3IWMA

The octameric sars-cov main protease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional domain swapping as a mechanism to lock the active conformation in a super-active octamer of SARS-CoV main protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 62
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3iwmA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3iwmA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3iwmA01
3RC6A 3ZZDA 1K1PA 3NCLA 1LHGH 4MDSA 1L2EA 4NZQA 1GHXH 4AYVB 1NRPH 2A4QA 3ATWA 5FPSA 3P70B 1O5BB 2V6NA 3AVZA 3A80A 4BAKB 2TPIZ 1CE5A 1DS2E 2VGCB 5A09A 3PLKA 1OS8A 1GI9B 1JRTA 1A0LA 1EOJA 2ZGCA 3A7TA 4ZHAA 2C90B 2IN2A 2ZFQH 3QTOH 1Y3WA 2AEIH 1KXEA 1P12E 2VINA 3BTQE 2PGBB 1GHYH 3M5MA 6ESTA 1OWEA 5LPFA 4DT7B 2M5TA 1IQGA 2AYWA 3RDZA 1MTWA 5C67A 1TA6A 1G2MA 1QQUA 2AGIX 2WYGA 1ZJDA 3E1XB 1FI8A 3QWCH 1O2YA 5FHTA 4YT7H 1QA7A 1E34B 1XKBC 3ZZ7A 1NRQH 1GJCB 1XX9A 4JYTA 2OBOA 1ELDE 3LGWA 2BY9X 3F1SB 3STJA 4OGYA 3TNSA 2Z6BD 4JK6A 2ZTYA 5JB9S 1F0TA 1H9IE 1KIGH 4O9VA 4U30A 1F5KU 4JZIA 5F8TA 1ESBA 7GCHG 3ITIA 2H1UA 1XUFA 4NSVA 3S0NA 1WOFA 1KDQB 2FI5E 1HBTH 1EUFA 3ATLA 4HGCA 4CR5A 2BTCE 8KME2 2QF3A 2FOHA 2FYQA 1QQ4A 1Y5AT 3SGBE 3TJVA 3V7TA 3MNCA 3U69H 1TPPA 1ELAA 3ZV8A 1YCPM 3H7OA 2Z9GA 1HIAB 2VIOA 2BDAA 1IQLA 1ANCA 1O2NA 1S81A 1UTOA 2BLWA 1EP6A 4X8VH 4H6SB 3TGIE 1PQ8A 4I8LA 3GCHC 4GCHF 4UFDH 4A6LA 3A8CA 2ZFFH 2CMYA 1PJPA 1XUGA 3ZZ9A 3BV9B 4XBBA 1J17T 1J8AA 2XXLA 4NSYA 1NRNH 4Q2KA 2SGQE 1AUTC 3M7UA 5EW1H 4OS1A 2FTLE 2FDAA 2HGTH 3M5NA 5T6GA 1MKWK 1AMHA 4X8TH 3KCGH 2BDHA 2H5DA 3SGAE 1HAPH 1A4WH 1P11E 1A61H 2NU1E 2DUCA 1MH0A 1XKAC 4FUHA 4YO9A 3EBNA 2TGDA 1PPBH 1ZSJA 1TX6A 3SJKA 1ZSLA 1GCTB 1OOKB 2GCHG 1O34A 3PLBA 3I77A 4Y7BA 1V2ST 1TOCB 2BLOA 4A1TA 3GISB 5HM2A 2BQWB 3RMOH 3EDXB 5ABWA 1FQ3A 1GMCG 1TRNA 4ZUHA 3JZ1B 1ZHMA 4AFSA 3SUGA 1E36B 4B73A 1QB1A 2BD3A 1P2NA 3GY4A 4K1EA 2F9UA 3VB3A 3KQBA 2ZHDA 1O3DA 1SR5C 3P6ZB 3RLYH 1TQ0B 4CRAA 4AFQA 4CBOA 1BITA 3LC5A 3NZIA 3M37A 4B76A 1VJAU 1P2KA 3SV6A 1V2VT 4AFUA 2A7CA 2VWMA 1KY9A 1TB6H 1WYKA 1PPHE 5PTPA 3AAVA 1P2IA 3PO1C 1EOLA 1C5XB 1QCPA 4NZLA 1YF4A 2FOCA 2GV6A 3A7XA 4X1NU 4BTUB 1UTMA 2Q6GA 3A7WA 1GVLA 1C1TA 4DIIH 2BLVA 2FI4E 3L6PA 1KLJH 1BBRE 2YNAA 1DXWA 3NPSA 3E8LA 4Y79A 1HAXB 1DLEA 1LQDB 2O8WA 3EA8A 3CS0A 2BD9A 2Y81A 4YESB 1TGTA 3RXKA 3QDZB 3BG8A 2A32A 4XFQA 1O2OA 2G51A 2OC8A 1YKTA 4IW4E 5A0AE 2K1QA 3SUFA 2A45B 1S6FA 1AZZA 1A46H 1TGCA 5G4BA 4F4OC 2JETC 4Y11E 1GBKA 5GXPA 1C5QA 1DUEA 1S82A 1TRYA 1WTGH 1YC0A 3GY2A 1PYTD 2XWBI 2VU8E 2WPHS 4CHAB 1PQAA 1PPZA 1C2FA 1ZMLA 3LOXA 2FOEA 1TABE 3RXUA 2WV4A 2XBWA 3A8AA 2NU4E 1WCZA 1Q31A 1JBUH 3V0XA 3M7TA 2BDYA 1C1WH 1AGJA 3ZYDA 4K5ZA 3E90B 1GDQA 5JBCS 5DP5A 1P02A 3DFJA 3FZZA 4ZKSU 2Y82A 2VIDA 1C2LA 1YPJH 1WQVH 1U6QA 2H9TH 4AOQA 2BQ6B 2KAIA 2VIWA 1WUNH 1ABIH 1P2JA 3AASA 2O8UA 1EJAA 6LPRA 1ESTA 1O2RA 1SGNE 1V2TT 3GY6A 1O2UA 4BANB 2I6SA 1QB9A 1NM6A 1QL7A 2A5KA 2OUAA 2WINI 2ZHWH 3P8OA 1T8MA 2EA3A 1AU8A 2P16A 2PKSC 3SZNA 1PFXC 4FU7A 1IQIA 5EOKA 1LCYA 1V3XA 1P8VC 2ZEBA 3UWJH 5C5NA 2BDBA 3MNBA 4ZHLU 5CMXH 4JZ1A 5E2OA 4K1SA 2HPQH 2OCVB 1FZZA 1MTSA 2OQUA 2J94A 1TQ7B 5GWZA 4NCYA 1GJ7B 3SV9A 4ZMAH 2P59A 1C5YB 3I29A 1EQ9A 1EZSC 1GJ8B 2Q6DA 2TGAA 1DWEH 1DWDH 3D62A 1J14A 1SSXA 3KQCA 3SU6A 1ZTKA 1FV9A 1QBNA 2PKAB 4FUIA 4CH2B 1SQTA 2B9LA 2H2ZA 3NUMA 1DE7H 1EPTA 5FPYA 3G01A 1XUIA 3MH6A 1N1LA 1RJXB 5EPNA 4MG3A 3T62A 4HI3A 1GJ4H 3T5FH 8LPRA 1JMOH 1C4Y2 4IN2A 1Y3VA 3T27A 2BD2A 3PTNA 5FCKA 2Z9KA 3W95A 1H4WA 1G36A 1A0HB 1O2VA 3C1KA 1LHEH 1BTYA 5L6NH 3CS7A 1W0YH 1GG6B 4UFEH 5FXLA 2WUBA 3UIRA 2PWXA 4IMQA 1H9HE 4GCHG 2VB0A 1T7CA 5I25A 1EAWA 2PKSB 5LH8A 1EB1H 3GDSA 4YZUA 3UTUH 2OLGA 1NROH 1GI8B 3K6YA 2A2QH 2R2MB 1HDTH 2ZO3H 1TBRH 3SJIA 2KAIB 3H7TA 1SGQE 1W7GH 1SGIB 4X2YA 4D7FA 8GCHF 3ZVEA 4UEHH 1ZGVA 2V3OH 2ZU3A 1TPAE 2XNIA 2ZG0H 2ESTE 1V2KT 1F7ZA 2BMGB 2QIQA 1ELGA 3MHWU 2PR3A 4IS5A 1SQAA 1W12U 2FIRH 4OGXA 2CXVA 1NO9H 3BG4C 4WXVA 3MU1A 1NTPA 1ZTJA 4PROA 4DY7B 1S84A 5EU8A 4UFFH 3M5LA 3LH3A 2BYAX 3BTGE 3PV4A 3ZZAA 1QJ1B 1GI5A 1ZHRA 4ASHA 5GCHF 1Q3XA 3UPEA 1DFPA 3QX5H 1CBWC 4GLYA 6CHAC 3GY7A 4BAQB 1JXPA 2VVUA 1TPSA 3A85A 1AQ7A 1CA0B 1LHDH 2XYAA 3RP2A 1HXFH 1HPGA 4DOQA 5H4IB 3RXPA 2Q6FA 3P8NA 3SW2B 1ABJH 1FY4A 3BEIB 3GY3A 1Z6JH 4ZKNU 1GI1A 2GMTC 1GI6A 1TRMA 1ZPBA 4CRCA 3M7QA 1BTPA 1K2I1 1Z71A 2BXTH 2CV3A 1RIWB 1IHTH 1KYNA 4K8BA 3TLOA 3U8RH 1EPTC 4WXIA 1BJUA 2QA9E 4H4FA 1EJNA 1LPZB 2Q1JA 4E7RG 2CN0H 3TU7H 3ZZBA 4TYDA 4WMFA 3PO1B 4JYVH 2G55A 4GPGA 3M3SA 2GDDA 1P01A 1C5VA 2XC5A 1Z1JA 2AMDA 1GBDA 2UWLA 2CHAB 2WV5A 2PW8H 2J4IA 3SUDA 3STIA 1A5HA 4KTCA 1QL9A 1UVSH 3KEEA 3P8GA 1P03A 3VB5A 1AHTH 1YPLH 1ACBE 2BB4A 5DPAA 1AFEH 1ELVA 1TMUH 3MH5A 3U9AH 1EZQA 3A8DA 3PWCA 4GAWA 4NA8A 4H6TA 1ELFA 1P57B 1Y3XA 2ZU1A 1SBWA 1W13U 2QYIA 1ZMNA 3RMMH 1PPFE 2GTBA 1FY1A 3RLWH 1VJ9U 3D23A 3MMGA 5A8YA 3ZZ5A 4JCNA 2A7JA 3FANA 2ULLA 3VXEH 1ARCA 1YPMH 2FODA 3MOCA 5A8XA 4XSKU 3BTHE 3MO6A 5A2MH 1DPOA 1GCTC 1C5WB 3KQEA 2Z7FE 7KMEH 2Z9JA 5C1YA 5F6MA 3KQDA 5JPMH 1UHBB 3KHVA 6GCHG 4YOJA 