;  4LFB E;  2NUG A;  4B3R E;  4RH8 A;  2WCC 3;  2EPC A;  2EOQ A;  2EMK A;  4L5N C;  2EPU A;  1HNW E;  2EPK X;  2L3J A;  4DR7 E;  2EM5 A;  2J7J A;  2Q8U A;  1UN6 B;  4WX9 A;  3LLH A;  2EMZ A;  5A2Q C;  3J7A G;  2EL4 A;  2EN4 A;  2EL6 A;  5LMU E;  1J5E E;  2LMZ A;  4R8O A;  3EPH A;  2JY9 A;  1MGT A;  4LF7 E;  3HXL A;  2EE8 A;  5A6A A;  2L2N A;  4DR4 E;  2V86 A;  2EMH A;  2EM2 A;  5AE3 A;  5A6B A;  2EWL A;  4WXD A;  4RHB B;  1X6E A;  2EQ1 A;  3ADG A;  2VQE E;  4NHR A;  1YYK A;  2YTO A;  2HGH A;  1FKA E;  5LMN E;  2EN2 A;  2EPX A;  2EOH A;  3P1X A;  2RS6 A;  4L8N A;  1XMQ E;  3AV0 A;  5TSE A;  5KL4 A;  1N3G A;  2CPN A;  5IT9 C;  1WRJ A;  2EPN A;  3C4T A;  2YRH A;  1DI2 A;  3EPK A;  3C6K A;  3C6M A;  3DJW A;  4X8W A;  2E72 A;  2ELY A;  1EKZ A;  2JVA A;  1B69 A;  4JI7 E;  2E1M A;  4R03 A;  2UUC E;  2V85 A;  5IV8 B;  5A6B D;  2VE7 C;  1JK1 A;  2N3G A;  2YTD A;  2HHH E;  2EOJ A;  1UBD C;  2YTE A;  2WBS A;  3ADI A;  4JYA E;  2EM4 A;  4JV5 E;  3TQM A;  5DNY A;  1SR9 A;  1EH7 A;  1X6H A;  2EOZ A;  2F4V E;  3VHT B;  1L4S A;  2L2K B;  1P47 A;  4Q28 A;  1UHZ A;  4B3S E;  4LF9 E;  4NZV A;  4F9B B;  2DMY A;  2EML A;  4X64 E;  2ENA A;  2VRD A;  2YSP A;  4FK5 C;  1QNT A;  5FLX C;  1EH6 A;  2NUF A;  3F6G A;  1N34 E;  4ZYE A;  2D9H A;  2VF1 A;  1HNZ E;  1YZ9 A;  3HPS A;  1MEY C;  1T39 A;  2M9A A;  5A69 A;  2GPI A;  5AC4 A;  4JI2 E;  2EM8 A;  4F54 A;  2ZM6 E;  1X3C A;  4DKK A;  2JOB A;  4LF6 E;  2NAB A;  3J7Y p;  4DV3 E;  5A6K A;  1IQO A;  3HPZ A;  4JI8 E;  2YRM A;  4DV7 E;  2LJH A;  2M1S A;  3FIG A;  5BR8 E;  1T4O A;  2IHR 1;  2L92 A;  2EOI A;  3THN A;  2YTN A;  2EM9 A;  2R76 A;  4WYQ B; 
#chains in the Genus database with same CATH homology
 4JI5 E;  2EWL A;  3HTX A;  4LTY A;  2L33 A;  3C4B A;  2B9D A;  4BMJ A;  1UIL A;  2F8B A;  3ADG A;  2FTX B;  3MSW A;  4P7D A;  2VQE E;  4LF4 E;  2B3T B;  4LF8 E;  1YYK A;  2UXD E;  3J80 C;  1FKA E;  4JI0 E;  2MC5 A;  5LMN E;  1FJG E;  4F9C B;  4DR2 E;  2UU9 E;  4JI1 E;  4DR6 E;  2V88 A;  1I94 E;  2ODR D;  3P1X A;  2ODR C;  2RS6 A;  3F6H A;  4L8N A;  2L8T A;  2RTX A;  3AV0 A;  1XMQ E;  1GQE A;  2MC6 A;  4DMI A;  1IBK E;  1XNQ E;  1STU A;  2CPN A;  3IWD A;  5IT9 C;  5F3W A;  4P78 A;  4GKJ E;  4X62 E;  2UUB