3IWMA

The octameric sars-cov main protease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
301
structure length
301
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Three-dimensional domain swapping as a mechanism to lock the active conformation in a super-active octamer of SARS-CoV main protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 62
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3iwmA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3iwmA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3iwmA01
4FUJA 3QZRA 1C5RA 1SQAA 1GJ7B 2O8WA 4Y0YE 1BRCE 1ZHRA 3UIRA 1BTWA 1ETRH 1C2MA 2H9TH 2NU2E 1IOEA 2F9UA 5E0GA 1DANH 1W10U 2GCTB 2XW9A 3ODDA 2ZTZA 4R0IA 3ZZ8A 2ZPSA 1HUTH 2XCFA 5DKMA 3SGQE 1NU9A 1O2UA 2A7HA 1JBUH 2EEKA 2PGBB 3MMGA 3SN8A 2ANWA 2FDAA 2A4OA 2FEQH 2P59A 3G01A 3VB6A 1ID5H 2FOMB 3ZV9A 1DLEA 1AZ8A 1O3FA 1X7AC 3O8RA 3PROA 4Y6DA 5C1XA 1OS8A 3ITIA 4UFDH 1L0ZA 1THSH 1HDTH 4ZHLU 1PFXC 1VR1H 2Z3CA 3EA7A 1G37A 1SVPA 4XBDA 1GCDA 2BVXH 2H5DA 4OS7A 1EZQA 2TRMA 5H4IB 3LGTA 2VB0A 3D65E 2XCNA 8GCHF 3HK6B 5CHAC 5HGGA 1XUHA 1A0HB 1GI8B 2VIVA 3SHAH 1VGCB 1BIOA 2BZ6H 3T26A 1C5PA 1SHHB 3E91A 4NA8A 1BCUH 2VGCB 2R9PA 3GCNA 4UFFH 4D7FA 1MTUA 1C5MD 1P04A 2PSYA 4ZHAA 2W5EA 4ISNA 3MH5A 1H8IH 1HJAC 4Y11E 1O2YA 2ZFSA 2VWNA 1ZOMA 3AASA 2GVFA 1Z6JH 2W7UA 1MBQA 2HNTE 2FS8A 1K2I1 1BMMH 2LIZA 1ZSLA 1S81A 1ZMNA 1JXPA 1NRRH 1AWFH 2W3KA 2A4QA 1Y5BT 4JCNA 2ANKH 3FP7E 2BD8A 2G8TA 4AGJA 1EOJA 4TWYA 5J4QA 1V2RT 1GVKB 2FM2A 1BITA 1TBQH 4YOIA 1KTSB 2GCTC 4ABGA 1LVMA 4CRAA 2ZCKP 1GI4A 1TBRH 2R2WU 1Z8RA 4ZKNU 1AB9B 1ESBA 1HRTH 4ZKRU 4CRGA 1CU1A 4X6NA 1GBTA 1UTQA 1AI8H 1LVOA 1ZZZA 3IWMA 1ESAA 2KAIA 2UWOA 1EZXC 1HXFH 1KXBA 2OC8A 1ELDE 5T6DA 1BHXB 2G52A 1UVSH 1GHYH 1C5XB 2THFB 3QX5H 1NROH 2R0KA 3SNAA 1Z1JA 2ZDLA 1A0LA 1BZXE 2XBWA 4ZROA 3U1IB 2FWWA 2EC9H 1S0RA 2IN2A 4BTIB 3LGUA 1AUTC 1ELAA 1NPMA 5HM2A 1DX5M 3H7TA 2UUJB 1PJPA 1KXEA 2P16A 2HPQH 5EQQA 2RCEA 1VGCC 3MNXA 2VGCC 3GYLB 3HGPA 3QZQA 4GSOA 1FIZA 5CMXH 1F0RA 2ODQA 1QBVH 2AH4X 5PTPA 1BTXA 5I25A 1LPZB 2XWAA 1EP6A 2DE8A 4A5TS 1C9PA 5GPIB 1P2KA 1KXCA 2QA9E 3ZZDA 3TIUA 4D8NA 1G3DA 4X2VA 3SJ9A 3ZVGA 1OKXA 2WPJS 2VH6A 2A45B 1C1MA 4TY6A 4AFZA 3I77A 1CA8B 2ZQ2A 1AE5A 3PYHA 2D8WA 1P2QA 3HGNA 4IN1A 1MUEB 4HGCA 2WPLS 3TH4H 4B2AA 3ZVAA 1K22H 1K1JA 1NRNH 2UWPA 3RXTA 1GI2A 4TPYA 1EKBB 4FUDA 2ALVA 1DWCH 2G00A 5FX5A 1JIMA 4WF8A 1BBRK 1LVBA 3RXJA 5ABWA 3RDZA 6GCHG 4XSKU 1G36A 2GZ9A 1BA8B 1GBIA 4NIWA 1JIRA 1FJSA 1WCZA 1QURH 4ZHMU 2ZA5A 5DG6A 3SI3H 4KELA 4DOQA 4X1SU 4E7RG 3Q76A 4AGKA 3K65B 1WSSH 2J9NA 2VU8E 7LPRA 3SU2A 4KKDA 1BT7A 1C2JA 1GHAF 1MAXA 4WXIA 1O33A 1RTFB 1V2TT 2BDHA 2BZAA 2XBYA 1P12E 4KTSA 3MU1A 2JKHA 2GV7A 4CH2B 1GBMA 1U6QA 1OWDA 4A1TA 1ESTA 2GDEH 4WVPE 1E0FD 4CH8B 1MTSA 1YCPK 2WUCA 3UFAA 2CV3A 4O3UA 2Y80A 2GT7A 1QBNA 1OOKB 3OTJE 1AUJA 3UR9A 1GMHG 4AFQA 4AOQA 2BLOA 2BLQA 3SU0A 3A8BA 1DPOA 1RTLA 1FN8A 1EATA 8ESTE 1TRNA 2OCVB 1PPHE 4FUFA 1GJAB 1J14A 1EB2A 1NS3A 1GBHA 3JZ1B 4ISIH 3VGCB 4WMFA 3PMJA 4YT7H 1GJ6A 3RLYH 1K9OE 2C3SA 1UCYH 1IQEA 1SI5H 5EGMA 1QJ1B 1DXWA 2ZZUH 2PTCE 2A2QH 2UUYA 1Y59T 1AIXH 2JETB 1HIAB 1HAHH 3RU4T 2BY6X 2K1QA 1AU8A 2AERH 2XXLA 3SQEE 5GWZA 1GDUA 4A1VA 1GPZA 8KME2 1FLEE 2OQ5A 2V3HH 1O0DH 1H9HE 1FIWA 2HPPH 4AB9A 1O2RA 3SV7A 2CHAB 2JH0D 4HTCH 1LHGH 3RXFA 2J2UA 1NRSH 1KTTB 4INLA 3SU4A 3F9HA 4O3TA 3LGYA 3M5NA 2A7CA 1TPOA 1BRUP 2TPIZ 3CENA 4Y79A 1C2HA 4JYTA 3M61U 3HATH 2AS9A 3DFJA 4NZQA 1GHXH 1Z1IA 2V6NA 3F9GA 1FMGA 2FODA 3VEQB 2Y5GA 5FPSA 5FCRA 2QYIA 2ZFQH 3OX7U 2JH6D 2BXTH 3QUMP 1SGQE 4Q7YA 3M7UA 2IOTA 3FZZA 1O3HA 3RMMH 3QK1A 1Y3VA 3LT3A 4A92A 4THNH 1T8NA 3LKWA 1CT2E 1G3EA 3ZVCA 1TPSA 1O2IA 1C5ZB 3CS0A 1EPTB 2GKVE 3SZNA 2RDLA 2ZU4A 1K28D 4I7YH 2AGGX 1S85A 1XUGA 2ZHEH 1ELBA 4B75A 2VVUA 3S7KB 5FBIA 3EA8A 2ZGHA 1YF4A 1XUJA 4H4FA 3RXPA 2TGTA 1YPLH 1O39A 3UQVA 3TJNA 1QQUA 3BG4B 1PPCE 3U98H 5DP7A 1MBMA 3RXOA 3U69H 5A8XA 1P03A 1ZMLA 1C4U2 1PPGE 5DJ7A 5JDUB 1FY8E 1HIAA 1CHOG 2JETC 3O8DA 5LGOA 1DFPA 5T3HA 2Q6FA 1O3AA 1ABIH 4I8LA 1O5FH 2UUKB 1SGEE 1ARCA 1G3BA 4BAHB 3ZVBA 5F8ZA 4F4OC 4X1PU 2CHAC 3IG6B 1HAGE 1SFQB 1NZQH 1DUAA 3M36A 1V2QT 3W94A 1QRWA 2Y7XA 3ZZ9A 3PV4A 4B74A 3KHVA 3LC3A 1GBJA 2O8TA 5A0BA 2M5TA 3UQOA 2WPMS 2F83A 3M7TA 2A4GA 1LVYA 1SBWA 1P3CA 1O2XA 3SV9A 4GVUA 3DA9B 2PKAA 3TH3H 2B9LA 4K60A 1RS0A 1TWXB 2C8YB 4Y7BA 3T5FH 3VB4A 4CR5A 4E05H 4KTCA 5DK1A 3B9FH 3E0PB 2ZTXA 3T27A 1EPTA 4FUEA 2ZU2A 2QF3A 1EPTC 3NWUA 1F0TA 3PMAB 1UJ1A 1TX7A 2FZZA 1AKSB 2VVVA 1GJBB 5F03A 2CMYA 3DFLA 4ABFA 1XKBC 2TGDA 4JYVH 4NFFA 5HM9A 3EA9A 3ATIA 3GCHC 1EX3A 2FOGA 3BG4C 3GCTG 4WH8A 3SJIA 2ZU3A 1SMFE 4MQAA 5C3NA 1V2PT 5DPAA 1GI1A 2ZQ1A 1WBGB 1LCYA 1TMBH 4DGJA 6GCHF 3OY6U 1ACBE 4ISHH 3A7YA 3FP8E 4OGXA 3H7OA 1VCWA 3NZIA 5CE1A 2ZDMA 3A7XA 3RXSA 3SNBA 1FV9A 1KIGH 4B71A 1L1GA 1GBDA 2SGQE 4ESTE 1O3KA 2QXGA 1ZTJA 4I33A 1LPGB 1QB6A 3KEEA 3SJKA 1FDPA 3WY8A 3ZZ5A 3QDZB 5AHGH 2Q6DA 4YO9A 2HVXA 1K1NA 1EJMA 1P2MA 2TBSA 4NFEA 1ANDA 1SHYA 3RC5A 2FOEA 2A7JA 3GY3A 1FY4A 1V2JT 4K1TA 4OS6A 1YPEH 4UDWH 3KNXA 5DP6A 1QBOA 3TGKE 