2TGTA 1EAUA 1O5AB 2H6MA 1SLWB 4QT8C 1G9IE 3RXGA 4BTTB 1V2RT 1FAKH 2PGQB 7GCHF 2H9HA 1Y8TA 3RXMA 1TIOA 2ZZUH 2BOKA 1X7AC 1THPB 2IJOB 1EAIA 1WU1A 3IG6B 4RN6A 1FAXA 1P3EA 4OS7A 3FP7E 2W7UA 1XUHA 4ISHH 3BTDE 1NU9A 3K9XB 3A84A 4NIVA 3DUXH 1MTVA 2V0BA 1P2QA 4JMYA 2O8LA 1SGDE 3K2UA 5TJXA 1YBWA 1SI5H 4K60A 1K21H 2QV1A 5J4SA 2A0QB 1QRXA 1GHAG 3V12A 1ARBA 1LPKB 4WMEA 1LKBA 3SU1A 1LTOA 3SU5A 3BTME 1IQEA 1HB0B 1AI8H 2Z9LA 3S69A 4FVDA 1G32B 5JBAS 1YPEH 1O2IA 1C2KA 1JIMA 4AZ2B 3C27B 3SU2A 2Y5FA 1BMAA 2ASUB 5HM9A 4THNH 1BZXE 4ZKRU 3SJOA 1CU1A 5K7RA 2Z94A 4Q7YA 4X8SH 4MNWA 1NPMA 3T28A 1IQNA 4AGKA 2GMTB 2BD4A 2GX4A 3EA9A 5DGJA 1VCQA 5T3HA 1BCUH 2SGAA 4ISOA 1GBLA 1MQ6A 8GCHG 3BF6H 2CGAA 3HKJB 3RXRA 1UHBA 4B2BA 1T8LA 1HIAA 1WSSH 2WPKS 1BBRH 1NRSH 2R3YA 4INKA 1P9UA 4F49A 4ABAA 3U8TH 2VIVA 2BDCA 3QTVH 1O0DH 2HNTE 4CBNA 3VGCC 3LT3A 2HPPH 2V3HH 4TWWA 2FZZA 1C1RA 2STBE 4ISLA 1MUEB 1AE8H 1CVWH 2R9PA 3HKIB 2AIQA 4LOYH 1CHGA 1JIRA 1HAZB 1KXDA 2ZGHA 3B23B 2H5CA 1O2GH 3SUEA 2ZU5A 1P3CA 4IC5A 5DP4A 4D9QA 1B5GH 1Z8JB 1QFKH 1OWDA 3BG4B 1SVPA 4O3TA 1TPOA 3BIVH 1SB1H 4WMDA 1Y59T 1GBBA 4Y8XA 3BIUH 3MNSA 2FS8A 1VGCC 4B2CA 3M61U 4U2WA 1C5OH 1ANDA 2CF8H 1CSOE 2F3CE 1C2MA 7LPRA 3WY8A 1UK3A 5JB8S 1V2WT 3DA9B 1HAVA 3RU4T 1KLTA 2FXRA 5C1UA 3VFEA 1YLCA 1RRKA 2W26A 1MBMA 1DICA 5B6OA 1ANBA 1MD8A 1G2LA 2FTMA 1O3IA 2WYJA 3FP6E 2D8WA 2P3TB 1BBRK 2LPRA 4B74A 3PMHB 3MH4A 2VWLA 3A7VA 1GVZA 1CQQA 1C5MD 4FUEA 4I8HA 4ISNA 1OYQA 3A7YA 2BX3A 3GCOA 1UCYE 1KXCA 2ZPRA 1K1OA 1O3OA 1MD7A 3BTEE 4UDWH 4JZEH 3RXJA 1KLIH 1RXPA 3IWMA 1AZ8A 3HK3B 2JH0D 3RUOA 1QIXB 1P04A 3T26A 1DOJA 4BAHB 3UNRA 4ESTE 1SGFG 1FMGA 1DX5M 1MAXA 4MLFB 3W94A 1BOQA 3ZVAA 1C5LH 4H42U 4UE7H 4X6MA 2ZPQA 3GCNA 1IQHA 3TK6A 5L30H 4MPWA 3LGIA 1Y3UA 3LPRA 3HATH 3PMBB 1C9PA 5CE1A 4TPIZ 1OSSA 1FONA 3Q00A 1YCPH 1P09A 5EXNA 2P95A 4Z0KA 1O3FA 5GCHG 4NIXA 4E7NA 4DCDA 1IAUA 1UVPA 1A3BH 1W14U 1OYTH 2BDIA 3ZZ3A 3RM2H 1GJ6A 2D2DA 2CHAC 3A8BA 3UNQA 1PPGE 1AY6H 3OSYA 4JZFH 2BLQA 5E0JA 1MCVA 2QCYA 2LIZA 4LZ1H 1YLDA 2XBVA 4D8NA 2VWOA 3ATKA 4RSPA 1XXDA 1O2SA 3RXSA 1YP9A 3Q77A 4ZKOU 2VIPA 2J2UA 2WPIS 1IQFA 3T25A 4X6PA 1AVGH 4ABJA 5A8ZA 1GMHG 3LGUA 1CT2E 1ZLRA 2PSXA 3OTJE 4NIWA 1GHZA 3CP7A 2FWWA 3FZDA 3LU9B 1VCWA 1ZJKA 4IMZA 1UTLM 1L0ZA 4Y0ZE 1TAWA 2G52A 1HAYB 5ETXA 3E3TA 1O2XA 3Q3YA 2WPLS 3UQOA 1MQ5A 2BY5X 2B5TB 2ZFPH 3ZVGA 1O5EH 1V2OT 3QO6A 1AWHB 1S83A 3SHAH 3B9FH 4B2AA 6CHAB 2FOAA 1MTNB 3NWUA 2UUKB 1FIWA 4HZHA 1B0EA 4RKOB 4WF8A 4WVPE 1KDQA 1TNLA 4DG4A 1F0UA 2QGRA 1D6WA 3RU4E 3A82A 2NU3E 2ODQA 4WWYA 4Q7ZA 1O2QA 1HV7A 4LK4A 1A5IA 3U98H 1A0JA 1Q2WA 4OS5A 3RMNH 1VITG 3PM3A 1QTFA 3A89A 2ZIQH 2AS9A 1O3MA 1C4V2 1GWAA 2A7HA 4FUCA 2AGEX 2ZTXA 2ALPA 3SQHE 3MU4A 1BTWA 1C1NA 3EYDA 4I31A 3A86A 2FI3E 5AHGH 2R3UA 1HAOH 3LGVA 3NK8A 3PROA 2OINA 3DT0H 1ZZZA 1FPCH 1ZMJA 1GI4A 4NA9H 3PLPA 1THSH 3EAJA 1GHBF 5A0BA 1ZRKA 2O9QA 3RXTA 2UUJB 2AIPA 1MCTA 3LC3A 1L1JA 1W11U 3QZRA 1GPZA 2WUCA 4UD9H 1XMNB 4WJG2 1MBQA 4IGDA 1DUAA 4AYYB 2XCNA 1L4DA 1O37A 1D9IA 1O3EA 4K2YA 2XWAA 1ELTA 2G4TA 5K0HA 3SNAA 2A1DB 3ZVBA 3F9HA 1UK4A 1C1MA 4X6NA 1AUJA 1EZUC 3ESTA 2A5IA 1GVKB 2C4FH 1P9SA 1SGCA 3SU4A 1C1OA 5F03A 5T6DA 2TBSA 2RDLA 1MKXH 1VGCB 1QR3E 2BD8A 2ODYB 1A2CH 1BTUA 1K1LA 3OYPA 1XUKA 3F6UH 1MZAA 4IBLH 9ESTA 4TPYA 1KSNA 3S7HB 1V2LT 1YYY1 1W0ZU 3TGJE 3RXHA 4KTUA 1KXBA 1UVTH 2NU0E 1AN1E 4BAMB 1TYNA 3RXAA 1TBZH 1EB2A 5C20A 1MTUA 3A88A 2FOMB 5E2PA 5GJ4B 3O8DA 1WV7H 4WH6A 5DJ7A 1ELEE 2FYRA 1UMAH 1CHOF 1DWCH 4ISIH 1GI3A 1F5RA 1RTKA 1O3GA 2BDGA 1HXEH 2VIQA 3E16B 2NU2E 1O2WA 2ZKSA 3GDUA 1CO7E 1BDAA 1LO6A 2GZ8A 3Q3KA 1OX1A 2EI7A 2ZFRH 1GDNA 2ZCKP 1S5SA 3H5CB 4X1RU 1VZQH 2QXIA 1NRRH 2RA0A 2RA3A 2ZGJA 3QGNB 1P05A 3TH4H 4YLUA 4K69A 1QHRB 3KGPA 4AB8A 2ZI2H 1XM1A 1O36A 4BXWA 1BQYA 2ZFTA 1O2MA 1HFDA 5EODA 3GCTF 2FMJA 1UTJA 1O2TA 3SNBA 1ETTH 1MAYA 1PPEE 4LZ4B 1O35A 2TGPZ 2Z3EA 1C5TA 3SJ9A 3M35A 3R0FA 3BSQA 2A5AA 3TITA 1GI2A 4CHAC 2IPHA 2BVSH 3FAOA 1GG6C 1YCPK 1IQJA 5AFYH 5FBIA 3TPIZ 1IOEA 2ZQ1A 5LPEA 1JOUB 2UUYA 1O2ZA 3TJUA 2C8XB 1WQSA 3I78A 1O5FH 1TGBA 4AG2A 2K7XA 3KN2A 2Y7ZA 3T29A 1GHWH 3LJOA 5F8XA 2HALA 1NESE 5DP9A 5C2ZA 1P10A 1W8BH 2ZP0H 1INCA 1NFWA 4CRGA 1DSTA 3RXOA 1H8DH 2EI6A 5JDUB 1LQEA 2GD4B 1BHXB 3O8BA 3AW1A 2ZU2A 2J38A 1GI0A 1O3KA 2SGFE 4FUDA 4A1VA 1C4U2 1XUJA 1L1GA 1TNKA 1C2DA 1D4PB 2HLCA 2OD3B 1EP5A 2PV9B 1JWTA 2J9NA 2ZHQH 3BTTE 2PUXB 4LXBH 1LVOA 1ELCA 1CGJE 2EC9H 2HVXA 1GJ5H 1C2JA 1RGQA 2ALVA 1FLEE 3PMAB 3F9EA 2ZWLH 4ABGA 1C2HA 1SLUB 1QGFA 2FM2A 3URCA 2Z3DA 5JBBS 2SGPE 2ZU4A 2D1JA 2XBYA 2ZECA 5DG6A 1J9CH 2VH0A 5HXFA 1MMJN 1UVUH 3BTWE 1LVMA 5IDKA 2ZCHP 4MQAA 1RTFB 2ZPSA 3GCHB 1FN8A 1V6DA 1FY5A 2DE9A 3FFGA 2BOHB 3EGKH 1K1NA 2C8YB 4CR9A 1E35B 1N6YA 1QL8A 4VGCB 1K1MA 4Y8ZA 1GBCA 2F9BH 5LPRA 5TCAA 4X6OA 1D3PB 3TVJB 2ZGBH 3RXFA 1T4UH 1BRBE 4I7YH 3GDVA 5EXLA 1BTXA 1V2MT 4ABIA 3SI4H 2ZQ2A 3ZVCA 3TIUA 2C8ZB 3LGYA 2QAAA 3R3GB 3VGCB 1ELBA 2HOBA 5FX6A 2D26C 4MPUA 3N7OA 3Q3XA 3P17H 4ZAEA 1GHVH 5GDSH 1XVMA 1EZXC 3E91A 1AE5A 3UUZA 2ODPA 4XE4A 4D76A 4AB9A 1S0RA 1SLVB 1HAIH 1O2KA 4YOGA 