E;  3C4T A;  4BC9 A;  2LRS A;  2L3C A;  3ADJ A;  2MDR A;  4DUY E;  1RQ0 A;  1QU6 A;  2KON A;  3AUZ A;  1T4N A;  4BC7 A;  5IWA E;  4F9A B;  3IWB A;  4YHH E;  2RSM A;  2DSY A;  3JU0 A;  1X49 A;  4GEQ B;  2E5L E;  3T1H E;  2V8Q B;  1J26 A;  3DJW A;  4X8W A;  1ZBQ A;  4LFC E;  1IBM E;  4WPY A;  3JAM C;  4M2Z A;  1EKZ A;  2UXB E;  4NXM E;  2JVA A;  2K4V A;  5ADZ A;  2H36 X;  4JI7 E;  4LF5 E;  2EZ6 A;  3VYY A;  5LL6 R;  4DV6 E;  3ADL A;  3RMP A;  2B7V A;  2E1M A;  3LML A;  4R03 A;  2UUC E;  2JR1 A;  3J7A G;  1RC7 A;  2V85 A;  1YYW A;  1XNR E;  1X47 A;  1PKP A;  2VE7 C;  2N3G A;  2RS7 A;  1WXR A;  2JWO A;  4I8O A;  4OOG C;  2HHH E;  3HQ1 A;  1DQ3 A;  1WHN A;  4B3M E;  1N33 E;  4WSP A;  1GZ6 A;  4X65 E;  2FV4 B;  4DV4 E;  4DR5 E;  1YYO A;  1ZBT A;  2B7T A;  4WFT A;  3ADI A;  4M0V A;  4JYA E;  1DI2 A;  2DIX A;  2KHX A;  2N3H A;  4JV5 E;  4DR1 E;  4AQY E;  2NUE A;  4BBY A;  5DNY A;  1SR9 A;  5T6J A;  2V89 A;  2JOX A;  4M30 A;  2NA2 A;  2M4I A;  2F4V E;  4YY3 E;  1N36 E;  5AAS A;  2L2K B;  4DV2 E;  1N32 E;  2LTS A;  1UHZ A;  3DF6 A;  4Q28 A;  3ZOQ B;  4B3S E;  4LF9 E;  2WZO A;  4F9B B;  2DMY A;  4DUZ E;  4LFA E;  2LUP B;  4JI4 E;  3IWC A;  2DB2 A;  2YZT A;  2M7Q A;  4X64 E;  4J8Z A;  2FGG A;  3KWR A;  5FLX C;  3K6Q A;  3T1Y E;  3VYX A;  1WHQ A;  3F6G A;  1IBL E;  1N34 E;  4DV0 E;  4KZS A;  2NUF A;  4JI3 E;  2NUG A;  2VF1 A;  1HNZ E;  4NXN E;  2LUQ A;  1YZ9 A;  4B3R E;  3HPS A;  5CFF E;  5AE1 A;  4DV1 E;  2L6M A;  4JI6 E;  4TUI A;  4L5N C;  4OX9 E;  4DV5 E;  1X48 A;  4LU9 A;  4K0K E;  1HNW E;  4LFB E;  3H09 A;  1O0W A;  3VK6 A;  2L3J A;  4JI2 E;  4DR7 E;  4F54 A;  2ZM6 E;  3LLH A;  4KHP E;  3JTZ A;  4DKK A;  5A2Q C;  3J81 C;  2G7H A;  2JOB A;  2V83 A;  3OML A;  4DR3 E;  1T4L B;  2YT4 A;  4X66 E;  3J7Y p;  4DV3 E;  2LBS B;  4LF6 E;  4TUG A;  2UUA E;  5LMU E;  2VQF E;  1J5E E;  2LMZ A;  4R8O A;  3HPZ A;  5AE2 A;  4JI8 E;  2LTR A;  1HNX E;  3OTO E;  4DV7 E;  2L2M A;  2LE2 A;  1HR0 E;  2JY9 A;  2LJH A;  4GKK E;  2M1S A;  3FIG A;  3HXL A;  5BR8 E;  1T4O A;  4LF7 E;  2L2N A;  2IHR 1;  2L92 A;  2V87 A;  1XMO E;  2V86 A;  2KOU A;  4DR4 E;  2UXC E;  4BS9 A;  4BCA A;  5AE3 A;  4B3T E;  4WYQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...