3IWBB

T. maritima adometdc in processed form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase
total genus 12
structure length 59
sequence length 59
chains with identical sequence D
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.110 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3iwbB00
3IWBB 3IWCB 3IWDB
chains in the Genus database with same CATH superfamily
4F3YA 2HO5A 1NWCA 1CRWG 4O89A 1I72B 1F06A 3KSZO 1VKNA 3OQBA 3WBBA 3JSAA 2XF8A 5A06A 2VYVA 3RC2A 2Q4EA 3K9QO 2GZ1A 3PYMA 3QY9A 3DZ4B 4YWJA 3VOSA 1C3VA 3MZ0A 3B20A 5C7OO 3BTSA 3GPDG 1T4DA 1DPGA 4XR4A 3NT2A 3TW3A 4GQAA 3E9MA 3V5NA 2PKRA 2YYYA 4AK1A 3DMTC 5J9GA 1DC6A 4R5MA 2AXQA 1RYDA 4MIOA 1RM4A 1NX6A 5EERA 2POQX 3DZ7B 4MJLA 3KV3O 4R5HA 3QVXA 3M2TA 3FHLA 1PQPA 3DB2A 3STHA 1SZJG 2NQTA 4GMFA 1ML3A 5JW6A 5M6DA 2I3GA 2PH5A 3E6AA 4PG6A 3C8MA 1NVMB 3DZ2B 1DSSG 5A03A 1E7YA 2OZPA 1YL5A 2DUUA 3INGA 5EIOA 1I33A 3BIOA 4L9RA 3EP8B 3OA2A 1QMIA 3KGDA 5C7LO 4H3VA 4XQGA 1DRUA 1PR3A 3OHSX 1LC3A 3KUXA 4CLQA 1QKIA 1GYQA 1TB4A 3DO5A 4KOAA 1K3TA 1EVJA 1NPTO 4PG7A 3V1YA 4WNIA 4MVJE 3TV1A 1TVEA 3EZYA 1ZNQO 3QVWA 4MVJM 3DTYA 3NTRA 1H6AA 3K73O 1Q7GA 2DPGA 3TUTA 3Q0EA 4FB5A 3TZ6A 1DC3A 5JYEA 1H6CA 4XRGA 1H93A 3EUWA 2I5PO 1E5LA 2X0NA 4XB2A 1MHMB 4MKZA 1A7KA 2GD1O 3ABIA 3L0DA 4INAA 3UW3A 3K2BA 4MIEA 3RC7A 1I7CB 3DR3A 4XB1A 3QVSA 3KSDO 1I32A 5DDIP 3RBVA 3ZCXA 3CINA 2X5KO 3E5RA 3O9ZA 1DBVO 1DIHA 3NTOA 3PZBA 4PG5A 3VAZA 3HJAA 4MVJD 5BNTA 3GNQA 2Q49A 4DPMA 1HDGO 3RVDA 3V2UA 4GMGA 1VC2A 5JYAA 5GZ6A 1YL7A 4HKTA 1JKIA 3GFGA 3PQVA 3FD8A 1Q2XA 3EPAB 2QZ9A 5TVOB 4MVJG 1P1IA 2VYVD 5GZ3A 4IQ0A 3DBVO 3EP5B 4R41A 1XYGA 5AVOA 5AQ1A 3UUWA 1OFGA 1MC4A 4XQCA 1NQ5A 2BH9A 1JENB 1VKOA 1GAEO 1JKFA 1NQOA 4L8VA 3CPSA 3B1KA 3PYLA 1J0XO 5A05A 2B4TO 3RC1A 4JN6B 3NTQA 3TUXA 3H0WB 1P1HA 4O63O 1RYEA 3EP3B 2EJWA 3C1AA 5A04A 4O8JA 3H9EO 4N54A 1NBOA 4R4JA 1JN0A 3WGQA 3LC2O 3LC1O 4DPLA 1IHYA 3EC7A 1DRVA 2CZCA 2VYNA 2IXBA 2FPNA 4DIBA 3IWCB 1DC4A 3PYXA 1GPDG 3L6OO 4QX6A 4MINA 4PG8A 1H2HA 3F4LA 4DBVO 1PQUA 5T73A 5CEFA 2O4UX 4BOYA 1I79B 1NQAO 4MVJF 1H6DA 3DZ6B 1BRMA 3WB9A 1LC0A 3Q2IA 2GLXA 