3IWVA

Crystal structure of y116t mutant of 5-hydroxyisourate hydrolase (trp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
b'SPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTTRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-hydroxyisourate hydrolase
molecule tags Hydrolase
source organism Danio rerio
publication title Probing the Evolution of Hydroxyisourate Hydrolase into Transthyretin through Active-Site Redesign
doi rcsb
total genus 24
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3iwvA00
3BT0A 3FC8A 3CFMA 5E4AA 3CBRA 3B56A 3CXFA 3IMRA 1THCA 2PABA 3IMWA 3IPBA 4Y9BA 4Y9FA 4DEUA 4TNEA 5DWPA 1SOQA 1QABA 1TYRA 3I9PA 2G3XA 4TL5A 5EN3A 1SN2A 3W3BA 1TFPA 2G9KA 4FI6A 3DK0A 5CLYA 4MRCA 1KGJA 3GRBA 2G2NA 3ESOA 4ACTA 3QVAA 1GKEA 3GS4A 4PWEA 1BZDA 3HJ0A 4PM1A 4Y9CA 5AL8A 2H4EA 4QYAA 1FHNA 4TQ8A 4HJUA 4PMEA 3DJRA 4WO0A 3GPSA 5K1NA 4IIZA 3A4DA 3NEOA 2G5UA 2B15A 4Y9EA 4MRBA 4HJSA 4IK7A 4PVMA 1ETB1 4IK6A 4QRFA 2QGDA 1THAA 2B16A 2FBRA 1TTCA 1X7SA 1BM7A 4TLKA 1DVZA 4IKLA 2QGCA 2B77A 3CFTA 5CLZA 4WNJA 2ROYA 1TT6A 3NESA 1F86A 4N86A 5E23A 3SSGA 4N85A 4PWJA 1BZEA 3NEEA 4IKJA 4DETA 5FW7A 1DVYA 3KGUA 3OZKA 4TLTA 4KY2A 1DVTA 1RLBA 2NOYA 2G3ZA 3IMUA 4ANKA 1SOKA 1E5AA 3D7PA 2QGBA 3GS0A 3M1OA 1TTBA 1IE4A 4IKKA 4PWHA 5K1JA 2WQAA 3U2IA 3OZLA 3KGTA 4TLSA 4I87A 4HJTA 4PWGA 3TCTA 4FI7A 1TTRA 2TRHA 4TLUA 4DESA 3ESPA 5L4JA 1U21A 2G4EA 3IWVA 4PWFA 3P3TA 5FW8A 1DVXA 3DJSA 3DJTA 3GS7A 2F7IA 2H1XA 4HIQA 3FCBA 4PVLA 5CNHA 5HJGA 1TTAA 4TM9A 2IGLA 5AKVA 4ABVA 5L4MA 4Q14A 4ABUA 1QWHA 3GLZA 2ROXA 5AKTA 2B9AA 3CN4A 5CLXA 1ZD6A 1BMZA 1IJNA 3D2TA 4TNFA 1E3FA 1G1OA 2TRYA 4HISA 3NG5A 4YDNA 5CM1A 1DVQA 4IKIA 4L1TA 5AKSA 3CN0A 2QELA 3CN1A 3IMTA 2H0JA 3DK2A 2H0EA 4PVNA 2FLMA 5A6IA 5IHHA 3P3UA 1GKOA 3GRGA 4TL4A 5EZPA 5FW6A 1E4HA 5JIDA 5L4FA 3DIDA 4AC4A 4I85A 4QXVA 3A4FA 5JIQA 3A4EA 3I9AA 5E4OA 4ABWA 2B14A 2F8IA 2H6UA 1KGIA 5AL0A 1SN5A 1OO2A 1ICTA 4YDMA 4TNGA 4TKWA 3IMSA 4MASA 4TQHA 2QGEA 4DERA 3CN3A 3CFQA 3I9IA 2G2PA 2QPFA 1F41A 1SN0A 1IIIA 3DGDA 1DVUA 5BOJA 3ESNA 3IPEA 3P3RA 1TLMA 5CR1A 3BSZA 2GABA 1IIKA 3KGSA 4ABQA 5JIMA 4TQPA 5DEJA 4FI8A 1Z7JA 1ZCRA 4DEWA 2G4GA 4PWKA 4PMFA 5CN3A 2H0FA 3IWUA 1X7TA 2GPZA 3CFNA 3IMVA 4L1SA 1TZ8A 4D7BA 3P3SA 4PWIA 3NEXA 1TSHA 3DJZA 1ETA1 4N87A 5AYTA 1FH2A 4Y9GA 5FO2A 3DO4A 3Q1EA 1BZ8A 3CN2A 4TQIA 5TTRA 5L4IA 4AC2A 1Y1DA 4WNSA 1DVSA 3U2JA 3TFBA 4I89A
chains in the Genus database with same CATH superfamily
1HZHL 3TT3L 3CFMA 4G5ZH 2C4XA 4AYGA 1SEBA 5JQ6H 2GHWB 4HIHA 1VADA 4ZFFB 4KO5A 2CPUA 4WEEA 3GSXB 2W9LA 1TKWA 2ALWA 2QADD 2E7DA 5JA9A 1O9ZA 3QZOA 4NRYB 2WLJA 4Z7IA 2ESVE 4JM4H 5KBLA 4P3DA 2GTZA 2NY4B 1WE5A 5HI4D 5EO0A 4U6TA 3FTWA 4LLMB 2H4EA 1P2CB 3G6JA 5IBLC 3CC1A 2ZYSA 3L3OA 4KJPC 3FUKA 3NUKA 4X6CB 3KWWB 3DTDA 3VFVA 1UM6L 1XH3B 3KXFA 4M6OL 2QDVA 1UXLA 3IJ8A 1QPKA 4I5BA 5JLZA 5CZXD 3L4YA 3FCSA 2EVIA 3LS5H 4K7PL 4EI6B 3QRGH 3NIGF 3L48A 4L8CB 1F6FB 1MAJA 2D7NA 5KVFL 4UOJA 2PCPA 4I3RL 3DSFL 2BWQA 3ZXAC 5ID0B 1AANA 1PZ2A 3WGVB 3TXAA 4W9GC 8CGTA 2H6OA 5C0BA 4RWYL 3O2WH 1RLBA 2ETWA 4PCTA 1CLOH 2WBXA 3PJSB 4JO1L 4RMSA 4FADA 4MAUL 3NCYS 1QR1A 5ESQA 2AJ3A 1H15A 3EFOA 1PZ5B 1JXKA 2JB6B 2PPDA 4AE0A 4B96A 5HDLA 3UAJA 3EFDH 3FK3A 1J48A 1MW3A 2Y06H 3K0YA 3VXTB 5LQBH 3KM1A 4H5SA 3SCMC 1GCFA 2WNWA 2WTPA 3NRFA 1EJFA 4LK4A 4OY9A 2Z9TA 2GVYA 5ICXB 3MLWL 5MEQB 4XP6H 4FXLA 3D50A 4W9FC 1L6XA 3N43B 4XCCL 2H0JA 