2ZGCA 3TK6A 4MPWA 4OS5A 3UY9A 4K69A 1V2UT 1NRPH 1A5HA 1K1IA 1PQAA 5JBAS 2RA3A 4JK5A 1CA0C 3BIVH 2ZHDA 4ZH8A 3RXLA 4O03A 1LDTT 4VGCB 3UTUH 2C8WB 2BD5A 1NFXA 2ZWLH 2HOBA 2WPHS 1D3DB 5IDKA 4FUIA 3LIWA 2FIRH 1O31A 2O8LA 3RXDA 1J15A 1O2OA 4AB8A 2C93B 2Y82A 3KIDU 3TNSA 1BQYA 1J17T 1GBCA 1QJ6B 1DICA 2NU1E 1GHWH 4ZAEA 2Z9JA 5A8YA 1HJ8A 5DP4A 3RXQA 2XRCA 1ARBA 3P8OA 2ZC9H 1TRMA 5EQRA 4RKOB 2XC0A 1O2JA 1NFWA 3GYMA 3TGJE 1KXDA 3P70B 1MZAA 2Y81A 1HNEE 4I8KA 3RXMA 1H4WA 1Y3UA 3S9BA 3SJOA 1GGDB 2J38A 3RC6A 1SLWB 2VIPA 4MNVA 1HAOH 5IYTA 2QV1A 3JZ2B 4Y7AA 1JRSA 1GMCG 2FI5E 4NIXA 3VB3A 3PLKA 2BQ6B 1UVPA 3UNQA 3ZZCA 1O5CB 4DIIH 1IQHA 2IPHA 2QY0B 2O9QA 3BTQE 5EPYA 1TRYA 3MU5A 2QXJA 1O3NA 4ABHA 4ZXXH 2OC1A 1A0JA 5FBEA 2PWXA 1V2ST 2BY5X 1W3CA 1LKBA 1W7GH 3SORA 3W95A 1GL0E 1V2KT 3SU1A 1DWBH 1HBTH 1IAUA 2H6MA 2GCHG 4K1SA 2OXSA 1C1OA 4TY7A 2QCYA 1QB1A 1YLDA 2ZDKA 1EAUA 1BMLA 1FY5A 1HAXB 1C1UH 1Q3XA 4BNRA 2Z94A 3L6PA 1B0FA 1O2KA 6LPRA 2P3FH 2GD4B 1S6HA 1BUIA 3GDSA 4I32A 1C1QA 1HFDA 2NU4E 2ZGXH 4MNYA 2BYAX 1O2WA 2G51A 2VIWA 2QF0A 5F8TA 3L33A 3QN7A 3UPEA 2ZU1A 3MU8A 2YNBA 1C2FA 1EAXA 5EPNA 4CRFA 6CHAB 2GT8A 3SUFA 2ZFTA 1H9LB 3N7OA 2WUBA 2PV9B 2UWLA 2FYRA 4IS5A 1HYLA 4K8BA 5E2OA 1UTKA 3MHWU 4MG3A 3UUZA 2TGPZ 3EGKH 4A1XA 1YPHE 4YOJA 1HGTH 2BX3A 1HCGA 2B5TB 1S84A 1FY3A 1O30A 1Z7KA 2XC5A 1C1NA 4Y71A 4WJG2 3HKJB 1O3CA 1CBWC 3E0NB 3ZZ6A 5EW1H 3GICB 1N6YA 3HK3B 2GX4A 1AE8H 3OY5U 1EZSC 4FUCA 1K1OA 1KYNA 1D3TB 2FOAA 3M7QA 2AYWA 3BF6H 5ESTE 2GMTB 1D4PB 1XXFA 3MU0A 1SGFG 1D6RA 1HAIH 5DP5A 1FPCH 1SGPE 1PPFE 1T7CA 4LK4A 4NG9H 4Q7ZA 4IW4E 3SJ8A 2BD4A 3SU5A 1E36B 3V12A 1CQQA 1F5KU 3F6UH 1G9IE 3VXEH 4A6LA 1GI6A 4UFEH 2F9NA 4CBNA 3P17H 4CRCA 4WY3A 3QGNB 5EG4A 1S82A 1THPB 4CBOA 2AMQA 3Q3XA 3BTWE 1TPPA 2P95A 3RXHA 2OBOA 3GCTF 1C5SA 1QL9A 4UONA 3I78A 3LH1A 1GI7B 5JBCS 1RFNA 2VWLA 1GVZA 5C1UA 2O8UA 2OTVA 1EAWA 1C1PA 3LJJA 2ZCHP 4Y76A 3MTYA 3NPSA 1C2LA 4X2YA 3A85A 5AFZH 4CHAB 1V2OT 1UTLM 5E0JA 3TJOA 1AN1E 2FTMA 1ANBA 1S0QA 2R3UA 3SGAE 5JPMH 3EDXB 2D26C 1K1PA 1IQNA 3KGPA 1O5DH 3RM0H 1BDAA 4NCYA 1NC6A 3F9FA 2PW8H 5EXNA 2ZG0H 2G4TA 4GAWA 1Q2WA 2VJ1A 2BD9A 2SNWA 5G4BA 1AFQB 3URDA 1WQSA 1YPJH 1SPJA 1P0SH 1TFXA 1BMNH 2Z7FE 3KQCA 2BMGB 5AFYH 1TGNA 2BDYA 1TNJA 1AHTH 1IQLA 2P8OB 5GXPA 1O5BB 3NXPA 2H2ZA 5K7RA 4U01A 3I29A 1VITG 2G5VA 3A80A 3T28A 2ZDAH 2YNAA 3UNRA 3DHKH 5EXMA 2IJOB 3SV2H 1O3MA 2J34A 4AYVB 2GMTC 1TABE 1V2WT 2ANMH 2UUFB 4SGBE 5LPRA 2A32A 4BXSA 1GDQA 4I8JA 1ELCA 2J92A 1D3QB 2A31A 1GBEA 1AB9C 4JMYA 1CHGA 2A1DB 4FUGA 2ZFFH 2ZI2H 3D62A 2O8MA 3A86A 1UTJA 2NU0E 1OWKA 1P11E 3NKKA 1AVWA 1ZPCA 1CVWH 1P02A 3T62A 1DWEH 1GI9B 3M35A 2G5NA 1UTOA 1O3LA 2WYGA 4B76A 5E0HA 1C2IA 3AVZA 1IQMA 3LGIA 3E90B 2STAE 1T8OA 2Z3DA 3U9AH 1O2TA 4WXVA 4JZFH 4YESB 1F0SA 4D9RA 4YTAA 4OS4A 1Z8JB 1DITH 1FONA 3SUGA 1G3CA 3OSYA 4CHAC 2ZGBH 3M5LA 4K3JA 2QAAA 2ZPRA 1QQ4A 2PUXB 4XOJA 1GMCF 1TAWA 4O9VA 2H9HA 1ETTH 3MWIU 3FP6E 5DP3A 3BG8A 5HXFA 2GZ8A 2NWNA 2PLXA 1H9IE 4GHTA 2B8OH 1AD8H 2F91A 4DCDA 4I8HA 1P09A 1QTFA 3TNTA 2FOFA 2FOBA 2I6QA 4ZXYH 2W3IA 2OD3B 1GBFA 3H5CB 1C5TA 2F3CE 4CR9A 2OINA 1GVLA 1FQ3A 3UREA 4BAMB 3MNBA 1EP5A 1LO6A 5AF9H 4K1EA 4AX9H 1NRQH 2GCHF 3K9XB 1V3XA 3FVFB 4R8TB 4X6PA 1EZUC 2SNVA 2ILNA 1XUKA 1SGFA 1UVTH 5FHTA 3A8AA 3B23B 3LPRA 1QRXA 2ZCLP 3L3TA 4WWYA 1OP2A 1BHXF 3MH4A 1O38A 1RJXB 3A87A 1FI8A 5GCHG 1O2SA 1YPHC 1O35A 1Y5UT 2XBVA 1GCTB 2BB4A 1SGYE 2V0BA 5JBTA 1ELGA 4ABDA 1THRH 2HNTC 3E8LA 3VPKA 2AMDA 2J94A 1LKAA 2NU3E 1N1LA 2XC4A 1O2QA 2ZDNA 3O8BA 1SQTA 2ZO3H 1C1RA 1ELVA 1V2MT 1WAYB 1FUJA 3RXVA 2FOHA 1J16A 1DXPA 1GG6B 3GY5A 3A7VA 4X1QU 1C1SA 2HGTH 4AORA 1GJ5H 2ALPA 1Z8GA 2QXIA 3UOUA 2TIOA 2H1UA 1EJAA 1QJ7B 4MLFB 2BDBA 1GL1A 1DSTA 4XBBA 1T4UH 1LTOA 1P01A 3LH3A 1E35B 1LHDH 1O3PB 1TNLA 2Z9IA 2RG3A 1G2MA 1PYTC 1UTNA 3MH6A 2FX6A 1O3BA 3A83A 2OC0A 2ZPQA 1MU6B 3A84A 1ZRBA 1JWTA 1DSUA 1KXAA 1W7XH 1EB1H 2STBE 4HFPB 3AAVA 4M7GA 1YPKH 4FU8A 1P8VC 2ZHQH 5DGJA 3SU6A 1LMWB 3RMOH 3VGCC 3V13A 4O97A 4X8UH 1C5UA 1BTPA 1F5RA 3D23A 4YOGA 1B7XB 3A89A 2FI4E 3PLPA 3RXIA 1QFKH 1IQGA 3GY7A 2GP9B 1PQ8A 1W0ZU 1EOLA 2ZF0H 2PKSB 1C1TA 2HNTF 1ELTA 2EI6A 1SL3A 1KLIH 1EQ9A 1BOQA 1QA0A 3BN9A 4DY7B 1DS2E 4CREA 1DY9A 1WU1A 2BM2A 2SGAA 1MTWA 1KY9A 4RKJB 1T32A 5GDSH 1GHVH 1G2LA 1GCTC 1A3BH 3BEFB 2FP7B 5A09A 1VCQA 1MTVA 2VIDA 1C5YB 3BTTE 3KQBA 2PSXA 2ZECA 4X1RU 1DLKB 4INHA 3ZZ4A 1GJ9B 4GUXA 5C2ZA 5EODA 1N6XA 3UNSA 1W0YH 1SG8B 3LC5A 4NWKA 5JB9S 3TLOA 1GDNA 5GIBA 1L2EA 3P8GA 4FXGH 3AW0A 1O2VA 1FN6A 1XX9A 5ESBA 1QGFA 4Z6AH 1C5LH 3C1KA 3RMNH 2ZU5A 4E06H 3MI4A 3GY8A 4RN6A 1A5IA 3ZZBA 1IQFA 1FZZA 1AVXA 5AVDA 1RTKA 2PR3A 1F0UA 1E34B 3QWCH 3RUOA 1MD7A 1BJVA 3U8OH 3SU3A 2FPZA 1YLCA 3M3VA 5FCKA 1MTNB 3PWCA 2FMJA 4H6SB 4XDEA 1GJDB 2BHGA 4X1NU 1OWEA 1RIWB 1TGSZ 2QXHA 5L2ZH 2C4FH 1BBRE 1TB6H 1ZLRA 1VITF 1HAVB 3MU4A 2GV6A 2HLCA 4XE4A 1SFIA 3FZDA 2VINA 1DWDH 2XWBI 4IMZA 4SGAE 4NSYA 2BVRH 2Z9KA 1DUEA 2SGDE 1SOTA 4KGAA 2ANYA 1WTGH 3CS7A 2BQ7B 3FFGA 2V35A 1SGTA 2PKSC 3EQ0H 1ZR0A 1AQ7A 1O2PA 4UE7H 3GY4A 4X8TH 2PUQH 2RA0A 1K21H 1VJAU 1YCPH 5TCAA 2BD7A 