3IWLA

Crystal structure of cisplatin bound to a human copper chaperone (monomer)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
b'PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Crystal structures of cisplatin bound to a human copper chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 19
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iwlA00
3BR8A 1RJJA 3HHLC 1FVQA 3HX9A 4HI1A 4A47A 3TOQA 2W4PA 1FVSA 5B0BA 2AW0A 3FMBA 3WDOA 2XMMA 2LQ9A 1ULRA 2RSQA 1FE4A 1TUVA 2OAUA 1X0PA 5B0CA 2ACYA 2PGCA 1APSA 2IYGA 5F0UA 1W2IA 1S6UA 1FESA 3HDSA 2LDIA 2FHMA 1AFIA 1FE0A 1SB6A 1FD8A 3CJKB 3FGVA 1Q8BA 1MWZA 1N5VA 2BBEA 4HH1A 2QIFA 1CC7A 4Q2LA 3HFKA 3UDCA 1OPZA 1TL4A 5T7LB 1GXUA 4QOTA 2ROPA 2OFGX 2GGPB 5B08A 2RMLA 1XBWA 3HHLB 2AJ1A 2XMVA 3KKFA 3QGPA 3TRGA 3CJKA 5IXUA 3VTIA 1X8DA 2CRLA 2AJ0A 2BJEA 3BN7A 5B09A 2LXFA 2BJDA 1LQ9A 2ROGA 2W4DA 5T7LA 1TZ0A 1AFJA 2IFXA 2VV5A 1JWWA 2GGPA 3LGMA 3HHLA 5B0AA 1YJVA 1P8GA 2W4CA 1SI9A 2FTRA 2XMTA 2GA7A 1AW0A 2K7KA 1IUJA 2XMKA 1YJUA 3F44A 1Y0HA 2K1RB 3BB5A 1N5SA 2HLUA 3HHLD 1JK9B 1Q4RA 2ASYA 1FEEA 1QUPA 2OKQA 2RU9A 1V3ZA 2ZDPA 3IWLA 1GXTA 2KYZA 1K0VA 2RILA 1TL5A 2K1RA 4YEAA 2ZDOA 3KNGA 3FRYA 4OIXA 2IYIA 1OQ3A 3TNVA 2OD4A 1Y3KA 3LO3A 1R6YA 2KKHA 2Q3PA 2XMWA 4OJ1A 4Q2MA 4Y2IA 4HI2A 4EFAC 3QMQA 1CPZA 1WD6A 2HIQA 3K7RA 5KAKA 4OJHA 2EW9A 1YJTA 2KT3A 2PD1A 3DCAA 5B0FA 1X7VA 3MCSA 4DN9A 1Y3JA 2LQBA 2L3MA 2GCFA 2KT2A 1P6TA 1YRXA 4A48A 2XMJA 2N4DA 3LGNA 4ZOSA 1KQKA 3DXSX 2K2PA 1VQYA 2QLWA 1U7LA 3I9ZA 5F0WA 5B0EA 2GFFA 5A6WA 2OD6A 4NL5A 3BF4A 2N4CA 1YJRA 2AP6A 1Y9OA 2XMUA 3BGUA 4DPOA 5A6PA 2JDJA 3E8OA 2K7JA 2HLTA 3HF5A 1MWYA 2ROEA 2QLXA 4A46A 1CC8A 1Q53A 2HQIA 3BDEA 3IWXA 2QYCA 2FIUA 4NPOA 1YG0A 2G9OA 2GV1A 3BM7A 4ZA1A 2GO8A 1KVJA 1N5QA 4U9RA 4Y2MA 3T9NA 4YDXA 2OP5A 1VQSA 2OFHX 2OMOA 2N7YA 1OSDA 1URRA 5B0DA 3KG1A 2BUNA 1TR0A 2HFOA 3MZIA 2FB0A 4FNIA 4F67A 4FNHA 4OJGA 5B0GA 2VH7A 1KVIA 2BYCA 3GZ7A 1N5TA 4HL9A 4DL0C 4A4JA 1Q8LA 4Y2KA 2HFNA 4HH0A 5K9FA 1SQEA 3KG0A 1S6OA 1OQ6A 4OJ3A
chains in the Genus database with same CATH superfamily
1RT6A 5DJBA 2YWHA 2EC2A 3I87A 2H51B 3ENVA 2RT3A 2DT9A 3MEGB 2NQPA 3UFCX 3UDCA 4LVNP 1J27A 4DOZA 1X9MA 1RLCL 3AJ2A 2BJEA 4TY8B 4C98A 1XIQA 1B64A 4RW7A 2E5JA 1TTHB 5KFNA 2DGSA 1FRXA 3ZZYA 2BRKA 3O8WA 4DBQA 2MKYA 4M5DA 1V5VA 2XMWA 2XI3A 4LFBJ 2RVJA 4QWAA 5B0FA 2CJKA 3KNAA 1E6YB 1N6QA 4H4KA 4IH5A 2AD9A 1HHQA 3RB6A 2MKCA 4ID8A 4KT0C 2HZCA 1YG0A 1S7HA 1CULA 5GMKa 1RHJB 2KL8A 4K4UA 4OZJA 1QD1A 3RRKA 5AJ3J 1HLWA 2VFTA 3MM9A 2HIYA 1S6OA 1WEZA 4DQPA 1FRLA 2CQHA 1LWEB 4PUOB 1DY3A 2V94A 5CCMA 1FNOA 3O5TB 4W92B 1T3NA 3DLKB 2R2RA 2X3GA 2CQ0A 4DG1B 2MQQA 2PIIA 2ZH6A 1BQXA 1T9VA 3CJKA 2RS8A 2B8PA 1CSJA 2BW2A 2ZBRA 1N33F 5KOWA 1Y0HA 2FHJD 3MPYA 2U2FA 2RILA 1WI6A 3KDNA 3DLGA 1R3NA 3O2IA 3P45B 1ACMB 2QA2A 4PZVA 3SCIE 3PYEA 1RACB 5KG4A 4CCHA 4IR1A 1UVMA 3ETOA 4GRSA 2ZH7A 5K8OA 2MQMA 3UCZP 4C8LA 3VZHA 5J1NA 3G4SS 3BBBA 1SCJB 5ADZA 1U1RA 3MZIA 2MLYA 2J8SA 1X4EA 5D3GA 2W7OA 2DH9A 3V6DB 2P6SA 1WC0A 3S7RA 1O6XA 2MTLA 2RRNA 4OYZA 2P9CA 3D67A 4USVA 3C19A 3MI7X 3CCUS 2AIRB 1DAXA 3NMRA 1T03A 1RHRB 1M5SA 4ZVFA 1Y5NB 4X65J 1D1UA 4ID5A 3ADAC 1NBEB 3OD2A 1BD6A 2ZH8A 3EXCX 3KKFA 2PDAA 1YX2A 1RTIB 3AD7C 4OHXA 4OV6A 5KTQA 1IXKA 4GKJF 3RJMB 1WWHA 4MKYA 3B6BA 1TQLA 4AYBD 1IR2A 1JLGB 2RE1A 4PKDB 3IWNC 2CZVC 1KTVA 2YKQA 5EHHA 2XZTB 3K5PA 1EETA 2PMHA 3UR0A 4QYZJ 5E33A 3DGPB 2RQ4A 2ZD1B 6FDRA 3SCJE 5J2QA 3H2VE 2F65A 4NPOA 4HYKA 3I32A 3BM7A 4ED8A 3J80U 2XM3A 3MEDB 2VJUA 2F9JA 2RKIB 2CWKA 5U47A 1S4FA 1V9OA 4HVZA 2I9SA 2WW8A 4PCQA 4NLDA 4K5SA 3QIPB 3K89A 1FD2A 3CCTA 3V4MA 1MWZA 2P5VA 1R0BG 2JOQA 5FD1A 5HJXA 4U7UK 1UWBA 1YHQS 2B8QA 2XSJA 1HPZB 4HEA9 4I1TA 1IJFB 4NASA 1N0UA 1NNDA 4OFZA 2B4PA 1B0TA 3AB4B 4QU6A 1F9EB 2DNKA 1U1KA 4ZKAA 1MG7A 2W9BA 3MCOA 4EFAC 3VGVA 1FRJA 2PD1A 2G0CA 4ECVA 4U7UD 3R6GB 5KFGA 2EBGA 4FF2A 2GMHA 1TAQA 5CZVA 2F7VA 4OYMA 3J7YI 1RT4A 1VHIA 2FZKB 3OW2R 4Y2MA 1VQ9S 3UCUP 3V2UC 1URRA 3B54A 1R8BA 2Z58B 3AAWB 3UDLA 4HL9A 5J1EA 4DS4A 1WHWA 4I6AA 3HHLC 2W2MP 4U95A 4DQRA 4LFAJ 3M2VA 4O4RA 1MROA 2W1BA 2ZHBA 3KLFB 1H2VZ 1RAJA 3M8QB 5CHCB 1JJ4A 3M2UB 2QN6B 2HHQA 1VQ7S 1DTQB 2XHCA 3H2UB 4ITSA 3TANA 4M5NA 2Q79A 3Q23A 3M7VA 2VASA 2J7UA 5LSOA 1NZAA 1RSCA 3DRPB 2R7WA 4UF4A 1W7WA 3EPIA 2B9EA 3QWUA 3IR6B 4J7CA 1CLFA 2YWWA 3KMSA 1NB2A 4DSEA 2A6OA 1XMQJ 2YBVA 3BGRA 4IDKA 3GFXA 3DYAB 4KFBB 3OR1B 2DNZA 4J9SA 2Y0BB 1UA1A 3A3OB 1H7WA 6AT1B 2IA0A 1W2BR 2DRBA 2JFDA 4QR0A 3OFHA 1RT3B 4C11A 3NGUA 1NJYA 4ZN1A 3MF5A 5KFJA 3ZXWA 1D9AA 2YKPA 1FVQA 3FK4A 3MR2A 1ULRA 4I7FB 3DI6B 4PQUB 5F0UA 2AEFA 1NU4A 2BJ1A 4TQRA 2UXBF 3VVTA 1NEEA 3N4WA 4AE5A 1B70B 2IFXA 3R7NB 3UN3A 4KAIA 3PJXA 2F8EX 3VQTA 4IRKA 2FY8A 3NG8A 5HROA 5J2NA 3DM2A 1SC1B 4QYRA 3DLEB 2YNFA 4DLEA 1RKIA 2MGZA 2A18A 3W63A 1C2PA 3FMWA 1S10A 1TFWA 1D9DA 3GR1A 1GH8A 3UVJB 1XJWB 2VJVA 1ICEB 2QX0A 2WZ1A 4RW6A 3PX4A 3D1HA 4E0DA 1F6TA 3TUZC 4LIWA 2XYPB 3HSDA 2OP5A 4DL4A 4ZVQB 1TP7A 2ZVIA 4B9NA 1TMJA 3FJ2A 2AX1A 2P8IA 2HFNA 1QE1B 4PG7A 4ECTA 2PI4A 1KFSA 1NAQA 4F50A 