4K8YA 4X1SU 2PFEA 2F83A 4YM9A 1ZPZA 4WH8A 5A0CA 1UTPA 3MH7A 1TNIA 2ILNA 2FOGA 1O3JA 1LHFH 1EPTB 5EW2H 1RIWC 3SN8A 1EAXA 2W3KA 4Y8YA 5FCRA 2ANKH 4TY7A 1NFUA 2BM2A 4KKDA 1EKBB 1QRZA 2AH4X 3SV8A 2PTCE 1HAHH 4WY3A 5CHAC 3E0NB 1GHAF 2H9EH 2NWNA 1O5DH 3NXPA 3RXEA 1KTTB 1TLDA 1RFNA 3RC4A 1O31A 1SOTA 1ZYOA 4HTCH 1MKXK 1CT0E 1Z8IB 3BEFB 4X1QU 1FY8E 1NT1A 2AERH 2AMPA 1ZGIA 1UCYH 2ZF0H 1TALA 3AAUA 1SC8U 5C1XA 2AMQA 3IITA 2P3FH 1DDJA 2XCFA 2P8OB 4B1TA 1AIXH 2A4GA 2A4RA 5HGGA 1QURH 1VITF 4NFEA 2QF0A 2HWLB 5HMAA 3ZVFA 4RKJB 1ZRBA 1Y5BT 1NN6A 4Y0YE 1QJ7B 4SGBE 2G8TA 3E6PH 3TK9A 2GCTB 2PSYA 5BPEA 1OPHB 3KIDU 1LVYA 1OKXA 1G30B 1QA0A 5T6FA 1SFQB 5DO4H 3RXIA 2FS9A 1H1BA 3OY6U 3VB7A 2G5VA 3EQ0H 1ZPCA 1QBOA 1EATA 1XXFA 1C5SA 1HAGE 2GT7A 1OWJA 1D3QB 2FX4A 4MNVA 4ABHA 4NA7A 1CA8B 1IQKA 1GBHA 2VGCC 4O03A 4XOJA 1D3TB 1OWKA 4I32A 1FDPA 4B71A 1DT2A 2ANMH 3VEQB 3UOPA 4A92A 4XBCA 2WPMS 1DANH 2W7SA 4MPXA 2THFB 4Y71A 1O3PB 4NG9H 5EPYA 1HCGA 3FP8E 1NS3A 1NZQH 1QY6A 3F68H 3MWIU 1AO5A 5E0GA 3TJOA 1A5GH 3PTBA 4AFZA 2AFQB 1SGFA 1GCDA 1E0FD 1RS0A 5AVDA 1IQMA 1O5GH 1UK2A 2TIOA 1TE0A 3MU8A 4UONA 4AX9H 1V2JT 1FXYA 2BVXH 2OP9A 1YGCH 4FXGH 4CRBA 5BRRE 4INHA 4JZDH 3SV2H 5FAHA 3SORA 2FX6A 1GL1A 2FP7B 2ZFSA 3LH1A 3DD2H 1T8NA 3QN7A 4Y6DA 3S9CA 3UQVA 1G3EA 5J4QA 4UFGH 4X1PU 1YPGH 1FPHH 1QRWA 2BY6X 3LJJA 1C5UA 4GVUA 3QUMP 4X2VA 2QXHA 1GBFA 3ATMA 5GIBA 2QY0B 4U01A 2ZDKA 4E05H 1BB0B 1HRTH 1O38A 4I8JA 3JZ2B 3MI4A 2Z3CA 2ZDNA 2WPJS 1WBGB 1DY8A 3UFAA 2ZNKH 2ANWA 5JBTA 2BHGA 1DITH 1Y3YA 1HJAB 1GBAA 2F9PA 3MU5A 1H9LB 1BTZA 3PMJA 5I46H 1C1VH 3BTKE 1GDUA 3RXDA 1C2GA 1EJMA 4DIHH 1AVWA 2IOTA 1SGEE 4K3JA 3HGPA 4MNXA 1XVOA 1AKSB 1TGSZ 1LDTT 3TH2H 1CA0C 3ODFA 3RXBA 3BEUA 4O3UA 3EE0B 5C5OA 1PPCE 3SU3A 1BMNH 1CBWB 5DP7A 5L2YH 1AB9B 1ETRH 2OTVA 3ODDA 4INLA 5FBEA 1GJ9B 2O8TA 2OQ5A 1BRAA 1G3DA 3E0PB 1V2NT 4KP0A 3LONA 3DHKH 1OP2A 2SGEE 3GY5A 1OWIA 1EXFA 2P93A 3QLPH 1SQOA 1EX3A 4BNRA 3SQEE 4J2YB 2ZHEH 2BD7A 1TOMH 3A7ZA 1Z1IA 2GDEH 1F5LA 4A5TS 1O2JA 1K1IA 4B75A 4U32A 3LGTA 4AGJA 3SNDA 3GY8A 2ZDMA 4ZHMU 1SOZA 3PWBA 3SGQE 5DKMA 3TJNA 5SGAE 5ESBA 1CHOG 3PB1E 3OY5U 1O33A 1QBVH 1LMWB 3V3MA 1E37B 1O3BA 3ELAH 1TNJA 4Q80A 4NWKA 4Z6AH 1TBQH 3SNCA 1C5NH 4MTBA 2VH6A 2OC7A 3CENA 3B8JA 3LDXH 2JH5D 2PTNA 2FLBH 1BTHH 1KXAA 3RMLH 1O3NA 2FESH 2YOLA 4SGAE 3SOSA 3S9BA 4JK5A 1BJVA 3ZZ4A 1T32A 1Z6EA 3UY9A 5E8EH 1N8OB 5FX5A 1AWFH 1GJDB 3MU0A 2CF9H 1C9TA 2GZ9A 2Y7XA 3SNEA 1ID5H 4K1TA 1T31A 5GPIB 1S85A 1V2PT 1GMDF 2Y6TA 1WAYB 5F8ZA 4X2XA 1P0SH 2XTTB 1MU6B 1KXFA 1PQ5A 3D49H 1GBIA 1JRSA 2ANYA 2BY7X 1QJ6B 4DURA 5EQSA 4M7GA 3TGKE 4AN7A 1PYTC 1AVXA 2Z9IA 3O8CA 4I8KA 3O8RA 3M3TA 2F9NA 1Z8GA 3UWIA 2I6QA 4NFFA 1C5ZB 5LGOA 1P2MA 1O5CB 2JKHA 1FY3A 1D3DB 2GCHF 2B8OH 2CJIA 3KNXA 3A87A 5DP6A 5HYOA 1GMHF 2C93B 3P92A 1OWHA 3SO3A 3UNSA 3SI3H 1O32A 4ZXYH 1TMTH 1EASA 1GJBB 4R8TB 3RXVA 2XW9A 3Q76A 4XBDA 2C8WB 2RG3A 3UREA 2J34A 3RU4D 1SHYA 1K9OE 2R0LA 1TWXB 4ABEA 4DW2U 1J16A 2ZGXH 2FOBA 3F9FA 1SLXB 4DJZB 1O2LA 4ZROA 1VR1H 1TNHA 2GP9B 3UR6A 5EXMA 4GHTA 1S6HA 2VVCA 1N8OC 3L3TA 2VWNA 5ESTE 1CGIE 1L1NA 4FUGA 3A83A 5EQQA 4E06H 1SMFE 4Y10E 1B0FA 3K65B 1GGDB 2AGGX 2JH6D 1FN6A 1CGHA 2F9VA 3NKKA 3GCTG 3GOVB 4R0IA 5DK1A 4JYUH 1UTNA 2ZTZA 2XBXA 3M5OA 5AF9H 2BY8X 2EI8A 3MNXA 4TWYA 2VNTA 3OU0A 1TGNA 1MU8B 1N6XA 2Y5GA 3DFLA 1GBEA 1L4ZA 3VPKA 2SNVA 3QGJA 1FIZA 3P95A 3ZYEA 1C2EA 4D7GA 2VJ1A 1GHBG 2ZDLA 2A31A 3GICB 3ZVDA 1O3CA 1FUJA 2J92A 2JETB 3U8OH 1TX8A 4ABDA 3V13A 3MYWA 1YM0A 4MVNA 3TNTA 1A7SA 1GMCF 1W3CA 1O3AA 1THRH 2STAE 3U1IB 1AB9C 2R0KA 2A4OA 8ESTE 2QXGA 4I33A 1S0QA 1F0RA 1T8OA 3OX7U 1FJSA 2FPZA 1ETSH 1BRUP 1HAVB 4CREA 1FNIA 2XC4A 4VGCC 3F9GA 4GUXA 4CRDA 1UJ1A 1TFXA 4ABBA 3ZZCA 1F0SA 5TCCA 1GBMA 4DVAU 2W3IA 3HGNA 4Y7AA 2FEQH 3U1JB 4XDEA 1Y5UT 1B7XB 5EQRA 1UTQA 1GI7B 5AFZH 2UUFB 4OS6A 1HJAC 1DXPA 1OXGA 3S9AA 3K6ZA 3ZZ8A 1ANEA 1ZTLA 1K28D 3A81A 1D6RA 2EEKA 2GT8A 2BD5A 1HYLA 1HGTH 2F9OA 2B0FA 1J15A 1BUIA 4CH8B 4DGJA 1NU7B 4AORA 1BT7A 1YPHC 2G00A 1C1SA 5DP3A 3RXQA 1A1RA 3RXLA 3ZV9A 3SBKA 1NFXA 1V2UT 5FPTA 1Z8RA 1VITH 1DVAH 2GGVB 3HK6B 1TX7A 2FO9A 4YLQH 1C5RA 2G5NA 2UWPA 1AD8H 1DWBH 1WTHD 1LPGB 4GSOA 5E0HA 1CT4E 1M9UA 1YPKH 2SNWA 2TRMA 3FVFB 2Y5HA 2GKVE 3LIWA 1W7XH 3RM0H 1C1UH 3GYMA 2FLRH 2ZA5A 4X0WU 1OP8A 1TNGA 3EA7A 2OC0A 1NFYA 2O8MA 3TK5A 1RTLA 4O97A 1NY22 4FUBA 4Q7XA 4IN1A 3HPTB 2J95A 2RCEA 4OS4A 2GVFA 3SV7A 7ESTE 1ZSKA 4IC6A 1G3CA 2BVRH 1ZHPA 4J1YA 4BAOB 2Y80A 1DSUA 1O2HA 1KTSB 1GBJA 2R2WU 1MTNC 3D65E 1P2OA 1O39A 1BRCE 5JYIA 4FU9A 2G4UA 1PQ7A 1G37A 1AFQC 3LKWA 3T2NA 2QC2A 3BTFE 1G3BA 3QZQA 3RC5A 3ATIA 2ZDAH 1SL3A 1O3LA 1K1JA 3MO3A 2ZHFH 1BIOA 3S7KB 1UTKA 1BHXF 3ZZ6A 1LHCH 2HNTF 1SGTA 1GGDC 2BX4A 1W10U 2QXJA 3L33A 4NIYA 1LKAA 2QN5T 5DP8A 3SHCH 1SG8B 2SGDE 4MNYA 2BXUH 3PYHA 4BXSA 1HJ9A 4FU8A 3MO9A 1SGPE 4YTAA 2GZ7A 1GBTA 1AKSA 4FVBA 2B7DH 2V35A 1SFIA 4BTIB 2ZC9H 1UVOA 3AW0A 1NC6A 2P8OC 4CRFA 1Z7KA 5EGMA 1YPHE 1V2QT 1SGRE 3UOUA 1MZDA 1W2KH 4ABFA 5L2ZH 4KELA 2BZ6H 1T4VH 2PUQH 2SFAA 2BZAA 1BA8B 2ZDVH 1UO6A 1K22H 1O2PA 1QNJA 4OS2A 3GYLB 1LVBA 3VB6A 3VXFH 2BQ7B 5CHAB 4FUFA 1DLKB 2GV7A 2OC1A 1HLTH 1O3HA 2G81E 3RXCA 4AG1A 1A3EH 1BMLA 1SPJA 3M3VA 3BN9A 4YT6H 2LNCA 1ZOMA 2ZCLP 2W5EA 1DM4B 2XC0A 4GHQA 9LPRA 4I8GA 1P06A 1GL0E 4A1XA 1AFQB 2P94A 1H8IH 2DE8A 1RD3B 1C1PA 3KF2A 3QK1A 4A7IB 1F92A 4TY6A 4HFPB 1OP0A 1O30A 4KTSA 1DY9A 3KL6A 3M36A 4NWLA 4ZH8A 2HRVA 1C1QA 2FOFA 4ZXXH 3VB4A 4YOIA 4D9RA 1UCYK 1QB6A 2OBQA 1HNEE 1ZR0A 1MKWH 1BMMH 4FUJA 4X2WA 3URDA 2UWOA 2OXSA 2F91A 1ESAA 6GCHF 2PHBA 2C3SA 2PKAA 1F2SE 3MTYA 2HNTC 3ENSB 2A2XH 1ORFA 2YNBA 2VVVA 4MPVA 1C2IA 1GJAB 1TONA 1TMBH 1E38B 2GCTC 3P8FA 2P3UB 4X8UH 5C3NA 4BOHA 4NGAH 1VCPA 1SHHB 4Y76A 3TH3H 1C5PA 3SU0A 1GMDG 1SGYE 2XRCA 1TA2A 1HJ8A 1HUTH 5IYTA 4KGAA 1IHSH 3MFJA 5EG4A 3UR9A 2PLXA 3SJ8A