2VWOA 3P6ZB 4BAOB 1J8AA 1MAYA 1ABJH 2FO9A 4JYUH 1NESE 1IHTH 3PLBA 3Q77A 4Y8ZA 1BMAA 1K1LA 2Z9GA 5C5NA 2A2XH 1KDQB 1JOUB 4ABIA 1ZSJA 1P05A 3VB7A 5HYOA 4I8GA 3SGBE 1N8OB 4B73A 3RXKA 7KMEH 1RD3B 2AIQA 2J4IA 2BOKA 2A5AA 1XXDA 4DURA 1SGDE 1YYY1 1K1MA 1AMHA 3MOCA 1AVGH 1NU7B 4BTTB 2ULLA 1AGJA 2BDAA 4NZLA 1PPEE 4X0WU 5L2YH 4LOYH 1GMHF 1C1VH 1GI0A 2XNIA 3TK5A 7GCHG 2D2DA 3Q3YA 4IBLH 2K7XA 2F9VA 2TGAA 3E3TA 1BTHH 4CRDA 3SV8A 2SGEE 1FAXA 4FUBA 3OU0A 1TOCB 1JRTA 1LHEH 3KCGH 3B8JA 1HAVA 2ODYB 2OC7A 3ZVDA 3PTNA 1TPAE 1OX1A 1AKSA 2WPIS 3BEUA 1L1NA 5EU8A 3P95A 3M5OA 3GISB 3O8CA 1V6DA 4BOHA 1ELEE 1Y5AT 1SQOA 1BB0B 1AFEH 2SGFE 2VIQA 1L4ZA 1SGCA 3MO6A 2BLWA 1EAIA 3MYWA 1UHBB 1TALA 3PO1B 5F6MA 1C2DA 1QNJA 1Z6EA 2VNTA 1VCPA 1NO9H 1KSNA 3ZVFA 1IQKA 4ISOA 3KL6A 1A2CH 1O3OA 1FPHH 3K2UA 1A61H 1UVUH 1GWAA 4JZ1A 2CN0H 2H5CA 4X8SH 2R2MB 1O3JA 7ESTE 1V2LT 1NFYA 1ZMJA 2BDIA 1GHAG 4Q2KA 1EJNA 4H6TA 2ZDVH 2XYAA 4F49A 2R0LA 1EASA 5JYIA 4MTBA 1SGNE 3KQEA 4RSPA 2FI3E 1HJAB 3ESTA 1N8OC 1CO7E 1GMDG 2EA3A 2Q6GA 2P94A 4UD9H 1L1JA 3A88A 2G4UA 3GOVB 3LDXH 1D3PB 4BXWA 1MKXH 3PM3A 4JZDH 3ATMA 2ODPA 1IHSH 1OYQA 3MH7A 2WYJA 1AY6H 2FS9A 1MKWH 1AZZA 1PYTD 1C2GA 4IC6A 4ISLA 2DE9A 2WV5A 5HMAA 4GHQA 4DVAU 4ZKOU 1MH0A 1GBLA 1A4WH 1BTZA 4MPVA 4VGCC 1YPMH 1TBZH 1A1RA 1TMTH 3RXRA 1S5SA 3LONA 2HWLB 3V7TA 3E6PH 1P06A 3BTFE 1DOJA 3TGIE 5LPEA 4AN7A 4HI3A 5B6OA 1ZHPA 2BDGA 4XBCA 3RXCA 1P10A 1A5GH 4U2WA 1QR3E 2ZNKH 1ZPZA 3RU4E 4NWLA 1UTMA 5TJXA 3P8FA 2KAIB 1AO5A 1CHOF 5LH8A 2WV4A 1XMNB 1GBAA 3MO9A 1DE7H 1OPHB 3BV9B 3VFEA 4JZEH 4E7NA 3BSQA 1SGIB 1UHBA 3MO3A 1TA2A 4YM9A 1A7SA 3TVJB 3PO1C 1XKAC 1PQ7A 1O2HA 1LQDB 1UCYK 3GDUA 1GHBG 1GGDC 5FX6A 2FX4A 1JMOH 3GY6A 1Z8IB 1O2LA 4B1TA 1IQJA 1QHRB 3KQDA 5EQSA 1GHZA 1UO6A 4X6MA 2OBQA 4JK6A 1P9SA 5J4SA 4LZ1H 3BTEE 5FPYA 1OP8A 1YPGH 3M5MA 2BXUH 4DIHH 1NY22 1INCA 9ESTA 1YC0A 1VJ9U 1OWHA 5C20A 3Q00A 3OYPA 2ZEBA 2P93A 4INKA 3VXFH 3R3GB 4Y8XA 2BD3A 4WMEA 1WQVH 1TIOA 1SR5C 5JBBS 1ZSKA 2ZKSA 1XM1A 1T31A 4IN2A 1HXEH 3F1SB 3TH2H 1LPKB 3PB1E 4BANB 1O37A 3K6YA 3RP2A 1RGQA 1E38B 1WTHD 3QGJA 3STJA 2BQWB 1P9UA 2PGQB 1VITH 3RMLH 2SGPE 4NSVA 3IITA 4AG2A 6CHAC 1W14U 1YKTA 2BTCE 5T6GA 2Q1JA 4U30A 4AZ2B 5LPFA 3TITA 1C5OH 2OLGA 3P8NA 1XUFA 1S83A 5SGAE 4K8YA 2Z3EA 2Y7ZA 4YT6H 1TONA 1M9UA 3S0NA 3DD2H 1E37B 1HAYB 3QTVH 4ZMAH 3BIUH 2FESH 4KP0A 4MDSA 1TX6A 2GGVB 4MPXA 3RXUA 1C4V2 1C4Y2 1S6FA 1D9IA 3E16B 1A3EH 4NGAH 1BRAA 1TLDA 3ELAH 5DP8A 1F7ZA 1HB0B 4BAKB 4UFGH 4YLQH 3A7WA 3BTKE 4X6OA 3ATLA 3LJOA 4B2CA 1OP0A 1PPZA 4XFQA 4TWWA 2B0FA 3GDVA 4PROA 3NK8A 7GCHF 1DVAH 2XTTB 1TA6A 2QIQA 3SO3A 3RXGA 4H42U 2A5IA 1FXYA 4ABAA 1ZJDA 3ENSB 3M37A 1P3EA 3ATWA 1CGHA 1GBBA 1HPGA 2C8ZB 1HJ9A 2ZHWH 3QLPH 4Z0KA 1YCPM 3Q3KA 3FANA 1QA7A 2CF9H 3LGVA 1Z71A 2W26A 3SI4H 4D9QA 2GDDA 2GTBA 3M3SA 2ASUB 3PWBA 1UTPA 3DT0H 2R3YA 2A5KA 1UK4A 2LNCA 4X2XA 1W11U 5A0AE 1O2MA 2WINI 1SOZA 1ZHMA 1QIXB 1D6WA 2CJIA 1WOFA 4AFUA 4MNXA 1XVMA 3QO6A 3LU9B 3F9EA 1O3IA 4U32A 3TPIZ 1KLTA 3EBNA 1WUNH 1H8DH 1HLTH 1PPBH 3BTHE 3SNEA 4IGDA 1QB9A 4ABJA 3U8RH 1PQ5A 4NA7A 1QL7A 2BY7X 1CT4E 3SUDA 3SBKA 6ESTA 1AFQC 5L6NH 1TNGA 4AFSA 2ZFRH 1O2ZA 1ANCA 1XVOA 1GMDF 2SFAA 3AW1A 2PTNA 3FAOA 3PTBA 1AWHB 2FTLE 1ZYOA 2ZTYA 3NUMA 2P8OC 3TJVA 1QCPA 3SW2B 1J9CH 2G81E 1O32A 1OWIA 1HV7A 1TQ0B 5I46H 4K2YA 4ABBA 2HRVA 1WV7H 1GJCB 2BD2A 2EI8A 1P2IA 3E1XB 4J2YB 5EW2H 8LPRA 4Y10E 1ZTLA 2HALA 2I6SA 2P3TB 1QL8A 1ZRKA 3UR6A 5K0HA 1ETSH 3ATKA 1NFUA 3MNCA 2Y5HA 5DP9A 1UCYE 1C2EA 1OSSA 2VIOA 1O3GA 1ELFA 2BOHB 2G55A 4AYYB 1T4VH 1KLJH 1DM4B 4JZIA 5BRRE 2FYQA 2OUAA 2A0QB 2JH5D 3SNDA 1TX8A 1YM0A 5FPTA 2ZIQH 1TQ7B 1MMJN 3TK9A 1EUFA 1F2SE 1NN6A 2BY9X 2PHBA 4IC5A 1GHBF 4GCHG 1MCTA 2AFQB 1OYTH 5C1YA 3BTME 3NCLA 4LZ4B 2LPRA 1TNIA 3ZZ7A 3VB5A 1B5GH 2VWMA 2ZFPH 3SV6A 2GZ7A 4LXBH 3EAJA 1T8MA 3A82A 3S69A 4OS2A 1UMAH 1UK3A 1NT1A 4NIVA 3T29A 1CSOE 1NTPA 3M3TA 1L4DA 3U1JB 3BTGE 1YGCH 4J1YA 1LHFH 1O2NA 1XUIA 1MD8A 4FU9A 2XBXA 5FXLA 1MQ6A 2PKAB 1HAPH 3V3MA 1QRZA 4MPUA 5T6FA 1CGIE 1GBKA 2FLRH 1QY6A 1F5LA 3GCOA 2H9EH 1W2KH 4D76A 4GPGA 3ZV8A 3STIA 5BPEA 1GI3A 4Y0ZE 2WPKS 1LQEA 3SUEA 1W12U 4ASHA 1C2KA 2QN5T 1IQIA 1C9TA 4QT8C 3HKIB 5TCCA 4ABEA 3TU7H 1T8LA 3BEIB 4Y8YA 3GCHB 2AIPA 1Y3YA 1SLXB 1BJUA 4K5ZA 1C5VA 1C5WB 1MKXK 1DY8A 1P2JA 4OS1A 4X2WA 1GJ8B 1A46H 4I31A 1GI5A 3EYDA 1TOMH 2CXVA 4B2BA 1MKWK 8GCHG 2QC2A 4TPIZ 1O5EH 1TGTA 4Q7XA 4WMDA 1CGJE 2VVCA 3RXEA 1RXPA 3A8CA 1SB1H 2W7SA 3U8TH 1MU8B 4WH6A 1GG6C 4BAQB 3A7TA 4X8VH 4DT7B 4HZHA 1C1WH 2A4RA 3URCA 3RXAA 3ZVEA 1FY1A 2Y6TA 1Y8TA 2J95A 1TE0A 1SGRE 3ZZAA 3HPTB 1FNIA 2BDCA 4MNWA 2FLBH 2BX4A 3RM2H 5F8XA 1MQ5A 1DDJA 2AMPA 4OGYA 5DO4H 1W8BH 1BBRH 3PMHB 1UVOA 3S9AA 3EE0B 1TNHA 2B7DH 1SC8U 4DW2U 1ANEA 3TJUA 3R0FA 1G30B 4FVBA 2Z9LA 3BTDE 3T25A 1Y3WA 1ZTKA 2ZGJA 4KTUA 1O3EA 1CA0B 4ZUHA 1P2OA 3QTOH 5C67A 2CGAA 2CF8H 1RRKA 1SLUB 2BVSH 3AAUA 3V0XA 1DT2A 5E8EH 1O36A 1NM6A 5L30H 4NA9H 1ZJKA 2FXRA 3A7ZA 3KF2A 1BRBE 2DUCA 2ZP0H 4FVDA 3F68H 1ZPBA 4AG1A 1YP9A 3SHCH 3D49H 1Q31A 1O3DA 1TNKA 2FOCA 3UWJH 5ETXA 3S7HB 1TGCA 1O5GH 1O2GH 4NIYA 1MZDA 2EI7A 