1OBFO 2Q22A 2EP7A 1VM6A 1ARZA 1YL6A 4LSMA 1GR0A 3B1JA 1IHXA 2P2SA 3EVNA 1P9LA 3GDOA 3WGYA 5JY6A 1RM5A 1GL3A 1YS4A 2G82A 3NT5A 3QVTA 4MVJP 3DZ3B 2DBVO 4ZICA 5KVSA 3CMCO 4MVJI 5C7IO 3PWKA 1EBUA 1LA2A 5KVQA 1I7MB 1U1IA 2NVWA 1UYJA 1U8FO 3IDSA 4WNCA 4XQ9A 1EBFA 2IXAA 2R00A 3WGOA 4LGVA 4LRSB 3Q1LA 2R00C 1T4BA 4R54A 1H9AA 1ZH8A 4P8RA 1RM0A 4XQEA 3QV1A 5JYFA 1PS8A 4II7A 4K9DA 3H0VB 2BHLA 2G17A 3EPBB 4WOJA 3PZRA 1DC5A 5A02A 3WBFA 1GADO 1QMHA 3HNPA 3EP7B 3DMTA 5EINA 3WYBA 1OZAA 3NT4A 2EP5A 1E7MA 1VSUA 2PKQO 3MTJA 4Z0HO 4NHEA 1DRWA 1E77A 3HSKA 4O59O 3CIFA 3MOIA 3HXLA 2B4RO 5EESA 1RM3A 4R3WA 5GZ1A 1P1KA 4PLPA 1P1FA 3EP4B 3DAPA 3E82A 4RL6A 4LRTB 1J5PA 2DAPA 3E18A 3U3XA 4EW6A 1NWHA 3RCBA 2O48X 4HADA 4DPKA 4GPD1 1CF2O 1FF9A 2CVOA 2GZ2A 3Q11A 4MKXA 4YDRA 2GYYA 3L4SO 2I3AA 2D2IA 2GZ3A 3LVFO 1QXSA 1TA4A 3EP9B 3RC9A 3PWSA 1P1JA 3DOCA 4MVJH 2VYND 2DC1A 3BTVA 4MVJA 1PU2A 1I7BB 1TLTA 3PFWO 4ZHSA 2YV3A 3OA0A 1GCUA 2PKQP 4IQ8A 1YDWA 1XEAA 1YWGO 3LC7O 1CERA 1VSVA 4MIYA 3IP3A 1B7GO 3IWBB 1GD1O 1H6BA 3HQ4O 3CEAA 1E5QA 3IJPA 3ZJXA 1H94A 3ZDFA 2HJSA 2X5JO 3I23A 2H63A 1H9BA 4TVBA 4R3NA 3QW2A 2HKIA 4PG4A 1MB4A 1DAPA 1S7CA 3EP6B 3WYCA 1GYPA 3E1KA 3Q2KA 3WGZA 4R51A 3IWDB 3BTUA 3DZ5B
chains in the Genus database with same CATH topology
4F3YA 2HO5A 1NWCA 1CRWG 4O89A 1F06A 3KSZO 1VKNA 3OQBA 3WBBA 3JSAA 2XF8A 5A06A 2VYVA 3RC2A 2Q4EA 3K9QO 2GZ1A 3PYMA 3QY9A 4YWJA 3VOSA 1C3VA 3MZ0A 3B20A 5C7OO 3BTSA 3GPDG 1T4DA 1DPGA 3NT2A 3TW3A 4GQAA 3E9MA 3V5NA 2PKRA 2YYYA 4AK1A 3DMTC 5J9GA 1DC6A 4R5MA 2AXQA 1RYDA 4MIOA 1RM4A 1NX6A 5EERA 2POQX 4MJLA 3KV3O 4R5HA 3QVXA 3M2TA 3FHLA 1PQPA 3DB2A 3STHA 1SZJG 2NQTA 4GMFA 1ML3A 5JW6A 5M6DA 2I3GA 3E6AA 4PG6A 3C8MA 1NVMB 1DSSG 5A03A 1E7YA 2OZPA 1YL5A 2DUUA 3INGA 5EIOA 1I33A 3BIOA 4L9RA 3OA2A 1QMIA 3KGDA 5C7LO 4H3VA 1DRUA 1PR3A 3OHSX 1LC3A 3KUXA 4CLQA 1QKIA 1GYQA 1TB4A 3DO5A 4KOAA 1K3TA 1EVJA 1NPTO 4PG7A 3V1YA 4WNIA 4MVJE 3TV1A 1TVEA 3EZYA 1ZNQO 3QVWA 4MVJM 3DTYA 3NTRA 1H6AA 3K73O 1Q7GA 2DPGA 3TUTA 3Q0EA 4FB5A 3TZ6A 1DC3A 5JYEA 1H6CA 1H93A 3EUWA 2I5PO 1E5LA 2X0NA 4XB2A 4MKZA 1A7KA 2GD1O 3ABIA 3L0DA 4INAA 3UW3A 3K2BA 