chains in the Genus database with same CATH superfamily
3RC6A 3ZZDA 1K1PA 3NCLA 1LHGH 4MDSA 1L2EA 4NZQA 1GHXH 4AYVB 1NRPH 2A4QA 3ATWA 5FPSA 3P70B 1O5BB 2V6NA 3AVZA 3A80A 4BAKB 2TPIZ 3FN8A 1CE5A 1DS2E 2VGCB 5A09A 3PLKA 1OS8A 1GI9B 1JRTA 1A0LA 1EOJA 2ZGCA 3A7TA 4ZHAA 4AC9A 2C90B 2IN2A 2ZFQH 3QTOH 1Y3WA 3OFND 2AEIH 1KXEA 4XD7D 1P12E 2VINA 3BTQE 2PGBB 1GHYH 3M5MA 6ESTA 1OWEA 5LPFA 3SYJA 4DT7B 2M5TA 1IQGA 3OEED 2AYWA 3RDZA 1MTWA 5C67A 1TA6A 1G2MA 1QQUA 2AGIX 2WYGA 1ZJDA 3E1XB 2JIZD 1FI8A 3QWCH 2W6ID 1O2YA 5FHTA 4YT7H 1QA7A 1E34B 1XKBC 3ZZ7A 1NRQH 1GJCB 1XX9A 4JYTA 2OBOA 1ELDE 3LGWA 2BY9X 3F1SB 3STJA 4OGYA 3TNSA 2Z6BD 4JK6A 2ZTYA 5JB9S 1F0TA 1H9IE 1KIGH 4O9VA 4U30A 1F5KU 4JZIA 5F8TA 1ESBA 7GCHG 3ITIA 2H1UA 1XUFA 4NSVA 4P00A 2PP6A 3S0NA 1WOFA 1KDQB 2FI5E 1HBTH 1EUFA 3ATLA 4HGCA 4CR5A 2BTCE 8KME2 2QF3A 2FOHA 2FYQA 1QQ4A 1Y5AT 3SGBE 3TJVA 3V7TA 3MNCA 3U69H 1TPPA 1ELAA 3ZV8A 1YCPM 3H7OA 2Z9GA 1HIAB 2VIOA 2BDAA 1IQLA 1ANCA 1O2NA 4ACBA 1S81A 1UTOA 2BLWA 1EP6A 4X8VH 4H6SB 3TGIE 1PQ8A 4I8LA 3GCHC 4GCHF 4UFDH 4A6LA 3A8CA 2ZFFH 2CMYA 1PJPA 1XUGA 2EQNA 3ZZ9A 3BV9B 4XBBA 1J17T 1J8AA 2XXLA 4NSYA 1NRNH 4Q2KA 2SGQE 1AUTC 3M7UA 3DSPA 5EW1H 4OS1A 2FTLE 2FDAA 2HGTH 3M5NA 5T6GA 1MKWK 1AMHA 4X8TH 3KCGH 2BDHA 2H5DA 3SGAE 1HAPH 1A4WH 1P11E 1A61H 2NU1E 2DUCA 1MH0A 1XKAC 4FUHA 4YO9A 3EBNA 1PPBH 1ZSJA 2TGDA 1TX6A 3SJKA 1ZSLA 1GCTB 1OOKB 2GCHG 1O34A 3PLBA 1SQRA 3I77A 4Y7BA 1V2ST 1TOCB 2BLOA 4A1TA 3GISB 5HM2A 2BQWB 3RMOH 3EDXB 5ABWA 1FQ3A 1GMCG 1TRNA 4ZUHA 3JZ1B 1ZHMA 4AFSA 3SUGA 1E36B 4B73A 1QB1A 2BD3A 1P2NA 3GY4A 4K1EA 2F43B 2F9UA 3VB3A 3KQBA 2ZHDA 1O3DA 2W6JD 1SR5C 3P6ZB 3RLYH 1TQ0B 4CRAA 4AFQA 4CBOA 5EJLA 1BITA 3LC5A 3NZIA 3M37A 4B76A 1VJAU 1P2KA 1E79D 3SV6A 1V2VT 4AFUA 2A7CA 2VWMA 1KY9A 1TB6H 1WYKA 1PPHE 5PTPA 2L6OA 3AAVA 1P2IA 3PO1C 1EOLA 1C5XB 1QCPA 4NZLA 1YF4A 2FOCA 2GV6A 3A7XA 4X1NU 4BTUB 1UTMA 2Q6GA 3A7WA 1GVLA 1C1TA 4DIIH 2BLVA 2FI4E 3L6PA 1KLJH 1BBRE 2YNAA 1DXWA 3NPSA 3E8LA 4Y79A 1HAXB 1DLEA 1LQDB 2O8WA 3EA8A 3CS0A 2BD9A 2Y81A 4YESB 3KQ5A 3N99A 1TGTA 3RXKA 3QDZB 3BG8A 2A32A 4XFQA 1O2OA 2G51A 2OC8A 1YKTA 4IW4E 5A0AE 2K1QA 3SUFA 2A45B 1S6FA 1AZZA 1A46H 1TGCA 5G4BA 4F4OC 2JETC 4Y11E 1GBKA 5GXPA 1C5QA 1DUEA 1S82A 1TRYA 1WTGH 1YC0A 2GJGA 3GY2A 1PYTD 2XWBI 2JJ1D 2VU8E 2WPHS 3FOAA 4CHAB 1PQAA 1PPZA 5CHBA 1C2FA 1EFRD 1ZMLA 3LOXA 2FOEA 1TABE 3RXUA 2WV4A 2XBWA 3A8AA 2NU4E 1WCZA 1Q31A 1JBUH 3V0XA 3M7TA 2BDYA 1C1WH 1AGJA 3ZYDA 4K5ZA 3E90B 1GDQA 5JBCS 5DP5A 1P02A 3DFJA 3FZZA 4ZKSU 2Y82A 2VIDA 1C2LA 1YPJH 1WQVH 1U6QA 2H9TH 4AOQA 2BQ6B 2KAIA 2VIWA 2QF5A 1WUNH 2YMSC 1ABIH 1P2JA 3AASA 4RT1A 5EJZA 2O8UA 1EJAA 6LPRA 1ESTA 1O2RA 1SGNE 1V2TT 3GY6A 1O2UA 4BANB 2I6SA 1QB9A 1NM6A 1QL7A 2A5KA 2OUAA 2WINI 2ZHWH 3P8OA 1T8MA 2XOKD 2EA3A 1AU8A 2P16A 2PKSC 3SZNA 1PFXC 4FU7A 1IQIA 5EOKA 1LCYA 1V3XA 1P8VC 2ZEBA 3UWJH 1W0KD 5C5NA 2BDBA 3MNBA 4ZHLU 5CMXH 4JZ1A 1QZ8A 5E2OA 4K1SA 2HPQH 2OCVB 1FZZA 1MTSA 2OQUA 3F2GA 2J94A 1TQ7B 5GWZA 2V3MA 1GJ7B 4NCYA 3SV9A 3U28C 4ZMAH 2P59A 1C5YB 3I29A 1EQ9A 1EZSC 1GJ8B 2Q6DA 2TGAA 1DWEH 1DWDH 3D62A 1J14A 1SSXA 3KQCA 3SU6A 1ZTKA 1FV9A 1QBNA 2PKAB 4FUIA 4CH2B 1SQTA 2B9LA 2H2ZA 3NUMA 1DE7H 1EPTA 5FPYA 3G01A 1XUIA 3MH6A 1N1LA 1RJXB 5EPNA 4MG3A 3T62A 4HI3A 1GJ4H 3T5FH 8LPRA 1JMOH 1C4Y2 4IN2A 1Y3VA 3T27A 2BD2A 3PTNA 5FCKA 2Z9KA 3W95A 1H4WA 1G36A 1A0HB 1O2VA 3C1KA 1LHEH 1BTYA 5L6NH 3CS7A 1W0YH 1GG6B 4UFEH 5FXLA 2WUBA 3UIRA 2PWXA 4IMQA 1H9HE 4GCHG 2VB0A 1T7CA 5I25A 1EAWA 2PKSB 5LH8A 1EB1H 3GDSA 4YZUA 3UTUH 2OLGA 1S6LA 1NROH 1GI8B 3K6YA 2A2QH 2R2MB 1HDTH 1VKYA 2ZO3H 1TBRH 3SJIA 2KAIB 3H7TA 1SGQE 1W7GH 3KYFA 1SGIB 4X2YA 4D7FA 8GCHF 3ZVEA 4UEHH 3GS9A 1ZGVA 2V3OH 2ZU3A 1TPAE 2XNIA 2ZG0H 2ESTE 1V2KT 1F7ZA 2BMGB 2QIQA 1ELGA 3MHWU 2PR3A 4IS5A 1SQAA 1W12U 2FIRH 4OGXA 2CXVA 4F48B 1NO9H 3BG4C 2KR7A 4WXVA 3MU1A 1NTPA 1ZTJA 3OE7D 4PROA 4DY7B 2HVYB 1S84A 5EU8A 4UFFH 3M5LA 3LH3A 2BYAX 3BTGE 3PV4A 3ZZAA 4Z1MD 1QJ1B 1GI5A 1ZHRA 4ASHA 5GCHF 1Q3XA 3UPEA 1DFPA 3QX5H 1CBWC 4GLYA 6CHAC 3GY7A 4BAQB 1JXPA 2VVUA 5HIZA 1TPSA 3A85A 1AQ7A 2WPDD 3UAIC 1CA0B 1LHDH 2XYAA 3RP2A 1HXFH 1HPGA 4DOQA 5H4IB 3RXPA 2Q6FA 3P8NA 3SW2B 1ABJH 4TSFD 1FY4A 3BEIB 3GY3A 1Z6JH 4ZKNU 1GI1A 2GMTC 1GI6A 1TRMA 1ZPBA 4CRCA 3M7QA 1BTPA 1K2I1 1Z71A 2BXTH 2CV3A 1RIWB 1IHTH 1KYNA 4K8BA 3TLOA 3U8RH 1EPTC 4WXIA 1BJUA 