5EOKA 2D1JA 3MNSA 1VZQH 2AGIX 4GLYA 4YZUA 1ZGVA 4MVNA 1F92A 3LGWA 1MCVA 2AGEX 1O5AB 2ESTE 3PMBB 4TYDA 1G32B 4YLUA 2C90B 3CP7A 1OXGA 1YBWA 4DG4A 1ORFA 1C5QA 2VH0A 1CE5A 1V2NT 3RC4A 1LHCH 4IMQA 1HAZB 2V3OH 1CT0E 2C8XB 2YOLA 5A8ZA 4A7IB 5A0CA 1MTNC 2P3UB 3S9CA 1C5NH 1RIWC 1TGBA 2BLVA 3T2NA 1KXFA 9LPRA 4CRBA 4ZKSU 3RU4D 1BTYA 3GY2A 2QGRA 5A2MH 1UK2A 5JB8S 3ZZ3A 1TMUH 2BY8X 2ZHFH 3DUXH 3RXBA 5GJ4B 3SNCA 2PFEA 1P57B 1WYKA 3UWIA 1EXFA 1OWJA 1W13U 2F9PA 5GCHF 3A81A 5FAHA 5E2PA 4FUHA 3UOPA 4Q80A 4DJZB 1P2NA 3C27B 2OQUA 3K6ZA 3P92A 1B0EA 2Y5FA 1GJ4H 5CHAB 3ODFA 1TYNA 4BTUB 3SQHE 3SOSA 1FAKH 3ZYDA 2Z6BD 1SSXA 3A8DA 1KDQA 3KN2A 4FU7A 1ZGIA 3RLWH 2F9OA 1V2VT 3LOXA 3MFJA 1SLVB 5EXLA 4GCHF 1Y3XA 2AEIH 1O34A 3ZYEA 4D7GA 2F9BH 2OP9A 4UEHH 1H1BA 5C5OA 1CBWB 1BTUA
chains in the Genus database with same CATH superfamily
4FUJA 3QZRA 1C5RA 1SQAA 1GJ7B 2O8WA 4Y0YE 2J5UA 1BRCE 1ZHRA 3UIRA 1BTWA 1ETRH 1C2MA 2H9TH 2NU2E 1IOEA 2F9UA 4RT1A 5E0GA 1DANH 1W10U 2GCTB 2XW9A 3ODDA 2ZTZA 4R0IA 3ZZ8A 2ZPSA 1HUTH 2XCFA 5DKMA 3SGQE 1NU9A 1O2UA 2A7HA 1JBUH 2EEKA 2PGBB 3MMGA 3SN8A 4P00A 2ANWA 2FDAA 2A4OA 2FEQH 2P59A 3G01A 3VB6A 1ID5H 2FOMB 3ZV9A 1DLEA 1AZ8A 1O3FA 1X7AC 3O8RA 3PROA 4Y6DA 5C1XA 1OS8A 3ITIA 4UFDH 1L0ZA 1THSH 1HDTH 4ZHLU 1PFXC 1VR1H 2Z3CA 3EA7A 1G37A 1SVPA 4XBDA 1GCDA 2BVXH 2H5DA 4OS7A 1EZQA 2TRMA 5H4IB 3LGTA 2VB0A 3D65E 2XCNA 8GCHF 3HK6B 5CHAC 5HGGA 1XUHA 1A0HB 1GI8B 2VIVA 3SHAH 1VGCB 1BIOA 2BZ6H 4I86A 3T26A 1C5PA 1SHHB 3E91A 4NA8A 1BCUH 2VGCB 2K0QA 2R9PA 3GCNA 4UFFH 4B6EA 4D7FA 1MTUA 1C5MD 1P04A 2PSYA 4ZHAA 2W5EA 4ISNA 1YLNA 3MH5A 1H8IH 1HJAC 4Y11E 1O2YA 2ZFSA 2VWNA 1E1QD 1ZOMA 3AASA 2GVFA 1Z6JH 2W7UA 1MBQA 2HNTE 2FS8A 1K2I1 1BMMH 2LIZA 1ZSLA 1S81A 1ZMNA 1JXPA 1NRRH 1AWFH 2W3KA 5F53A 2A4QA 1Y5BT 4JCNA 2ANKH 3FP7E 2BD8A 2G8TA 4AGJA 1EOJA 4TWYA 5J4QA 2YMSB 1V2RT 1GVKB 2FM2A 1BITA 1TBQH 4YOIA 1KTSB 2GCTC 4ABGA 1LVMA 4CRAA 2ZCKP 1GI4A 1TBRH 2R2WU 1Z8RA 4ZKNU 1AB9B 1ESBA 1HRTH 4ZKRU 4CRGA 1CU1A 4X6NA 1GBTA 1UTQA 1AI8H 1LVOA 1ZZZA 3IWMA 1ESAA 2KAIA 2UWOA 1EZXC 1HXFH 1KXBA 2OC8A 1ELDE 5T6DA 1BHXB 5FL7D 2G52A 1UVSH 1GHYH 1C5XB 2THFB 3QX5H 1NROH 2R0KA 3SNAA 1Z1JA 2ZDLA 1A0LA 1BZXE 2XBWA 4ZROA 3U1IB 2FWWA 2EC9H 1S0RA 2IN2A 3OAAD 4BTIB 3LGUA 1AUTC 1ELAA 1NPMA 5HM2A 1DX5M 3H7TA 1NBMD 2UUJB 1PJPA 1KXEA 2P16A 2HPQH 5EQQA 2RCEA 1VGCC 3MNXA 2VGCC 3GYLB 3HGPA 3QZQA 4GSOA 1FIZA 5CMXH 1F0RA 3PV2A 2ODQA 1QBVH 2AH4X 5PTPA 1BTXA 5I25A 1LPZB 2XWAA 3FKSD 1EP6A 2DE8A 4A5TS 1C9PA 5GPIB 1P2KA 1KXCA 2QA9E 3ZZDA 3TIUA 4D8NA 1G3DA 4X2VA 3SJ9A 3ZVGA 1OKXA 2WPJS 2VH6A 2A45B 1C1MA 4TY6A 4AFZA 3I77A 1CA8B 2ZQ2A 1AE5A 3PYHA 2D8WA 1P2QA 3HGNA 4IN1A 1MUEB 4HGCA 2WPLS 3TH4H 4B2AA 3ZVAA 1K22H 1K1JA 1NRNH 2UWPA 3RXTA 1GI2A 4TPYA 1EKBB 4FUDA 2ALVA 1DWCH 2G00A 5FX5A 1JIMA 4WF8A 1BBRK 1LVBA 3RXJA 5ABWA 3RDZA 6GCHG 4XSKU 1G36A 2GZ9A 1BA8B 1GBIA 4NIWA 1JIRA 4F48B 1FJSA 1WCZA 1QURH 4ZHMU 2ZA5A 5DG6A 3SI3H 4KELA 4DOQA 4X1SU 4E7RG 3U28C 3Q76A 4AGKA 3K65B 3OEED 1WSSH 2J9NA 2VU8E 7LPRA 3SU2A 4KKDA 1BT7A 1C2JA 1GHAF 1MAXA 4WXIA 1O33A 1RTFB 1V2TT 2BDHA 2BZAA 2XBYA 1P12E 4KTSA 3MU1A 2JKHA 2GV7A 4CH2B 1GBMA 1U6QA 1OWDA 4A1TA 1ESTA 2GDEH 3WW7A 4WVPE 1E0FD 4CH8B 1MTSA 1YCPK 2WUCA 3UFAA 2CV3A 4O3UA 2Y80A 2GT7A 1QBNA 1OOKB 3OTJE 1AUJA 3UR9A 1GMHG 3ZIAD 4AFQA 4AOQA 2BLOA 2BLQA 3SU0A 3A8BA 1DPOA 1RTLA 1FN8A 1EATA 8ESTE 1TRNA 2OCVB 1PPHE 4FUFA 1GJAB 1J14A 2L6OA 3F0PA 1EB2A 1NS3A 1GBHA 3JZ1B 4ISIH 3VGCB 4WMFA 1SKYE 3PMJA 4YT7H 1GJ6A 3RLYH 1K9OE 2C3SA 1UCYH 1IQEA 1SI5H 5EGMA 1QJ1B 1DXWA 2ZZUH 2PTCE 2A2QH 2UUYA 1Y59T 3F2HA 1AIXH 2JETB 1HIAB 1HAHH 3RU4T 2BY6X 2K1QA 1AU8A 2AERH 2XXLA 3SQEE 5GWZA 1GDUA 4A1VA 1GPZA 8KME2 3PV5A 4F55A 1FLEE 2OQ5A 2V3HH 1O0DH 1H9HE 1FIWA 2HPPH 4AB9A 1O2RA 3SV7A 2CHAB 2JH0D 4HTCH 1LHGH 3RXFA 2J2UA 1NRSH 1KTTB 4INLA 3SU4A 3F9HA 4O3TA 3LGYA 3M5NA 2A7CA 1TPOA 1BRUP 2TPIZ 3CENA 4Y79A 1C2HA 4JYTA 3M61U 3HATH 2AS9A 3DFJA 4NZQA 2LP6A 1GHXH 1Z1IA 2V6NA 3F9GA 1FMGA 2FODA 3VEQB 2Y5GA 5FPSA 5FCRA 2QYIA 2ZFQH 3OX7U 2JH6D 2BXTH 1VKYA 3QUMP 1SGQE 4Q7YA 3M7UA 2IOTA 3FZZA 1O3HA 3RMMH 3QK1A 1Y3VA 3LT3A 4A92A 3F0OA 4THNH 1T8NA 3LKWA 1CT2E 1G3EA 3ZVCA 1TPSA 1O2IA 1C5ZB 3CS0A 1EPTB 2GKVE 3SZNA 2RDLA 2ZU4A 1K28D 4I7YH 2AGGX 1S85A 1XUGA 2ZHEH 1ELBA 4B75A 2VVUA 3S7KB 5FBIA 3EA8A 2JDID 1YF4A 2ZGHA 1XUJA 4H4FA 3RXPA 2TGTA 1YPLH 1O39A 3UQVA 3TJNA 1QQUA 3BG4B 1PPCE 3U98H 5DP7A 5C17A 1MBMA 3RXOA 3U69H 5A8XA 1P03A 1ZMLA 1C4U2 1PPGE 5DJ7A 5JDUB 2CK3D 1FY8E 1HIAA 1CHOG 2JETC 3O8DA 5LGOA 1DFPA 5T3HA 2Q6FA 1O3AA 1ABIH 4I8LA 1O5FH 2UUKB 1SGEE 1ARCA 1G3BA 4BAHB 3ZVBA 5F8ZA 4F4OC 4X1PU 2CHAC 1OHHD 1HAGE 3IG6B 1SFQB 1NZQH 1DUAA 2W6JD 3M36A 1V2QT 3DSGA 3W94A 1QRWA 2Y7XA 3ZZ9A 3PV4A 4B74A 3KHVA 3LC3A 1GBJA 2O8TA 5A0BA 2M5TA 3UQOA 2WPMS 2F83A 3M7TA 2A4GA 1LVYA 1SBWA 2WV9A 3MQKC 1P3CA 1O2XA 3SV9A 4GVUA 3DA9B 4XRNA 2PKAA 3TH3H 2B9LA 4K60A 1RS0A 1TWXB 2C8YB 4Y7BA 3T5FH 3VB4A 4CR5A 4E05H 4KTCA 5DK1A 3B9FH 3E0PB 2ZTXA 3T27A 1EPTA 4FUEA 2ZU2A 2QF3A 1EPTC 3NWUA 1F0TA 3FOAA 3PMAB 1UJ1A 1TX7A 2FZZA 1AKSB 2VVVA 1GJBB 5F03A 2CMYA 3DFLA 4ABFA 