2EH8H 5A7EA 4A04A 3N3EA 1MCCA 2ZOLA 4BFJA 3HBZA 3QUYC 4KK8C 2LFEA 5C0RL 1H3UA 4NZDA 1U58A 3BIKA 2O5YL 3KYNB 3V4PB 4HWZA 1IU1A 1KV7A 1QWUA 3NACL 5JNYA 1IVTA 3T0EC 1CTOA 1AGFB 2VR8A 3I9IA 2R1YB 4PY8I 3DGDA 1MH5B 1HKLH 3B6SB 4HLZH 3ARYA 5FOBB 5I6XC 4Y2DA 3P4LA 5E6SB 4LLWA 3GJFB 1KN4L 4X4XA 3UTTE 1L4IA 5FYJD 2WLIB 1Z3GL 4JFPB 4TVUA 4S0TD 4NN5C 5AB1A 1ET5A 3OX8B 3ZE0F 1F42A 2YO3A 1RUAH 4L1LA 2Z91A 1RZ8A 3OKKA 3LZQA 1ZJAA 5KVFE 4AC2A 1K4CB 2CRYA 4YGVB 4ORGB 1FP5A 2QQQA 4TNWF 4QRPE 1I31A 1KJMA 4GS7C 5FKPB 2J20A 1MWAA 4XHQA 1XF2A 1CD0A 2A83A 2ZG3A 2N0KA 3MRCB 4JFDB 3BH8B 4JO3H 4BDVB 2W59A 2BZCA 3F2LA 1F90L 2R2BA 1KGCE 5C07B 5DQDL 1M7IA 1OSZA 1KTLA 3CHQA 2YN3A 3GS4A 5E00B 2DB8A 2BRRL 4M00A 2ISDA 3O0RH 3EYVA 3LB6D 3GMPA 4LPCA 3WY3A 3T71A 5J57B 1ECYA 2QKIC 5D5ME 1TKWB 3OB0K 3HS0A 1B6UA 3NGBB 4N2CA 2VQUA 4OZFA 3GF8A 5C8JB 1W15A 5CJQH 2CAKA 2BIHA 4GW4B 1UWFA 3ZT7A 3W37A 1RJYB 4XN1A 4IRSC 2SEBB 1MY5A 2HFGH 5DD3H 1V3JA 3E3QE 2D7TH 3CXDL 4MNQA 1MCWM 4P2OC 4ZMXA 4TLTA 5I71C 3QA3A 4QRTA 3FSOA 5JW3L 5L0QB 4N2NA 4XBPB 5IIEB 3VI4A 5I1EL 4NQDE 2H8PB 1FLTX 4XE5B 1IRAY 4APQB 1LO0L 1SGKA 3FL7A 2EDNA 3TLRA 3WHE0 1OAUL 1N0LA 3HC4H 5IBTH 1S5HB 4F5CA 3HZYA 4GIPD 4PVLA 3CCHA 2XQ0A 3QUXD 4WI6A 4K94L 1PLGL 3DMMB 1RZIB 3K2KA 3VFNB 5IGXH 1Z9OA 1OTTD 1I8KA 1MCEA 4AKPA 4X6DA 4QHMB 4X2UA 2W8CA 2IPTL 3WTUA 1EEQA 1SZNA 2N7BA 3BUPA 4P4KA 4PBDA 4CMHC 3D85B 2MTPA 3MV9D 4I85A 4FG4A 4FCHA 3G7TA 2F7RA 1G7PA 2UUDH 1KGIA 2ZWZA 3LPPA 3MLPA 2EJ1A 1IGFH 3O3AA 1ZVHA 4DERA 1YN7B 1TQTA 4JPKL 5JHMA 5DRZA 1RZ7L 2NW2B 3CJJA 3K6IA 4PRBA 3AB0B 4BH8B 2ZXBA 4ZMZA 1QNZL 3C6LA 3T1WA 1KSRA 4MS8C 3ZE0E 3OHXA 2V37A 4P9MH 2E7CA 4F9PC 2BVEA 2J56A 1MLCB 3MBWB 4PRID 2HLFC 5C0AD 4DUVA 4IBTA 2IWFA 4HHAB 4J3BA 1NIEA 2H32H 3VU2A 3N1QC 3QG6A 3P0GB 5T1LA 1EHLH 3HS0B 5ITFA 3WS6C 4MXWL 1KT2B 2CMRL 3ORJA 2O72A 3ZHLA 2FZ3B 4FLSA 2WUCH 3VXQA 3TX4A 2BVQB 1QBLL 3AITA 4NLHA 4AYDC 1LO3H 2ZWLT 3L2LA 2BINA 2I9TA 4EKXA 2OMWA 2XZQL 2Y22A 4LSUL 3QR1A 5F0PB 4M3HA 2WY3B 3M8OH 1QSFB 5D2NE 4AMXA 5C6TL 1VFBB 2ZYHA 5BOZG 1E50A 5DD6B 5AYUH 5IROC 2EZ0C 1CDYA 2RHEA 3UTSD 3ZYJA 1OF2A 3HZKB 1RIVH 1CGTA 2WVVB 3JWOH 5HGDA 3RVWD 4XBPA 4PG2C 2OMUA 4RLDA 2CUIA 3HC0B 3HKZA 4YFDB 5A2IH 4OZFH 2ADYA 2WYZA 2XQBL 3LHPL 3QIWC 3MR9A 2VLJE 1E9PA 2WQUA 4U1GB 1TJHH 3X14A 3RWFB 3V0VA 3VUAA 3ALXA 3WFBH 1XTMA 2XPGB 3TWCH 3T6WA 3HPJA 1NLDL 1ZLDA 1KTDB 3OAYH 4UIMB 3U36B 5I1KH 3O4OC 4KHTL 3OM3B 5CR8A 4HHWA 4JFDE 1BZEA 4DCQB 3VCLA 3TBYB 1T83C 1JS4A 3QIWD 1IKNA 4PJXF 1ZA3A 4GI8A 4FI7A 2D8KA 4K5NA 2I26N 4BQ8A 3CFDA 4GS7B 4PWFA 5F1NA 4M48L 2OFQA 3HBQA 1MF2H 2VZ3A 3O3EB 2XVGA 5IESH 5C0AA 3UBGA 4TOYH 1ZPLA 1A4CA 3C09B 5FYKE 3V4UH 3T2OA 2XFXB 3FNKA 4LL9A 1KXHA 1NCOA 4CILA 1I4FA 2NY3B 2AV7A 1ZS8A 1ZKAA 2A2QT 5AVTB 3TVMD 2IPKA 3QXAB 4Z7OF 3DUSB 1B0RB 2W65A 1LGVA 3QG7H 4OCSL 1BREA 1NJ9B 1BQLH 5KYUA 1X5AA 4TN9A 1DE4B 3V5HB 1D6EA 4XZUA 1G9HA 3UPRB 4NO5A 3E6HA 3LV3A 1BFOA 1EHKB 2XXCB 1AG6A 2B08A 2R0ZL 4BA8A 2O4EA 2Q3ZA 1O7DE 3QXUA 1Q90A 5F9JB 2YOAA 3GSQB 1P0SE 3GBML 5C07A 3P0VH 3L9BA 3FCTA 3DUUA 3QULA 2APBA 3C5SB 4GBXB 4LKCB 1MREH 5I0YA 1D2PA 1AMXA 1ID5I 1KZQA 1PG7W 4K73A 4QF1A 4E9VA 4QXTA 5FFLA 2PTUA 4HK0B 2AJSH 2ZUYA 4AZUA 1NEPA 5HPOA 1MIML 2FJHA 2DQDH 1XZ0B 4OZGB 3T4AA 1KDIA 4Z0XB 3L1EA 3MBWA 5HYQB 4JM2B 1Z9SA 1I1FA 4TVPE 5E8EB 3RDJA 4M7LT 3RDTC 2I9LB 5BZWB 4KROC 4PS4L 5KBKA 1WFIA 4KK5D 2KT6A 5FYLL 4NSKB 4ZDHA 4KJQC 4P9HL 1IJ9A 