3BO3A 3FQKA 3VAKA 4XK8C 3VAJA 2B9YA 1UZHA 2PSZA 2M8HA 2XZWA 3PR5B 1VQ4S 2XI2A 1HWIA 1S1WB 1JLAA 3MPVA 2DNGA 2QL9B 3W2VA 4ZVUB 1S1UB 1HD0A 3PZPA 2MQLA 1VRTA 3KG4A 1DLOB 3UI3A 1QDUB 5E3QA 2GHVC 4OHVA 2ASJA 3NGSA 3FRYA 2CJYB 1N5YA 2RQCA 1NDKA 2YPZA 4RW9B 3L09A 2KT2A 2K2PA 2JEFA 2AJ2A 2KYXA 3W2WB 4AXIA 4KC5A 3FNNA 2HG4A 4FF1A 3JSMA 3NGDA 4BBYA 1RHUB 1YSJA 2HFOA 4LQ9A 2YNIA 3HSJA 1S1XB 2JEIA 3VGUA 3R5CA 4I0WA 3OBIA 4NYPA 4PG6A 1KSPA 4C8OA 4X62F 2GQ2A 1R43A 3RW6A 1ZZFA 1UWAA 3GJRB 3TZZA 4EZ9A 4ZPWR 1WG5A 2MZTA 1VHFA 2AGOA 4G6VB 3OL6A 5THWA 3UWTA 4PG4A 3JAMY 4UUWA 1RU2A 3QMQA 1WD6A 1SL0A 1WOOA 1TKDA 1X7VA 3QBCA 1RKJA 4ZCIA 4GC7A 1TMMA 4TN2A 4ZP6A 4UOFA 4DR1F 2HLTA 3RB0A 1T9WA 1RBAA 3IM9A 1L3SA 2CPFA 1VK3A 1K1QA 4N47A 3DGVA 2H3EB 3T19A 2SXLA 4IFVB 1Q8LA 1S0VA 1AZSB 3DRRA 2AMCB 3P6YC 3H5XA 3NRBA 1NDPA 1XQIA 4HI1A 1KR4A 2XYHB 1H98A 4FVCA 2RB7A 3FCHA 4FF3A 4L72B 1HBUA 3ZTRA 3Q8VA 2ATLA 1UVJA 5H9EJ 4P73A 2MZQA 2FJWA 4JV5F 4GMKA 2KH9A 3C6UB 4B9TA 4C4WA 2DB1A 4CLSA 4ECXA 1GMWA 1P8GA 3OUYA 1L3KA 4ZVTB 4JUZA 3AXKA 2G4BA 4R0EA 4JV2A 3MECB 4FKYA 2UU9F 4HACA 1IBKJ 4DV4J 4NXNF 2I5JB 4K5RA 5C42B 1KWMA 4CYUB 3I9V9 5F41A 3CCLS 1IKXB 3HK2A 5GMDA 4C8MA 2BZ2A 1R7IA 1Q95G 3JTOA 5IWAF 2BMBA 2RHSB 1FTRA 4K4YA 1EZZB 1LW2A 5I42B 3VQSA 5AXMA 1CS4A 2G9OA 3BSOA 2OFHX 1RT7A 2HVIA 3HP6A 1IKVB 3HHKA 4CQ1A 3H40A 5C7PA 3W1YC 3KLHB 1JLFB 2Y9HA 1GX5A 1P27B 1AFIA 3G82A 1H6KX 2OFGX 4YB1P 1X8DA 2NPIA 3QATA 3FDSA 1G7CB 2LQ5A 1GMUA 4CLWA 1X4GA 3EWGA 3W64A 3ZZRA 3BO2A 3T6JA 3R1HA 2FLNA 3TAMA 3K0JA 5C2GA 3N01A 4DUZF 4Y2IA 1RTJB 3C14B 2B4VA 2WAQD 4ZJQA 5KT6A 1FI4A 3BYPA 4PABA 2ZJPQ 3ZZOA 2XY5A 2CPJA 4OYAA 3A8KA 3DDNA 1SJQA 2OEMA 1QSSA 4NLWA 3MM5A 1KVJA 5ETPA 3H98A 5KFKA 4O3NA 3MM8A 5HMWA 1WNEA 1R27B 2C3PA 5KG0A 1X31C 3G96A 3VF0B 5FLXU 4G1IA 3I0SB 1K47A 2EG2A 2ZOGA 3GPAA 2IA6A 4QBUA 2BJ9A 1J5OB 5DM7Q 2LEBA 1VJQA 1UETA 4Q0BB 3MM6A 4RR5A 4QW8A 1N56A 4I2PB 2PMWA 1GTEA 1UW9A 1FXRA 2EFPA 2MY8A 4JI3F 3KLGA 2E5LF 4Y2AA 2YNGB 2DEJA 2BE2B 2CPXA 4IO1A 2AHOB 3POTB 2E1AA 1UVKA 2MB0B 1RWMB 4BC9A 1NZ8A 4WP3A 1FX4A 3DCAA 3EE3A 1CJVA 4G1QB 3NCQA 4C8YA 3KK2A 3EICA 4HLBA 1RYSA 4PYDA 3CCWA 4CLUA 4LQ3A 2G1DA 2Y8WA 1R89A 1ZPVA 2DO4A 3QRRA 5GVQA 1VC6A 3QAEA 4OZLA 1RA7A 3MGJA 3JSRA 4J9QA 1YJNS 3PCOB 2OPPA 2Y1JA 4C3KA 4D3GA 5J2PB 1FE0A 4NLTA 3E51A 1Y5LB 4KGMA 4FBUA 2CPIA 3C15A 1UFLA 4ANDA 2CIMA 1RHQB 4DR7J 3SMZA 2IHR1 1EKRA 2V8PA 1Z4UA 4A8WA 2V0NA 1R8AA 3MMCA 3MMBB 4DR1J 5G0RA 2XSFA 2IAJA 4V19J 1MSWD 1UPPA 4DX7A 5FDLB 4WIQA 4OJ1A 3S8SA 5K5MA 3D2WA 2ALYB 2WB1D 5G4DA 2LQBA 2BACA 5DLGA 5E3CA 3OQ2A 5DRKA 4DPOA 2HHUA 1HBNB 1KEKA 2XCPA 5IOLA 2VZ9A 3NNCA 3V5RA 2GMLA 4ZCLA 2AYMA 4U9RA 3O1LA 2VHGA 1R0CB 3TJ8A 1XEZA 4PXCA 4JV5J 2LFVA 3FQLA 2RRBA 1AT1B 1NUEA 4HR2A 1S49A 1UMJA 4UTGA 3BGLA 5E5NA 1NJIT 4P52A 1RT1A 2DNQA 2JFKA 1C0TA 4OQJA 2CQPA 3D0HE 1OO0B 5C5JA 2FHMA 2UU9J 1TL4A 4NXNJ 1C1BA 2IJNA 3QGPA 2OI2A 2V63A 4ZPAA 3V6HA 2W4DA 3UD5A 5E2QA 5EUHA 5CQGA 4RLEA 3LGMA 2HZAA 2R7UA 3T5JA 4DXLA 4BC7A 5HVGA 4KKOA 1VQMS 4O4GB 1F5BA 1L3TA 2ZDOA 5KFXA 2XMAA 2WW4A 1JLQA 4FKXA 2KVQE 3TX0A 5IQ6A 4JI2J 2N4DA 3M1VA 2LECA 4MFBB 1JJ2R 2RS2A 4TU7A 1X4BA 5KFAA 3LW5C 1OY8A 3OXFA 5LMNF 2R2SA 3RG6A 1YZ7A 2WTFA 3V81B 2QTWA 1LXJA 3SDEB 1JB0C 3Q24A 3PX6A 2WONB 2UP1A 4TLRA 1EP4B 3N9UC 1UVIA 5MLCV 1HQEB 1RCXB 4OHWA 1QSLA 4IQMA 2D9OA 3KLIB 2FY1A 1S57A 3HHLA 4ZPCA 2XMTA 2ASDA 1WKLA 1VRUA 3MR7A 5HQLA 2CQGA 2YKMA 2CQBA 5GAEI 1KC8T 1K0VA 2CQIA 1UEUA 2D69A 4DR4F 2DD8S 1OQ3A 1KNZA 3G6XA 2JLGA 1NDLA 1U1MA 2MLZA 4ER8A 3DRYA 3KHGA 3MDFA 3IBWA 1U7LA 5KT7A 3AJDA 2HNYA 3M6UA 3GV5B 2BDPA 3BDEA 1HYSB 3OXGA 4A8SA 9RUBA 1S1VB 1LWFB 1S5ZA 1V5IB 2ZNZA 1REGX 2XY6A 2X1GA 5GAHI 1IKYB 2MJNA 2FJVA 1KFDA 3K5MA 4B3RF 3TQEA 2XMMA 3BN4A 4IKAA 4JI3J 4HTIA 3CJ8A 3TWZA 5KFIA 1WHYA 2H4WB 5A8KB 2KXHA 3BPDA 4CO4A 2CRLA 3Q8RB 2OPSB 4GO5X 1XC9A 3GQCA 3T5LA 4OX9F 3CC7S 2XMKA 1AB8A 2J8AA 4OI2A 1E6VB 1YLXA 1VJWA 3M05A 1S6QB 4ZMMA 4ZVEA 1LW0A 2FJBB 5ETMA 1CJKA 1VISA 2YNHA 4CTAA 4FVMA 1BQMA 1HWUA 4WP9A 2KI2A 4PAAA 1NO8A 2I0XA 4ZP9A 4MMOA 3H5UA 5A6WA 4ED3A 3RYLA 4AUKA 1FX2A 1FKOB 3EVOA 5I3QA 1Y11A 5IT0A 1LWCB 2O3DA 2HZVA 1UKUA 1T05A 2CQDA 5CAAA 2R8KA 1F5CA 4J9PA 5DLFA 4YS2A 1I1GA 1F3FA 1REVB 3CJ3A 3B8HA 2YWEA 2MZJA 2JVRA 3U7JA 3BKTA 4PWUA 4K2XA 2YPYA 2NS1B 1S9FA 1TKTB 3HVWA 1FD8A 4WWSA 3FGVA 3BKFA 1TV6B 1RI7A 4F8RA 1GMVA 4GVBA 3EM1A 3TRGA 1W25A 1HL6A 3KLEA 2VG6A 4USMA 1U0HB 2FTRA 1VIOA 3LALA 1OPIA 3FEXB 1MNEA 4ES2A 1DTTB 1RT2A 1QUPA 2D3OR 3HD1A 3C46A 3TNVA 2BE7D 4OI3A 1KQFB 4LRBA 1KLMA 5D78A 3RTVA 1HBMB 2UUBJ 1RT5A 1IWGA 3IBCB 4CM0A 2I38A 4LSZB 2HEKA 1S77D 4Y2CA 4F0KA 1S9EB 1G4CA 4JI4F 4BHQA 5DO2A 3EVWA 3F0NA 5HLFB 1Q8IA 3Q8UA 2B6AA 3MR5A 1GEHA 2PA3A 5HATA 3BBCA 1N5TA 1WC5A 3ISZA 4A4JA 4AL7A 3CJSA 3IP0A 1T9YA 3ISND 4NLOA 2DGWA 3EVMA 4OV1A 2RDIA 5KFBA 1JNRB 4QWCA 4P2FA 3MAQA 4LF6F 1PBUA 3H0PA 2DR5A 2RQKA 1JNZB 4X4TA 4DV0F 3CD0A 2FUG9 4L3NA 2FHJA 1QVGR 5F9LA 2GJIA 3PHEA 5A0YB 1KQGB 4WJBA 5LSLA 3A12A 4YP3A 2GS8A 1FEEA 4TYAA 1VQNS 1N34F 5IC6B 4XPCA 4RNMA 3GJTB 3OTOJ 1C1CB 