2QA9E 4H4FA 1EJNA 1LPZB 2Q1JA 4E7RG 2CN0H 3TU7H 3ZZBA 4TYDA 2KFWA 4WMFA 3PO1B 4JYVH 2G55A 4GPGA 3M3SA 3CNRA 2GDDA 1P01A 2V7QD 1C5VA 2XC5A 1Z1JA 2AMDA 5DN6D 1GBDA 2UWLA 2CHAB 2WV5A 2PW8H 2J4IA 3SUDA 3STIA 1A5HA 4I86A 4KTCA 1QL9A 1UVSH 3KEEA 3P8GA 1P03A 3VB5A 1AHTH 1YPLH 1ACBE 2BB4A 5DPAA 1AFEH 1ELVA 1TMUH 3MH5A 3U9AH 1EZQA 3A8DA 3PWCA 4GAWA 4NA8A 4H6TA 1ELFA 1P57B 1Y3XA 2ZU1A 1SBWA 1W13U 2QYIA 1ZMNA 5T1VA 3RMMH 1PPFE 2GTBA 1FY1A 3RLWH 1VJ9U 3PV5A 3D23A 2RFKC 3MMGA 5A8YA 3ZZ5A 4JCNA 2A7JA 3FANA 2ULLA 3VXEH 1ARCA 1YPMH 2FODA 3MOCA 5A8XA 4XSKU 3BTHE 3MO6A 5A2MH 1DPOA 1GCTC 1C5WB 3KQEA 2Z7FE 7KMEH 2Z9JA 5C1YA 5F6MA 3KQDA 5JPMH 1UHBB 3KHVA 6GCHG 4YOJA 2TGTA 4YXWD 1EAUA 1O5AB 2H6MA 1SLWB 4QT8C 1G9IE 3RXGA 1NBME 4BTTB 1V2RT 1FAKH 2PGQB 7GCHF 2H9HA 1Y8TA 4ASUD 3RXMA 1TIOA 2ZZUH 2BOKA 1X7AC 1THPB 2IJOB 1EAIA 1WU1A 3IG6B 4RN6A 1FAXA 1P3EA 4OS7A 3FP7E 2W7UA 1XUHA 4ISHH 3BTDE 1NU9A 3K9XB 3A84A 4NIVA 3DUXH 1MTVA 2V0BA 1P2QA 4JMYA 5DSFA 2O8LA 1SGDE 5C0UA 3K2UA 5TJXA 1YBWA 1SI5H 4Q4LA 4K60A 1K21H 2QV1A 5B6LA 5J4SA 2A0QB 1QRXA 1GHAG 3V12A 1ARBA 4HG6A 1LPKB 4WMEA 1LKBA 3SU1A 1LTOA 3SU5A 3BTME 1IQEA 1HB0B 1AI8H 2Z9LA 3S69A 4FVDA 1G32B 5JBAS 1YPEH 1O2IA 1C2KA 1JIMA 4AZ2B 3C27B 3SU2A 2Y5FA 1BMAA 2ASUB 4B6EA 5HM9A 4THNH 1BZXE 4ZKRU 3SJOA 1CU1A 5K7RA 2Z94A 4Q7YA 4X8SH 4MNWA 1NPMA 3T28A 1IQNA 4AGKA 2GMTB 2BD4A 2GX4A 3EA9A 5DGJA 1VCQA 5T3HA 1BCUH 2SGAA 4ISOA 1GBLA 1MQ6A 8GCHG 3BF6H 2CGAA 3HKJB 3RXRA 1UHBA 4B2BA 1T8LA 1HIAA 2QF4A 4DT4A 1WSSH 2WPKS 1BBRH 1NRSH 2R3YA 4INKA 1P9UA 4F49A 2KM0A 4ABAA 3U8TH 2VIVA 2BDCA 3QTVH 1O0DH 2HNTE 4CBNA 3VGCC 3LT3A 2HPPH 2V3HH 4TWWA 2FZZA 1C1RA 2STBE 4ISLA 3H09A 1MUEB 1AE8H 1CVWH 2R9PA 3HKIB 2AIQA 4LOYH 1CHGA 1JIRA 1HAZB 1KXDA 2ZGHA 3B23B 2H5CA 1O2GH 3SUEA 2ZU5A 1P3CA 4IC5A 5DP4A 4D9QA 5KECA 1B5GH 1Z8JB 1QFKH 1OWDA 3BG4B 1SVPA 4O3TA 1TPOA 3BIVH 5HIYA 1SB1H 4WMDA 1Y59T 1GBBA 4Y8XA 3BIUH 2EY4C 3MNSA 2FS8A 1VGCC 4B2CA 3M61U 4M9FA 4U2WA 1C5OH 1ANDA 2CF8H 1CSOE 2F3CE 4FOUC 1C2MA 7LPRA 3WY8A 1UK3A 5JB8S 2J5UA 1V2WT 3DA9B 1HAVA 3RU4T 1KLTA 2FXRA 5C1UA 3VFEA 1YLCA 1RRKA 2W26A 1MBMA 1DICA 5B6OA 1ANBA 1MD8A 1G2LA 2FTMA 1O3IA 2WYJA 3FP6E 2D8WA 2P3TB 1BBRK 2LPRA 4B74A 3PMHB 3MH4A 2VWLA 3A7VA 1GVZA 1CQQA 1C5MD 4FUEA 4I8HA 4ISNA 4RI0A 1OYQA 3A7YA 2BX3A 3GCOA 1UCYE 1KXCA 2ZPRA 1K1OA 1O3OA 1MD7A 3BTEE 4UDWH 4JZEH 3RXJA 5EJ1A 1KLIH 1RXPA 3IWMA 1AZ8A 3HK3B 2JH0D 3RUOA 1QIXB 1P04A 3T26A 1DOJA 4BAHB 3UNRA 4ESTE 1MABB 1SGFG 1FMGA 1DX5M 1MAXA 4MLFB 3W94A 1BOQA 3ZVAA 4F55A 1C5LH 4H42U 4UE7H 4X6MA 2ZPQA 3GCNA 1IQHA 3TK6A 5L30H 4MPWA 3LGIA 1Y3UA 3LPRA 3HATH 3PMBB 1C9PA 5FL7D 5CE1A 4TPIZ 1OSSA 1FONA 3Q00A 1YCPH 1P09A 5EXNA 2P95A 4Z0KA 1O3FA 5GCHG 4NIXA 4E7NA 4DCDA 4TT3D 1IAUA 1UVPA 1A3BH 1W14U 1OYTH 2BDIA 3ZZ3A 3RM2H 1GJ6A 2D2DA 2CHAC 2YMSD 3A8BA 3UNQA 1PPGE 1AY6H 3OSYA 4JZFH 2BLQA 5E0JA 1MCVA 2QCYA 2LIZA 4LZ1H 1YLDA 2XBVA 4D8NA 2VWOA 3ATKA 4RSPA 1XXDA 1O2SA 3RXSA 1YP9A 3Q77A 4ZKOU 2VIPA 2OK5A 2J2UA 2WPIS 1IQFA 3T25A 4X6PA 1AVGH 4ABJA 5A8ZA 1GMHG 3LGUA 1CT2E 1ZLRA 2PSXA 3OTJE 4NIWA 1GHZA 3DSOA 2YMSB 3CP7A 2FWWA 3FZDA 3LU9B 1VCWA 1ZJKA 4IMZA 1UTLM 1L0ZA 4Y0ZE 1TAWA 2G52A 1HAYB 5ETXA 3E3TA 1O2XA 3Q3YA 2WPLS 3UQOA 2KCPA 1MQ5A 2BY5X 2B5TB 2ZFPH 3ZVGA 1O5EH 1V2OT 3QO6A 1AWHB 1S83A 3SHAH 3B9FH 4B2AA 6CHAB 3AK5A 2FOAA 1MTNB 3NWUA 3PV2A 2UUKB 1FIWA 4HZHA 1B0EA 4RKOB 4WF8A 4WVPE 1KDQA 1TNLA 4DG4A 1F0UA 2QGRA 1D6WA 3RU4E 3A82A 2NU3E 2ODQA 4WWYA 4Q7ZA 1O2QA 1HV7A 4LK4A 1A5IA 3U98H 1A0JA 1Q2WA 4OS5A 3RMNH 1VITG 3PM3A 1OHHD 1QTFA 5HKKD 3A89A 2ZIQH 2AS9A 1O3MA 1C4V2 1GWAA 2A7HA 4FUCA 2AGEX 2ZTXA 2ALPA 3SQHE 3MU4A 1BTWA 4FETA 1C1NA 3EYDA 4I31A 3A86A 2FI3E 5AHGH 2R3UA 1HAOH 3LGVA 2KX4A 3NK8A 3PROA 2OINA 3DT0H 1ZZZA 1FPCH 1ZMJA 1GI4A 4NA9H 4RT0A 3FO8D 3PLPA 1THSH 3EAJA 1GHBF 5A0BA 1ZRKA 2O9QA 3RXTA 2UUJB 2AIPA 1MCTA 3LC3A 1L1JA 2VBCA 1W11U 3QZRA 1GPZA 2WUCA 4UD9H 1XMNB 4WJG2 1MBQA 4IGDA 1DUAA 4AYYB 2XCNA 1L4DA 1O37A 1D9IA 1O3EA 4K2YA 2XWAA 1ELTA 2G4TA 5K0HA 3SNAA 2A1DB 3ZVBA 3F9HA 1UK4A 1C1MA 4X6NA 1AUJA 1EZUC 3ESTA 2A5IA 1GVKB 2C4FH 1P9SA 1SGCA 3SU4A 1C1OA 5F03A 5T6DA 2TBSA 2RDLA 1MKXH 1VGCB 1QR3E 2BD8A 2ODYB 1A2CH 1BTUA 1K1LA 3OYPA 1XUKA 3F6UH 1MZAA 4IBLH 9ESTA 4TPYA 1KSNA 3S7HB 1V2LT 1YYY1 1W0ZU 3TGJE 1E1QD 4KTUA 3RXHA 1KXBA 1UVTH 2NU0E 1AN1E 4BAMB 1TYNA 3RXAA 1TBZH 1EB2A 5GNDA 5C20A 1MTUA 3A88A 2FOMB 5E2PA 5GJ4B 3O8DA 1WV7H 4WH6A 3N7DA 1COWD 5DJ7A 1ELEE 2FYRA 1UMAH 1CHOF 1DWCH 4ISIH 1GI3A 1F5RA 1RTKA 1O3GA 2K0QA 2BDGA 1HXEH 2VIQA 3E16B 2NU2E 3WWFA 1O2WA 2ZKSA 3GDUA 1CO7E 1BDAA 1LO6A 2GZ8A 3Q3KA 1OX1A 2EI7A 2ZFRH 1GDNA 2ZCKP 1S5SA 3H5CB 4X1RU 1VZQH 2QXIA 1NRRH 2RA0A 2RA3A 2ZGJA 3QGNB 1P05A 3TH4H 4YLUA 4K69A 1QHRB 3KGPA 4AB8A 2ZI2H 1XM1A 1O36A 4BXWA 1BQYA 2ZFTA 1O2MA 1HFDA 5EODA 3GCTF 2FMJA 1UTJA 1O2TA 2KCOA 3SNBA 1ETTH 1MAYA 1PPEE 4LZ4B 1O35A 2WSSD 2TGPZ 2Z3EA 1C5TA 3SJ9A 3M35A 3F2FA 3R0FA 3BSQA 2A5AA 3TITA 1GI2A 4CHAC 2IPHA 2BVSH 3F0OA 3FAOA 1GG6C 1YCPK 1IQJA 5AFYH 5FBIA 3TPIZ 1IOEA 2ZQ1A 5LPEA 1JOUB 2UUYA 1O2ZA 3TJUA 2C8XB 1WQSA 3I78A 1O5FH 1TGBA 4AG2A 