1ZWIB 4PJ9D 2HSIA 5FOBA 4K3GA 3B9KB 1J0IA 4KTGA 3C5JA 4LL1A 3VFWB 5GRUH 1UKSA 5IMOA 1HCZA 2FQGA 2XN1A 3L5JA 4UOZA 1AGBA 2AABH 3BX7C 5I6OA 3BFWA 3EOBB 2B1HH 4KI5E 4PJ9B 3PWVB 3WSQH 5K59E 4E9LA 3FTGA 5DHXB 2GITA 1BECA 2AQ3A 5EF3A 2EDBA 1AZCA 2MEJB 4HZLB 4X4YA 4JDZB 2PYFA 3DGGA 2D03H 2HUHA 3OL2A 3AJ7A 4ELMA 5KAQG 3U4AA 4RAVB 3ZDXF 4F9PA 3FT3B 2YAHA 1SYVA 7PAZA 2ILLA 4YXLL 4FQXC 3FFCE 2J1XA 5DMIL 4NKQB 3GMMB 4TSCH 4X6FB 3UAFA 2AEQH 2WB7A 4R4NC 2ATPB 3FN0L 2B0SH 3O4LA 4WO4A 3SO5A 2VH5H 3PHAA 4PUBH 5AVZB 2R29H 5DD0L 3V7MA 4W9LC 3PHOB 2CRZA 3VWJD 1LE5A 3RZCA 4OCYH 1EZUA 4A55A 2HFGL 5GGVL 5L4MA 5CKGA 5DJZB 5C08A 3NSJA 1BVLB 3L5WA 3WEXB 5C0EB 2ZICA 3FUFA 1P6FA 1U95A 2OULB 3V52L 5IMMB 1UWXK 5L2JB 1S6NA 1OP3H 4LE8A 5IHHA 4TNWK 5B1JA 4JFQA 5EU6D 3DHUA 4EBQL 1FNLA 5IW1B 1C9SA 1EDQA 5J06A 1XR9A 5M95B 3T0AA 3G5ZB 4HUWA 5FS5A 4ZBJA 4MAYB 4OJYA 1K4DA 2DM2A 5DJAA 2CO7B 5ALBH 4ZQKA 3QZNA 5FUOL 4YXHL 4NHUA 2IOIA 2APXA 4HSAC 3AY4C 4R0LA 5F3HB 5G4NA 5LXGL 3MLUH 3BDYL 1ZTXL 1ORQA 4G9FE 5BRQA 2ICWB 5D8JL 4N2LA 2A6IB 2UZXB 4WEBH 4X4ZA 3E6HB 1A4KA 2IWGA 1C8PA 3J2PA 4HUCA 4KK8D 1S2EA 3HAEB 3QUYD 4XVSL 4DGUA 4G3YL 2WSPA 2LLGA 1CBJA 5GGVH 1N18A 2H1PH 4JLRB 5BUGA 3P4NB 2J3SA 4ZMQA 5HYFA 2F8VA 2NQ3A 2B59A 3FC8A 4XO4A 1OF0A 1VZIA 5KVDL 2CKBH 4IU3B 1MFEL 2NY3C 3N9GH 3LKOB 4ONHB 5F3BA 2Z4TA 2XTSA 3E9UA 1FZKA 3MRDA 2EIDA 4OGZA 4KH9A 4U1NB 5IM7B 5B8CA 3IGKA 1EHXA 3FU9A 3MGOA 3IVKA 4FI6A 4WO4D 4BQ9A 4YFLF 3ZTJG 1T5XB 1M71A 3MJ7A 3MRPA 4P4RA 3X17A 3NSXA 3SOTA 1TQBC 3KZ8A 1CLZL 2BVOB 3O6LH 1NEZB 5DHYA 1ETZA 4QKXB 2NX5B 2XVBA 3MRKB 4TQ8A 3VRLE 1BVKA 4OFQA 4TS6A 1NAMH 1XSOA 1AVAA 3NFPB 1ZVYA 3NP3A 4OT1H 2K6YA 1UD4A 4M7JL 2VL5B 1SBBA 3IRZA 3ZSSA 5JYLA 3EJYD 4XMVA 4OZIE 1X7SA 4LVNB 2JLPA 4ZG1A 1I7UB 2AJXL 1S9XB 3V6ZA 5IMLB 4JM4L 3Q7JA 4FFVD 2JI2A 3RJOA 1QASA 1FV1B 4DP4X 5ITBH 3MV8D 5IBLD 3D2UA 2HX8A 5EU5B 4ZUUA 4Y8AA 3HAEH 3BE1L 1JDDA 3VXRD 4HWEH 4DKDC 2VDQL 4GMSL 3SDAA 5L4JA 1OZTG 4I3SL 1B0GA 1TJXA 2HYMA 3UEQA 4F2EA 3MN8A 2HH0H 4PB9H 5J7CC 2EACA 3IGLA 4ONGH 1NGZB 4HW6A 1H8NA 5FXCH 2H0PA 4PGCA 1YEGH 1ROCA 3F3HA 5IF0B 4YDNA 4DPCX 3C9NB 1NEUA 3FU6A 2Z8VC 3I2CL 5J6HA 3FUNA 1ZSDA 3OD3A 2APTA 4QRAA 6FABL 25C8H 5D6CB 1FVEA 1FO0B 2X2HA 4U6HA 2WMPA 4JR9L 4ONGL 4ABWA 1ZT7B 2YQGA 5D2NB 5BZWA 1RULH 1P7HL 4GUCA 5DMJB 3LZFH 3T8XA 3B9EA 1W0WB 1AGEB 2AJXH 4MNGA 5B1KA 4B9ZA 4W9CC 4OVVA 3HZVB 4HX1B 4LPTA 3FT3A 4N0RA 1CFSB 3ERXA 2CQVA 3K5RA 3IJYB 1G7QB 3S3DB 3NJFA 3KVPA 4AUUA 1CZ8L 2EIJB 1DO6A 4PN6A 4FQJH 1DEDA 4G8AC 5DUPL 1LMKA 3BP7A 1G0DA 1LNUB 4Q8BA 3UTZB 2UY7B 4Y0GA 1JMXA 3D39D 4L37B 4A2FA 2HTKC 1KG0B 4L05A 1H6FA 3VD7A 4N0CC 2BW4A 4C56E 3LS4H 4PS3A 2ERJB 1P69B 5KVEE 1W8OA 4KTEH 5AG8A 3UPRA 4UAOB 2X3CA 5ELIA 3S6CA 1YUHB 4F7EA 4NM4H 4IIQB 4Y5YA 4G8GE 3MC0A 3VXRA 1B3JA 1A9EA 1CXHA 3S4SG 2ZOWA 3DK0A 4U0RC 4A7GF 1KGJA 3FRPG 4UV7L 3ALPA 4C4UA 1CDCA 1YRKA 1IX2A 2H1PL 5KSBA 2XETA 3SPGA 1R5WB 5ADOL 2P1YA 3IXTA 3J07A 4OZHA 5I8EA 4MCYA 3CK0H 1T3FA 1TJMA 2KERA 4XAWL 5D1ZI 2X4PA 4RCAA 1TZIA 4AG4H 4U33A 3ULSB 3B2VL 2NXYD 4QRPD 5ES4B 3LN5B 4KRLB 4UILL 2RR3A 3MLUL 4NQEE 3UC2A 5HVFB 4JAMA 4DHLA 2XQYK 1MPAL 2AK1H 4PJ7A 4UTBH 4OZ4A 3BO8B 3B9VA 5HHOE 4ODXA 1NM9A 2VXSH 4Y89A 4WJ5B 1UD2A 1Q9KA 2J88L 3LTVA 1DVFB 1VDGA 4U05A 3T2PA 1L6PA 3QZPA 5CCKH 1YNTF 1ZEAH 2ADGB 4XMKH 3AY2A 1A64A 2QZ5A 3HNSH 4DESA 1VFMA 1U8OA 2B2XH 8FABA 1ZDSA 2P43B 1K2DA 3O4OB 4BSJA 4F58H 3H0TB 4FCAA 3B5GA 