4MIEA 3RC7A 3DR3A 4XB1A 3QVSA 3KSDO 1I32A 5DDIP 3RBVA 3ZCXA 3CINA 2X5KO 3E5RA 3O9ZA 1DBVO 1DIHA 3NTOA 3PZBA 4PG5A 3VAZA 3HJAA 4MVJD 5BNTA 3GNQA 2Q49A 4DPMA 1HDGO 3RVDA 3V2UA 4GMGA 1VC2A 5JYAA 5GZ6A 1YL7A 4HKTA 1JKIA 3GFGA 3PQVA 3FD8A 1Q2XA 2QZ9A 4MVJG 1P1IA 2VYVD 5GZ3A 4IQ0A 3DBVO 4R41A 1XYGA 5AVOA 5AQ1A 3UUWA 1OFGA 1MC4A 1NQ5A 2BH9A 1VKOA 1GAEO 1JKFA 1NQOA 4L8VA 3CPSA 3B1KA 3PYLA 1J0XO 5A05A 2B4TO 3RC1A 4JN6B 3NTQA 3TUXA 1P1HA 4O63O 1RYEA 2EJWA 3C1AA 5A04A 4O8JA 3H9EO 4N54A 1NBOA 4R4JA 1JN0A 3WGQA 3LC2O 3LC1O 4DPLA 1IHYA 3EC7A 1DRVA 2CZCA 2VYNA 2IXBA 4DIBA 3IWCB 1DC4A 3PYXA 1GPDG 3L6OO 4QX6A 4MINA 4PG8A 1H2HA 3F4LA 4DBVO 1PQUA 5T73A 5CEFA 2O4UX 4BOYA 1NQAO 4MVJF 1H6DA 1BRMA 3WB9A 1LC0A 3Q2IA 2GLXA 1OBFO 2Q22A 2EP7A 1VM6A 1ARZA 1YL6A 4LSMA 1GR0A 3B1JA 1IHXA 2P2SA 3EVNA 1P9LA 3GDOA 3WGYA 5JY6A 1RM5A 1GL3A 1YS4A 2G82A 3NT5A 3QVTA 4MVJP 2DBVO 4ZICA 5KVSA 3CMCO 4MVJI 5C7IO 3PWKA 1EBUA 1LA2A 5KVQA 1U1IA 2NVWA 1UYJA 1U8FO 3IDSA 4WNCA 1EBFA 2IXAA 2R00A 3WGOA 4LGVA 4LRSB 3Q1LA 2R00C 1T4BA 4R54A 1H9AA 1ZH8A 4P8RA 1RM0A 3QV1A 5JYFA 1PS8A 4II7A 4K9DA 2BHLA 2G17A 4WOJA 3PZRA 1DC5A 5A02A 3WBFA 1GADO 1QMHA 3HNPA 3DMTA 5EINA 3WYBA 1OZAA 3NT4A 2EP5A 1E7MA 1VSUA 2PKQO 3MTJA 4Z0HO 4NHEA 1DRWA 1E77A 3HSKA 4O59O 3CIFA 3MOIA 3HXLA 2B4RO 5EESA 1RM3A 4R3WA 5GZ1A 1P1KA 1P1FA 3DAPA 3E82A 4RL6A 4LRTB 1J5PA 2DAPA 3E18A 3U3XA 4EW6A 1NWHA 3RCBA 2O48X 4HADA 4DPKA 4GPD1 1CF2O 1FF9A 2CVOA 2GZ2A 3Q11A 4MKXA 4YDRA 2GYYA 3L4SO 2I3AA 2D2IA 2GZ3A 3LVFO 1QXSA 1TA4A 3RC9A 3PWSA 1P1JA 3DOCA 4MVJH 2VYND 2DC1A 3BTVA 4MVJA 1PU2A 1TLTA 3PFWO 4ZHSA 2YV3A 3OA0A 1GCUA 2PKQP 4IQ8A 1YDWA 1XEAA 1YWGO 3LC7O 1CERA 1VSVA 4MIYA 3IP3A 1B7GO 3IWBB 1GD1O 1H6BA 3HQ4O 3CEAA 1E5QA 3IJPA 3ZJXA 1H94A 3ZDFA 2HJSA 2X5JO 3I23A 2H63A 1H9BA 4R3NA 3QW2A 2HKIA 4PG4A 1MB4A 1DAPA 1S7CA 3WYCA 1GYPA 3E1KA 3Q2KA 3WGZA 4R51A 3IWDB 3BTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWB B;  3IWC B;  3IWD B; 
#chains in the Genus database with same CATH topology