2HHHF 1T9TA 3NLCA 3N5FA 2KKHA 2H4YB 3HHEA 4URSA 2KZZA 2GVZA 3T9ZA 3VWSA 1NJZA 1NHVA 4OI4A 3PHTA 3H8YA 2A2DA 3LP2B 5JMNA 3A1YG 3IG1A 3E8OA 4LSNB 2OGUA 1YI2S 2KHCA 1UJ4A 2QGFB 3CE8A 3Q2TC 1F5AA 3FFIB 2FZGB 1TK5A 5IT4A 1RWNB 1RT6B 2XGPA 4R0JA 4R5PA 3KG0A 3RAQA 2VBWA 1DRZA 4JI1F 4DL3A 5CYMA 5IM0B 1KD1T 4DSIA 4C48A 3OR2A 3PRVA 4DR4J 3PW7A 2C28A 5F8NA 4RW7B 2K3KA 2BJDA 4PXBA 4P75A 2IVFB 1YJ7A 4ED7A 1D09B 1S48A 3M6VA 5B7WA 3W9HA 4LF5J 2DHAA 2IDLA 2WHOA 4M5DB 4F7VA 1BUXA 4Q7AA 3GLJA 3CJ2A 3QFWA 2XNRA 3JQJA 4P10A 4OJHA 3SYZA 1N6QB 5KT3A 3LPEA 1TAUA 2PEHA 3NOGA 3IRWP 2CVEA 3KJFB 2XS2A 3L4BC 5A6PA 1KOHA 2K7JA 5J1PA 4DFJA 1YRTA 3QFHA 1CULB 4OZ5A 2DNMA 3CDBA 1PIEA 4MJKA 3R7SB 2EXUA 3M9NB 1TUWA 1H73A 3MM9B 4L6V3 2HNZA 2CPYA 4O44A 1KVIA 2EI5A 3CGIA 4B02A 4K50A 3BS9A 3OTEA 2ZH5A 4GKKF 2IDEA 2FZCB 3AOCA 2MEWA 3CJKB 2ZJQQ 2VKZG 2MMYA 2Z57B 2O01C 1YIJS 2MDAA 2GIQA 1NH8A 3JAMU 1YBAA 3IR7B 2E7VA 2C2EA 2C3YA 3SXLA 4B3OA 2QC3A 3DLGB 2B7BB 2F1FA 4OI1A 4HKQA 4QWEA 2AT1B 2HRYA 7AT1B 2Z2ZA 1H3DA 4KYZA 4IR9A 4NXMJ 1LOUA 4KE5A 2FJAB 1WDDA 5KAKA 4OMFG 2BKNA 4PWDA 3G6YA 5EDWA 3PO5A 3J80Y 4WFZA 2K8GA 3M6XA 2W9CA 2P9GA 2KJWA 2M0GB 4IOBA 4G65A 3O6QA 5GADU 5D3GB 4B9VA 3FCVA 2YKNA 4DQSA 3D3BJ 2IM2A 3BJYA 3D68A 3ZZTA 2LQ8A 2KM8B 2CYYA 3D1QA 1T03B 3OPKA 3SV3A 5K8MA 4ID5B 3GFHA 2QLJB 2MHNA 3HDSA 2JH3A 1M90T 1WI8A 3IAS9 3DLHA 1GXUA 1KQSR 2HVHA 3ZTQA 1EAYC 4EYIB 3QZ7A 4IG0A 4ED5A 4NI2B 1FJEB 2HBRB 4QR2A 3BB5A 3NS5A 4IQXA 3R5JB 2DH8A 3GONA 3G86A 3P49B 5HJYA 4JI4J 2W24A 2D3UA 1WC4A 2PN6A 3S1TA 3B4MA 3IRXA 3MCSA 1EETB 4A8QA 5J2QB 1HNWF 3NAIA 3DXBA 1VYAA 2JLEA 3GJQB 4M94A 3HZEA 2QJ3A 2WBMA 2DISA 1HMVA 2U1AA 1P9QC 2VODA 3TW0A 4JI8F 3MCNA 4HH0A 4IO9Q 3OLAA 3RBEA 3CD6S 4K7QA 4O3QA 4A47A 1UJ5A 4FYVB 4F4WA 3HKZD 1FRIA 4A8FA 1RTDA 2OPQA 5L1LA 4ILMA 2RQMA 3RRHA 5IXUA 1HA1A 5D0RA 3VAMA 1Q8KA 2W9BB 2VKRA 2E1MC 1HNVA 1VLOA 1X5SA 2YQ3A 3PRDA 3U27A 1R6YA 2XS7A 4QIEA 2HHVA 4JV1A 2OJ3A 2ZITA 1QSYA 4BS2A 2Z2YB 2HQ3A 4YY3F 2IM3A 3VAGA 5GAGU 2AX0A 1RT4B 2DR9A 1KHVA 2ZOFA 3ILIA 2HVZA 4WBFA 2PA8D 1ZETA 1HI0P 3FSIA 4IRCA 4HDGA 4J37A 5K8NA 5J1EB 4F67A 4RWXA 4ILRA 2JX2A 3M2VB 3ZFVA 4AQYJ 2XO7A 1MROB 1RHKB 3DXSX 3EYZA 5D77A 3OVSA 3N79A 4KGVB 2ZWOA 3I4HX 2GO9A 2LDIA 2JC0A 3WIUA 1HWJA 5EWEA 1Q8BA 2ZBQA 1WDTA 1EQMA 2C2KB 2UV8G 4DN0A 2A6MA 2ROPA 1NK9A 3LANA 4DQIA 1LQ9A 1U45A 2P9EA 5DG7A 3LF0A 4FS1A 2CADA 2E1RA 4RWWA 3ZZPA 4HT7A 2EPIA 5D4OA 3BYRA 1DHMA 3MEEB 4DV2F 3W3SA 2PFFB 4N77A 4OIXA 1FWLA 4DUYF 1LV5A 4J9UE 3HVTA 3NL0A 3OFEA 4DV3F 3I96A 3ET6A 3BGRB 4IDKB 4N7TA 2HAIA 3HULA 3ISNC 3AODA 3PEJA 1LK7A 2AYEA 3SFUA 5KFPA 3F56A 2G2YA 3PW5A 5T41A 2LA4A 1ZM2A 4C11B 4W98A 4EWTA 1BWVA 3LP0A 5CD4A 1MLAA 1U4BA 3I0RA 2OIHA 2M3DA 2HQGA 5L8RC 2J7WA 1WTFA 2KB2A 5ETOA 1G3OA 1U1OA 3T1YJ 3CWJA 4LBIA 2QIFA 3K5NA 2AQ4A 4N8OA 1SJ3P 5ETTA 4AD6A 4MK9A 4JI6F 5B09A 3CDEA 3RBZA 2CQ2A 1UPMB 5ETSA 1IM6A 3V6DA 3FZBA 4JI5F 3D9BA 5HROB 5J2NB 3DM2B 3D5MA 1WKKA 1N36F 2BRLA 3BBFA 2YNFB 1SJ1A 2MGZB 3D54A 2VOPA 2UVWA 2WBRA 5KFDA 4PG8A 4UT4A 3TYTA 2CG8A 4OHZA 1VIXA 3QRQA 2RDDA 2YWGA 4RW6B 2AP6A 5KFFA 3CJTA 1HIYA 2KXFA 2OH2A 4HTJA 3OTBA 4JI7J 4ETXA 3U1NA 2JC1A 4WIIA 4F3OA 3M4XA 3EZ5A 4ETZA 1FO1A 3FSXA 4EUVA 5KFOA 1OQ6A 1C4CA 3IFEA 2ZH3A 3IS9B 3BQ1A 1MU2A 1W2IA 1FJ7A 1JLAB 3TEGA 4HH1A 3W2VB 4JV0A 3MEDA 4I67A 1U6FA 2OMLA 4CRJA 1RBLA 3H4BA 1VRTB 5A8RA 3QWPA 2W2PP 1OMSA 1KVKA 2HLUA 2EG1A 1N5YB 3MD1A 5GAGI 1HNWJ 3K5LA 2K1RA 1SH2A 3N28A 2GVDA 2GHPA 4CM2A 2W7AA 2LU1A 2E29A 4KGXB 3HFZB 2FYXA 5JJBA 3UCGA 3OJUA 2XMJA 2HSEB 5HAOA 1CJUA 3JSMB 3MCMA 4JI8J 2CPEA 1DARA 1PJ5A 4F4YA 4DR3J 1OSCA 1WC3A 2R7SA 3I4PA 4TVAB 3PV8A 1QLNA 2JLFA 2YNIB 4ZN3A 2YX1A 3KUEA 1Q81T 1UP1A 1JJHA 2H5JB 2XGQA 2V4JA 3TVZA 1S12A 3NWRA 5AJ3F 1HI8A 5JVGQ 4RBTA 4J9OA 5L46A 3QPIA 1Y5IB 1RK8A 3HLUA 4NEYA 3ZZZA 4MYTA 3BR9A 1N88A 3CCES 4NLQA 2LYVA 4DV1F 3QSIA 2DO0A 3AA8A 2VA3A 3A8IA 3L7PA 3EUNA 2FHKA 1Q4RA 4YY3J 4EO8A 2DGVA 4X4PA 3NWGA 3QQCD 3UNGC 2E9ZA 2QMWA 3M2UA 5M2UA 1DTQA 1RAAB 2UUWA 2DR7A 4KBIA 2L3MA 2H65B 4FXVA 4DS5A 4YB7A 2CJ9A 4X2BA 3HF5A 1ZTWA 3DOKB 4UOCA 1RAFB 3IWXA 3TAPA 4L3KA 3E01A 2CDRB 3J81j 5BYRA 4QYZK 3D0IE 4EYHB 2C2DA 2N7YA 2GC8A 2EVZA 1GX6A 5LSRA 4C9DA 4ERDA 3EDRB 3GIIA 2ALZA 4LR7A 1HBUB 1PCAA 2L9WA 4I6WA 5EWFA 4AFFA 3ELHA 1S6UA 1X5TA 1Z2ZA 4X65F 4DV2J 5E7OB 2WVDA 3OUYB 4OYXA 3N6LA 4EMDA 1SI9A 4DV3J 5D0GA 4HACB 3HPOA 1GXTA 2XEXA 3UPFA 1IBMJ 1WSVA 2HW3A 3VZIA 4FPRA 3OV7A 1XK8A 1NLKL 3G2XA 1SV5A 5K20B 2VPXB 2DGQA 2B7CB 1EX8A 4RJVA 3RZAA 1LW2B 4RW8A 1Y9OA 4R8UA 3OVBA 2P2CB 2AYGA 3ZZUA 5HQ8A 1RT7B 3DLEA 4G1PA 2YX7A 3CCJS 7FDRA 1N48A 5FLXY 1OS5A 2DGTA 5L1KA 1U1QA 3V4IA 3IN5A 2VH7A 5L9NA 4JI6J 3G6VA 4JI5J 1BY9A 1TUVA 2OLWA 2F63A 3G82B 3WIVA 3JS9A 3CMAS 3GYGA 1O5JA 1KLNA 4OLPA 3ITHB 2DNYA 2HGMA 4YB5A 1AFJA 1GK8A 1IWAA 3U1MA 4FF4A 4B17A 2R7VA 1QE1A 3JYTA 2VPWB 1SKSA 3TAMB 3GIMA 3P8BB 2D1CA 5KG5A 5DDOC 2YY3A 2BQUA 2L41A 2CJXB 1WEYA 4ZVHA 2HWTA 2LMIA 4EBDA 4Y6IA 2J0WA 3MEKA 2M7SA 1RUSA 1KQKA 4K4TA 1DLOA 4ECWA 1VGYA 5IV4A 1Q16B 3MM5B 2J7KA 2QYCA 3MM8B 2QLBB 3X3UA 