3KL5A 1KCSL 2W92A 1QW9A 1ORSB 3BH8A 2O61A 1FZOA 1SJXA 1ASPA 4AW4A 3HHSB 1ZIBA 4GUPA 5D1QD 3RWJA 1OOAA 2EDXA 3A6CH 5IHUL 5T3XD 1F6AA 3II1A 4ZMPA 5HHPB 1AACA 4DAGH 3IJEA 3MV9A 3VNYA 3UACA 1AKJD 2AEQL 2B39A 3KWWA 3SZ6A 4QTIH 4RX4A 5DJ0A 1M2VB 4PJEE 3VWKD 1FGVL 1GS8A 5CWSB 1I1AA 3QS3A 3DO7B 4ZO9A 1A66A 4LLVB 3U0PA 4TQHA 3MODL 4QT5A 1E42A 4AM0Q 3Q2NA 5J9PA 2G9HB 1INDH 1DUZA 3BKCH 3HLAA 5LKNA 5LG1A 4UMGA 4KC3B 1SXZA 1G7IB 3DRQB 3VXRB 3P40A 2XX0A 2JI3A 2WQVA 3ESNA 2IANE 4HETA 1CQYA 3QG6B 5T1LB 1MRCL 1TJIL 2R1YA 3BJLA 4QWWD 5T3XE 5HVHB 4PRIA 4XXWA 5HYIA 2R8SH 4K5MA 3VX1A 1KIQB 1AE6L 4FQIL 1QNIA 3QUKB 3K80A 2HKAA 3NFPA 5KG9B 2H2SC 4MQ7B 2OMVA 3H3BC 4LMQI 4DK3A 5CD5C 2VDKB 4IM8A 1UZ8B 1AO7E 1NMBH 4LDOB 5JDJA 1Z9MA 2ZOLB 1G1CA 1LD9A 1YMHA 1OAUH 2AERT 2P47B 4LARL 4F7TA 1UCBL 2MTAA 2X9YA 2J8UA 1PD1A 3P11L 3QHTC 1KIRB 4YPGA 3W1ZA 3QJTB 2VRQA 1IM3B 4FN0A 1R3JB 5BZXA 5DSCA 2OCJA 4R7XA 1AGEA 2Y72A 3N41B 4ZUUB 3VFOA 5I17B 4N22A 2ZSWA 4FFYA 2HTLD 2EDOA 1R75A 4JREC 3QP3A 4JHWH 3FULA 5HHOD 4B50A 3BDXA 1YEJH 3BP4B 3WJJC 4JFFB 3SCMB 4GG8B 3MRQA 4TNVF 5DGQA 1AI1H 3H9SD 3QCTH 3MJ9L 4D8PB 1JYNA 2YD8A 2J7LA 2G30A 1F3RB 1KFAL 1E5ZA 2BCKB 2R59A 3NJVA 1E7VA 1VGKB 4GRLC 4FMKA 1GJIA 4M3JA 1D5MB 5EU4B 5FA4A 1EERB 15C8H 2P42B 3LYRA 2BVTA 2X4PB 4HQQL 2JTYA 3C6EA 4WFGD 5HGHB 4ETYA 5TE4L 3HG1E 5AYQA 3QJSB 1XF2B 4NQCD 3TBWB 2WANA 5EEYA 4Y1AD 1AFVL 4BQCA 1WD8A 4L1BA 3W39A 4LCWB 1UFGA 4I87A 2A7BA 4F8PA 4JUTA 4EKJA 2OR9H 3CFJB 2YQBA 4QHKI 1GGUA 1DQQB 2EVJA 1D5IH 2IGTA 3GIVB 4WU5A 1YVLA 1KNOB 4IIQC 4GAJL 2EO1A 3SY6A 3DROA 3R1GL 5IQ9B 1JZFA 2GJRA 3CDCA 4LBEB 3VACA 4IRZA 1QTPA 4HGMA 4QTIL 3TVMC 1WBZA 4Q0XH 2Y25A 2NSQA 4YDVA 3CQQA 1G7HA 2QV2A 3GMPB 3SBWA 5BXFA 1K8DA 3D3VB 3KDMB 3CMOH 4H8PA 5ICZA 5GSVB 1QRNE 5D7KD 2OM5A 4RRPM 1QLFB 3BVUA 1H3GA 1T0PB 3GMNA 3FFCB 3ARUA 4HIXL 4TNGA 1RV6X 4O4YH 5T1JA 3TA4D 5FWQA 4PJ8C 3VGDA 4K8RC 5ADPL 2E27H 9CGTA 4NOFA 4Z7WE 2FJHB 1MVUB 2JKIS 2W95A 2WBJB 4GT7A 4HBCH 4P46A 1BQHA 4TQEL 1QBAA 3MV01 4R7DB 4CA4A 4CKVX 4YSQA 3DX7B 3FMGL 3F83A 1MPAH 4GSRA 2ZJSL 5ESVB 2ZNWA 3HG0A 1DJIA 3UTQB 4S11A 5AVXB 3Q01A 5FYJU 4TVPL 1KCUH 2D73A 2VDNL 1MFAL 5FK9A 3QEQA 4BFFA 3M8OL 5C6TH 3CDFA 4UM9B 1M05B 3VFGH 4P2OB 2JWYA 3LHPH 3GMOA 3MI6A 4JHZA 4KRPD 4ZUTA 3NIGE 5CBEA 3THMH 3C2AL 1NFDE 2WXNA 1XQ4A 5B39B 5FLUA 3AMLA 1O7SA 3NPZB 5HY9A 5LVEA 3QDMD 4G7YL 3A47A 4ZNCD 2YBGA 5FO8B 4JDTH 5SWQB 3AAZB 2XWJB 5L2KE 1VPOL 4EIZC 4D2NA 4X98A 1OAXH 3BQUA 2K4WA 2VLRA 1Z66A 4HJSA 4LHUG 5INCA 4BFBD 1F3JA 2XG5B 1V7MH 2X4RB 1QNZH 1RIHH 1XB8A 2JV6A 3DVGA 3EJZD 4LOUD 2WWMC 5JXED 1JN6A 2XI9A 5AVSB 4HH8A 4XNYH 5CLZA 4IGBB 4NPYA 5E23A 3QXWA 3F5WA 4FQJL 1XGRA 4PGBA 3CZSA 4XN4A 1QR1B 3MBXL 4Y4FA 3ZMRA 3ISRA 2AK4E 1PLAA 3KLHC 4OQTH 1TQCC 5EOTB 5F8QC 2DTMH 2OSXA 1LEKA 4CDGC 4IOSA 2AXGA 5IZ7A 1EZLA 3O3BA 4DWHA 2VXQL 1YNTB 3VD0A 1KCWA 1W8EA 2APFA 5D2LE 4XMPH 3FTVA 4QRPB 3ZZ1A 2Q76B 1Q9WA 1HH9B 1YMMD 1TTGA 3V9FA 3H2WA 2M2DA 5I74C 5BQ7A 4R26H 1MJUH 1R1CA 1AXSB 4K94H 4U7KA 4ZO7A 5GXBB 2WXHA 3BFQG 1KB5A 3MJ9H 2JNZA 1NGPL 2N4IA 3NG5A 4E2OA 5FF6B 1UB5B 5AWNL 2C9RA 3NJIA 1JGEA 5DO8A 3UDWC 2ZUUA 4NZTL 4XNUH 4LHUD 3EJTA 4O2FB 3PWVA 2X0UA 4HCFA 4S0SD 3X1EA 4PGDA 1AHMA 3MXWL 3BZEB 5CJ5A 1HVXA 3FXIC 3MV7D 5IFHH 4KZEH 1U8HB 1JK9A 4Y4HB 4WHTB 3V0FA 3HVDA 1CQKA 2YAMA 3ARDB 2IADA 1PMYA 3G9VA 2WK2A 4KUCD 1A14L 3V5HA 3ARXA 4UT6L 5KVGH 3CFEA 4I9WD 3K8LA 4PTUA 4DGVH 3QIUA 5CSZB 1A3QA 