2K7XA 3KN2A 2Y7ZA 3T29A 3SZEA 1GHWH 3LJOA 5F8XA 2HALA 1NESE 5DP9A 3OTPA 1P10A 1W8BH 5C2ZA 2ZP0H 1INCA 1NFWA 4CRGA 1DSTA 3RXOA 1H8DH 2EI6A 5JDUB 1LQEA 2GD4B 1BHXB 3O8BA 3AW1A 2JJ2D 2ZU2A 2J38A 4B6FA 1GI0A 1O3KA 2SGFE 4FUDA 4A1VA 1C4U2 1XUJA 1L1GA 1TNKA 1C2DA 1D4PB 2HLCA 2OD3B 1EP5A 2PV9B 1JWTA 2J9NA 2ZHQH 3BTTE 2PUXB 4LXBH 1LVOA 1ELCA 1CGJE 2EC9H 2HVXA 1GJ5H 1C2JA 1RGQA 2ALVA 1FLEE 3PMAB 3F9EA 2ZWLH 4ABGA 1C2HA 1SLUB 1QGFA 2FM2A 3URCA 2Z3DA 5JBBS 2SGPE 2ZU4A 2D1JA 2XBYA 2ZECA 1SKYE 1J9CH 2VH0A 5DG6A 5HXFA 1MMJN 1UVUH 3BTWE 1LVMA 5IDKA 2ZCHP 4MQAA 1RTFB 2ZPSA 3GCHB 1FN8A 1V6DA 1FY5A 2DE9A 3FFGA 2BOHB 3EGKH 1K1NA 2C8YB 2M2AA 4CR9A 1E35B 1N6YA 1QL8A 4VGCB 1K1MA 4Y8ZA 1GBCA 2F9BH 5LPRA 1H8ED 5TCAA 4X6OA 1D3PB 3TVJB 2ZGBH 3RXFA 1T4UH 1BRBE 4I7YH 3GDVA 5EXLA 1BTXA 1V2MT 4ABIA 3SI4H 2ZQ2A 3ZVCA 3TIUA 2C8ZB 3LGYA 2QAAA 3R3GB 3VGCB 1ELBA 2HOBA 2CK3D 5FX6A 2D26C 4MPUA 3N7OA 3Q3XA 3P17H 4ZAEA 1GHVH 5GDSH 1XVMA 1EZXC 3E91A 1AE5A 3UUZA 2ODPA 4XE4A 4D76A 4AB9A 1S0RA 1SLVB 1HAIH 1O2KA 4YOGA 4K8YA 4X1SU 2PFEA 2F83A 4YM9A 1ZPZA 4WH8A 5A0CA 1UTPA 3MH7A 1TNIA 2ILNA 2FOGA 1O3JA 1LHFH 1EPTB 5EW2H 1RIWC 3SN8A 1EAXA 2W3KA 4Y8YA 4ACAA 5FCRA 2ANKH 4TY7A 1NFUA 2BM2A 4KKDA 1EKBB 1QRZA 2AH4X 3SV8A 2PTCE 1HAHH 4WY3A 5CHAC 3E0NB 1GHAF 2H9EH 2NWNA 1O5DH 3NXPA 3RXEA 1KTTB 1TLDA 1RFNA 3RC4A 1O31A 1SOTA 1ZYOA 4HTCH 1MKXK 1CT0E 1Z8IB 3BEFB 4X1QU 1FY8E 1NT1A 2AERH 2AMPA 1ZGIA 1UCYH 2ZF0H 1TALA 3AAUA 1SC8U 5C1XA 2AMQA 3IITA 2P3FH 1DDJA 2XCFA 2P8OB 4B1TA 1AIXH 2A4GA 2A4RA 5HGGA 1QURH 1VITF 4NFEA 2QF0A 2HWLB 5HMAA 3ZVFA 4RKJB 1ZRBA 1FX0B 1Y5BT 1NN6A 4Y0YE 1QJ7B 5F53A 4SGBE 3PRDA 2G8TA 3E6PH 3TK9A 2GCTB 2PSYA 5BPEA 1OPHB 3KIDU 1LVYA 1OKXA 1G30B 1QA0A 5T6FA 1SFQB 5DO4H 3RXIA 2FS9A 1H1BA 3OY6U 3VB7A 2G5VA 3EQ0H 1ZPCA 1QBOA 1EATA 1XXFA 1C5SA 1HAGE 2GT7A 1OWJA 1D3QB 2FX4A 4MNVA 4ABHA 4NA7A 1CA8B 1IQKA 1GBHA 2VGCC 3KYGA 4O03A 5C0TA 1YWUA 2AHME 1D3TB 1OWKA 4XOJA 4I32A 1FDPA 4B71A 1DT2A 2ANMH 3VEQB 3UOPA 2J98B 4A92A 4XBCA 2WPMS 1DANH 2W7SA 4MPXA 2THFB 4Y71A 1O3PB 4NG9H 3DCLA 5EPYA 1HCGA 3FP8E 1NS3A 1NZQH 1QY6A 3F68H 3MWIU 1AO5A 5E0GA 3TJOA 1A5GH 3PTBA 4AFZA 2AFQB 5C94A 1SGFA 1GCDA 5KEDA 1E0FD 1RS0A 5AVDA 1IQMA 1O5GH 1UK2A 2TIOA 1TE0A 4XRNA 3MU8A 4UONA 4AX9H 1V2JT 5CDFE 1FXYA 2BVXH 2OP9A 1YGCH 4FXGH 4CRBA 5BRRE 4INHA 4JZDH 3SV2H 5FAHA 3SORA 2FX6A 1GL1A 2FP7B 2ZFSA 3LH1A 3DD2H 1T8NA 3QN7A 4Y6DA 3S9CA 3UQVA 1G3EA 5J4QA 4UFGH 4X1PU 1YPGH 1FPHH 2RDEA 1QRWA 3F3BA 2BY6X 3LJJA 1C5UA 4GVUA 3QUMP 4X2VA 2QXHA 1GBFA 3ATMA 5GIBA 2QY0B 4U01A 2ZDKA 4E05H 1BB0B 1HRTH 1KMHB 1O38A 4I8JA 3JZ2B 3MI4A 2Z3CA 3FKSD 1E1RD 2ZDNA 2WPJS 1WBGB 1DY8A 3UFAA 2ZNKH 2ANWA 2J98A 5JBTA 2BHGA 1DITH 1Y3YA 1HJAB 1GBAA 3WWBA 2F9PA 3MU5A 1H9LB 1BTZA 3PMJA 5I46H 1C1VH 3BTKE 2JDID 1GDUA 3RXDA 1C2GA 1EJMA 4DIHH 1AVWA 2IOTA 1SGEE 4K3JA 3HGPA 4MNXA 1XVOA 1AKSB 1TGSZ 1LDTT 3TH2H 1CA0C 3ODFA 3RXBA 3BEUA 4O3UA 3EE0B 5C5OA 1PPCE 3SU3A 1BMNH 1CBWB 5DP7A 5L2YH 1AB9B 1ETRH 2OTVA 3ODDA 4INLA 5FBEA 1GJ9B 2O8TA 2OQ5A 1BRAA 1G3DA 3E0PB 2QE7D 1V2NT 2WZQA 4KP0A 3LONA 3DHKH 1OP2A 2SGEE 3GY5A 1OWIA 1EXFA 2P93A 1H8HD 1SQOA 1EX3A 4BNRA 3QLPH 3SQEE 4J2YB 2ZHEH 2BD7A 1TOMH 3A7ZA 1Z1IA 2GDEH 1F5LA 4A5TS 1O2JA 1K1IA 4B75A 4U32A 3LGTA 4AGJA 3SNDA 3GY8A 2ZDMA 3VG8A 4ZHMU 1SOZA 3PWBA 3SGQE 5DKMA 3TJNA 5SGAE 5ESBA 1CHOG 3PB1E 3OY5U 1O33A 1QBVH 1LMWB 3V3MA 1E37B 1O3BA 3ELAH 1TNJA 4Q80A 4NWKA 4Z6AH 5IK2D 1TBQH 3SNCA 1C5NH 4MTBA 2VH6A 2OC7A 3CENA 3B8JA 3LDXH 2JH5D 1W0JD 2PTNA 2FLBH 1BTHH 1KXAA 3RMLH 1O3NA 2FESH 2YOLA 4SGAE 3SOSA 3S9BA 4JK5A 1BJVA 3ZZ4A 1T32A 1Z6EA 3UY9A 5E8EH 1N8OB 5FX5A 1AWFH 1GJDB 3MU0A 2CF9H 1C9TA 2GZ9A 2Y7XA 3SNEA 1ID5H 4K1TA 1T31A 5GPIB 1S85A 1V2PT 1GMDF 2Y6TA 1WAYB 5F8ZA 4X2XA 2IJD1 1P0SH 2XTTB 1MU6B 1KXFA 1PQ5A 3D49H 1GBIA 1JRSA 2ANYA 2BY7X 1QJ6B 4DURA 5EQSA 4M7GA 3TGKE 4AN7A 1PYTC 1AVXA 2Z9IA 3O8CA 4I8KA 3O8RA 3M3TA 2F9NA 1Z8GA 3UWIA 2I6QA 4NFFA 1C5ZB 5LGOA 1P2MA 1O5CB 2JKHA 1FY3A 1D3DB 2GCHF 2B8OH 2CJIA 3KNXA 3A87A 5DP6A 2F4LA 5HYOA 1GMHF 2C93B 3P92A 1OWHA 3SO3A 3UNSA 3SI3H 1O32A 4ZXYH 2HLDD 1TMTH 1EASA 1GJBB 4R8TB 3RXVA 2XW9A 3Q76A 4XBDA 3F0PA 2C8WB 2RG3A 3UREA 2J34A 3RU4D 1SHYA 1K9OE 2R0LA 1TWXB 4ABEA 2IPQX 4DW2U 1J16A 2ZGXH 2FOBA 3OEHD 3F9FA 1SLXB 4DJZB 1O2LA 4ZROA 1VR1H 1TNHA 2GP9B 3UR6A 5EXMA 4GHTA 1S6HA 2VVCA 1N8OC 3L3TA 2VWNA 5ESTE 1CGIE 1L1NA 4FUGA 3A83A 5EQQA 4E06H 1SMFE 4Y10E 1B0FA 3K65B 1GGDB 2AGGX 2JH6D 1FN6A 1CGHA 2F9VA 3NKKA 3GCTG 3GOVB 4R0IA 5DK1A 1YLNA 4JYUH 1UTNA 2ZTZA 2LELA 2XBXA 3M5OA 5AF9H 2BY8X 2EI8A 3MNXA 4TWYA 2VNTA 1YY3A 3OU0A 1TGNA 1MU8B 1N6XA 2Y5GA 3DFLA 1GBEA 1L4ZA 3VPKA 2SNVA 3QGJA 5C17A 1FIZA 3P95A 3ZYEA 1C2EA 4D7GA 2VJ1A 1GHBG 2ZDLA 2A31A 3GICB 3ZVDA 1O3CA 1FUJA 2J92A 2JETB 3U8OH 1TX8A 4ABDA 3V13A 3MYWA 1YM0A 4MVNA 3TNTA 1A7SA 1GMCF 1W3CA 1O3AA 1THRH 2STAE 3U1IB 1AB9C 2R0KA 2KZ4A 2A4OA 8ESTE 2QXGA 4I33A 1S0QA 1F0RA 1T8OA 3OX7U 1FJSA 2FPZA 1ETSH 1BRUP 1HAVB 4CREA 1FNIA 2XC4A 4VGCC 3F9GA 4GUXA 1WDIA 4CRDA 1UJ1A 1TFXA 4ABBA 3ZZCA 1F0SA 5TCCA 1GBMA 4DVAU 2W3IA 3HGNA 4Y7AA 2FEQH 3U1JB 