3VALA 4RW9A 5ETVA 1SJRA 2OO4A 1MN9A 3CTRA 2CJAA 1U49A 4C0BA 4ES1A 4LFAF 2V9WA 3MM6B 1FE4A 3AXMA 5KFYA 2DJWA 1CC7A 5AE3A 1FCAA 2V50A 2DBBA 3KLGB 4X84A 4CO3A 2B9WA 5K14A 2EKNA 3KHRA 4LVOP 1FFWB 3C6TA 1U09A 5CABA 4DSJA 3NMAA 1JLBA 3FUYA 2N82B 2RF2A 1H72C 3W60A 5LT5A 3GV8B 4ZCMA 2OEJA 4I6YA 3Q89A 1CJVB 1XMQF 3KK2B 5KFVA 4B3SF 1U1PA 1T9UA 2AU0A 4F02A 1UL3A 5I3PA 3J7YU 2R42A 2BM1A 4WYLA 2GO8A 3BGOP 2QSWA 4C0OC 1P1TA 4KV8B 2FB0A 3QYYA 2UUCJ 2OPPB 4DV1J 3M8PA 1QY7A 2CQCA 1M5HA 2C1EB 3EMTA 1UW4A 4IG3B 2QV6A 2E1PA 4I68A 2DHHA 4DFMA 1DJ0A 2JZ5A 3UNYA 2B5JA 2HWIA 3CDWA 3NCRA 2FC8A 4W90B 5CCLA 2L9NA 3TVKA 2C3MA 1FEHA 3MMCB 5KT2A 5G0RB 4XAKA 1QUVA 2HGNA 4PQAA 1T0TV 3TEHB 4Z37A 1IKWA 2DVIA 3M30A 3CJRA 1N4LA 4X66F 1RDRA 3CIZA 4WK1A 2VG5A 3ZO7A 2QLWA 1MMNA 3HT0A 4TLQA 2QA4S 4DV7F 2MJUA 3EGWB 2B0GA 3DLJA 3E2EA 2V8GA 4M5JA 3Q8QB 1RB0A 4CH1A 2HAFA 3I56S 2UXDJ 2C2RA 3VCDA 4ES3A 2GHWA 2VG7A 2DHSA 1VOMA 2OELA 4LT6A 1TKZA 3T1HJ 1G6BA 1RT1B 1C0TB 4RUBA 1IVZA 2PGCA 4WU2A 1C1BB 4S0MA 5KG6A 3PYGA 3DRSA 2YXLA 4ED1A 1I94F 2NXJA 2V2ZA 3CB4A 5HMXA 4KQZA 4KKOB 2W4CA 3CO9A 4ZLNA 3DHWC 3N5BA 1L3UA 2CFXA 3B4DA 4ICLA 2VPYB 1JLQB 4ECUA 2C42A 3J7A1 2BX6A 1N32F 3QO9A 4TQSA 5KFQA 1FT8A 4CI0B 2EFVA 3M1VB 2WB4A 3T5KA 2CNOB 1NMEB 2V8VA 3R5BA 1N0VC 2PE8A 3I9ZA 4CLFA 2QYGA 2LVWA 1H38A 3GFYA 1T7PA 4MYUA 1VC5A 1FK9B 1U48A 1HNIA 3IGNA 3AOAA 1U8WA 1UEKA 1WKJA 2V9KA 4TNOA 3UN2A 3MPDA 5LJ3Y 4RO0A 4OYWA 5K9FA 4YMEA 3ZTOA 2D3O1 2MYFA 3VHQA 2R2TA 3KWMA 1PJ7A 2JHEA 2W2OP 3HT3A 2KM8C 4C8NA 2C2ZB 3DLLQ 4Q45A 9ATCB 2R3VA 1ELOA 1PO6A 2OPRB 2RMLA 3HHLB 1H74A 2Q1LA 4P2SA 4QU7A 3VAFA 1VRUB 2RDJA 2DPJA 4C8KA 2R8GA 2PO4A 2YKMB 2G2OA 2ZFHA 5H9EK 4HT5A 4U6PA 2BV3A 2VC1A 2VBXA 3M8SA 2JRSA 1KKHA 1YJTA 2IBKA 4I2PA 4QQBA 2IVYA 2FGCA 3J7AN 1JMTA 1IQZA 3CC2S 1TK0A 2J9DE 2FVCA 5KFEA 3W9IA 4OYPA 4ANEA 2VQFF 1AXQA 2YNGA 3CJ5A 4BCAA 3NKYA 4UUXA 2DPIA 1Q5YA 4ALZA 2DIVA 1U24A 2F8MA 1VBYA 4NX9A 3W61A 3LUYA 2VC0A 4OZ2A 4UOGA 3AOBA 2POKA 4KO0A 2ZOMA 3H90A 1U25A 3TO8A 7FD1A 4H4MA 4F0MA 2X3DA 2Z2LA 2V69A 3MPWA 2MZRA 3PM9A 2DCUB 1IUJA 3FSYA 2OSQA 1CJKB 4B3SJ 2BA9A 1IBKF 2Q43A 2E7XA 2YNHB 4CTAB 4DV4F 1BQMB 5E41A 3GMGA 3WX4A 4DX5A 4USHA 2F40A 5L38A 4XPEA 3FKBA 2GCFA 4Z2XA 4ZOSA 2IRUA 3SFGA 4AT1B 4BWJA 4NA1A 1U6ZA 2VDIA 1JLEA 3HVRA 1VS3A 4LSLA 1FRMA 4QIGA 2KFNA 3EDQB 4CH0S 8AT1B 2Z56B 1S59A 5B0GA 3OL9A 5C25A 1N54B 1U1LA 2NSBA 4O3RA 2DNHA 2R2UA 3I6PA 3SBMA 4GVBB 2MKJA 2BBEA 1GXLA 4Q2LA 3L7OA 3L9ZA 3KLEB 2VG6B 1MMDA 1V6HA 2E66A 2BVZA 4F4XA 2EBEA 3NCPA 3UDEA 1RT2B 3AB2B 2Y8YA 4X66J 1NSAA 4DV7J 1KS2A 1KLMB 2WVFA 3DMJA 3KJVA 3JQKA 1RT5B 2IRXA 1SJFA 3H5SA 3HI9A 3SEOA 3D66A 4CO0A 3VAIA 4PEOA 5DQIA 3HO1A 1VC0A 1R6VA 2NR0A 2P6TA 1QTNB 3CNQP 3QSYB 4YUDA 2M5YA 2L08A 2D41A 2G0JA 4O4GA 5D15A 3AH6A 5DZ7A 5DM6Q 3ULHA 3NGRA 2B6AB 4FYDA 5DETA 2V6AA 4M63A 5HI7A 4ATNA 1I94J 4CO2A 5CYQA 3IR5B 5BR8F 3D6HB 3VV2B 4CH7A 3QT6A 1SPBP 3OL7A 1PKUA 2ACYA 2EK1A 3RAXA 3QIDA 2BANA 2C3OA 1VQKS 3L95X 1EB0A 1BLUA 2FGOA 1V3SA 1N32J 3CCSS 2VV5A 1X4FA 1EP4A 2K7KA 3F44A 2CNLB 3D6TB 1QAJA 1QAXA 4ZHRA 1FDAA 4PXEA 3KNGA 4IYQA 1NKBA 1OIAA 3KLIA 3B82A 2HS4A 3PFEA 2JEJA 1WOPA 4CT9A 3IG1B 1WC6A 1YWXA 5F0WA 3IBFB 4CIOA 3QT5A 5EWGA 3GFZA 4FP9A 2BW7A 4MTPA 2X51A 2HBZB 4ZA1A 4DL2A 5JUMA 1BQNA 2NLWA 1HQ2A 5M2RA 4R5PB 1RZMA 3DLBA 1LKZA 4QR1A 4KR0B 5CYMB 5MAOA 3SZ2A 1TVRA 2M9KA 2YQ0A 2VF3A 4EI2A 3OR2B 5KFHA 2M52A 5DG9A 1BE4A 1GAOA 5HVFA 1YRUA 1SB6A 3PIOQ 4WE1A 4Y34A 4XIUA 4ZITA 3HFKA 3CDAA 4XTTA 3DN9A 3K59A 4MK8A 4DR7F 2DGUA 4ZK7M 4F04B 3VR1A 1NSKL 3QT7A 4UW2A 4LRFA 2NXUA 3KUGA 1FKAF 1PJ6A 4USWA 4PYAA 2HHXA 2J0XA 2VQFJ 5E3RA 3UQSA 2XLJA 4DPWA 1ZS6A 1TFYA 5KFSA 5HVHA 2Z0GA 3BF4A 4FYWB 4NZ0A 1C0UA 2DITA 1D0EA 4ED0A 3G8TA 1X9SA 3NS6A 1VRQC 1FRHA 2HNZB 1SUQA 4DLGA 1CQMA 4O44B 3KOAA 2C2OB 3VAHA 3TUPA 3K58A 1SQEA 2CPDA 4ECZA 3MM7A 1ZM4A 3HX9A 2NCKL 4O0IA 3AQPA 2WOMA 4XO0A 5CXTA 4NMLA 1PC5A 3LWLA 3R5AA 1ZZNA 2IBOA 5T7LA 1WSRA 4DV5J 2RIJA 4ECQA 4B3OB 3AT1B 2AF6A 2H54B 2H5EA 3D3CJ 5DDQC 3LAMA 4ED4A 3M6WA 1PG5B 1TL3A 3THPA 1WOSA 4LF4J 2C2MB 4PWDB 5DDRC 3OFGA 4L73A 3QAUA 4Y28C 1Q5VA 5SUHA 5KG1A 4JI2F 2XQCA 1U0HA 5LMUJ 2FLLA 1S4EA 2W9CB 3KK3A 4IFYA 3I55S 3CO0P 1Q78A 2FIUA 3M8WA 3S01A 2Z2MA 2YKNB 3D28A 2KRBA 4LBHA 3C16A 4KY3A 1O51A 3FRZA 4M95A 2FPHX 5DQGA 3ENAA 4WZMA 2BUNA 3W5XA 3KUHA 5F8HA 2VDHA 5BJRA 2MKSA 1S97A 5D0EA 1VQ6S 1RTHA 2ERRA 4F2SA 1S9EA 4JP8A 4ELUA 1TL7A 3KHLA 1S9GA 4IG0B 1YK9A 2L48A 3HMJG 1VBKA 1EARA 1NK5A 1SKWA 1U47A 2DNRA 1FKPA 1BC6A 2PEBA 2NUHA 4GO7X 2CWXA 2CKWA 1SBRA 2E1CA 3KTQA 3IRXB 2KZMA 5BXIA 3HFVA 1UTAA 1P6TA 4HHJA 3DRXA 1S72S 1ZH5A 4PWWA 1QVFR 5AXLA 4OHYA 1DZ5A 4KH1B 3HCXA 2VL1A 3THTA 3DHXA 4K2JA 5BR8J 3G71S 1HMVB 4U8VA 2KDOA 2W8KA 2JL9A 1G1XA 5EX3A 1X4CA 1IM4A 2COLA 2XBPA 2AZ3A 4E98A 1L3VA 3WBZA 3ZNJ1 2VQEJ 1X9WA 2UVRA 2F9DA 4X4UA 2B43A 2W7PA 2PI5A 4LSNA 1RTDB 3R6LB 2OPQB 1APSA 2B51A 2V67A 3L3CA 3FFIA 4QOTA 3BN7A 1TELA 4ILLA 2B4UA 3Q8SB 1HNVB 3GILA 2A10A 5GAEU 3CF5Q 5IM0A 2OHDA 2KRRA 5GMEA 2MQOA 2VFUA 2OTJS 1PYTA 4PRFA 3TQ1A 2AJ4A 2GJ2A 4ZIVA 