2CLVB 1DSFH 3MLVH 4JFFD 4OT1L 1NCGA 2C26A 3DPDA 3QJHB 4IHOA 3KYOA 1T0NA 2AI0L 2AQPA 4WU5B 3MV8B 2DIAA 1MI5A 3O6LL 2HT2D 4X98B 3M6DA 2FX8H 2B4CL 2BY0A 3CN2A 1CK0L 1EO8L 4WWID 5CJQL 5EIIG 3ZL2A 4XN8A 3GEFA 1QWNA 3IGUA 4Q9QL 3T1FA 4P3DB 3SE4C 4AT6A 2YUXA 4DP5X 1SHSA 2FX7L 1YPZE 1JV2B 1RUPL 5T3XH 4XNAA 2RB8A 5DU7A 2K7QA 3IDGB 3ZUCA 4FFZL 3PQYD 4WTWA 3RTQD 2PPCA 2MQ3A 2NY7H 1P4UA 4HIEA 5KBMA 4G3YH 2J55A 1DE4A 4WKZB 4ZUWB 4RBPH 4LEOA 4APXA 1PAZA 3L95B 3AM8A 1SYSB 3SJVB 1KJVB 1BF2A 3QJQB 5IHUH 3LQAH 4IBQA 2J57A 2X4NB 1Q9WB 1HHHA 2RFXA 1SQMA 1MVUA 1G87A 3WTVA 4CSPA 4X6CA 1U8NB 3H8NA 4ANVA 4PJBA 2H8PA 4U6VL 2DD8L 3WHXB 1DFBH 1ZOXA 2R9HC 4ANKA 2VRAA 1NDGA 5KSVB 2V7HB 2WLHA 1IE4A 4AQ8A 1F8TH 2JKTM 1XHHA 3PGDB 1KB3A 2IIJA 1JZ7A 1DN2A 3N2JA 1J8HD 1UA7A 5JORB 1FCGA 1N5AA 4MVBD 5EHFA 1M6UA 1JF5A 4RAUB 3RI5K 1NICA 3M07A 1GGBL 1WHPA 1BBDL 3GI8H 4QRBA 2KYIA 3WJMA 1PJWA 5AVYB 2Z0BA 3SDXA 2VXVL 3TCLA 2QELA 1M57B 4F8OA 1QFOA 2BY1A 2VXUH 4XP6L 1GKOA 1E4WL 4AJWA 2HPTA 2VL4A 3FQNA 2OL3L 2OP4H 4FYRA 5KUMA 5T5FL 4LPYA 2O6EA 5KVGL 4XVJH 3NABL 2BC4B 4XBGB 5FKAA 2XY1A 4NQDB 1FGNH 1FFTB 4FTVE 5GRYA 1YEEL 1LLAA 3V55A 4GRWB 4JG0H 3BAYA 1FFNA 4POZD 4BZ2A 1ZHLB 1LDPH 4ZZFA 4WI2A 4JRXD 4U1IB 1JPEA 2BJMH 1JXGA 2YD2A 1GYUA 2YD3A 1MVYA 2YJLA 3OAYK 4XCFH 1CFTA 2XBZA 3WMQA 3EJPA 1WBYB 4XNUL 3FYEB 4YXLH 4PP2B 1T2QL 4UT9L 1FSKB 2VSMB 2OXHA 4XNQB 2ESVA 4CC1A 5PAZA 1AD0B 4DP7X 5DRNB 5I6PA 4UWQB 3S34L 1ETA1 1HOCB 3FSWA 4ZODA 4LLWB 2CRIA 3Q5OA 3PQYE 4WW2F 3OR6B 5L9DH 5LWYL 1NWPA 2NMSA 4RGNE 1J12A 2A77H 1M7IB 1MHEA 3V7AG 3IN0A 1NLBL 5HVGB 3DGCR 2DQGH 3BPLC 1NCIA 2X4TA 1RUQL 3NJGA 3HAEG 1KPUB 3GDCA 1FZJB 4Y16C 2F2HA 3CU7A 1BJMA 4XVTH 4WUKH 2Y6SD 3QZWB 1DSWA 4CBPA 5A2LH 3ECQA 2AJUH 4ZMYA 3EJJX 3IJSB 2BIIA 4HLEA 1XB3A 2BS8A 1G7PB 1R33A 4JFDD 4PJFF 2QLYA 3U9PH 4M8QA 3IDMB 3UERA 1V3LA 4NKOB 3MRKA 3QDAA 3ZDZE 2F1BA 2LV4A 3TNNB 3VM5A 3L3IA 4NERA 1DVFC 2YBRB 5CCGE 1MHCB 4NFCA 4E0RB 5CEYA 2QHLA 3EYSL 3OHXC 5JHDA 5C09A 3W0WB 4A7QA 3LD8B 4FMVA 4ONHA 4JRXA 3HZYB 3D4CA 3QE5A 3A24A 2CHWA 1I3GH 3IDIA 4XP9L 2OL3A 3FH5A 3VG9B 4A39A 1TZOA 3PREA 2P8LB 2FEDC 2VDNH 3EFFA 1I3RB 1A6VL 1F6AB 4E9RA 1PD6A 4IW4C 1P7KB 5T1DL 5MERA 1CL7L 4QJ3B 5AKTA 4FNTA 1KPVA 2D0HA 2YFOA 3ABKB 3MLYL 1YN6B 5AW0B 2M83A 5KTEH 3UDWA 3IE4A 3GXFA 2F53E 1XEDA 3I75A 2Q87A 3TZVD 3S36L 4L29B 3ETTA 4CU7A 3PAYA 3KYMB 3G6AB 5I6XB 1NAML 2BOCA 4HWBL 4N8UA 3IFLH 3CZGA 3HTLX 4BZ2H 2QSVA 1ZLVK 4GPVA 3LAFA 3OF6D 3WHXA 5IEHA 1M53A 1I1AD 2NY2C 4XI5D 1ICTA 4N26A 3VGFA 1TG8A 3V0WH 1ZA6B 1DZ0A 2K45A 1MHEB 2FT7A 1RHFA 4Y19B 4IDJL 5SWSB 1DTUA 1XD0A 4YUEL 5DFAA 4HWBH 3WNIA 4K3EH 1QFWM 5C0NC 2FDBP 4YWGL 3T2LA 2QSTA 2OSWA 2D4DA 3HW7A 1WEJH 3FS9A 2WXOA 2ZXGA 4KHTH 1B0GB 3L2MA 4OH2A 2AVGA 3QORD 3BMWA 5T1DH 1A9BA 3LJ3A 5IQ7L 2WZ0A 1EJOH 1UUNA 3L4WA 1L9PA 5DF0A 4Z5RA 1D9KC 1ID2A 4G6FD 4FXGA 4MA3A 4GO6B 3W11D 1DLHB 2YSTA 3IU3A 3QC6X 1CTMA 1BDYA 1JI1A 3EHBB 3LKRA 3IU4H 3AREC 5IW3A 4ADIA 3GB7B 3QWRD 4P5KA 4PS8A 3ZKXB 1SY6A 1LP9F 3EBIA 1A1MA 5C08E 2IPKB 3QXAA 2CO6B 4NPKA 3SGKC 1QUNB 3QJHA 2P8PB 2GAZB 4AEHL 2ATAA 3TIEA 2ITDB 4OZIB 5HHME 2XBDA 1FIGH 1YC8A 3QUZA 3D0LB 3GWJA 1TQUA 3Q48A 2R69A 4Q2ZB 2MKWA 1CPUA 1I1YA 3N1GC 1KYDA 5DO2D 4YSCA 3R4RA 4GH7B 4N90E 4U1JA 2XC8A 4X5RA 4ZS6C 5I8CB 4M6MH 4Z78B 4L9DA 5A2AA 2I07A 2PR4H 4FNQA 1DBKL 4MDJB 2X2IA 3GPEA 2VITB 4NWTH 4PUBL 1Z5LB 1C5DB 4M6AA 4AE1A 4Z77A 3G6AA 4K15A 4DO6A 3US9A 2R0KL 1E8YA 