 4F3Y A;  2HO5 A;  1NWC A;  1CRW G;  4O89 A;  1I72 B;  1F06 A;  3KSZ O;  1VKN A;  3OQB A;  3WBB A;  3JSA A;  2XF8 A;  5A06 A;  2VYV A;  3RC2 A;  2Q4E A;  3K9Q O;  2GZ1 A;  3PYM A;  3QY9 A;  3DZ4 B;  4YWJ A;  3VOS A;  1C3V A;  3MZ0 A;  3B20 A;  5C7O O;  3BTS A;  3GPD G;  1T4D A;  1DPG A;  4XR4 A;  3NT2 A;  3TW3 A;  4GQA A;  3E9M A;  3V5N A;  2PKR A;  2YYY A;  4AK1 A;  3DMT C;  5J9G A;  1DC6 A;  4R5M A;  2AXQ A;  1RYD A;  4MIO A;  1RM4 A;  1NX6 A;  5EER A;  2POQ X;  3DZ7 B;  4MJL A;  3KV3 O;  4R5H A;  3QVX A;  3M2T A;  3FHL A;  1PQP A;  3DB2 A;  3STH A;  1SZJ G;  2NQT A;  4GMF A;  1ML3 A;  5JW6 A;  5M6D A;  2I3G A;  2PH5 A;  3E6A A;  4PG6 A;  3C8M A;  1NVM B;  3DZ2 B;  1DSS G;  5A03 A;  1E7Y A;  2OZP A;  1YL5 A;  2DUU A;  3ING A;  5EIO A;  1I33 A;  3BIO A;  4L9R A;  3EP8 B;  3OA2 A;  1QMI A;  3KGD A;  5C7L O;  4H3V A;  4XQG A;  1DRU A;  1PR3 A;  3OHS X;  1LC3 A;  3KUX A;  4CLQ A;  1QKI A;  1GYQ A;  1TB4 A;  3DO5 A;  4KOA A;  1K3T A;  1EVJ A;  1NPT O;  4PG7 A;  3V1Y A;  4WNI A;  4MVJ E;  3TV1 A;  1TVE A;  3EZY A;  1ZNQ O;  3QVW A;  4MVJ M;  3DTY A;  3NTR A;  1H6A A;  3K73 O;  1Q7G A;  2DPG A;  3TUT A;  3Q0E A;  4FB5 A;  3TZ6 A;  1DC3 A;  5JYE A;  1H6C A;  4XRG A;  1H93 A;  3EUW A;  2I5P O;  1E5L A;  2X0N A;  4XB2 A;  1MHM B;  4MKZ A;  1A7K A;  2GD1 O;  3ABI A;  3L0D A;  4INA A;  3UW3 A;  3K2B A;  4MIE A;  3RC7 A;  1I7C B;  3DR3 A;  4XB1 A;  3QVS A;  3KSD O;  1I32 A;  5DDI P;  3RBV A;  3ZCX A;  3CIN A;  2X5K O;  3E5R A;  3O9Z A;  1DBV O;  1DIH A;  3NTO A;  3PZB A;  4PG5 A;  3VAZ A;  3HJA A;  4MVJ D;  5BNT A;  3GNQ A;  2Q49 A;  4DPM A;  1HDG O;  3RVD A;  3V2U A;  4GMG A;  1VC2 A;  5JYA A;  5GZ6 A;  1YL7 A;  4HKT A;  1JKI A;  3GFG A;  3PQV A;  3FD8 A;  1Q2X A;  3EPA B;  2QZ9 A;  5TVO B;  4MVJ G;  1P1I A;  2VYV D;  5GZ3 A;  4IQ0 A;  3DBV O;  3EP5 B;  4R41 A;  1XYG A;  5AVO A;  5AQ1 A;  3UUW A;  1OFG A;  1MC4 A;  4XQC A;  1NQ5 A;  2BH9 A;  1JEN B;  1VKO A;  1GAE O;  1JKF A;  1NQO A;  4L8V A;  3CPS A;  3B1K A;  3PYL A;  1J0X O;  5A05 A;  2B4T O;  3RC1 A;  4JN6 B;  3NTQ A;  3TUX A;  3H0W B;  1P1H A;  4O63 O;  1RYE A;  3EP3 B;  2EJW A;  3C1A A;  5A04 A;  4O8J A;  3H9E O;  4N54 A;  1NBO A;  4R4J A;  1JN0 A;  3WGQ A;  3LC2 