3UO0A 4RPFA 1YJ9S 3PR4A 5HBMA 1XNRF 3SQGA 1YGYA 5HP1A 1PSDA 2XC9A 4V19X 2XB2D 1DQ8A 2ZKUA 4ZVGA 4FXDA 3K57A 1LEOA 4BDPA 4RW4A 2HFZA 4ZPTR 1T11A 4OZ1A 4P72A 2KFZA 1UFWA 2XCAA 1FTCA 2CQ1A 5GAHU 1YDLA 4ZPVR 4DL6A 3BDPA 2XG8A 4DZDA 1TL1A 1XR5A 1SKRA 3PNIA 1VBZA 2VB6A 4H4OA 1ZAXA 2J6SA 4PPZA 3CCQS 2YKAA 1UVLA 4LUBA 2LXFA 4HHHA 5HO4A 2E5HA 5L1JA 3JTNA 4WTYA 3AA9A 4J9LA 2KT5A 2B4OA 2AJFE 4TKTA 1FJGF 3H25A 5ETRA 3KDOA 2RU3A 1KN6A 3BQ0A 3CJQA 5KFMA 5LOQA 1K1SA 3HVTB 2JJ4D 3A3NB 4YQWA 3LO3A 1R8HA 3ET6B 3NBPA 2EFQA 3JSBA 1RADB 2UUBF 1Y3JA 4OX6A 2WVEA 1NXIA 3QJPA 2XYGB 5H1SV 2HMIA 3P5TL 3KFWX 1SC6A 2QLXA 2HFUA 1QAYA 3R5DA 1VI7A 4JOUA 2GV1A 3DOMA 4NLPA 4LR9A 4DCPB 4Y0FA 3LP0B 4ECYA 3RW7A 3I0RB 5IT9Y 1HWKA 4NCGA 1KP6A 3PACA 2V4QA 2R4FA 4DL0C 2V2KA 2C3UA 4MIAA 3PYDA 4NWBA 2Z8QA 4K4XA 1LXNA 1HBOA 3JQMA 1FESA 1K9MT 1RBOB 1IBCB 3PTWA 3CW2C 5KT4A 3PDNA 5ETQA 4JYAF 3R97A 3GP9A 4P74A 2QL5B 3CJ4A 5C24A 2CXEA 3K8VA 1Z2LA 1NHKL 3NGKA 2JWNA 2RU9A 3N6MA 3GSIA 3GG0A 3HHNB 3DOLA 3OTOF 2ZH4A 1Q82T 1PAEX 2HGLA 1R0AA 3GV7B 5E0OA 2QFIA 3CD5A 4USIA 4DZ6A 1RAIB 1SH0A 3J81Y 3FBCA 4NI2A 4K4SA 3U02A 4ELTA 3JXOA 4M1KA 4C8ZA 2HRUA 2FVQA 2UZAA 3EGZA 2VIHA 1FDBA 2M4MA 1VQSA 3R2CJ 4XDCA 4NCAA 5KG7A 1IR1A 2AV5A 1B0VA 3PW4A 1Y00A 4Y2KA 4HDHA 4YR3A 2CNNB 4X4RA 4EBCA 4V1Ak 1MU2B 1OWXA 2I6WA 4B3TJ 5CA5A 4P71A 4ZVSB 2FLPA 4URGA 2LXUA 1K8AT 4B3MJ 3C66A 5A8RB 1S1TA 2UUTA 2DHXA 2KG1A 2LP4A 5CH7B 5LL6d 4ZVRB 2A1BA 2K1RB 4LF5F 1PYSB 2GVDB 2UVVA 3C2PA 1BGXT 3AJ1A 4KPCA 5RUBA 2UUAF 3K2YA 3SCKE 4X4NA 2DYAA 3HVAA 4WXWA 2HNDA 2RHQB 4OYIA 2CZ9A 4YN3B 2XULA 1AUDA 2HURA 3OSPA 5HMZA 1RTZA 1CJUB 2ZBPA 4I56A 1H7XA 1HNZJ 2CQ3A 2N4CA 1XNQF 4Q44A 2XS5A 2XY7A 3OJSA 4I4BA 1KHWA 2YQ1A 2CJBA 2IMOA 5HK4A 1URNA 2ZHOA 3KJNB 3MWBA 4J5OA 5KFUA 4CLYA 2Z30B 4OYOA 2V4JB 2HHSA 2F4VF 3P96A 4OL8A 4DR6J 3NNHA 3ZNUA 3PO4A 4LFCF 1B99A 2ZZMA 3HZGA 3UN5A 4ZLJA 2YWKA 5H9FJ 3UD3P 2R7XA 4Q5VA 1MMLA 2ACMA 3PVXA 4OZNA 1M5KC 3QJLA 1JLCA 2H1YA 1XNRJ 2I8EA 2XO6A 2ATCB 4USJC 1Y3KA 2BOAA 4NXMF 3MPUB 2MQPA 5F8GA 3AFGA 4DV6F 3KK1A 4EEYA 4CLZA 1JXEA 4OI6A 1ZA2B 3FBBA 3E01B 1S76D 4A46A 2VFSA 5A8WA 2Y1LB 1PC4A 3MEEA 4FN5A 1AYEA 1TKXA 4ZP8A 2IC3A 2DEIA 1MW7A 1F9HA 2J9CA 2HYIB 4N41A 3EZOA 1SVDA 2BJ3A 2IJRA 4MAKA 4QIWD 4M5HA 1UA0A 3FMBA 3WDOA 2DR6A 2DRDA 4I2QA 1NJWA 1FJGJ 3MMAA 2ZE2A 1U1NA 1UCNA 1SL2A 3R8YA 2B56A 3BSCA 4NLUA 4WZQA 2EWHA 2ROGA 5F8MA 1FHTA 2GGPA 2HQDA 1YJVA 4C3MA 4C3LA 2XWYA 1N33J 1XR7A 4A8XA 4JB8B 5A2QY 2QG9B 1YKWA 1SV5B 1U8SA 3MFHA 2G2ZA 2ZUGA 4DSKA 4K4VA 2W2QP 4D3HA 4RW8B 4R8UB 2DGXA 3W7BA 1FA0A 2OD6A 1VQ8S 3QGIA 1GNKA 1HI1A 4LBPA 3KXDA 4QIVA 1Q0NA 2ADBA 1N8RT 1B7YB 2ZJRQ 1NRKA 2CPZA 3U1LA 1VFJA 3V4IB 4TYBA 1N5QA 3M8YA 1X5OA 2HFSA 1VMBA 4ZLLA 1M1KT 3M2RA 3SSRA 1RAGB 4U96A 3A13A 1RWOB 2K3IA 4JYAJ 1PBAA 3Q2SC 4P9SA 1RJJA 1PILA 5B0BA 4ZIWA 3T5HA 3EGNA 1CQNA 2HHTA 4RNNA 2GIRA 5I3UA 2J5AA 1U2RA 4LREA 3W62A 1OPZA 2W2NP 1M5PC 4LF2A 2DR8A 4F26A 3TVYA 4C7QA 4DU7A 3JYTB 2QMUB 3H2LA 2FQQB 3QGGA 4USUA 1DURA 1SIZA 2E9RX 1JKHA 4WP8A 1D3WA 1BMQB 2ASYA 3O44A 1AUSL 4DPTA 1GT8A 3V6KA 2NREA 3IS9A 4GKJJ 2Q3PA 4L76A 4TY9A 2ADCA 4NYOA 2KT3A 1RABB 2ZWPA 2RD5C 3JB9k 1NK4A 2BQRA 2CAJA 3PG9A 1MWYA 2UV8A 1FERA 1WTBA 3LP1A 3Q22A 5K8PA 4EO6A 4KIAA 3HJVA 4ZCKA 2KU7A 4FS2A 2KG0A 4AQYF 2EFNA 2IVMA 4A8MP 3IA0A 1DBDA 1YITS 5JXSA 2J9EA 3UR3C 1S6PA 2AW0A 2FJDB 4N76A 2BJ8A 4N5SA 1O8BA 2IYGA 2YVSA 5F9NA 3PW2A 2X7IA 4BWMA 2UUAJ 2Q6CA 3LGHA 1FDDA 3W9JA 5K14B 1P1LA 3C6TB 1JLBB 2RF2B 3DDKA 2XNQA 3NOCA 1U6BA 1N5SA 4DJBA 2V8HA 4RKUC 2NYHA 4ZPBA 1XNQJ 3CJ0A 3HKWA 3WC0A 3MOJB 2EC0A 3ONQA 2UXCF 2ZH9A 1HQUA 4EGLA 1X5PA 4WFNQ 1O0PA 3A8EA 1ZYQA 3D6FB 2ZH1A 4QZVB 2F4VJ 2E44A 2ZBIA 3QLHA 2M2BA 4Y65A 2FVRA 1WHXA 5E3AA 2MY7A 5IV3A 5BYSA 4LFCJ 3Q8YA 3FCWA 4C2MA 5KFLA 1ZM9A 1OSDA 4B9SA 3M8PB 1T8EA 3MHYA 3DU5A 3NEKA 5DGBA 3MAAA 2J0SD 4ED6A 2LA6A 2B5JB 4NRTA 2V4RA 3BV8A 3DOKA 3T1YF 4RX6A 4CLKA 1RE1B 1L5UA 3D1OA 3DC2A 5J2MA 1F60B 2FVPA 1I51B 4YHHF 3OXLA 4I69A 3G9CA 2M88A 4DV6J 3SIPB 1X4DA 1IKWB 3D4JA 3M30B 3CEDA 4YOEA 3R3TA 3GIKA 5EGYA 1NK7A 2N7CA 2VFVA 2VG5B 3D7SB 4DN9A 3T41A 4CLPA 5ETKA 1X4AA 1RWVB 5F3ZA 4NL5A 2H48B 1HD1A 4TU8A 2BR0A 5KG3A 3US5A 4K4ZA 1RHMB 3Q83A 3J7ZT 4HHUA 2WVBA 1CJTA 4KHMA 4ZP7A 4JI7F 4UQTA 2HQFA 3G8SA 2BXJA 3GU0A 2DNLA 2VG7B 3LWMA 1TR0A 3OHAA 1TKZB 2XLIA 1ZOTA 2BKPA 4NLRA 4EK2A 2MLXA 3PY8A 3TA2A 1NHUA 2FDNA 2H5IB 5F8IA 1XTZA 1X0PA 3IMQJ 2R7RA 3DRSB 2CVIA 3CMES 4Y3CA 3WC2A 1LWXA 4IH7A 2UXBJ 3HHDA 4KHRA 4ICLB 4P7TA 4RNHA 2GNKA 5I4MA 3MURP 5JVHQ 4OX8A 2GJFA 4X4SA 4C6AA 3TUIC 3QO9B 3PEHA 4ZVOB 1BWEA 4QPXA 4HI2A 2HIQA 3GTYX 4DU8A 3ITHA 3C3LA 3ILLA 2VOOA 2KN4A 4Y00A 4DR3F 2YKOA 3W8GA 2HQIA 5KFCA 2UVUA 2MZSA 3A8JA 5ITHA 2GX8A 3UDVA 1HNIB 2IY5B 4MH8A 2EK6A 3H7HB 2GZOA 1UWBB 2Y1IA 1Q7LB 3KG1A 4FZVA 2XSJB 1UAWA 2O67A 3M32A 4M5GA 3ZTSA 4WU3A 4GVLA 2A3JA 1A0OB 2MZ1A 2ZH2A 1RXOB 1JXLA 3N0VA 3PIPQ 1T3OA 1X4HA 1GTHA 1F1BB 4WFYA 3KMQA 1NK0A 4DFPA 3MEGA 2RUGA 2VFRA 4UZCA 2HWHA 4TY8A 5LJ5Y 4WCEQ 4LF9F 1LFWA 1CEZA 1V3RA 2BJ7A 4J91A 1BXNA 1V3ZA 1RQ0A 