2FNBA 5D7LA 5D2NC 5GGUB 4OCWH 4NKMA 3TCTA 1DSYA 1E4XL 1ZAGA 3BWAA 2CCVA 1A1OB 2R7EA 4G9FA 5EO9B 3ZKNC 1KB5B 3O6FA 4DCQA 1RZQA 3Q8EA 3LZNA 3AFLA 3CWGA 1ZT1B 5GQBA 3CBKB 4DZBA 15C8L 2B7DT 4YSRA 5F93C 3S34H 4IRJC 3G9AB 3UCRA 2ZCKH 4APQD 3QH3B 4OD1H 4PSRA 3BPNC 4M3KB 3HBGA 1HK6A 1AI1L 1VB9A 3DOIA 2WZPA 1CICD 2JCCF 3S88L 5SWZA 3RU8H 3OLIA 1DBML 3TVMA 4PJGF 4N2FA 4MA1C 5B3SB 1NGXA 2Y4SA 2IADB 3QYNA 4YDKH 4UT9A 5CEYB 5FPIA 2VQ4A 3UTTD 1UT2A 2NY4C 2VDOB 1SN5A 5D7EA 4KHXL 5C2BL 3F64A 1YEEH 4FXGB 3FAXA 2UZIL 3DUSA 3H9SB 2PR4L 4NEHB 1NANI 3O2DA 4KV5E 4R7DA 4U0RB 5DURD 1JYVA 2DMKA 3QPKA 1LEGA 1BVZA 2V5TA 3GXIA 4JFSA 3QNYA 4Z18A 3RILA 1ZVSA 1UURA 4RAVA 2GJ6B 1BA9A 4KK6C 5K1VA 1AQDB 3A6CL 1Y18B 5IJKA 3LZPA 5TQ0L 4DKFH 2Z93B 3CFNA 4FQQA 2P8LA 4XN9A 3P30L 3V8CA 4GRLA 3V6FA 5EZJA 2P24B 1XCTB 1NEZG 5ETUB 5F1NB 1CWVA 4XRCB 1CDUA 2Y5QA 3CV5A 1E9QA 2Q7NA 2WSKA 5DQ9A 1IGIH 2OX5B 3WJJA 2FECI 1ADWA 4JCMA 3VFWA 2Q8BH 3DV4A 3KE0A 1IVLA 3MRMA 4YDVB 5SWSE 3UTPD 4C57C 4G80B 1YAIA 2WLLB 1G43A 4FQHA 3QEHA 3Q8FA 1XIWD 2VERA 4PJCF 4XN7A 5DS8B 5HDQH 3VE0B 4OCXH 3TO4D 3QG7L 1HSAB 2CHZA 3LKSB 4R4FH 3AADB 4PV8B 1MEXH 5TE7H 4DIXA 2R51A 1A3LL 5AQ0A 3IM1A 2FQEA 3IFNH 1OP4A 5IBUG 3QYCA 4EUPH 1P7KA 1VACB 2DQMA 4WKXA 1GPOH 3MRJB 4MDIA 2IAMB 4YHPA 1EUTA 4ODSH 3NESA 3FCTB 1NGQH 1KGYE 3O3BB 2A0LD 1LK2A 2BSSA 3OZ9L 3KGUA 4F9LA 4OB5L 4AH2B 4AMKL 2EUWA 3EIFA 3KDMA 2GCYB 3M17A 1C5CH 3N6YA 1IC5H 2J8OA 1TMQA 4N0FA 1K5NB 3IFLL 1G9NC 1N8ZA 2W0FA 3P77A 3CH1A 4KTEL 3BYTA 3P73B 1J1XH 1NGWA 1E8XA 1M1XA 32C2B 1K85A 1JGDB 4PJIA 4MHHG 2VXSL 5HJGA 1JXJA 5AVVB 4CW1B 1U3ZA 3LPWA 4EIGB 1NLDH 1ZLVH 1UASA 2IC2A 3IJHB 5C0BE 1OSEA 4ZUSA 1G9NH 1CZ8H 3RZCB 2Q9OA 1A6PA 3EKCA 3CZKA 1ZK5A 3ZIYA 5GZOC 1GJWA 2A9ML 3MMEA 2VSKB 4D9RE 4J4PD 1AIFA 1WH0A 5D6DC 2H6UA 1UXWA 4XRCA 5FYJE 4H8HA 3WY2A 5JPMA 4ZYKA 5MHSD 1D5MA 4H25A 1FA4A 2E8ZA 2PYED 5C0GB 2BZ7A 2Z7UA 1H9VA 2AQ1A 4B9KC 3GMRA 3KDPB 5DEFB 2DJSA 4RNRA 5JLZB 4DGYH 43C9B 4LLYA 4WJG3 2O93L 3QIUD 1WO2A 3IS0X 1LO3L 4X42A 3L17A 3STZB 3QPQC 4Y2OB 5G55A 1O9VA 2PWEA 3C60C 4XCYB 4IBZA 1JGUL 1FVCB 1OPGL 4UUJB 3FB8A 5FCUH 4H13C 4C4KO 5FO2A 4C4KT 4RISH 5DD1L 2OXGB 1H5BB 5IG7B 4FZEH 4DGIH 5MEPA 4JQVA 3ZQWA 4Z78A 3EJCA 1CXLA 3QZWA 3MJ7B 3MRPB 1XGQB 4HWEL 5ALCL 3WNJA 5KWYC 4MA1B 4G1MA 4OIBA 1QZNA 2FB4H 1CGVA 3OKNB 3SKOA 2I9LA 1T7VA 1VZGA 4DGWC 3VNZA 4OCRH 5AZEL 4A6YB 2CLRA 3MLTA 2BDNH 4ERSL 1ONQA 4V2BA 4X8JB 4R3SB 2QDWA 2A6DA 3W9EA 3PWJA 3QXVA 5C07E 1NA8A 3VGHA 2W9DL 3N50A 4LNRA 3CLWA 4K9EL 2LHAA 1FYTB 3ABGA 1BJ1J 3NA9H 4CVZB 4MB5A 3KPLB 1DJWA 1HXYB 1XCWA 2VQTA 1HQRA 4OD2A 4O02B 4L23A 4PJAA 4XCFL 3VXRE 4Q9RL 3P3YA 1L9RA 3RPBA 4DEUA 4RGNB 4NC2B 4NQSA 4AY0A 4Z8FL 3K8MA 4PV9A 4WEUD 2VR3A 4P23D 4R83A 4I3SH 2DQTH 1RJCA 1JWMB 1PSKL 2HJFB 2ZP9A 3N42B 4W9DC 4V1DA 5EUKA 4Z0BH 3BKML 4W70A 4AV0A 5E24E 3IDYC 2OP4L 1NBVL 3VDCA 1FFOA 2ZAIA 1G9NL 2BHFA 4XVOA 4H20L 1QI5A 4MLSA 3GMQA 2F74A 1QWHA 3RNQB 1GZQA 1NGYB 1VHPA 2B9AA 5AOMA 5DS8A 4HUXA 5ICUA 3EUDA 4P5MA 4EUPG 3STZA 2GTWA 4IKIA 4N2OA 3EOTH 1IGML 4X9FA 4YDJB 2YD9A 2DMHA 3KLSA 1ZJBA 1JNLH 1WA0X 3HB3D 1F8TL 3U0PB 2X70B 2Q3AA 1SLWA 3TTSA 5KYWA 4MAZA 1L0YA 1X5IA 1JHLL 2Y2WA 3MTXA 2D31A 5FO7B 2NY5C 3RWHA 2OTWA 4X5QA 2NY1D 2JJVA 4LCCA 1MFEH 4N0YL 4KKLD 3CMOL 4F2MB 2EDFA 1E5YA 3U9WA 4EI5D 4J3OD 4NXSA 4PMFA 5TGBA 3EH2A 1J9CT 4JGMA 3V0VB 2PW2B 3WKML 1DANT 1MUJA 1OAKH 2OKMA 2JKLA 2NY7L 2Z7ZA 2Y07H 4KI5D 1OAYL 