3F2HA 4XDEA 1Y5UT 1B7XB 5EQRA 5KGOA 1UTQA 1GI7B 5AFZH 2UUFB 4OS6A 1HJAC 1DXPA 1OXGA 3S9AA 3K6ZA 3ZZ8A 3PRBA 1ANEA 1ZTLA 1K28D 3A81A 1D6RA 2EEKA 2GT8A 2BD5A 1HYLA 1HGTH 3NRLA 1BMFD 2F9OA 1WXRA 2B0FA 1J15A 2XNDD 3N7EA 1BUIA 4CH8B 4DGJA 1NU7B 2LP6A 4AORA 1BT7A 1YPHC 4P02A 2G00A 1C1SA 5DP3A 3RXQA 1A1RA 3RXLA 3ZV9A 3SBKA 1NFXA 1V2UT 5FPTA 1Z8RA 1VITH 1DVAH 2GGVB 3HK6B 1TX7A 2FO9A 4YLQH 1C5RA 2G5NA 3MQKC 2UWPA 1AD8H 1DWBH 1WTHD 1LPGB 4GSOA 5E0HA 1CT4E 1M9UA 1YPKH 2SNWA 2KCAA 2TRMA 3FVFB 2Y5HA 2GKVE 3LIWA 1W7XH 3RM0H 1C1UH 3GYMA 2FLRH 2ZA5A 4X0WU 1OP8A 1TNGA 3EA7A 2OC0A 1NFYA 2O8MA 3TK5A 1RTLA 4O97A 1NY22 4FUBA 4Q7XA 4IN1A 3HPTB 2J95A 2RCEA 4OS4A 2GVFA 3SV7A 3OAAD 3W1EA 7ESTE 1ZSKA 4IC6A 1G3CA 2BVRH 1ZHPA 4J1YA 4BAOB 2Y80A 1DSUA 1O2HA 1KTSB 1GBJA 2R2WU 1MTNC 3D65E 1P2OA 1O39A 1BRCE 5JYIA 4FU9A 2G4UA 1PQ7A 1G37A 1AFQC 3LKWA 3T2NA 2QC2A 3BTFE 1G3BA 3QZQA 3RC5A 3ATIA 2ZDAH 1SL3A 1O3LA 1K1JA 3ZIAD 3MO3A 2ZHFH 1BIOA 3S7KB 1UTKA 1BHXF 3ZZ6A 1LHCH 2HNTF 1SGTA 1GGDC 2BX4A 1W10U 1UW7A 2QXJA 3L33A 4NIYA 1LKAA 2QN5T 5DP8A 3SHCH 1SG8B 2SGDE 4MNYA 2BXUH 3PYHA 5EIYA 4BXSA 1HJ9A 4FU8A 3MO9A 1SGPE 4YTAA 2GZ7A 2WV9A 1GBTA 1AKSA 4FVBA 2B7DH 2V35A 1SFIA 4BTIB 2ZC9H 1UVOA 3AW0A 1NC6A 2P8OC 4CRFA 1Z7KA 5EGMA 1YPHE 1V2QT 4Q63A 1SGRE 3UOUA 1MZDA 1W2KH 4ABFA 5L2ZH 4KELA 2BZ6H 1T4VH 2PUQH 2SFAA 2BZAA 1BA8B 3DSGA 2ZDVH 1UO6A 1K22H 1O2PA 3WW7A 1QNJA 4OS2A 3GYLB 1LVBA 3VB6A 3VXFH 2BQ7B 5CHAB 4FUFA 1DLKB 1K0HA 2GV7A 2OC1A 1HLTH 1O3HA 2G81E 3RXCA 4AG1A 1A3EH 1BMLA 1SPJA 2WHXA 2KCYA 3M3VA 3BN9A 4YT6H 2LNCA 1ZOMA 2ZCLP 2W5EA 1DM4B 2XC0A 4GHQA 9LPRA 4I8GA 1P06A 1GL0E 4A1XA 1AFQB 2P94A 1H8IH 2DE8A 1NBMD 1RD3B 1C1PA 3KF2A 3QK1A 4A7IB 1F92A 4TY6A 4HFPB 1OP0A 1O30A 4KTSA 1DY9A 2L74A 3KL6A 3M36A 4NWLA 4ZH8A 2HRVA 1C1QA 2FOFA 4ZXXH 3VB4A 4YOIA 4D9RA 1UCYK 1QB6A 2OBQA 4ZCNA 1HNEE 1ZR0A 1MKWH 1BMMH 4FUJA 4X2WA 3URDA 2UWOA 2OXSA 2F91A 1ESAA 6GCHF 2PHBA 2C3SA 2PKAA 2K8IA 1F2SE 3MTYA 2HNTC 3ENSB 3UB0A 2A2XH 1ORFA 2YNBA 2VVVA 4MPVA 1C2IA 1GJAB 1TONA 1TMBH 1E38B 2GCTC 3P8FA 2P3UB 4OM9A 4X8UH 5C3NA 4BOHA 4NGAH 1VCPA 1SHHB 4Y76A 2J97A 3TH3H 1C5PA 3SU0A 1GMDG 1SGYE 2XRCA 1TA2A 1HJ8A 1HUTH 5IYTA 4KGAA 1IHSH 3EE7A 3MFJA 5EG4A 3UR9A 2PLXA 3SJ8A
chains in the Genus database with same CATH topology
3RC6A 3ZZDA 1K1PA 3NCLA 1LHGH 4MDSA 1L2EA 4NZQA 1GHXH 4AYVB 1NRPH 2A4QA 3ATWA 5FPSA 3P70B 1O5BB 2V6NA 3AVZA 3A80A 4BAKB 2TPIZ 1CE5A 1DS2E 2VGCB 5A09A 3PLKA 1OS8A 1GI9B 1JRTA 1A0LA 1EOJA 2ZGCA 3A7TA 4ZHAA 2C90B 2IN2A 2ZFQH 3QTOH 1Y3WA 2AEIH 1KXEA 1P12E 2VINA 3BTQE 2PGBB 1GHYH 3M5MA 6ESTA 1OWEA 5LPFA 4DT7B 2M5TA 1IQGA 2AYWA 3RDZA 1MTWA 5C67A 1TA6A 1G2MA 1QQUA 2AGIX 2WYGA 1ZJDA 3E1XB 1FI8A 3QWCH 1O2YA 5FHTA 4YT7H 1QA7A 1E34B 1XKBC 3ZZ7A 1NRQH 1GJCB 1XX9A 4JYTA 2OBOA 1ELDE 3LGWA 2BY9X 3F1SB 3STJA 4OGYA 3TNSA 2Z6BD 4JK6A 2ZTYA 5JB9S 1F0TA 1H9IE 1KIGH 4O9VA 4U30A 1F5KU 4JZIA 5F8TA 1ESBA 7GCHG 3ITIA 2H1UA 1XUFA 4NSVA 3S0NA 1WOFA 1KDQB 2FI5E 1HBTH 1EUFA 3ATLA 4HGCA 4CR5A 2BTCE 8KME2 2QF3A 2FOHA 2FYQA 1QQ4A 1Y5AT 3SGBE 3TJVA 3V7TA 3MNCA 3U69H 1TPPA 1ELAA 3ZV8A 1YCPM 3H7OA 2Z9GA 1HIAB 2VIOA 2BDAA 1IQLA 1ANCA 1O2NA 1S81A 1UTOA 2BLWA 1EP6A 4X8VH 4H6SB 3TGIE 1PQ8A 4I8LA 3GCHC 4GCHF 4UFDH 4A6LA 3A8CA 2ZFFH 2CMYA 1PJPA 1XUGA 3ZZ9A 3BV9B 4XBBA 1J17T 1J8AA 2XXLA 4NSYA 1NRNH 4Q2KA 2SGQE 1AUTC 3M7UA 5EW1H 4OS1A 2FTLE 2FDAA 2HGTH 3M5NA 5T6GA 1MKWK 1AMHA 4X8TH 3KCGH 2BDHA 2H5DA 3SGAE 1HAPH 1A4WH 1P11E 1A61H 2NU1E 2DUCA 1MH0A 1XKAC 4FUHA 4YO9A 3EBNA 2TGDA 1PPBH 1ZSJA 1TX6A 3SJKA 1ZSLA 1GCTB 1OOKB 2GCHG 1O34A 3PLBA 3I77A 4Y7BA 1V2ST 1TOCB 2BLOA 4A1TA 3GISB 5HM2A 2BQWB 3RMOH 3EDXB 5ABWA 1FQ3A 1GMCG 1TRNA 4ZUHA 3JZ1B 1ZHMA 4AFSA 3SUGA 1E36B 4B73A 1QB1A 2BD3A 1P2NA 3GY4A 4K1EA 2F9UA 3VB3A 3KQBA 2ZHDA 1O3DA 1SR5C 3P6ZB 3RLYH 1TQ0B 4CRAA 4AFQA 4CBOA 1BITA 3LC5A 3NZIA 3M37A 4B76A 1VJAU 1P2KA 3SV6A 1V2VT 4AFUA 2A7CA 2VWMA 1KY9A 1TB6H 1WYKA 1PPHE 5PTPA 3AAVA 1P2IA 3PO1C 1EOLA 1C5XB 1QCPA 4NZLA 1YF4A 2FOCA 2GV6A 3A7XA 4X1NU 4BTUB 1UTMA 2Q6GA 3A7WA 1GVLA 1C1TA 4DIIH 2BLVA 2FI4E 3L6PA 1KLJH 1BBRE 2YNAA 1DXWA 3NPSA 3E8LA 4Y79A 1HAXB 1DLEA 1LQDB 2O8WA 3EA8A 3CS0A 2BD9A 2Y81A 4YESB 1TGTA 3RXKA 3QDZB 3BG8A 2A32A 4XFQA 1O2OA 2G51A 2OC8A 1YKTA 4IW4E 5A0AE 2K1QA 3SUFA 2A45B 1S6FA 1AZZA 1A46H 1TGCA 5G4BA 4F4OC 2JETC 4Y11E 1GBKA 5GXPA 1C5QA 1DUEA 1S82A 1TRYA 1WTGH 1YC0A 3GY2A 1PYTD 2XWBI 2VU8E 2WPHS 4CHAB 1PQAA 1PPZA 1C2FA 1ZMLA 3LOXA 2FOEA 1TABE 3RXUA 2WV4A 2XBWA 3A8AA 2NU4E 1WCZA 1Q31A 1JBUH 3V0XA 3M7TA 2BDYA 1C1WH 1AGJA 3ZYDA 4K5ZA 3E90B 1GDQA 5JBCS 5DP5A 1P02A 3DFJA 3FZZA 4ZKSU 2Y82A 2VIDA 1C2LA 1YPJH 1WQVH 1U6QA 2H9TH 4AOQA 2BQ6B 2KAIA 2VIWA 1WUNH 1ABIH 1P2JA 3AASA 2O8UA 1EJAA 6LPRA 1ESTA 1O2RA 1SGNE 1V2TT 3GY6A 1O2UA 4BANB 2I6SA 1QB9A 1NM6A 1QL7A 2A5KA 2OUAA 2WINI 2ZHWH 3P8OA 1T8MA 2EA3A 1AU8A 2P16A 2PKSC 3SZNA 1PFXC 4FU7A 1IQIA 5EOKA 1LCYA 1V3XA 1P8VC 2ZEBA 3UWJH 5C5NA 2BDBA 3MNBA 4ZHLU 5CMXH 4JZ1A 5E2OA 4K1SA 2HPQH 2OCVB 1FZZA 1MTSA 2OQUA 2J94A 1TQ7B 5GWZA 4NCYA 1GJ7B 3SV9A 4ZMAH 2P59A 1C5YB 3I29A 1EQ9A 1EZSC 1GJ8B 2Q6DA 