1XKBC 2TGDA 4JYVH 4NFFA 5HM9A 5HIYA 3EA9A 3ATIA 3GCHC 2V7QD 1EX3A 2FOGA 3BG4C 2F43B 2YMSD 2JJ2D 3GCTG 4WH8A 3SJIA 5EIYA 2ZU3A 1SMFE 4MQAA 5C3NA 1V2PT 5DPAA 1GI1A 2ZQ1A 5GNDA 1WBGB 1LCYA 1TMBH 4ACAA 4DGJA 2M2AA 3OY6U 6GCHF 1ACBE 4ISHH 3A7YA 1WXRA 3FP8E 4OGXA 3H7OA 1VCWA 3NZIA 5CE1A 2ZDMA 3A7XA 3RXSA 3SNBA 1FV9A 1KIGH 4B71A 1L1GA 1GBDA 2SGQE 2V3MA 4ESTE 1O3KA 2QXGA 1ZTJA 4I33A 1LPGB 1QB6A 3KEEA 3SJKA 1FDPA 3WY8A 3ZZ5A 3QDZB 5AHGH 2Q6DA 4YO9A 2HVXA 1K1NA 1EJMA 1P2MA 2TBSA 4NFEA 1ANDA 1SHYA 3RC5A 2FOEA 2A7JA 3GY3A 1FY4A 1V2JT 4K1TA 4OS6A 1YPEH 4UDWH 3KNXA 5DP6A 1QBOA 3TGKE 2ZGCA 4HG6A 3TK6A 4MPWA 4OS5A 3UY9A 4K69A 1V2UT 1NRPH 1A5HA 1K1IA 1PQAA 5JBAS 2RA3A 4JK5A 1CA0C 1YY3A 3BIVH 2ZHDA 2KCYA 4ZH8A 3RXLA 4O03A 1LDTT 4VGCB 3UTUH 2C8WB 2BD5A 1NFXA 2ZWLH 2HOBA 2WPHS 1D3DB 5IDKA 4FUIA 3LIWA 2FIRH 1O31A 2O8LA 3RXDA 1J15A 1O2OA 4AB8A 2C93B 2Y82A 3KIDU 2EY4C 3TNSA 1BQYA 1J17T 1GBCA 1QJ6B 1DICA 2NU1E 1GHWH 4ZAEA 2Z9JA 2XNDD 5A8YA 1HJ8A 5DP4A 3RXQA 2XRCA 1ARBA 3P8OA 2ZC9H 1TRMA 5EQRA 1E79D 4RKOB 2XC0A 1O2JA 1NFWA 3GYMA 3TGJE 1KXDA 3P70B 1MZAA 2Y81A 1HNEE 4I8KA 1FX0B 1H4WA 1Y3UA 3RXMA 3S9BA 3SJOA 1GGDB 2J38A 3RC6A 1SLWB 2VIPA 4MNVA 1HAOH 5IYTA 2QV1A 3JZ2B 4Y7AA 1JRSA 1GMCG 1EFRD 2FI5E 4NIXA 4Q4LA 3VB3A 3PLKA 2BQ6B 1UVPA 3UNQA 3ZZCA 1O5CB 2J98B 4DIIH 1E1RD 1IQHA 2IPHA 2QY0B 2O9QA 3BTQE 5EPYA 1TRYA 3MU5A 2QXJA 1O3NA 4ABHA 4ZXXH 2OC1A 1A0JA 5FBEA 3FN8A 2PWXA 1V2ST 2BY5X 1W3CA 1LKBA 1W7GH 3SORA 3W95A 1GL0E 1V2KT 3SU1A 1DWBH 1HBTH 1IAUA 5HIZA 2H6MA 2GCHG 4K1SA 2OXSA 1C1OA 4TY7A 2QCYA 1QB1A 1YLDA 2ZDKA 2KM0A 1EAUA 3EE7A 1BMLA 1FY5A 1HAXB 1C1UH 1Q3XA 4BNRA 2Z94A 3L6PA 1B0FA 1O2KA 6LPRA 2P3FH 2GD4B 1S6HA 1BUIA 3GDSA 4I32A 1C1QA 3OTPA 1HFDA 2NU4E 2ZGXH 4MNYA 2BYAX 1O2WA 2G51A 2VIWA 2QF0A 5F8TA 3L33A 3QN7A 3UPEA 2ZU1A 3MU8A 2YNBA 1C2FA 1EAXA 2KZ4A 5EPNA 4CRFA 5CDFE 6CHAB 2GT8A 3SUFA 2ZFTA 1H9LB 2GJGA 3N7OA 2WUBA 3DCLA 2PV9B 2UWLA 2FYRA 4IS5A 1HYLA 4K8BA 5E2OA 1WDIA 1UTKA 3MHWU 4MG3A 3UUZA 2TGPZ 3EGKH 4A1XA 4M9FA 1YPHE 4YOJA 1HGTH 2BX3A 1HCGA 2B5TB 1S84A 1FY3A 1O30A 2WHXA 1Z7KA 2XC5A 3F2FA 1C1NA 4Y71A 4WJG2 3HKJB 1O3CA 1CBWC 3E0NB 3ZZ6A 5EW1H 3GICB 1N6YA 3HK3B 2GX4A 1AE8H 3OY5U 1EZSC 4FUCA 1K1OA 1KYNA 1D3TB 2FOAA 3M7QA 2AYWA 3BF6H 5ESTE 2GMTB 1D4PB 1XXFA 3MU0A 1SGFG 1D6RA 1HAIH 5DP5A 1FPCH 1SGPE 1PPFE 1T7CA 4LK4A 4NG9H 4Q7ZA 4IW4E 3SJ8A 2BD4A 3SU5A 1E36B 3V12A 1CQQA 1F5KU 3F6UH 1G9IE 3KYFA 3VXEH 4A6LA 1GI6A 4UFEH 1H8HD 5EJLA 2F9NA 4CBNA 3P17H 4CRCA 4WY3A 3QGNB 5EG4A 1S82A 1THPB 4CBOA 2AMQA 3Q3XA 3BTWE 1TPPA 2P95A 3RXHA 2OBOA 3GCTF 1C5SA 1QL9A 4UONA 3I78A 3LH1A 1GI7B 5JBCS 1RFNA 2VWLA 1GVZA 5C1UA 2O8UA 2OTVA 1EAWA 1SQRA 1C1PA 3LJJA 2ZCHP 4Y76A 3MTYA 3NPSA 1C2LA 4X2YA 3A85A 5AFZH 4CHAB 2IPQX 1V2OT 1UTLM 5E0JA 3TJOA 1AN1E 2FTMA 1ANBA 1S0QA 2R3UA 3SGAE 5JPMH 3EDXB 2D26C 1K1PA 1IQNA 3KGPA 1O5DH 3RM0H 1BDAA 4NCYA 1NC6A 3F9FA 2PW8H 5EXNA 2ZG0H 2G4TA 2LELA 4GAWA 1Q2WA 2VJ1A 2BD9A 2SNWA 5G4BA 1AFQB 3URDA 1WQSA 1YPJH 1SPJA 1P0SH 1TFXA 1BMNH 2Z7FE 3KQCA 2BMGB 5AFYH 1TGNA 2BDYA 1TNJA 1AHTH 1IQLA 2P8OB 3UB0A 5GXPA 1O5BB 3NXPA 2H2ZA 5K7RA 4U01A 3I29A 1VITG 2G5VA 3A80A 3T28A 2ZDAH 2YNAA 3UNRA 3DHKH 5EXMA 2IJOB 3SV2H 1O3MA 2J34A 2YMSC 4AYVB 2GMTC 1TABE 1V2WT 2ANMH 2UUFB 4SGBE 5LPRA 2A32A 4BXSA 1GDQA 4I8JA 1ELCA 5CHBA 2J92A 1D3QB 2A31A 1GBEA 1AB9C 4JMYA 1CHGA 2A1DB 4FUGA 5C0TA 2ZFFH 2ZI2H 3N99A 3D62A 2O8MA 3A86A 1UTJA 2NU0E 1OWKA 5C0UA 1P11E 3NKKA 1AVWA 1ZPCA 1CVWH 1P02A 3T62A 1DWEH 1GI9B 3M35A 2G5NA 1UTOA 1O3LA 2WYGA 4B76A 5E0HA 1C2IA 3AVZA 1IQMA 2F4LA 3LGIA 3E90B 4FETA 2STAE 1T8OA 2Z3DA 3U9AH 1H8ED 1O2TA 4WXVA 4JZFH 4YESB 1F0SA 4D9RA 4YTAA 4OS4A 1Z8JB 1DITH 1FONA 3SUGA 1G3CA 3OSYA 4CHAC 2ZGBH 3M5LA 4K3JA 2QAAA 2ZPRA 1QQ4A 2PUXB 4XOJA 1GMCF 1TAWA 4O9VA 2H9HA 1ETTH 3MWIU 3FP6E 5DP3A 3BG8A 5HXFA 2GZ8A 2NWNA 2PLXA 1H9IE 4GHTA 2B8OH 1AD8H 2F91A 4DCDA 4I8HA 3KQ5A 1P09A 1QTFA 3TNTA 2FOFA 2FOBA 2I6QA 4ZXYH 2W3IA 2OD3B 1GBFA 3H5CB 1C5TA 2AHME 2F3CE 3AK5A 4CR9A 2OINA 1GVLA 1FQ3A 3UREA 4BAMB 3MNBA 1EP5A 1LO6A 2W6ID 5B6LA 5AF9H 4K1EA 4AX9H 1NRQH 2GCHF 3K9XB 1V3XA 3FVFB 4R8TB 4X6PA 1EZUC 2SNVA 2ILNA 1XUKA 1SGFA 1UVTH 5FHTA 3A8AA 3B23B 3LPRA 1QRXA 2ZCLP 3L3TA 4WWYA 1OP2A 1BHXF 3MH4A 1O38A 1RJXB 3A87A 1UW7A 1FI8A 5GCHG 1O2SA 1YPHC 1O35A 1Y5UT 2XBVA 1GCTB 2BB4A 1SGYE 2V0BA 3PRBA 5JBTA 1ELGA 4ABDA 1THRH 2HNTC 1QZ8A 3E8LA 3VPKA 2AMDA 2J94A 1LKAA 2NU3E 1N1LA 2XC4A 1O2QA 2ZDNA 3O8BA 1SQTA 2ZO3H 1C1RA 1ELVA 1V2MT 1WAYB 1FUJA 3RXVA 2FOHA 1J16A 1DXPA 1GG6B 3GY5A 3A7VA 4X1QU 1C1SA 2HGTH 4AORA 1GJ5H 2ALPA 1Z8GA 2QXIA 3UOUA 2TIOA 2H1UA 1EJAA 1QJ7B 4MLFB 2WPDD 2BDBA 1GL1A 1DSTA 4XBBA 5KECA 3H09A 1T4UH 1LTOA 1P01A 3LH3A 1E35B 1LHDH 1O3PB 1TNLA 2Z9IA 2RG3A 1G2MA 1PYTC 1UTNA 3MH6A 2FX6A 1O3BA 3A83A 2OC0A 2ZPQA 1MU6B 3A84A 1ZRBA 1JWTA 1DSUA 1KXAA 1W7XH 1EB1H 2STBE 4HFPB 3AAVA 4M7GA 1YPKH 4FU8A 1P8VC 5HKKD 2ZHQH 5DGJA 3SU6A 1LMWB 3RMOH 4DT4A 3VGCC 3V13A 4O97A 4X8UH 1C5UA 1BTPA 1F5RA 3F2GA 3D23A 4YOGA 1B7XB 3A89A 2FI4E 3PLPA 3RXIA 1QFKH 1IQGA 3W1EA 3GY7A 2GP9B 1PQ8A 1W0ZU 1EOLA 2ZF0H 2PKSB 1C1TA 2HNTF 