4B9UA 2MKHA 3K5OA 3OT9A 4EZ6A 2GAGC 3WQPA 1MN7A 3V6JA 3TI0A 2R7QA 1M5VC 4Z7YA 2E5IA 4F4KA 3M8RA 1E6YA 4CLTA 1TU0B 4AXJA 4Q43A 3HD2A 3F73A 4WKYA 1WF1A 2KJVA 3ENWA 4KO0B 4DUTA 2XWXA 2AGPA 1IQTA 3A3PB 1OY6A 3BR8A 2BOPA 3PJWA 4AL5A 2YX4A 3RUBL 3EJMA 4H4MB 1LNQA 4F36A 1SQFA 4PUOA 1LWEA 4N56A 4X62J 5HSPA 3H59A 3T3FA 4DCJB 3DLKA 2MXYA 3TR5A 2AJ1A 4DG1A 1VK8A 2CUYA 4KV8A 2UXCJ 3LQVA 4DPXA 4RU9A 4RNFA 4PPDA 3CPWR 3CMQA 4IG3A 2KYZA 2ZM6F 1IBMF 1RWPB 4QWDA 2DNOA 2XLKA 2GQCA 3GE9A 3SSQA 3BEGB 2W8LA 2ASLA 3AD9C 1B7FA 1VCTA 3WZ0A 1JLEB 3ZZ0A 2HS3A 1HR0F 2HHWA 4DL5A 4LSLB 2AJQA 4M5LA 2W25A 4F25A 4LR8A 2LEPA 3UD4P 1KBRA 3NY0A 2GQQA 4DL7A 4YDXA 3CCVS 5D4LA 5AE1A 1DQAA 3AY0A 4U7CA 1S7IA 5C25B 3TAQA 3OHBA 1TUGB 2O66A 1RGVA 4YHHJ 2Y0SD 3GWCA 4NYZA 2KO1A 2CQ4A 2RSQA 2FVSA 1KDNA 3RR7A 5IFMA 3VVUA 3TJ9A 1TZ0A 4WF9Q 4DR2F 3LAKA 4MKAA 1X60A 2B9XA 1JX4A 4NLGA 1RTIA 2FLOA 5L9XA 4P2XA 3DMJB 3KJVB 2KFYA 5A76A 5FIIA 4JBCA 1JLGA 1KRPA 4KB7A 2AGQA 4KH0B 3TUJC 3JTPA 1VQYA 8RUCA 4UQGA 5IWAJ 1VQLS 1EKSA 2M70A 3MR6A 4O23A 5IT9U 3UE2A 1M5OC 3DGPA 5SZTA 3RBDA 2ZD1A 2LLZA 2OMOA 4U8YA 5CYQB 5CYJA 4FNIA 2VICA 3CIMA 2RKIA 1WORA 2AYBA 2IM0A 2MSSA 4QWBA 3J7Z5 1FNMA 3IAM9 2BANB 4WKRA 3QIPA 2DTJA 4B08A 1XMBA 3MUTP 3DKDA 1FK9A 4YR0A 3NP5A 1QAIA 4F3QA 5B0AA 4ZHRB 4ZPDA 1HPZA 4ZVPB 5L1IA 2DXFA 3THVA 1C4AA 1RAEB 1D8ZA 3R27A 5DDPC 3Q86A 2DXEA 3H42A 4PG5A 2DIUA 3M8ZA 3J81U 3W8PA 5KT5A 4DUZJ 2OPRA 3K7RA 5IQQA 4CLLA 5IZHA 3NS7B 2N3OA 4DPUA 2X1BA 2DCLA 5D8HB 3RAMA 4RU2A 1R8PA 2AEMA 3BPSP 3FEZA 2NZCA 1BQNB 2HFVA 2RAQA 4RBUA 1FF2A 1I6JA 2LEAA 2I1RA 2QA1A 1SH3A 1TVRB 2UUCF 5DZ6A 3IO1A 3JSYA 4WFXA 3TOQA 1QTMA 4WE1B 4LF9J 4TU9A 4K4WA 3GSDA 1R31A 4M8LA 3HM9A 2E5GA 3KLFA 3QJJA 3M8QA 1A9NB 3SSSA 2V2VA 4O3SA 3CSKA 4K59A 3R9LA 3GCXP 4RUAA 3MR3A 4OYBA 2QO3A 2E5LJ 1JK9B 1U2CA 1NK8A 1SL1A 3C8YA 4LRCA 2IYIA 2DXDA 3DRPA 2EW9A 4KSEB 4LRAA 4E8UA 3SV4A 3PJ9A 2HK2A 1WF0A 1FDNA 3DRRB 1F0XA 4ANCA 1C0UB 3I5AA 5HN0A 4C0HA 4EU0A 3I31A 1OYEA 1S0OA 1J5EF 3DYAA 3FBEA 1SUQB 3TX8A 2KXNB 2VPZB 4KFBA 3BREA 3OR1A 2UXDF 4LF1A 5IS2A 3CT9A 2EEYA 2QSFA 3MM7B 1RT3A 2MKIA 2MQNA 3T1HF 1YZ6A 3BZQA 3FVYA 1RWXB 3B78A 2WOMB 2DHGA 3NGTA 3PXGa 1S0MA 1VR6A 2FD2A 2CPHA 2OUGA 3EX7B 1JJCB 4N8NA 4X4OA 1AW0A 3CDUA 2X1FA 2ZM6J 4I7FA 3DI6A 4PQUA 5T7LB 3LPYA 2K06A 4LIRA 3RB3A 4OZ3A 3AQOA 4CNYA 1FJCA 4U67Q 4YDDB 5F8JA 1K44A 2ABYA 4QCLA 3GIJA 3TA0A 3RR8A 1TL3B 3P3DA 5KFWA 4F4ZA 1HR0J 2VUGA 1D9FA 1CS4B 2ILYA 5IC4B 2ZC4A 3PRBA 3TZXA 2X1AA 4WFBQ 1RYRA 3D0GE 3KK3B 3PFOA 4LF7F 4IFYB 4DDFA 4Q8FA 4KJIA 2J9DA 2J6TA 2ROEA 4CO1A 5DS7A 3UVJA 3C16B 4LF8F 4KPYA 1HNXF 1ZAWA 2QRRA 1FXLA 3Q8PB 3SQOP 1RTHB 4RNOA 5ETNA 1NSQA 1XN9A 1IR0A 3BO4A 1TL7B 3TARA 4DR2J 2LQ9A 3CC4S 1PAUB 5AXKA 1S9GB 5KFZA 4MIWA 3PKYA 4OI0A 2DY1A 1S1WA 5A2QU 3MTJA 3G6ES 1S1UA 1FKPB 3MUVP 2GAHC 4WTOB 2V5HG 2JVOA 3PX0A 2BKOA 1B3TA 2OEKA 2JSXA 4FXWA 3GR0A 4J9VA 2CDQA 1Y7PA 3R5GA 3QT8A 4KHPF 2F8HA 1FFSB 3MUMP 3NNAA 1ZPWX 3LTOA 1ZAVA 1WACA 3D6MB 3BGUA 3GB0A 4G3IA 3W2WA 4RBVA 1U0SA 1Q53A 3DFEA 4DSFA 1BHNA 2ZKTA 2NSCA 2DGOA 2ZBCA 1WC1A 1OYDA 5LMNJ 1GQEA 1WHVA 2BEFA 1WELA 4E2FB 3RB4A 1ROFA 1N52B 1J2VA 2Y3YA 1OJ4A 2CZ4A 2W4PA 1VBXA 1S1XA 3TZWA 2ZZTA 4DSLA 2EFGA 2G13A 1UEVA 4F3MA 4USKA 4W4MA 3LH2S 4MKVA 2M8DB 1AA1B 1EJ7L 2WK4A 1D8YA 1H2UX 2D74B 4I64A 8ATCB 1YJUA 2AWZA 2OSRA 3ZTPA 1RCOB 3MTKA 2IJFA 3ILOA 3LOUA 4YEAA 1KOOA 1SC4B 3CCZA 4CDIA 2HK3A 5HBMB 4KRWA 3SQGB 4A48A 2APOA 5HP1B 2MSTA 4CWBA 4OZ0A 4WXOA 5LXRA 2ZC3A 2WSFC 4H54A 6FD1A 1CC8A 1IBLF 3QRPA 1B0PA 4RW4B 2LKZA 3FEYB 4NA2A 4F2RA 3HSZA 4UY8T 3C15B 1NB7A 4NOHA 4L74A 4WK3A 4B9LA 2GIFA 1U2FA 1YBUA 1EHWA 1A7GE 1TL1B 2XZDB 4IFVA 5E3PA 3FC9A 1XWLA 1AZSA 4B3RJ 4H4OB 2HVEA 4KGKA 4ELVA 2IAJB 2VA2A 5F8LA 2L9DA 4DR5F 4P6QA 2R8HA 4X4VA 3C6UA 2QE5A 3MMJA 2PFDA 2HPUA 4OX9J 4H4KC 2OKQA 3IWLA 1ZM3A 4K8RA 3IC1A 1RWKB 3MECA 3NBPB 1EQ0A 3W5YA 1J5EJ 3BSNA 2I5JA 2QLFB 3N6NA 5C42A 4CYUA 1RWWB 1IKXA 2NYIA 3M9OB 2WRMA 3PYFA 1SQGA 2FJEB 2HMIB 4IOCQ 5HMYA 3DOMB 4Z7CA 1RP5A 1T95A 4DCOB 2BM0A 3OTDA 1RISA 5I42A 1KTQA 3HJFA 1ZA1B 4NCGB 4UZBA 1K0TA 2JNJA 1IKVA 3MFIA 1HBOB 4QPTA 3KLHA 4QJVA 3FBFA 3P4UB 1JLFA 5DG8A 4LMZA 3IGVA 3WHIA 4IOAQ 2J0QD 4ZS6A 2XHWA 5B08A 2C2NA 2PMZD 1NH7A 3GYNA 4ENOA 1YQHA 2KTQA 5C24B 5FJ4A 2Q66A 4ZLPA 1U02A 3GYXB 1NKEA 3H4DA 4A8OA 4LF7J 3A4TA 3DOLB 4F0HA 2LCWA 2O1PA 3QZ8A 3BH6B 1R0AB 3ZC4A 4L75A 1RLDA 4LF8J 1EIYB 4MT1A 2R7OA 2MQ8A 1H0HB 1RTJA 3C14A 1WEXA 3EPGA 1HNXJ 3RGIA 1UVNA 2HVDA 4C97A 3KLVA 2QZ8A 4MKBA 2ZUAA 4ECRA 1M0SA 2V8DA 2R8JA 4WFAQ 1Q1KA 2EKYA 1HHSA 3CUNA 1FNXH 1RU1A 4KTQA 2R8IA 1NCLA 2JEGA 1PGZA 3MAHA 3I0SA 1UJ6A 4R25A 1R8CA 2AKWB 3GG1A 1J5OA 1S1TB 3IXQA 3UW1A 1RAHB 4LF6J 2Z4PA 4Q0BA 2DH7A 2XMVA 4DV0J 2AJ0A 2NUUG 4USTA 1HFEL 4CP5A 4KHPJ 2WSCC 2A0FB 1GMWD 2HNYB 4BLGA 5C2CA 1N34J 1UFKA 2QMXA 4K0KF 2DKOB 3CCMS 4NA3A 3QGHA 2HNDB 2HHHJ 2BE2A 3TJAA 1VQOS 1IJEB 4NLSA 3POTA 4CNZA 4YR2A 1I3OB 2DK2A 1CG2A 1K73T 5B0EA 5DGAA 1YJRA 2XMUA 1VQ5S 2JDJA 4G1QA 3K17A 4ZDNA 3OL8A 4FPIA 3RRGA 1NJXA 4KGZB 1B4SA 3G8QA 4FYYB 4RUCA 5KOXA 4NZ6A 