2TGAA 1DWEH 1DWDH 3D62A 1J14A 1SSXA 3KQCA 3SU6A 1ZTKA 1FV9A 1QBNA 2PKAB 4FUIA 4CH2B 1SQTA 2B9LA 2H2ZA 3NUMA 1DE7H 1EPTA 5FPYA 3G01A 1XUIA 3MH6A 1N1LA 1RJXB 5EPNA 4MG3A 3T62A 4HI3A 1GJ4H 3T5FH 8LPRA 1JMOH 1C4Y2 4IN2A 1Y3VA 3T27A 2BD2A 3PTNA 5FCKA 2Z9KA 3W95A 1H4WA 1G36A 1A0HB 1O2VA 3C1KA 1LHEH 1BTYA 5L6NH 3CS7A 1W0YH 1GG6B 4UFEH 5FXLA 2WUBA 3UIRA 2PWXA 4IMQA 1H9HE 4GCHG 2VB0A 1T7CA 5I25A 1EAWA 2PKSB 5LH8A 1EB1H 3GDSA 4YZUA 3UTUH 2OLGA 1NROH 1GI8B 3K6YA 2A2QH 2R2MB 1HDTH 2ZO3H 1TBRH 3SJIA 2KAIB 3H7TA 1SGQE 1W7GH 1SGIB 4X2YA 4D7FA 8GCHF 3ZVEA 4UEHH 1ZGVA 2V3OH 2ZU3A 1TPAE 2XNIA 2ZG0H 2ESTE 1V2KT 1F7ZA 2BMGB 2QIQA 1ELGA 3MHWU 2PR3A 4IS5A 1SQAA 1W12U 2FIRH 4OGXA 2CXVA 1NO9H 3BG4C 4WXVA 3MU1A 1NTPA 1ZTJA 4PROA 4DY7B 1S84A 5EU8A 4UFFH 3M5LA 3LH3A 2BYAX 3BTGE 3PV4A 3ZZAA 1QJ1B 1GI5A 1ZHRA 4ASHA 5GCHF 1Q3XA 3UPEA 1DFPA 3QX5H 1CBWC 4GLYA 6CHAC 3GY7A 4BAQB 1JXPA 2VVUA 1TPSA 3A85A 1AQ7A 1CA0B 1LHDH 2XYAA 3RP2A 1HXFH 1HPGA 4DOQA 5H4IB 3RXPA 2Q6FA 3P8NA 3SW2B 1ABJH 1FY4A 3BEIB 3GY3A 1Z6JH 4ZKNU 1GI1A 2GMTC 1GI6A 1TRMA 1ZPBA 4CRCA 3M7QA 1BTPA 1K2I1 1Z71A 2BXTH 2CV3A 1RIWB 1IHTH 1KYNA 4K8BA 3TLOA 3U8RH 1EPTC 4WXIA 1BJUA 2QA9E 4H4FA 1EJNA 1LPZB 2Q1JA 4E7RG 2CN0H 3TU7H 3ZZBA 4TYDA 4WMFA 3PO1B 4JYVH 2G55A 4GPGA 3M3SA 2GDDA 1P01A 1C5VA 2XC5A 1Z1JA 2AMDA 1GBDA 2UWLA 2CHAB 2WV5A 2PW8H 2J4IA 3SUDA 3STIA 1A5HA 4KTCA 1QL9A 1UVSH 3KEEA 3P8GA 1P03A 3VB5A 1AHTH 1YPLH 1ACBE 2BB4A 5DPAA 1AFEH 1ELVA 1TMUH 3MH5A 3U9AH 1EZQA 3A8DA 3PWCA 4GAWA 4NA8A 4H6TA 1ELFA 1P57B 1Y3XA 2ZU1A 1SBWA 1W13U 2QYIA 1ZMNA 3RMMH 1PPFE 2GTBA 1FY1A 3RLWH 1VJ9U 3D23A 3MMGA 5A8YA 3ZZ5A 4JCNA 2A7JA 3FANA 2ULLA 3VXEH 1ARCA 1YPMH 2FODA 3MOCA 5A8XA 4XSKU 3BTHE 3MO6A 5A2MH 1DPOA 1GCTC 1C5WB 3KQEA 2Z7FE 7KMEH 2Z9JA 5C1YA 5F6MA 3KQDA 5JPMH 1UHBB 3KHVA 6GCHG 4YOJA 2TGTA 1EAUA 1O5AB 2H6MA 1SLWB 4QT8C 1G9IE 3RXGA 4BTTB 1V2RT 1FAKH 2PGQB 7GCHF 2H9HA 1Y8TA 3RXMA 1TIOA 2ZZUH 2BOKA 1X7AC 1THPB 2IJOB 1EAIA 1WU1A 3IG6B 4RN6A 1FAXA 1P3EA 4OS7A 3FP7E 2W7UA 1XUHA 4ISHH 3BTDE 1NU9A 3K9XB 3A84A 4NIVA 3DUXH 1MTVA 2V0BA 1P2QA 4JMYA 2O8LA 1SGDE 3K2UA 5TJXA 1YBWA 1SI5H 4K60A 1K21H 2QV1A 5J4SA 2A0QB 1QRXA 1GHAG 3V12A 1ARBA 1LPKB 4WMEA 1LKBA 3SU1A 1LTOA 3SU5A 3BTME 1IQEA 1HB0B 1AI8H 2Z9LA 3S69A 4FVDA 1G32B 5JBAS 1YPEH 1O2IA 1C2KA 1JIMA 4AZ2B 3C27B 3SU2A 2Y5FA 1BMAA 2ASUB 5HM9A 4THNH 1BZXE 4ZKRU 3SJOA 1CU1A 5K7RA 2Z94A 4Q7YA 4X8SH 4MNWA 1NPMA 3T28A 1IQNA 4AGKA 2GMTB 2BD4A 2GX4A 3EA9A 5DGJA 1VCQA 5T3HA 1BCUH 2SGAA 4ISOA 1GBLA 1MQ6A 8GCHG 3BF6H 2CGAA 3HKJB 3RXRA 1UHBA 4B2BA 1T8LA 1HIAA 1WSSH 2WPKS 1BBRH 1NRSH 2R3YA 4INKA 1P9UA 4F49A 4ABAA 3U8TH 2VIVA 2BDCA 3QTVH 1O0DH 2HNTE 4CBNA 3VGCC 3LT3A 2HPPH 2V3HH 4TWWA 2FZZA 1C1RA 2STBE 4ISLA 1MUEB 1AE8H 1CVWH 2R9PA 3HKIB 2AIQA 4LOYH 1CHGA 1JIRA 1HAZB 1KXDA 2ZGHA 3B23B 2H5CA 1O2GH 3SUEA 2ZU5A 1P3CA 4IC5A 5DP4A 4D9QA 1B5GH 1Z8JB 1QFKH 1OWDA 3BG4B 1SVPA 4O3TA 1TPOA 3BIVH 1SB1H 4WMDA 1Y59T 1GBBA 4Y8XA 3BIUH 3MNSA 2FS8A 1VGCC 4B2CA 3M61U 4U2WA 1C5OH 1ANDA 2CF8H 1CSOE 2F3CE 1C2MA 7LPRA 3WY8A 1UK3A 5JB8S 1V2WT 3DA9B 1HAVA 3RU4T 1KLTA 2FXRA 5C1UA 3VFEA 1YLCA 1RRKA 2W26A 1MBMA 1DICA 5B6OA 1ANBA 1MD8A 1G2LA 2FTMA 1O3IA 2WYJA 3FP6E 2D8WA 2P3TB 1BBRK 2LPRA 4B74A 3PMHB 3MH4A 2VWLA 3A7VA 1GVZA 1CQQA 1C5MD 4FUEA 4I8HA 4ISNA 1OYQA 3A7YA 2BX3A 3GCOA 1UCYE 1KXCA 2ZPRA 1K1OA 1O3OA 1MD7A 3BTEE 4UDWH 4JZEH 3RXJA 1KLIH 1RXPA 3IWMA 1AZ8A 3HK3B 2JH0D 3RUOA 1QIXB 1P04A 3T26A 1DOJA 4BAHB 3UNRA 4ESTE 1SGFG 1FMGA 1DX5M 1MAXA 4MLFB 3W94A 1BOQA 3ZVAA 1C5LH 4H42U 4UE7H 4X6MA 2ZPQA 3GCNA 1IQHA 3TK6A 5L30H 4MPWA 3LGIA 1Y3UA 3LPRA 3HATH 3PMBB 1C9PA 5CE1A 4TPIZ 1OSSA 1FONA 3Q00A 1YCPH 1P09A 5EXNA 2P95A 4Z0KA 1O3FA 5GCHG 4NIXA 4E7NA 4DCDA 1IAUA 1UVPA 1A3BH 1W14U 1OYTH 2BDIA 3ZZ3A 3RM2H 1GJ6A 2D2DA 2CHAC 3A8BA 3UNQA 1PPGE 1AY6H 3OSYA 4JZFH 2BLQA 5E0JA 1MCVA 2QCYA 2LIZA 4LZ1H 1YLDA 2XBVA 4D8NA 2VWOA 3ATKA 4RSPA 1XXDA 1O2SA 3RXSA 1YP9A 3Q77A 4ZKOU 2VIPA 2J2UA 2WPIS 1IQFA 3T25A 4X6PA 1AVGH 4ABJA 5A8ZA 1GMHG 3LGUA 1CT2E 1ZLRA 2PSXA 3OTJE 4NIWA 1GHZA 3CP7A 2FWWA 3FZDA 3LU9B 1VCWA 1ZJKA 4IMZA 1UTLM 1L0ZA 4Y0ZE 1TAWA 2G52A 1HAYB 5ETXA 3E3TA 1O2XA 3Q3YA 2WPLS 3UQOA 1MQ5A 2BY5X 2B5TB 2ZFPH 3ZVGA 1O5EH 1V2OT 3QO6A 1AWHB 1S83A 3SHAH 3B9FH 4B2AA 6CHAB 2FOAA 1MTNB 3NWUA 2UUKB 1FIWA 4HZHA 1B0EA 4RKOB 4WF8A 4WVPE 1KDQA 1TNLA 4DG4A 1F0UA 2QGRA 1D6WA 3RU4E 3A82A 2NU3E 2ODQA 4WWYA 4Q7ZA 1O2QA 1HV7A 4LK4A 1A5IA 3U98H 1A0JA 1Q2WA 4OS5A 3RMNH 1VITG 3PM3A 1QTFA 3A89A 2ZIQH 2AS9A 1O3MA 1C4V2 1GWAA 2A7HA 4FUCA 2AGEX 2ZTXA 2ALPA 3SQHE 3MU4A 1BTWA 1C1NA 3EYDA 4I31A 3A86A 2FI3E 5AHGH 2R3UA 1HAOH 3LGVA 3NK8A 3PROA 2OINA 3DT0H 1ZZZA 1FPCH 1ZMJA 1GI4A 4NA9H 3PLPA 1THSH 3EAJA 1GHBF 5A0BA 1ZRKA 2O9QA 3RXTA 2UUJB 2AIPA 1MCTA 3LC3A 1L1JA 1W11U 3QZRA 1GPZA 2WUCA 4UD9H 1XMNB 4WJG2 1MBQA 4IGDA 1DUAA 4AYYB 2XCNA 1L4DA 1O37A 1D9IA 1O3EA 4K2YA 2XWAA 1ELTA 2G4TA 5K0HA 3SNAA 2A1DB 3ZVBA 3F9HA 1UK4A 1C1MA 4X6NA 1AUJA 1EZUC 3ESTA 2A5IA 1GVKB 2C4FH 1P9SA 1SGCA 3SU4A 1C1OA 5F03A 5T6DA 2TBSA 2RDLA 1MKXH 1VGCB 1QR3E 2BD8A 2ODYB 1A2CH 1BTUA 1K1LA