1ELTA 2EI6A 1SL3A 2KCOA 1KLIH 1EQ9A 1BOQA 1QA0A 3BN9A 4DY7B 1DS2E 4CREA 1DY9A 1WU1A 2BM2A 2SGAA 1MTWA 1KY9A 4RKJB 1T32A 5GDSH 1GHVH 1G2LA 1GCTC 1A3BH 3BEFB 2FP7B 5A09A 1VCQA 1MTVA 2VIDA 1C5YB 3BTTE 3KQBA 2PSXA 2ZECA 4X1RU 1DLKB 4INHA 3ZZ4A 1GJ9B 4GUXA 5C2ZA 5EODA 1N6XA 3UNSA 1W0YH 1SG8B 3LC5A 4NWKA 5JB9S 3TLOA 1GDNA 4P02A 5GIBA 1L2EA 1BMFD 3P8GA 4FXGH 3AW0A 1O2VA 1FN6A 1XX9A 5ESBA 1QGFA 4Z6AH 1C5LH 2K8IA 3C1KA 3RMNH 2ZU5A 4E06H 3MI4A 3GY8A 4RN6A 1A5IA 3ZZBA 1IQFA 1FZZA 1AVXA 5AVDA 1RTKA 2PR3A 1F0UA 1E34B 3QWCH 3RUOA 2PP6A 1MD7A 1BJVA 3U8OH 3SU3A 2FPZA 1YLCA 3M3VA 5FCKA 1MTNB 3PWCA 2FMJA 4H6SB 3CNRA 4XDEA 1GJDB 2BHGA 4X1NU 1OWEA 1RIWB 1TGSZ 2QXHA 5L2ZH 2C4FH 1BBRE 1TB6H 1ZLRA 1VITF 1HAVB 3MU4A 2GV6A 3NRLA 2HLCA 4XE4A 1SFIA 3FZDA 1YWUA 2VINA 1DWDH 2XWBI 4IMZA 4SGAE 4NSYA 2BVRH 2Z9KA 1DUEA 2SGDE 1SOTA 4KGAA 2ANYA 1WTGH 3CS7A 2BQ7B 3FFGA 2V35A 2KCPA 1SGTA 2PKSC 3EQ0H 1ZR0A 1AQ7A 1O2PA 4UE7H 3GY4A 4X8TH 2PUQH 2RA0A 1K21H 1VJAU 1YCPH 5TCAA 2BD7A 2VWOA 3P6ZB 4BAOB 1J8AA 1MAYA 1ABJH 2FO9A 2RDEA 1NESE 4JYUH 1IHTH 3GS9A 3PLBA 3Q77A 4Y8ZA 1BMAA 1K1LA 2Z9GA 5C5NA 2A2XH 5C94A 1KDQB 1JOUB 4ABIA 1ZSJA 1P05A 3VB7A 5HYOA 4I8GA 3SGBE 1N8OB 4B73A 3RXKA 7KMEH 1RD3B 2AIQA 2J4IA 2BOKA 2A5AA 1XXDA 4DURA 1SGDE 1YYY1 1K1MA 1AMHA 3MOCA 1AVGH 1NU7B 4BTTB 2ULLA 1AGJA 2BDAA 4NZLA 1PPEE 4X0WU 5L2YH 4LOYH 1GMHF 1C1VH 1GI0A 2XNIA 3TK5A 7GCHG 2D2DA 3Q3YA 4IBLH 2K7XA 2F9VA 2TGAA 3E3TA 1BTHH 4CRDA 3SV8A 2SGEE 1FAXA 4FUBA 3OU0A 1TOCB 1JRTA 1LHEH 3KCGH 3B8JA 1HAVA 2ODYB 2OC7A 3ZVDA 3PTNA 1TPAE 1OX1A 1AKSA 2WPIS 3BEUA 1L1NA 5EU8A 3P95A 3M5OA 3GISB 3O8CA 1V6DA 4BOHA 1ELEE 1Y5AT 1SQOA 1BB0B 1AFEH 2SGFE 2VIQA 1L4ZA 1SGCA 3MO6A 2BLWA 1EAIA 3MYWA 1UHBB 1TALA 3PO1B 5F6MA 1C2DA 1QNJA 1Z6EA 2VNTA 1VCPA 1NO9H 2OK5A 1KMHB 1KSNA 3ZVFA 1IQKA 4ISOA 3KL6A 1A2CH 1O3OA 1FPHH 3K2UA 1MABB 1A61H 1UVUH 1GWAA 4JZ1A 2CN0H 2H5CA 4X8SH 2R2MB 1O3JA 7ESTE 1V2LT 2EQNA 1NFYA 1ZMJA 2BDIA 1GHAG 4Q2KA 1EJNA 4H6TA 2ZDVH 2XYAA 4F49A 2R0LA 1EASA 5DN6D 5JYIA 4MTBA 2WZQA 1SGNE 3KQEA 4RSPA 2FI3E 1HJAB 3ESTA 1N8OC 1CO7E 1GMDG 4OM9A 2EA3A 2Q6GA 2P94A 4UD9H 3SZEA 1L1JA 3A88A 2G4UA 3GOVB 3LDXH 1D3PB 4BXWA 1MKXH 3PM3A 4JZDH 3ATMA 2ODPA 1IHSH 1OYQA 3MH7A 2WYJA 1AY6H 2FS9A 1MKWH 1AZZA 1PYTD 1C2GA 4IC6A 4ISLA 2DE9A 2WV5A 5HMAA 4GHQA 4DVAU 4ZKOU 1MH0A 1GBLA 1A4WH 1BTZA 4MPVA 4VGCC 1YPMH 1TBZH 1A1RA 1TMTH 3RXRA 1S5SA 3LONA 2HWLB 3V7TA 3E6PH 1P06A 3BTFE 1DOJA 3TGIE 5LPEA 4AN7A 4HI3A 5B6OA 1ZHPA 2BDGA 4XBCA 3RXCA 1P10A 2VBCA 1A5GH 4U2WA 1QR3E 2ZNKH 1ZPZA 3RU4E 3VG8A 4NWLA 1UTMA 5TJXA 3P8FA 2KAIB 1AO5A 1CHOF 5LH8A 2WV4A 1XMNB 1GBAA 3MO9A 1DE7H 1OPHB 3BV9B 3VFEA 4JZEH 4E7NA 3BSQA 1SGIB 1UHBA 3MO3A 1TA2A 4YM9A 1A7SA 3TVJB 2IJD1 3PO1C 1XKAC 1PQ7A 1O2HA 1LQDB 1UCYK 3GDUA 1GHBG 1GGDC 4B6FA 3SYJA 5FX6A 2KR7A 2FX4A 1JMOH 3GY6A 1Z8IB 1O2LA 2J98A 4B1TA 1IQJA 1QHRB 3KQDA 5EQSA 1GHZA 1UO6A 4X6MA 2OBQA 4JK6A 1P9SA 5J4SA 4LZ1H 3DSPA 5DSFA 3BTEE 5FPYA 1OP8A 4FOUC 1YPGH 3M5MA 2BXUH 4DIHH 1NY22 1INCA 9ESTA 1YC0A 1VJ9U 1OWHA 5C20A 2QF4A 3Q00A 3OYPA 2ZEBA 2J97A 2P93A 4INKA 3R3GB 3VXFH 4Y8XA 2BD3A 4WMEA 1WQVH 4TSFD 1TIOA 1SR5C 5JBBS 1ZSKA 2ZKSA 1XM1A 1T31A 4IN2A 1HXEH 3F1SB 3TH2H 4Z1MD 1LPKB 3PB1E 4BANB 1O37A 3K6YA 3RP2A 1RGQA 1E38B 1WTHD 3QGJA 3STJA 2BQWB 1P9UA 2PGQB 1VITH 3RMLH 3DSOA 2SGPE 4NSVA 3IITA 4AG2A 6CHAC 1W14U 1K0HA 1YKTA 2BTCE 5T6GA 2Q1JA 4U30A 4AZ2B 5LPFA 3TITA 1C5OH 2OLGA 2XOKD 3P8NA 1XUFA 1S83A 2HVYB 5SGAE 4K8YA 2Z3EA 2Y7ZA 4YT6H 1TONA 1M9UA 3S0NA 3DD2H 1E37B 1HAYB 3QTVH 4ZMAH 3BIUH 2FESH 4KP0A 4MDSA 1TX6A 2GGVB 4MPXA 3RXUA 1C4V2 1C4Y2 1S6FA 1W0KD 1D9IA 3E16B 1A3EH 4NGAH 1BRAA 1TLDA 3ELAH 5DP8A 1F7ZA 1HB0B 4BAKB 4UFGH 4YLQH 3A7WA 3BTKE 4X6OA 3ATLA 3LJOA 4B2CA 1OP0A 1PPZA 4XFQA 4TWWA 2B0FA 3GDVA 4PROA 3NK8A 7GCHF 1DVAH 2XTTB 1TA6A 2QIQA 3SO3A 3RXGA 4H42U 2A5IA 3KYGA 1FXYA 4ABAA 1S6LA 1ZJDA 3ENSB 3M37A 1P3EA 3ATWA 1CGHA 1GBBA 1HPGA 2C8ZB 1HJ9A 2ZHWH 3QLPH 4Z0KA 1YCPM 3Q3KA 3FANA 1QA7A 2CF9H 3LGVA 4ACBA 1Z71A 2W26A 3SI4H 4D9QA 2GDDA 2GTBA 3M3SA 2ASUB 3PWBA 1UTPA 3DT0H 2R3YA 2A5KA 1UK4A 2LNCA 4X2XA 1W11U 5A0AE 1O2MA 2WINI 1SOZA 1ZHMA 3OEHD 1QIXB 1D6WA 2CJIA 1WOFA 4AFUA 4MNXA 1XVMA 3QO6A 3LU9B 3F9EA 1O3IA 4U32A 3TPIZ 1KLTA 3EBNA 1WUNH 3PRDA 1H8DH 1HLTH 1PPBH 3BTHE 3SNEA 4IGDA 1QB9A 4ABJA 3U8RH 1PQ5A 4NA7A 1QL7A 2BY7X 1CT4E 3SUDA 3SBKA 6ESTA 1AFQC 5L6NH 1TNGA 4AFSA 2ZFRH 1O2ZA 1ANCA 1XVOA 1GMDF 2SFAA 3AW1A 2PTNA 1NBME 3FAOA 3PTBA 1AWHB 2FTLE 1ZYOA 2ZTYA 3NUMA 2P8OC 3TJVA 1QCPA 3SW2B 1J9CH 2G81E 1O32A 1OWIA 1HV7A 1TQ0B 5I46H 4K2YA 4ABBA 2HRVA 3WWBA 1WV7H 1GJCB 2BD2A 2EI8A 1P2IA 3E1XB 3FO8D 4J2YB 5EW2H 8LPRA 4Y10E 1ZTLA 2HALA 2I6SA 2L74A 2P3TB 1QL8A 1ZRKA 3UR6A 5K0HA 1ETSH 3ATKA 1NFUA 3MNCA 2Y5HA 5DP9A 1UCYE 1C2EA 1OSSA 2VIOA 1O3GA 1ELFA 2BOHB 2G55A 2HLDD 4YXWD 4AYYB 1T4VH 1KLJH 5IK2D 1DM4B 4JZIA 5BRRE 2FYQA 5KGOA 2OUAA 2JIZD 2A0QB 2JH5D 3SNDA 1TX8A 1YM0A 5FPTA 2ZIQH 1TQ7B 1MMJN 3TK9A 1EUFA 1F2SE 1NN6A 2BY9X 2PHBA 4IC5A 1GHBF 4GCHG 1MCTA 2AFQB 1COWD 1OYTH 5C1YA 3BTME 3NCLA 4LZ4B 2LPRA 1TNIA 3ZZ7A 3VB5A 1B5GH 2VWMA 2ZFPH 3SV6A 