O;  3LC1 O;  4DPL A;  1IHY A;  3EC7 A;  1DRV A;  2CZC A;  2VYN A;  2IXB A;  2FPN A;  4DIB A;  3IWC B;  1DC4 A;  3PYX A;  1GPD G;  3L6O O;  4QX6 A;  4MIN A;  4PG8 A;  1H2H A;  3F4L A;  4DBV O;  1PQU A;  5T73 A;  5CEF A;  2O4U X;  4BOY A;  1I79 B;  1NQA O;  4MVJ F;  1H6D A;  3DZ6 B;  1BRM A;  3WB9 A;  1LC0 A;  3Q2I A;  2GLX A;  1OBF O;  2Q22 A;  2EP7 A;  1VM6 A;  1ARZ A;  1YL6 A;  4LSM A;  1GR0 A;  3B1J A;  1IHX A;  2P2S A;  3EVN A;  1P9L A;  3GDO A;  3WGY A;  5JY6 A;  1RM5 A;  1GL3 A;  1YS4 A;  2G82 A;  3NT5 A;  3QVT A;  4MVJ P;  3DZ3 B;  2DBV O;  4ZIC A;  5KVS A;  3CMC O;  4MVJ I;  5C7I O;  3PWK A;  1EBU A;  1LA2 A;  5KVQ A;  1I7M B;  1U1I A;  2NVW A;  1UYJ A;  1U8F O;  3IDS A;  4WNC A;  4XQ9 A;  1EBF A;  2IXA A;  2R00 A;  3WGO A;  4LGV A;  4LRS B;  3Q1L A;  2R00 C;  1T4B A;  4R54 A;  1H9A A;  1ZH8 A;  4P8R A;  1RM0 A;  4XQE A;  3QV1 A;  5JYF A;  1PS8 A;  4II7 A;  4K9D A;  3H0V B;  2BHL A;  2G17 A;  3EPB B;  4WOJ A;  3PZR A;  1DC5 A;  5A02 A;  3WBF A;  1GAD O;  1QMH A;  3HNP A;  3EP7 B;  3DMT A;  5EIN A;  3WYB A;  1OZA A;  3NT4 A;  2EP5 A;  1E7M A;  1VSU A;  2PKQ O;  3MTJ A;  4Z0H O;  4NHE A;  1DRW A;  1E77 A;  3HSK A;  4O59 O;  3CIF A;  3MOI A;  3HXL A;  2B4R O;  5EES A;  1RM3 A;  4R3W A;  5GZ1 A;  1P1K A;  4PLP A;  1P1F A;  3EP4 B;  3DAP A;  3E82 A;  4RL6 A;  4LRT B;  1J5P A;  2DAP A;  3E18 A;  3U3X A;  4EW6 A;  1NWH A;  3RCB A;  2O48 X;  4HAD A;  4DPK A;  4GPD 1;  1CF2 O;  1FF9 A;  2CVO A;  2GZ2 A;  3Q11 A;  4MKX A;  4YDR A;  2GYY A;  3L4S O;  2I3A A;  2D2I A;  2GZ3 A;  3LVF O;  1QXS A;  1TA4 A;  3EP9 B;  3RC9 A;  3PWS A;  1P1J A;  3DOC A;  4MVJ H;  2VYN D;  2DC1 A;  3BTV A;  4MVJ A;  1PU2 A;  1I7B B;  1TLT A;  3PFW O;  4ZHS A;  2YV3 A;  3OA0 A;  1GCU A;  2PKQ P;  4IQ8 A;  1YDW A;  1XEA A;  1YWG O;  3LC7 O;  1CER A;  1VSV A;  4MIY A;  3IP3 A;  1B7G O;  3IWB B;  1GD1 O;  1H6B A;  3HQ4 O;  3CEA A;  1E5Q A;  3IJP A;  3ZJX A;  1H94 A;  3ZDF A;  2HJS A;  2X5J O;  3I23 A;  2H63 A;  1H9B A;  4TVB A;  4R3N A;  3QW2 A;  2HKI A;  4PG4 A;  1MB4 A;  1DAP A;  1S7C A;  3EP6 B;  3WYC A;  1GYP A;  3E1K A;  3Q2K A;  3WGZ A;  4R51 A;  3IWD B;  3BTU A;  3DZ5 B; 