3W66A 1OY9A 2YH1A 4DQQA 3ILJA 4JI1J 1LW0B 3VGSA 2FHOB 1Z1ZA 3GIRA 5D6GA 1XBWA 2HKEA 5J2PA 1F3VA 4IRDA 1H2TZ 1JLCB 4WPAA 2PT0A 4DV5F 4OLOA 4RL1A 4PXDA 3KJQB 3CD7A 3DNCA 3IM8A 2DNNA 1NK6A 1F2HA 4LF4F 3HXMA 3MMBA 1T05B 1IBLJ 4FYXB 5KFRA 4LRDA 4NCBA 3CVKA 3KK1B 4A8KA 3OSNA 5FDLA 2LDYA 4EBEA 1NSPA 5AXNA 3LGNA 5LMUF 2W01A 5A8WB 2J76E 3MOZA 4X64F 4LJMA 1HW9A 1TKXB 3CCRS 1QJHA 2IC3B 3EGVA 2QA4G 1HBNA 3ETMA 5T14A 2DNPA 3T9NA 3P5BP 1RWUA 5GADI 2CNKB 2CJQA 3TP2A 4DR5J 4I2QB 2ILZA 4O0NA 1VQPS 2Y1RI 3MMAB 3BQ2A 2ZE2B 4UY85 3PKMA 3BH7B 1YTYA 4GKKJ 4IUFA 2LQJA 2GGPB 3CULA 2PC6A 3VTIA 2I2YA 1NPKA 3BGFA 5BYQA 1SJ4P 2D9PA 4DX6A 5M2PA 4QW9A 1YJWS 4JI0F 1Y4ZB 3PW0A 3FZ2A 2XTJP 2YWFA 1S0NA 3MXHP 2ZHAA 2F3JA 2ZDPA 4B9MA 4DFKA 2G0IA 4X4QA 3I82A 4RUHA 2IIHA 4YFUA 1F2GA 1S99A 1FRKA 5CZXA 1F9FA 1ZTTA 2V68A 4MFBA 2IPOB 3X1LB 2IRYA 1LFPA 4CT8A 2NXEA 2MKKA 3M2RB 2NZ4A 2VBZA 5D4NA 3Q0AA 2MPUA 4FNHA 4DF8A 2AZ1A 2N3LA 2BYCA 4AL6A 2OTLS 3V81A 2VQEF 3SDEA 4OJ3A 1I5OB 3GJSB 2C22A 2O5DA 5I3UB 2WONA 1WG1A 5AT1B 1XR6A 2W9AA 3E3XA 5B0CA 1M1GA 1VLYA 1YBTA 1HARA 4J9MA 1HQEA 1XMOF 2GVZB 3SCLE 1ZBTA 1A6LA 3R7BB 1JKHB 1Q7YT 2EFOA 2HHPA 4PR6A 3MD3A 1JXVA 2GA7A 5LM7E 4ECSA 3H5YA 2FC9A 2Q6BA 3F41A 2HRTA 2RNEA 1SXLA 2OD4A 4NEZA 5DQHA 3AD8C 4ED2A 4RZRA 1FFGB 4IH6A 2D3ZA 3RU0A 1DFDA 2GW8A 4NE9C 3OTCA 4NZ7A 4OX7A 1AROP 2GFFA 1NPPA 3BSAA 3O3LA 2V34A 5LXYA 4DWIA 3LP1B 1ITPA 1MWQA 3R2DJ 4LFBF 1QM9A 1KONA 1FXDA 3T6BA 4FBTA 1Q79A 1HYSA 2VU5A 3I5CA 4M5MA 3I5BA 2MHEA 1S1VA 1LWFA 1S79A 1T94A 4DEZA 2QFJA 3QNWB 3GZ7A 1DQ9A 2CG4A 1S6PB 4DF4A 4J9RA 3W5ZA 1M1HA 4XDDA 2KVIA 1IKYA 1VDHA 4P7VA 2YH0A 4DI6A 3NXZA 2NXNA 3LA0A 2WVCA 4K0KJ 5F3TA 2ZZNA 3T1AA 5KG2A 5L39A 3OFFA 5A8KA 1CBKA 3OLBA 2IMWP 4J9NA 2OPSA 4J90A 3OVAA 5ETLA 1HHTP 2B3TB 2F5GA 4ZJLA 3EZUA 1E6VA 4DHVA 4J9KA 1HQUB 1S6QA 4NRUA 1CPZA 4FDFA 1T02A 3QLHB 2DRAA 4WYWA 1JQGA 1WF2A 5EX0A 1NKCA 4YB6A 3WX8A 2KHDA 1FKOA 3W65A 4CO5A 1PYOB 2YTCA 4ZJOA 2ZNYA 2NPFA 3VGTA 4M5IA 1LWCA 5B0DA 1IN0A 5KFTA 3MAAB 4M5KA 4DMZA 2A2CA 1TK8A 2G1HA 3AHPA 1U26A 2VD3A 1FVSA 1REVA 1HW8A 2V2QA 3KYLA 5J2MB 2BQ3A 1GFWB 2RH3A 4DX8H 1G2EA 1NM2A 2VBYA 1TKTA 2NXCA 3DU6A 1TV6A 1WUUA 1JWWA 1UZDA 1XERA 2DY9A 4GC6A 4NLXA 3HHLD 2IM1A 2CA9A 2LU2A 3R1LA 1DTTA 4A8YA 2BE9B 1JIHA 4X64J 3SI8A 1Y10A 4DUYJ 4P2MA 4Q2MA 1W26A 4O3OA 5CD4H 3TA1A 1YRXA 1P9YA 3ICLA 1HBMA 1CJTB 2H9ZA 2AEJA 2E7WA 3HSGA 2VONA 2LXIA 2R9LA 5HLFA 4O3PA 5D0HA 1FWPA 1SC3B 2HS0A 2J6UA 4B3TF 4NMXA 1YVFA 4JI0J 2F4FA 2OAUA 2R7TA 1RA6A 3ENQA 1FWKA 2RRAA 2QEXS 4B3MF 1N5VA 1WJ9A 2HQCA 4F4AA 1SKUB 5D4PA 2FJXA 1SIWB 2HBQB 4Q8EA 3G87A 3GCWP 2E9TA 1NPRA 1X0FA 2RUSA 4URQU 5H9FK 5HANA 2BABA 4DPYA 1HKAA 2WSEC 5AE2A 3EXYA 1N36J 5A0YA 3RBXA 1CVJA 1TL5A 2WCXA 4CZCA 4QIFA 1C1CA 2ZEJA 5EN1A 2RJZA 3S6EA 3H20A 1T9XA 3K8WA 1HNZF 4NLVA 1WG4A 1NDCA 3LP2A 5HQMA 2QT7A 3CXCR 2ZVSA 3BKUA 2QL7B 3DDIA 1HWLA 1RAOA 1Q86T 2GMJA 4TXSA 3M32B 4DR6F 3L7UA 1XMOJ 4OJGA 2HBYB 4MIBA 3KHHA 4MK7A 2D7SA 5HL7Q 1LK5A 3NAHA 3M9MB 4UOHA 4NLYA 3TZYA
chains in the Genus database with same CATH topology
3BR8A 3ISND 1RT6A 4O3RA 2DNHA 2BOPA 5DJBA 3PJWA 2R2UA 2YWHA 4AL5A 2YX4A 3I87A 4NLOA 2DGWA 4H4MB 4OV1A 3I6PA 3ENVA 2RDIA 2RT3A 4PUOA 1LWEA 5KFBA 1JNRB 4N56A 4QWCA 2MKJA 2DT9A 3H59A 3MEGB 3MAQA 4LF6F 2BBEA 2NQPA 1GXLA 4Q2LA 3UFCX 3UDCA 3T3FA 3L7OA 2DR5A 2RQKA 1JNZB 3DLKA 4LVNP 3TR5A 2MXYA 4X4TA 3KLEB 2VG6B 1MMDA 2AJ1A 4DOZA 4DG1A 4DV0F 1X9MA 1V6HA 3AJ2A 1VK8A 2BJEA 2E66A 4KV8A 3CD0A 4TY8B 2FUG9 3LQVA 2FHJA 4L3NA 4C98A 2BVZA 1QVGR 4F4XA 5F9LA 2EBEA 3NCPA 1B64A 2GJIA 4RW7A 3PHEA 1RT2B 2E5JA 3AB2B 5A0YB 1KQGB 4WJBA 5LSLA 5KFNA 2DGSA 1FRXA 3ZZYA 2BRKA 4YP3A 3O8WA 4RU9A 4RNFA 4PPDA 3CPWR 1FEEA 4TYAA 1VQNS 4IG3A 1N34F 2KYZA 2ZM6F 4XPCA 1IBMF 4DBQA 4QWDA 1KS2A 1KLMB 4RNMA 2DNOA 2XLKA 1C1CB 2HHHF 4M5DA 3NLCA 2GQCA 3DMJA 3GE9A 2XMWA 2KKHA 3N5FA 3KJVA 3SSQA 3HHEA 2XI3A 4URSA 1RT5B 2IRXA 3BEGB 1SJFA 2W8LA 3H5SA 2RVJA 2KZZA 3HI9A 3SEOA 4QWAA 4CO0A 5B0FA 3VAIA 2ASLA 3T9ZA 2CJKA 3KNAA 1B7FA 3VWSA 1E6YB 5DQIA 1NJZA 1NHVA 4OI4A 1N6QA 4H4KA 3H8YA 4IH5A 1JLEB 2A2DA 3WZ0A 3ZZ0A 2HS3A 3LP2B 1VC0A 1HR0F 2NR0A 2P6TA 3A1YG 2HHWA 2AD9A 4DL5A 3IG1A 4YUDA 4LSLB 2M5YA 2L08A 3E8OA 4LSNB 2AJQA 3RB6A 2MKCA 2D41A 4ID8A 4KT0C 2W25A 4O4GA 4F25A 1YI2S 2LEPA 2HZCA 3UD4P 3AH6A 1YG0A 5DM6Q 2KHCA 1UJ4A 3CE8A 3Q2TC 2GQQA 4DL7A 1S7HA 3ULHA 1F5AA 4YDXA 3FFIB 3CCVS 5GMKa 5D4LA 5AE1A 1DQAA 2B6AB 3AY0A 4U7CA 5C25B 4K4UA 5DETA 3TAQA 1TK5A 4FYDA 3OHBA 5IT4A 4OZJA 4M63A 1RT6B 2O66A 4R0JA 5HI7A 4ATNA 3RRKA 2XGPA 4CO2A 5CYQA 2VFTA 3MM9A 3IR5B 1RGVA 4R5PA 3KG0A 1S6OA 3RAQA 1WEZA 2VBWA 4DQPA 2Y0SD 3GWCA 5BR8F 1DRZA 4NYZA 1FRLA 4JI1F 2CQHA 1LWEB 4PUOB 2KO1A 4DL3A 4CH7A 5CYMA 2CQ4A 3OL7A 2RSQA 5IM0B 1KD1T 2V94A 5CCMA 2ACYA 1FNOA 4DSIA 3O5TB 4W92B 1T3NA 2EK1A 3DLKB 3OR2A 2X3GA 3QIDA 2R2RA 3RAXA 2BANA 2C3OA 2FVSA 2CQ0A 4DG1B 2MQQA 1VQKS 3L95X 1BLUA 2PIIA 2FGOA 2ZH6A 1V3SA 1BQXA 3PW7A 2C28A 5F8NA 3RR7A 4RW7B 3CJKA 2RS8A 2K3KA 5IFMA 2BJDA 4PXBA 3CCSS 1TZ0A 2VV5A 1CSJA 4WF9Q 2IVFB 2BW2A 4DR2F 4ED7A 1S48A 1X4FA 