2GZ7A 4LXBH 3EAJA 1T8MA 3A82A 3S69A 4AC9A 4OS2A 1UMAH 1UK3A 1NT1A 4NIVA 3T29A 1CSOE 1NTPA 3M3TA 1L4DA 3U1JB 3BTGE 1YGCH 4J1YA 1LHFH 1O2NA 1XUIA 1MD8A 4FU9A 2XBXA 5FXLA 1MQ6A 2PKAB 1HAPH 3V3MA 1QRZA 4MPUA 5T6FA 1CGIE 1GBKA 2QF5A 3OE7D 2FLRH 5EJZA 1QY6A 1F5LA 3N7EA 3GCOA 2H9EH 1W2KH 4D76A 4GPGA 3ZV8A 3STIA 5BPEA 1GI3A 4Y0ZE 2WPKS 1LQEA 3SUEA 1W12U 4ASHA 1C2KA 2QN5T 1IQIA 1C9TA 4QT8C 3HKIB 5TCCA 4ABEA 3TU7H 1T8LA 2KCAA 3BEIB 4Y8YA 3GCHB 2AIPA 1Y3YA 1SLXB 1BJUA 4ASUD 4K5ZA 1C5VA 1C5WB 2KFWA 1MKXK 1DY8A 1P2JA 4OS1A 4X2WA 1GJ8B 1A46H 4I31A 1GI5A 3EYDA 1TOMH 2CXVA 4B2BA 1MKWK 8GCHG 2QC2A 4TPIZ 1O5EH 1TGTA 4Q7XA 4WMDA 1CGJE 2JJ1D 2VVCA 3RXEA 1RXPA 3A8CA 1SB1H 2W7SA 3U8TH 1MU8B 4WH6A 1GG6C 4BAQB 3A7TA 4X8VH 4DT7B 4HZHA 1C1WH 2A4RA 3URCA 3RXAA 3ZVEA 1FY1A 2Y6TA 1Y8TA 2J95A 1TE0A 1SGRE 3ZZAA 3HPTB 1FNIA 2BDCA 4MNWA 2FLBH 2BX4A 3RM2H 5F8XA 1MQ5A 1DDJA 2AMPA 4OGYA 5DO4H 1W8BH 1BBRH 3PMHB 1UVOA 3S9AA 3EE0B 1TNHA 2B7DH 1SC8U 4DW2U 1ANEA 3TJUA 3R0FA 1G30B 4FVBA 2Z9LA 3BTDE 3T25A 1Y3WA 1ZTKA 2ZGJA 4KTUA 3UAIC 1O3EA 1CA0B 4ZUHA 1P2OA 3QTOH 4Q63A 2CGAA 5C67A 4XD7D 2CF8H 1RRKA 1SLUB 2BVSH 3AAUA 3V0XA 1DT2A 5E8EH 1O36A 1W0JD 1NM6A 5L30H 4NA9H 1ZJKA 2FXRA 3A7ZA 3KF2A 1BRBE 2DUCA 2ZP0H 4FVDA 3F68H 1ZPBA 4AG1A 3F3BA 4TT3D 1YP9A 3SHCH 2QE7D 3D49H 1Q31A 1O3DA 1TNKA 2FOCA 3UWJH 5ETXA 3S7HB 1TGCA 1O5GH 1O2GH 4NIYA 1MZDA 2EI7A 5EOKA 2D1JA 3MNSA 1VZQH 2AGIX 4GLYA 4YZUA 1ZGVA 4MVNA 1F92A 3LGWA 1MCVA 2AGEX 1O5AB 2ESTE 3PMBB 4TYDA 1G32B 4YLUA 2C90B 2KX4A 3CP7A 1OXGA 1YBWA 4DG4A 4RT0A 1ORFA 1C5QA 2VH0A 1CE5A 1V2NT 3RC4A 1LHCH 4IMQA 1HAZB 2V3OH 1CT0E 2C8XB 2YOLA 5A8ZA 4A7IB 5A0CA 1MTNC 2P3UB 3S9CA 1C5NH 1RIWC 1TGBA 2BLVA 3T2NA 1KXFA 9LPRA 5KEDA 4CRBA 4RI0A 4ZKSU 3RU4D 1BTYA 3GY2A 2QGRA 5A2MH 1UK2A 5JB8S 3ZZ3A 1TMUH 2BY8X 2ZHFH 3DUXH 3RXBA 5GJ4B 3SNCA 2PFEA 5EJ1A 1P57B 1WYKA 3UWIA 1EXFA 1OWJA 1W13U 2F9PA 5GCHF 2WSSD 3A81A 5FAHA 4ZCNA 5E2PA 3WWFA 5T1VA 4FUHA 3UOPA 4Q80A 4DJZB 1P2NA 3C27B 2OQUA 3K6ZA 3P92A 1B0EA 2Y5FA 3OFND 1GJ4H 5CHAB 3ODFA 1TYNA 4BTUB 3SQHE 3SOSA 1FAKH 3ZYDA 2Z6BD 1SSXA 3A8DA 1KDQA 3KN2A 4FU7A 1ZGIA 3RLWH 3N7DA 2F9OA 1V2VT 3LOXA 3MFJA 1SLVB 5EXLA 4GCHF 1Y3XA 2AEIH 1O34A 2RFKC 3ZYEA 4D7GA 2F9BH 2OP9A 4UEHH 1H1BA 5C5OA 1CBWB 1BTUA
chains in the Genus database with same CATH topology
4FUJA 3QZRA 1C5RA 1SQAA 1GJ7B 2O8WA 4Y0YE 1BRCE 1ZHRA 3UIRA 1BTWA 1ETRH 1C2MA 2H9TH 2NU2E 1IOEA 2F9UA 5E0GA 1DANH 1W10U 2GCTB 2XW9A 3ODDA 2ZTZA 4R0IA 3ZZ8A 2ZPSA 1HUTH 2XCFA 5DKMA 3SGQE 1NU9A 1O2UA 2A7HA 1JBUH 2EEKA 2PGBB 3MMGA 3SN8A 2ANWA 2FDAA 2A4OA 2FEQH 2P59A 3G01A 3VB6A 1ID5H 2FOMB 3ZV9A 1DLEA 1AZ8A 1O3FA 1X7AC 3O8RA 3PROA 4Y6DA 5C1XA 1OS8A 3ITIA 4UFDH 1L0ZA 1THSH 1HDTH 4ZHLU 1PFXC 1VR1H 2Z3CA 3EA7A 1G37A 1SVPA 4XBDA 1GCDA 2BVXH 2H5DA 4OS7A 1EZQA 2TRMA 5H4IB 3LGTA 2VB0A 3D65E 2XCNA 8GCHF 3HK6B 5CHAC 5HGGA 1XUHA 1A0HB 1GI8B 2VIVA 3SHAH 1VGCB 1BIOA 2BZ6H 3T26A 1C5PA 1SHHB 3E91A 4NA8A 1BCUH 2VGCB 2R9PA 3GCNA 4UFFH 4D7FA 1MTUA 1C5MD 1P04A 2PSYA 4ZHAA 2W5EA 4ISNA 3MH5A 1H8IH 1HJAC 4Y11E 1O2YA 2ZFSA 2VWNA 1ZOMA 3AASA 2GVFA 1Z6JH 2W7UA 1MBQA 2HNTE 2FS8A 1K2I1 1BMMH 2LIZA 1ZSLA 1S81A 1ZMNA 1JXPA 1NRRH 1AWFH 2W3KA 2A4QA 1Y5BT 4JCNA 2ANKH 3FP7E 2BD8A 2G8TA 4AGJA 1EOJA 4TWYA 5J4QA 1V2RT 1GVKB 2FM2A 1BITA 1TBQH 4YOIA 1KTSB 2GCTC 4ABGA 1LVMA 4CRAA 2ZCKP 1GI4A 1TBRH 2R2WU 1Z8RA 4ZKNU 1AB9B 1ESBA 1HRTH 4ZKRU 4CRGA 1CU1A 4X6NA 1GBTA 1UTQA 1AI8H 1LVOA 1ZZZA 3IWMA 1ESAA 2KAIA 2UWOA 1EZXC 1HXFH 1KXBA 2OC8A 1ELDE 5T6DA 1BHXB 2G52A 1UVSH 1GHYH 1C5XB 2THFB 3QX5H 1NROH 2R0KA 3SNAA 1Z1JA 2ZDLA 1A0LA 1BZXE 2XBWA 4ZROA 3U1IB 2FWWA 2EC9H 1S0RA 2IN2A 4BTIB 3LGUA 1AUTC 1ELAA 1NPMA 5HM2A 1DX5M 3H7TA 2UUJB 1PJPA 1KXEA 2P16A 2HPQH 5EQQA 2RCEA 1VGCC 3MNXA 2VGCC 3GYLB 3HGPA 3QZQA 4GSOA 1FIZA 5CMXH 1F0RA 2ODQA 1QBVH 2AH4X 5PTPA 1BTXA 5I25A 1LPZB 2XWAA 1EP6A 2DE8A 4A5TS 1C9PA 5GPIB 1P2KA 1KXCA 2QA9E 3ZZDA 3TIUA 4D8NA 1G3DA 4X2VA 3SJ9A 3ZVGA 1OKXA 2WPJS 2VH6A 2A45B 1C1MA 4TY6A 4AFZA 3I77A 1CA8B 2ZQ2A 1AE5A 3PYHA 2D8WA 1P2QA 3HGNA 4IN1A 1MUEB 4HGCA 2WPLS 3TH4H 4B2AA 3ZVAA 1K22H 1K1JA 1NRNH 2UWPA 3RXTA 1GI2A 4TPYA 1EKBB 4FUDA 2ALVA 1DWCH 2G00A 5FX5A 1JIMA 4WF8A 1BBRK 1LVBA 3RXJA 5ABWA 3RDZA 6GCHG 4XSKU 1G36A 2GZ9A 1BA8B 1GBIA 4NIWA 1JIRA 1FJSA 1WCZA 1QURH 4ZHMU 2ZA5A 5DG6A 3SI3H 4KELA 4DOQA 4X1SU 4E7RG 3Q76A 4AGKA 3K65B 1WSSH 2J9NA 2VU8E 7LPRA 3SU2A 4KKDA 1BT7A 1C2JA 1GHAF 1MAXA 4WXIA 1O33A 1RTFB 1V2TT 2BDHA 2BZAA 2XBYA 1P12E 4KTSA 3MU1A 2JKHA 2GV7A 4CH2B 1GBMA 1U6QA 1OWDA 4A1TA 1ESTA 2GDEH 4WVPE 1E0FD 4CH8B 1MTSA 1YCPK 2WUCA 3UFAA 2CV3A 4O3UA 2Y80A 2GT7A 1QBNA 1OOKB 3OTJE 1AUJA 3UR9A 1GMHG 4AFQA 4AOQA 2BLOA 2BLQA 3SU0A 3A8BA 1DPOA 1RTLA 1FN8A 1EATA 8ESTE 1TRNA 2OCVB 1PPHE 4FUFA 1GJAB 1J14A 1EB2A 1NS3A 1GBHA 3JZ1B 4ISIH 3VGCB 4WMFA 3PMJA 4YT7H 1GJ6A 3RLYH 1K9OE 2C3SA 1UCYH 1IQEA 1SI5H 5EGMA 1QJ1B 1DXWA 2ZZUH 2PTCE 2A2QH 2UUYA 1Y59T 1AIXH 2JETB 1HIAB 1HAHH 3RU4T 2BY6X 2K1QA 1AU8A 2AERH 2XXLA 3SQEE 5GWZA 1GDUA 4A1VA 1GPZA 8KME2 1FLEE 2OQ5A 2V3HH 1O0DH 1H9HE 1FIWA 2HPPH 4AB9A 1O2RA 3SV7A 2CHAB 2JH0D 4HTCH 1LHGH 