1UTDA 3FQRA 4RGOL 3WL9A 2JQMA 4HKJA 4I89A 2EYSB 1P9MC 4NRXB 1T1YB 2W5PA 1OARL 1Q0EA 1A21A 3O6KL 3KJ4C 2OR9L 5B22A 3WIFA 5DVMA 5ICYA 2X9WA 3U7WH 1U4EA 2XN0A 4GEIA 2WXMA 4FG0A 3DX9B 1QBMH 3O6MH 4ZX3A 3FT4B 5D5MB 5TE4H 2O5XL 5B8CC 3QIBD 1XAKA 2QVKA 4JFOB 5HHPA 4G9DB 5D1QB 1WV7T 1M1XB 2HFEA 1QSFE 1AR1C 3QUGA 1UD3A 2NR6D 1CVSC 1U8LA 2PP9A 1OB0A 2VDRL 5I26A 5F6IC 2B15A 2PCFB 4FL4B 1JNJA 3APMA 5E00A 4D8OA 4MNGB 4GMTL 5I8EB 1WG3A 4K9EC 1A3RH 4FG6D 3ESVF 3C60B 4MAYC 2XNAB 2EDLA 1IAKA 3CFTA 1UXSB 3ZGIA 3K6NA 4BH8A 4MJID 1XGQA 1ANUA 2X6UA 4KHXH 3ZDWA 5C2BH 1J9SA 4ZRGA 4ZJ9A 1E67A 5IG7A 4FFWC 5IHZB 2JFCA 3MQIA 2TRHA 1JI2A 1KJ3H 2F0CA 3C6SB 1CU4H 3FHEA 3R19A 5E1GA 3QS2A 5I5RA 3LKSA 5BV7L 3D69A 2J1ZA 2DQDL 2XPGA 1ZHBB 5EU7E 1SLXA 4RZKA 1X7QA 2FVNA 3KPSD 2M26A 4OLXL 1YLBB 2OS7A 1PDKB 3KYKH 4GIAA 5IQLA 3TH2T 3GUTB 4HK0A 4TPRH 4UQIM 4OFYD 3TA3A 3Q8BA 5D7IB 1O0VA 3EG9B 4GKSA 3HZ3A 3KH4A 1SXSA 1OEZW 2VMDA 1FPTH 3QJRB 3DIFB 1PZCA 4XXCC 3PJNA 1AQ8A 1YEFL 1TLKA 3IS1X 3JWNE 4CVUA 5GRUL 4PEEA 2XDHA 4UNVA 5F6HJ 1ACYH 2FWLB 3FHQA 1SOXA 4CAGA 3VDAA 3AUWB 5FYLH 4YSUA 5T1KB 1JOIA 2L04A 4MA8H 4LVHC 1RPKA 3TO2B 4M6ML 4O58H 2WGXA 1FVDB 5BW7A 4LOVA 4XO9A 4A6YH 4AGNA 4AYMC 3VI3F 1JV5B 1SJHB 4P5TB 2WXKA 5E8OA 1BFTA 1S5IL 3EH1A 3OJMB 3R4DA 5BZDB 1EMTH 4KXZI 5C7ZA 4FA6A 4WHYH 2B9BA 1SMAA 3T6XA 3QORA 4HJGB 3ZHKA 1TZ8A 4L8SA 3NJJA 2NNCA 1UG9A 1KTCA 1PPIA 2C9UA 3D3VE 1BJ1H 1K6QL 2MKLC 2GG1A 4XPAL 2VLJD 2OJZH 4KZ0A 5IESL 5LGHL 3FCGA 3EDDA 4J1UB 4ZX5A 4ENEC 2BSRB 1Q9OB 3HUJF 4WSJA 1JUFB 4Y9BA 5INDB 4ZW8A 3N43F 5EEZA 2FH6A 2FGWL 2ZWYA 3JTBA 4R90L 2AQQA 4Z7QF 1RK1A 2BHYA 5I1AB 1AZBA 2BWDA 3KL0A 2I9TB 2Z1KA 5C09E 2DMGA 4OCSH 3EJRA 4TVPD 3UADA 5DYOB 4B0MM 2YGNA 2EDTA 4TQEH 4BE6A 3L9YA 4HSQA 4XBEH 3D05A 1DFXA 1QEXA 1OOWA 2EH7H 4WW1B 4AJVA 2D9CA 2Z3FA 4ZO8A 3TJHC 4QTFA 1B0IA 1UZ6F 1JGLH 2VE6A 2WCSA 2X40A 3FQRB 1UT1A 3WL9B 2ICES 1VADB 4ZFFA 3BGMA 3OC8A 3AS0A 4JRLA 2H3NB 2YMXH 4M1CC 4X80L 4ZXBC 2HLAA 4K23L 3TIDA 1JNNH 4HWZB 2W9EL 1T1ZA 2BVYA 1P7QB 3IJHA 1IO4C 3C6LD 2YUWA 2IAMC 3L4VA 2NUTA 1OGTA 4E9TA 3MO1A 4GKOA 4NCC1 2ZPKH 4HS8H 1CLYH 2P7TB 5KTEL 4QUOA 1FYTA 2J4WL 2RD0A 3DVIA 4OGAD 2AKRB 1JF6A 1BW8A 4J23A 2ED9A 4TNFA 2YXMA 3RL1B 5DUPH 2VLJA 2VLLA 2VM3A 1UGKA 3FCUB 4HGWA 4XN2A 2QHRL 1A4JA 1XF4A 3DXAB 1WWAX 4GKNA 3ZBMA 3CCHB 2WXLA 3K71B 2ZUSA 4NC0B 3SO3B 4RBPK 4PG9B 2DQ6A 1M6OA 2Z31D 4MMXA 3Q0HA 3O9WB 3I9AA 1HEZA 1NSNH 4JPKH 4HIIB 3GUTA 1A4BA 4XO3A 4PLNC 5IM7A 3L4ZA 5FKPA 4ODTH 3ZVVA 1V5JA 3LKQB 3BVWA 1PF3A 4NNXB 1OTSD 4F8LA 2LABA 3CIQA 4KMTH 3DYMA 3I2CH 2WUCL 2X6VA 4WW2C 3ZO0A 4N3UA 3GXPA 3SHSA 2B5IB 3VI3B 1NCUA 2CUMA 4Q4EA 3VFVB 4I9XA 3AWEA 4QEGA 3WFEL 1J86A 3O41A 2VJXA 4JHWL 2G3MA 5CEZH 1A9VA 2H26B 3ML9A 1AOHA 1A6AB 4GKZB 4MD5A 2OK0L 3AACA 4LASH 5T1MA 3AMKA 3KPRA 4OLVL 4R7VA 2IFFH 2KLSA 3QEQD 4IBUA 4HOMA 2HVKA 2YKLL 4IJTA 1QI3A 2XHNA 4MZ2A 5D7IA 3AROA 3L54A 4MDJA 1GCYA 5DVNA 3CXHJ 2AZAA 1GA2A 4PJ5B 3ZO9A 1ZHKB 4ZNEA 5IROA 3LIZA 5KJ4A 3RKDD 4AQEB 4QHLA 3CDGB 1A7RL 3ARBB 1KMGA 3WS3A 1P7QA 5B39A 2VYRE 2JXMB 2CO6A 4WJKB 1Y6NR 3F7PC 3ZMNA 4ZFOA 2TSAA 5CP3H 1KELH 1G7MA 1T22B 3KHQA 5EOTA 1AZRA 3IJ7A 4GKLA 2IALA 5D1ZB 2CJTA 4M61B 1X6NA 4ADGA 1LDPL 4PWJA 1U8MA 1CGSL 1IEAB 3HC4L 4MD0A 1WYJA 5KSAD 5K9OA 3TVMB 2QGBA 2PPFA 3GMQB 2V17H 4UNTA 2HT4D 1TJGL 2XIBA 1OCRB 4YBQD 5C07D 3MCKA 4JM2F 2BRQA 3WLBA 3RG1C 1UQSB 1LNUA 2C3VB 4I2XE 5E6RB 3RY4A 2BP0A 4I5BB 5FV2A 