3M6VA 1EP4A 2K7KA 2KH9A 3F44A 3LAKA 1N33F 5KOWA 5B7WA 1Y0HA 2FHJD 4MKAA 1QAJA 1QAXA 2B9XA 1JX4A 4NLGA 3MPYA 4ZHRA 1RTIA 2DHAA 2FLOA 2WHOA 5L9XA 1FDAA 2U2FA 4M5DB 3DMJB 2RILA 3KJVB 4PXEA 3KNGA 1WI6A 3DLGA 2KFYA 4IYQA 4Q7AA 1NKBA 3CJ2A 1R3NA 1OIAA 2XNRA 4OJHA 3KLIA 3B82A 5FIIA 3SYZA 2HS4A 5KT3A 3O2IA 1N6QB 3PFEA 2QA2A 3SCIE 4JBCA 1JLGA 1KRPA 5KG4A 4KB7A 2AGQA 2JEJA 1TAUA 4CCHA 4IR1A 2PEHA 3TUJC 4CT9A 3IRWP 3JTPA 3IG1B 1YWXA 1VQYA 2CVEA 1UVMA 3ETOA 4UQGA 1VQLS 5F0WA 4CIOA 2ZH7A 5EWGA 5K8OA 2MQMA 3UCZP 2XS2A 3GFZA 1KOHA 5A6PA 2K7JA 2M70A 5J1PA 4C8LA 3MR6A 4O23A 3VZHA 4DFJA 3UE2A 1YRTA 1M5OC 3DGPA 4OZ5A 4FP9A 5J1NA 5SZTA 3G4SS 4MTPA 3RBDA 2X51A 2ZD1A 2DNMA 3CDBA 2LLZA 4ZA1A 4DL2A 4MJKA 5ADZA 5JUMA 3M9NB 2OMOA 1U1RA 1BQNA 2NLWA 5CYQB 3MM9B 3MZIA 4L6V3 5M2RA 5CYJA 2HNZA 4FNIA 4R5PB 1X4EA 3DLBA 5D3GA 2W7OA 2CPYA 2DH9A 3CIMA 1LKZA 4O44A 2P6SA 4QR1A 3V6DB 1KVIA 2RKIA 4KR0B 2AYBA 3S7RA 2EI5A 2IM0A 3CGIA 2MSSA 5CYMB 4QWBA 4B02A 5MAOA 3J7Z5 3SZ2A 1TVRA 2M9KA 2RRNA 4K50A 1FNMA 3BS9A 3OTEA 3IAM9 2P9CA 2ZH5A 3OR2B 5KFHA 2M52A 5DG9A 3MI7X 2BANB 1GAOA 3CCUS 1DAXA 3NMRA 4GKKF 1T03A 4WKRA 1YRUA 3QIPA 1SB6A 3PIOQ 4WE1A 1M5SA 3CJKB 4Y34A 4XIUA 4ZVFA 1Y5NB 2DTJA 4B08A 1XMBA 3HFKA 3CDAA 4ID5A 3MUTP 2ZJQQ 1D1UA 3DN9A 2VKZG 1BD6A 2ZH8A 3EXCX 3K59A 1FK9A 3KKFA 4MK8A 4DR7F 2MMYA 2DGUA 4ZK7M 2O01C 1YIJS 2PDAA 2MDAA 3NP5A 4YR0A 2GIQA 1QAIA 1NH8A 4F3QA 1YBAA 3IR7B 3VR1A 5B0AA 4UW2A 2C2EA 4ZHRB 1RTIB 2C3YA 1HPZA 4ZPDA 5L1IA 2NXUA 3THVA 1C4AA 3SXLA 1FKAF 1D8ZA 3R27A 5DDPC 4B3OA 3DLGB 2B7BB 2F1FA 4OHXA 4OI1A 4HKQA 4QWEA 2HHXA 5KTQA 1IXKA 4GKJF 2J0XA 1WWHA 2HRYA 4PG5A 4MKYA 2DIUA 5E3RA 3UQSA 1TQLA 5KT5A 1H3DA 4AYBD 4IR9A 1JLGB 2XLJA 1LOUA 4KE5A 2OPRA 2FJAB 3K7RA 5IQQA 5KAKA 4OMFG 2RE1A 4PKDB 5IZHA 3IWNC 2CZVC 4PWDA 1KTVA 2N3OA 1TFYA 2YKQA 2X1BA 5KFSA 3G6YA 5EDWA 5EHHA 2DCLA 2Z0GA 3K5PA 3PO5A 1EETA 2PMHA 3UR0A 5D8HB 3BF4A 4QYZJ 3RAMA 5E33A 3J80Y 4RU2A 2RQ4A 1R8PA 4WFZA 4NZ0A 2ZD1B 2K8GA 3M6XA 2W9CA 6FDRA 3SCJE 5J2QA 2P9GA 3H2VE 2KJWA 1C0UA 2DITA 3FEZA 4ED0A 3G8TA 4NPOA 1D0EA 2M0GB 4HYKA 3I32A 4IOBA 1BQNB 3BM7A 4ED8A 1X9SA 3NS6A 4RBUA 3MEDB 1FF2A 1FRHA 1I6JA 2HNZB 3O6QA 5GADU 5D3GB 1SUQA 4DLGA 4B9VA 1CQMA 2LEAA 4O44B 2F9JA 2YKNA 2I1RA 4DQSA 2RKIB 3KOAA 2QA1A 1SH3A 2IM2A 3BJYA 1TVRB 2UUCF 5U47A 3VAHA 1S4FA 1V9OA 3ZZTA 3K58A 4HVZA 2I9SA 1SQEA 3IO1A 2CPDA 2WW8A 2KM8B 3JSYA 4ECZA 2CYYA 4PCQA 3MM7A 3D1QA 1ZM4A 3HX9A 4NLDA 1T03B 4WFXA 4K5SA 3TOQA 3QIPB 1QTMA 3OPKA 4WE1B 3SV3A 4O0IA 3AQPA 5K8MA 4TU9A 4ID5B 2WOMA 4K4WA 3GFHA 1FD2A 2MHNA 3GSDA 3HDSA 1R31A 2JH3A 3CCTA 3V4MA 4XO0A 1M90T 5CXTA 4M8LA 1MWZA 1WI8A 2P5VA 4NMLA 3IAS9 3DLHA 3HM9A 2JOQA 1GXUA 1PC5A 2E5GA 5FD1A 4U7UK 3LWLA 1KQSR 3KLFA 2HVHA 3R5AA 4EYIB 3QJJA 1UWBA 1ZZNA 3M8QA 3QZ7A 3SSSA 1YHQS 1A9NB 4O3SA 2IBOA 2XSJA 1HPZB 3CSKA 4IG0A 4K59A 4HEA9 5T7LA 4ED5A 2RIJA 4I1TA 1FJEB 1IJFB 4RUAA 4ECQA 4B3OB 1N0UA 1NNDA 4OFZA 3MR3A 2B4PA 1B0TA 2QO3A 2AF6A 3AB4B 4QR2A 3BB5A 4QU6A 3NS5A 2DNKA 1JK9B 2H5EA 5DDQC 1U1KA 3LAMA 4IQXA 1NK8A 4ZKAA 1SL1A 3M6WA 3C8YA 2W9BA 2DH8A 1TL3A 3THPA 2IYIA 3G86A 3P49B 3DRPA 4PWDB 2W24A 5DDRC 3OFGA 4EFAC 2D3UA 3QAUA 4Y28C 2EW9A 2PN6A 3S1TA 3B4MA 4KSEB 5SUHA 1FRJA 5KG1A 4JI2F 2PD1A 3IRXA 4E8UA 3MCSA 2G0CA 3SV4A 1EETB 4ECVA 1WF0A 1FDNA 4A8QA 3DRRB 5KFGA 2FLLA 2EBGA 2W9CB 1F0XA 3KK3A 4FF2A 5J2QB 2GMHA 1HNWF 1TAQA 1C0UB 3I5AA 3NAIA 4C0HA 4EU0A 5CZVA 5HN0A 3DXBA 4IFYA 2F7VA 3I55S 3I31A 3J7YI 1S0OA 1Q78A 1J5EF 2JLEA 1RT4A 2FIUA 3DYAA 3TX8A 1SUQB 4M94A 3HZEA 3S01A 2Z2MA 2KXNB 2WBMA 2YKNB 2VPZB 3D28A 2DISA 4KFBA 3OW2R 2KRBA 3BREA 3OR1A 2UXDF 4Y2MA 1HMVA 1VQ9S 1O51A 3FRZA 4M95A 3UCUP 2FPHX 5DQGA 2U1AA 1URRA 3V2UC 4WZMA 1P9QC 2BUNA 5IS2A 3CT9A 5F8HA 1R8BA 2QSFA 3AAWB 2VODA 3MM7B 3TW0A 3UDLA 4JI8F 4HL9A 5J1EA 1RT3A 4HH0A 2MKIA 4DS4A 2MQNA 5BJRA 4IO9Q 3T1HF 2MKSA 3OLAA 3BZQA 1S97A 3FVYA 3RBEA 1WHWA 3CD6S 4I6AA 3HHLC 3B78A 4O3QA 1VQ6S 2WOMB 4DQRA 1RTHA 2DHGA 3PXGa 4A47A 2ERRA 4F2SA 1S9EA 1UJ5A 4ELUA 3M2VA 4O4RA 1MROA 1S0MA 4F4WA 2FD2A 5I3UB 2ZHBA 3HO1A 2CPHA 3EX7B 3HKZD 4N8NA 1FRIA 3KLFB 1H2VZ 3KHLA 1RAJA 4X4OA 3M8QB 1AW0A 4A8FA 5CHCB 1S9GA 3CDUA 1JJ4A 2X1FA 1RTDA 4I7FA 3DI6A 4PQUA 5T7LB 2OPQA 4IG0B 3LPYA 5L1LA 3M2UB 4ILMA 2RQMA 2HHQA 3RRHA 1VQ7S 1DTQB 4LIRA 5IXUA 3RB3A 3AQOA 4CNYA 3H2UB 1FJCA 4U67Q 2L48A 4ITSA 4YDDB 3TANA 5F8JA 3HMJG 1HA1A 2Q79A 3Q23A 3VAMA 2ABYA 1NK5A 1SKWA 2VASA 2J7UA 4QCLA 3GIJA 5LSOA 2W9BB 2DNRA 2VKRA 3TA0A 1U47A 2E1MC 1TL3B 3RR8A 3P3DA 5KFWA 4F4ZA 1FKPA 1HNVA 1BC6A 2VUGA 1NZAA 2NUHA 1D9FA 3DRPB 4GO7X 1X5SA 2CKWA 2ILYA 2YQ3A 3PRDA 1SBRA 2E1CA 2R7WA 2ZC4A 3U27A 3PRBA 3KTQA 1R6YA 3IRXB 2KZMA 2XS7A 3EPIA 4QIEA 2X1AA 2HHVA 3QWUA 4WFBQ 1RYRA 4JV1A 3IR6B 2OJ3A 1CLFA 2ZITA 3D0GE 1QSYA 3KMSA 1P6TA 3KK3B 4HHJA 4BS2A 4DSEA 3DRXA 3PFOA 1S72S 4LF7F 1ZH5A 1QVFR 4IFYB 2HQ3A 4DDFA 2IM3A 5AXLA 4YY3F 3VAGA 4Q8FA 4OHYA 1DZ5A 5GAGU 3BGRA 4IDKA 4KJIA 2AX0A 1RT4B 2J9DA 2VL1A 3GFXA 3DYAB 3THTA 2J6TA 2DR9A 1KHVA 2ZOFA 2ROEA 3DHXA 2HVZA 4KFBB 4CO1A 3OR1B 2PA8D 5DS7A 3G71S 1HMVB 2KDOA 2DNZA 4J9SA 2W8KA