3RXFA 2J2UA 1NRSH 1KTTB 4INLA 3SU4A 3F9HA 4O3TA 3LGYA 3M5NA 2A7CA 1TPOA 1BRUP 2TPIZ 3CENA 4Y79A 1C2HA 4JYTA 3M61U 3HATH 2AS9A 3DFJA 4NZQA 1GHXH 1Z1IA 2V6NA 3F9GA 1FMGA 2FODA 3VEQB 2Y5GA 5FPSA 5FCRA 2QYIA 2ZFQH 3OX7U 2JH6D 2BXTH 3QUMP 1SGQE 4Q7YA 3M7UA 2IOTA 3FZZA 1O3HA 3RMMH 3QK1A 1Y3VA 3LT3A 4A92A 4THNH 1T8NA 3LKWA 1CT2E 1G3EA 3ZVCA 1TPSA 1O2IA 1C5ZB 3CS0A 1EPTB 2GKVE 3SZNA 2RDLA 2ZU4A 1K28D 4I7YH 2AGGX 1S85A 1XUGA 2ZHEH 1ELBA 4B75A 2VVUA 3S7KB 5FBIA 3EA8A 2ZGHA 1YF4A 1XUJA 4H4FA 3RXPA 2TGTA 1YPLH 1O39A 3UQVA 3TJNA 1QQUA 3BG4B 1PPCE 3U98H 5DP7A 1MBMA 3RXOA 3U69H 5A8XA 1P03A 1ZMLA 1C4U2 1PPGE 5DJ7A 5JDUB 1FY8E 1HIAA 1CHOG 2JETC 3O8DA 5LGOA 1DFPA 5T3HA 2Q6FA 1O3AA 1ABIH 4I8LA 1O5FH 2UUKB 1SGEE 1ARCA 1G3BA 4BAHB 3ZVBA 5F8ZA 4F4OC 4X1PU 2CHAC 3IG6B 1HAGE 1SFQB 1NZQH 1DUAA 3M36A 1V2QT 3W94A 1QRWA 2Y7XA 3ZZ9A 3PV4A 4B74A 3KHVA 3LC3A 1GBJA 2O8TA 5A0BA 2M5TA 3UQOA 2WPMS 2F83A 3M7TA 2A4GA 1LVYA 1SBWA 1P3CA 1O2XA 3SV9A 4GVUA 3DA9B 2PKAA 3TH3H 2B9LA 4K60A 1RS0A 1TWXB 2C8YB 4Y7BA 3T5FH 3VB4A 4CR5A 4E05H 4KTCA 5DK1A 3B9FH 3E0PB 2ZTXA 3T27A 1EPTA 4FUEA 2ZU2A 2QF3A 1EPTC 3NWUA 1F0TA 3PMAB 1UJ1A 1TX7A 2FZZA 1AKSB 2VVVA 1GJBB 5F03A 2CMYA 3DFLA 4ABFA 1XKBC 2TGDA 4JYVH 4NFFA 5HM9A 3EA9A 3ATIA 3GCHC 1EX3A 2FOGA 3BG4C 3GCTG 4WH8A 3SJIA 2ZU3A 1SMFE 4MQAA 5C3NA 1V2PT 5DPAA 1GI1A 2ZQ1A 1WBGB 1LCYA 1TMBH 4DGJA 6GCHF 3OY6U 1ACBE 4ISHH 3A7YA 3FP8E 4OGXA 3H7OA 1VCWA 3NZIA 5CE1A 2ZDMA 3A7XA 3RXSA 3SNBA 1FV9A 1KIGH 4B71A 1L1GA 1GBDA 2SGQE 4ESTE 1O3KA 2QXGA 1ZTJA 4I33A 1LPGB 1QB6A 3KEEA 3SJKA 1FDPA 3WY8A 3ZZ5A 3QDZB 5AHGH 2Q6DA 4YO9A 2HVXA 1K1NA 1EJMA 1P2MA 2TBSA 4NFEA 1ANDA 1SHYA 3RC5A 2FOEA 2A7JA 3GY3A 1FY4A 1V2JT 4K1TA 4OS6A 1YPEH 4UDWH 3KNXA 5DP6A 1QBOA 3TGKE 2ZGCA 3TK6A 4MPWA 4OS5A 3UY9A 4K69A 1V2UT 1NRPH 1A5HA 1K1IA 1PQAA 5JBAS 2RA3A 4JK5A 1CA0C 3BIVH 2ZHDA 4ZH8A 3RXLA 4O03A 1LDTT 4VGCB 3UTUH 2C8WB 2BD5A 1NFXA 2ZWLH 2HOBA 2WPHS 1D3DB 5IDKA 4FUIA 3LIWA 2FIRH 1O31A 2O8LA 3RXDA 1J15A 1O2OA 4AB8A 2C93B 2Y82A 3KIDU 3TNSA 1BQYA 1J17T 1GBCA 1QJ6B 1DICA 2NU1E 1GHWH 4ZAEA 2Z9JA 5A8YA 1HJ8A 5DP4A 3RXQA 2XRCA 1ARBA 3P8OA 2ZC9H 1TRMA 5EQRA 4RKOB 2XC0A 1O2JA 1NFWA 3GYMA 3TGJE 1KXDA 3P70B 1MZAA 2Y81A 1HNEE 4I8KA 3RXMA 1H4WA 1Y3UA 3S9BA 3SJOA 1GGDB 2J38A 3RC6A 1SLWB 2VIPA 4MNVA 1HAOH 5IYTA 2QV1A 3JZ2B 4Y7AA 1JRSA 1GMCG 2FI5E 4NIXA 3VB3A 3PLKA 2BQ6B 1UVPA 3UNQA 3ZZCA 1O5CB 4DIIH 1IQHA 2IPHA 2QY0B 2O9QA 3BTQE 5EPYA 1TRYA 3MU5A 2QXJA 1O3NA 4ABHA 4ZXXH 2OC1A 1A0JA 5FBEA 2PWXA 1V2ST 2BY5X 1W3CA 1LKBA 1W7GH 3SORA 3W95A 1GL0E 1V2KT 3SU1A 1DWBH 1HBTH 1IAUA 2H6MA 2GCHG 4K1SA 2OXSA 1C1OA 4TY7A 2QCYA 1QB1A 1YLDA 2ZDKA 1EAUA 1BMLA 1FY5A 1HAXB 1C1UH 1Q3XA 4BNRA 2Z94A 3L6PA 1B0FA 1O2KA 6LPRA 2P3FH 2GD4B 1S6HA 1BUIA 3GDSA 4I32A 1C1QA 1HFDA 2NU4E 2ZGXH 4MNYA 2BYAX 1O2WA 2G51A 2VIWA 2QF0A 5F8TA 3L33A 3QN7A 3UPEA 2ZU1A 3MU8A 2YNBA 1C2FA 1EAXA 5EPNA 4CRFA 6CHAB 2GT8A 3SUFA 2ZFTA 1H9LB 3N7OA 2WUBA 2PV9B 2UWLA 2FYRA 4IS5A 1HYLA 4K8BA 5E2OA 1UTKA 3MHWU 4MG3A 3UUZA 2TGPZ 3EGKH 4A1XA 1YPHE 4YOJA 1HGTH 2BX3A 1HCGA 2B5TB 1S84A 1FY3A 1O30A 1Z7KA 2XC5A 1C1NA 4Y71A 4WJG2 3HKJB 1O3CA 1CBWC 3E0NB 3ZZ6A 5EW1H 3GICB 1N6YA 3HK3B 2GX4A 1AE8H 3OY5U 1EZSC 4FUCA 1K1OA 1KYNA 1D3TB 2FOAA 3M7QA 2AYWA 3BF6H 5ESTE 2GMTB 1D4PB 1XXFA 3MU0A 1SGFG 1D6RA 1HAIH 5DP5A 1FPCH 1SGPE 1PPFE 1T7CA 4LK4A 4NG9H 4Q7ZA 4IW4E 3SJ8A 2BD4A 3SU5A 1E36B 3V12A 1CQQA 1F5KU 3F6UH 1G9IE 3VXEH 4A6LA 1GI6A 4UFEH 2F9NA 4CBNA 3P17H 4CRCA 4WY3A 3QGNB 5EG4A 1S82A 1THPB 4CBOA 2AMQA 3Q3XA 3BTWE 1TPPA 2P95A 3RXHA 2OBOA 3GCTF 1C5SA 1QL9A 4UONA 3I78A 3LH1A 1GI7B 5JBCS 1RFNA 2VWLA 1GVZA 5C1UA 2O8UA 2OTVA 1EAWA 1C1PA 3LJJA 2ZCHP 4Y76A 3MTYA 3NPSA 1C2LA 4X2YA 3A85A 5AFZH 4CHAB 1V2OT 1UTLM 5E0JA 3TJOA 1AN1E 2FTMA 1ANBA 1S0QA 2R3UA 3SGAE 5JPMH 3EDXB 2D26C 1K1PA 1IQNA 3KGPA 1O5DH 3RM0H 1BDAA 4NCYA 1NC6A 3F9FA 2PW8H 5EXNA 2ZG0H 2G4TA 4GAWA 1Q2WA 2VJ1A 2BD9A 2SNWA 5G4BA 1AFQB 3URDA 1WQSA 1YPJH 1SPJA 1P0SH 1TFXA 1BMNH 2Z7FE 3KQCA 2BMGB 5AFYH 1TGNA 2BDYA 1TNJA 1AHTH 1IQLA 2P8OB 5GXPA 1O5BB 3NXPA 2H2ZA 5K7RA 4U01A 3I29A 1VITG 2G5VA 3A80A 3T28A 2ZDAH 2YNAA 3UNRA 3DHKH 5EXMA 2IJOB 3SV2H 1O3MA 2J34A 4AYVB 2GMTC 1TABE 1V2WT 2ANMH 2UUFB 4SGBE 5LPRA 2A32A 4BXSA 1GDQA 4I8JA 1ELCA 2J92A 1D3QB 2A31A 1GBEA 1AB9C 4JMYA 1CHGA 2A1DB 4FUGA 2ZFFH 2ZI2H 3D62A 2O8MA 3A86A 1UTJA 2NU0E 1OWKA 1P11E 3NKKA 1AVWA 1ZPCA 1CVWH 1P02A 3T62A 1DWEH 1GI9B 3M35A 2G5NA 1UTOA 1O3LA 2WYGA 4B76A 5E0HA 1C2IA 3AVZA 1IQMA 3LGIA 3E90B 2STAE 1T8OA 2Z3DA 3U9AH 1O2TA 4WXVA 4JZFH 4YESB 1F0SA 4D9RA 4YTAA 4OS4A 1Z8JB 1DITH 1FONA 3SUGA 1G3CA 3OSYA 4CHAC 2ZGBH 3M5LA 4K3JA 2QAAA 2ZPRA 1QQ4A 2PUXB 4XOJA 1GMCF 1TAWA 4O9VA 2H9HA 1ETTH 3MWIU 3FP6E 5DP3A 3BG8A 5HXFA 2GZ8A 2NWNA 2PLXA 1H9IE 4GHTA 2B8OH 1AD8H 2F91A 4DCDA 4I8HA 1P09A 1QTFA 3TNTA 2FOFA 2FOBA 2I6QA 4ZXYH 2W3IA 2OD3B 1GBFA 3H5CB 1C5TA 2F3CE 4CR9A 2OINA 1GVLA 1FQ3A 3UREA 4BAMB 3MNBA 1EP5A 1LO6A 5AF9H 4K1EA 4AX9H 1NRQH 2GCHF 3K9XB 1V3XA 3FVFB 4R8TB 4X6PA 1EZUC 2SNVA 2ILNA 1XUKA 1SGFA 1UVTH 5FHTA 3A8AA 3B23B 3LPRA 1QRXA 2ZCLP 3L3TA 4WWYA 1OP2A 1BHXF