#chains in the Genus database with same CATH homology
 4F3Y A;  2HO5 A;  1NWC A;  1CRW G;  4O89 A;  1F06 A;  3KSZ O;  1VKN A;  3OQB A;  3WBB A;  3JSA A;  2XF8 A;  5A06 A;  2VYV A;  3RC2 A;  2Q4E A;  3K9Q O;  2GZ1 A;  3PYM A;  3QY9 A;  4YWJ A;  3VOS A;  1C3V A;  3MZ0 A;  3B20 A;  5C7O O;  3BTS A;  3GPD G;  1T4D A;  1DPG A;  3NT2 A;  3TW3 A;  4GQA A;  3E9M A;  3V5N A;  2PKR A;  2YYY A;  4AK1 A;  3DMT C;  5J9G A;  1DC6 A;  4R5M A;  2AXQ A;  1RYD A;  4MIO A;  1RM4 A;  1NX6 A;  5EER A;  2POQ X;  4MJL A;  3KV3 O;  4R5H A;  3QVX A;  3M2T A;  3FHL A;  1PQP A;  3DB2 A;  3STH A;  1SZJ G;  2NQT A;  4GMF A;  1ML3 A;  5JW6 A;  5M6D A;  2I3G A;  3E6A A;  4PG6 A;  3C8M A;  1NVM B;  1DSS G;  5A03 A;  1E7Y A;  2OZP A;  1YL5 A;  2DUU A;  3ING A;  5EIO A;  1I33 A;  3BIO A;  4L9R A;  3OA2 A;  1QMI A;  3KGD A;  5C7L O;  4H3V A;  1DRU A;  1PR3 A;  3OHS X;  1LC3 A;  3KUX A;  4CLQ A;  1QKI A;  1GYQ A;  1TB4 A;  3DO5 A;  4KOA A;  1K3T A;  1EVJ A;  1NPT O;  4PG7 A;  3V1Y A;  4WNI A;  4MVJ E;  3TV1 A;  1TVE A;  3EZY A;  1ZNQ O;  3QVW A;  4MVJ M;  3DTY A;  3NTR A;  1H6A A;  3K73 O;  1Q7G A;  2DPG A;  3TUT A;  3Q0E A;  4FB5 A;  3TZ6 A;  1DC3 A;  5JYE A;  1H6C A;  1H93 A;  3EUW A;  2I5P O;  1E5L A;  2X0N A;  4XB2 A;  4MKZ A;  1A7K A;  2GD1 O;  3ABI A;  3L0D A;  4INA A;  3UW3 A;  3K2B A;  4MIE A;  3RC7 A;  3DR3 A;  4XB1 A;  3QVS A;  3KSD O;  1I32 A;  5DDI P;  3RBV A;  3ZCX A;  3CIN A;  2X5K O;  3E5R A;  3O9Z A;  1DBV O;  1DIH A;  3NTO A;  3PZB A;  4PG5 A;  3VAZ A;  3HJA A;  4MVJ D;  5BNT A;  3GNQ A;  2Q49 A;  4DPM A;  1HDG O;  3RVD A;  3V2U A;  4GMG A;  1VC2 A;  5JYA A;  5GZ6 A;  1YL7 A;  4HKT A;  1JKI A;  3GFG A;  3PQV A;  3FD8 A;  1Q2X A;  2QZ9 A;  4MVJ G;  1P1I A;  2VYV D;  5GZ3 A;  4IQ0 A;  3DBV O;  4R41 A;  1XYG A;  5AVO A;  5AQ1 A;  3UUW A;  1OFG A;  1MC4 A;  1NQ5 A;  2BH9 A;  1VKO A;  1GAE O;  1JKF A;  1NQO A;  4L8V A;  3CPS A;  3B1K A;  3PYL A;  1J0X O;  5A05 A;  2B4T O;  3RC1 A;  4JN6 B;  3NTQ A;  3TUX A;  1P1H A;  4O63 O;  1RYE A;  2EJW A;  3C1A A;  5A04 A;  4O8J A;  3H9E O;  4N54 A;  1NBO A;  4R4J A;  1JN0 A;  3WGQ A;  3LC2 O;  3LC1 O;  4DPL A;  1IHY A;  3EC7 A;  1DRV A;  2CZC A;  2VYN A;  2IXB A;  4DIB A;  3IWC B;  1DC4 A;  3PYX A;  1GPD G;  3L6O O;  4QX6 A;  4MIN A;  4PG8 A;  1H2H A;  3F4L A;  4DBV O;  1PQU A;  5T73 A;  5CEF A;  2O4U X;  4BOY A;  1NQA O;  4MVJ F;  1H6D A;  1BRM A;  3WB9 A;  1LC0 A;  3Q2I A;  2GLX A;  1OBF O;  2Q22 A;  2EP7 A;  1VM6 A;  1ARZ A;  1YL6 A;  4LSM A;  1GR0 A;  3B1J A;  1IHX A;  2P2S A;  3EVN A;  1P9L A;  3GDO A;  3WGY A;  5JY6 A;  1RM5 A;  1GL3 A;  1YS4 A;  2G82 A;  3NT5 A;  3QVT A;  4MVJ P;  2DBV O;  4ZIC A;  5KVS A;  3CMC O;  4MVJ I;  5C7I O;  3PWK A;  1EBU A;  1LA2 A;  5KVQ A;  1U1I A;  2NVW A;  1UYJ A;  1U8F O;  3IDS A;  4WNC A;  1EBF A;  2IXA A;  2R00 A;  3WGO A;  4LGV A;  4LRS B;  3Q1L A;  2R00 C;  1T4B A;  4R54 A;  1H9A A;  1ZH8 A;  4P8R A;  1RM0 A;  3QV1 A;  5JYF A;  1PS8 A;  4II7 A;  4K9D A;  2BHL A;  2G17 A;  4WOJ A;  3PZR A;  1DC5 A;  5A02 A;  3WBF A;  1GAD O;  1QMH A;  3HNP A;  3DMT A;  5EIN A;  3WYB A;  1OZA A;  3NT4 A;  2EP5 A;  1E7M A;  1VSU A;  2PKQ O;  3MTJ A;  4Z0H O;  4NHE A;  1DRW A;  1E77 A;  3HSK A;  4O59 O;  3CIF A;  3MOI A;  3HXL A;  2B4R O;  5EES A;  1RM3 A;  4R3W A;  5GZ1 A;  1P1K A;  1P1F A;  3DAP A;  3E82 A;  4RL6 A;  4LRT B;  1J5P A;  2DAP A;  3E18 A;  3U3X A;  4EW6 A;  1NWH A;  3RCB A;  2O48 X;  4HAD A;  4DPK A;  4GPD 1;  1CF2 O;  1FF9 A;  2CVO A;  2GZ2 A;  3Q11 A;  4MKX A;  4YDR A;  2GYY A;  3L4S O;  2I3A A;  2D2I A;  2GZ3 A;  3LVF O;  1QXS A;  1TA4 A;  3RC9 A;  3PWS A;  1P1J A;  3DOC A;  4MVJ H;  2VYN D;  2DC1 A;  3BTV A;  4MVJ A;  1PU2 A;  1TLT A;  3PFW O;  4ZHS A;  2YV3 A;  3OA0 A;  1GCU A;  2PKQ P;  4IQ8 A;  1YDW A;  1XEA A;  1YWG O;  3LC7 O;  1CER A;  1VSV A;  4MIY A;  3IP3 A;  1B7G O;  3IWB B;  1GD1 O;  1H6B A;  3HQ4 O;  3CEA A;  1E5Q A;  3IJP A;  3ZJX A;  1H94 A;  3ZDF A;  2HJS A;  2X5J O;  3I23 A;  2H63 A;  1H9B A;  4R3N A;  3QW2 A;  2HKI A;  4PG4 A;  1MB4 A;  1DAP A;  1S7C A;  3WYC A;  1GYP A;  3E1K A;  3Q2K A;  3WGZ A;  4R51 A;  3IWD B;  3BTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...