4KI1A 4AIZB 5AKVA 4ETQA 4P9HC 1JTOA 1T6WA 5D7JC 4UQDA 2D0GA 4KZCA 3EO0B 4WCYH 5AG9A 2Y7QA 1FPTL 1T5KA 4P4KC 2VDPL 2BY2A 2P28B 4E9WA 5CJXA 4IOFC 4YMPA 3PGCA 1FZMA 4POYA 3C09C 1ZEAL 4CNIA 5K9JL 5LXGH 3BIAX 4ZI8A 4J4PA 3A4EA 2XKSA 3HS9A 4MMYA 1CS6A 2VDML 5CLWA 1H15B 3EFOB 4OKDA 4IOIB 4DVBB 3CLFH 3GD1C 1YUHA 4K7PY 1J9QA 4QD2E 3NCJH 4W6WB 1YY9D 4UQEA 1NFDB 4JO3L 5DQ9B 2J72A 1P1ZB 2NTSP 1MHHB 5GGQH 2E76C 2HAZA 2FX9L 2J43A 3RVUC 5KW9H 2A3TA 4NDMA 1DJHA 1J0YA 2F8XC 4X9YA 1AO7D 3CUPA 1I7RA 5HVWA 1J0KA 3QWQB 3T3MB 5BS0D 2QR0A 3TFKC 2DWTA 1YEKH 3ILQC 1SY6L 2EYSA 5J11C 4OI8A 1XCQA 1U8QB 2Y9RT 4UOW1 4L1SA 3PGFL 4MZ3A 4WW2B 3DJZA 2WOBA 1U8PB 1FH2A 1MI5D 1A6ZB 1SMDA 1W2KT 1LJMA 1HNYA 3AG3B 3X2QB 5DJYB 5E4EB 1OWWA 2YR3A 5KSAA 5DK0A 2LQRA 4OTXH 1KIPA 4N90D 2JCCB 1PZ3A 2GKIA 4N8VG 4JFEE 4Z7WF 3VCLB 3NSDA 3RHWK 4NFDA 4XB7A 2R69H 1B2WH 2Y3NA 3OKMB 4NUGH 1LWJA 4OI9A 2QPEB 1S7QB 3VFNA 1KB9J 4KKBD 3G5WA 4I3RH 2M1KA 2X7LB 2AJYL 5D2LB 3TEXA 4EZKA 3QEHB 5IT2L 4M03A 1IKFL 2CDGA 3MA7A 2FWSA 1T2XA 4DN3L 1J1PL 3APFA 5D7JB 5TE6H 1CFQB 2A1WL 2Z8SA 4AVJA 3F6IA 1M2VA 4NHCL 4W9KC 1HHIB 1NBZA 2C7FA 5DFVD 3CFCH 5I1IL 2EUXA 1VF5C 3V5DA 2J21A 3B7SA 4IKLA 1LP9A 3BXNA 3LN4A 4XMTA 5LQBL 4QO1A 3S48A 1HESA 1P5UC 1TIUA 4WGWB 1OAZH 5EZJB 1WF5A 4LSQH 5F7KC 3DTUB 2NPLX 3AREB 4JR9H 1D2OA 1V10A 3I6KB 3NGBC 4K3JL 1FFPA 5EU6B 4E9XA 4F8QA 4PWGA 4QDGA 1RSYA 3AT0A 3D0VA 3D4ZA 1I8KB 3DKHA 3TONA 4QMEA 3R0MA 4XB3A 2IEPA 3BH9A 1MNNA 4NO0D 4YVNA 1IM9B 2PMZA 3QI9C 4TV3A 4WENB 3UBHA 4KKPA 1MLCA 2MPVA 2E59A 4RA3A 3B9KC 5JORA 3D2TA 3QR2A 5KZCD 3IN2A 3FO0L 1NCWH 1KTBA 2FO4A 3OAUL 4UANA 2C3HA 2CCLA 5AOJA 2BIMA 1VFAB 2NX5D 4QRRD 3MAWA 1S46A 2C4FT 3N40P 1UB5A 1IBYA 3QFDA 1VACA 2Q10A 3OMNB 2X09A 2OA9A 3AGVA 3CBJB 5BO0D 1ACZA 3HR5A 4NT6A 2CGRH 1EXHA 4YX2H 3VRIA 4CN1A 2AFNA 3WTYA 1NDMA 2PWHA 3H0TA 4FYSA 5EORH 5DHVH 3RA7L 1A7BA 4M62H 2H1LM 1HT6A 4M7KH 2EIEA 4MBOA 2MOGA 4N0FB 3CSFA 1BIHA 3NBNA 1LE9B 2CHNA 2IG2L 2HT3C 4L5FH 3MV11 4KO9A 2DLGA 4JZOA 4RSVA 4A2HA 4P48A 3VD2A 2HP4A 4ZAKB 1N9PA 4YZFE 3HE6D 4JX0A 4M93B 4UUJA 4CUCA 4PD4J 3C08L 4QXGL 4YPGB 5JIHA 3LEVH 1JZ6A 5GRJL 1YECL 3MMEB 3ZN6A 4YL4A 2PP8A 3GIZH 3IMWA 4G8IA 3D2UD 1OSPH 4LSVH 4NI3A 3V4VB 3UO8B 4A66A 1U2YA 4AQAB 4C47A 2WZ5A 3ATDA 4X50A 4CGTA 1E2ZA 3O11A 2ICWI 5CD3B 3AUVA 4NYLB 4CU6A 4ECNA 3RVTD 4LU5L 1W6LA 3DX1A 4HJ0D 2H3KA 1J8SA 3KYMA 4LFHG 2DWEB 2F15A 1IQDA 2NR6A 4QYAA 3FW6A 4RMRA 3OKMA 4LQFL 3ZDYE 2N01B 4HOZA 4H88L 4Y9EA 5ABDE 4QHPA 4ZMLA 4HKZB 1ZTXH 4PRHB 2ZX6A 1KENH 5J9PB 3ROLA 1XTLA 1KXTA 4CMMA 3BUIA 5LB1A 5I66A 3ZTNL 4W1TA 5CGYD 4AITA 3FQ4A 4I0PC 2NOYA 1OGSA 2H2PC 3H6AA 5C09D 1GGTA 3UO1L 4JAMB 3CLEL 3GSVB 4IMKC 5JW5B 3ZTEA 3D6GA 3WFHA 2HX7A 2YPVH 1X5XA 3M45A 3MRQB 5DMGC 2A5UA 2DRUA 4JRYE 2WB1A 4LLMA 1BQSA 4OGYH 4PJDF 4WWOA 4PJAE 3UYRL 1OW0C 3NH7L 5EU5A 3QULB 2WTRA 3BZ4B 1NIFA 3MJGX 2V0AA 4PP1C 4UBDD 2DYRB 5EZLB 4ZXBB 3RHWF 4X4XB 1FCCA 2E0PA 2V5RA 5TPWH 5EEVA 2A6JB 3HC3H 4EO5A 2H0EA 1J5OH 4NO5B 2NCEA 2VDLL 4N0UB 1IKFH 4CJ1A 4Z9KB 1MCPL 2PWFA 1ZWIA 1BAGA 3K8KA 5AUMB 1XGZA 2K4AA 2Q8AL 5IHWA 2HKHL 1TUPA 2F8IA 1VENA 5EA0L 5CMAA 3VB9A 3U4BL 1KACB 4DO5A 3IDNB 2ED6A 2NZ9D 1IIIA 1T89A 3KD4A 1Y18A 4OTXL 1T5XA 3KMDA 3EF7A 4OR1A 4ZUVA 1OZUA 1M3JA 1PGRB 1EIBA 1HKFA 4LCCB 4DEWA 4V1DB 3O9WC 5EUKB 2XA3A 2Z0UA 1CUOA 4FFYL 3IDIB 4WWNA 5JOFA 2BFGA 4PP2A 2AGJH 5AAMA 3CX5J 1PLGH 4D9QE 4H8VA 5DS1A 2HKFL 2VW4A 3LSOB 4ALAC 5A2CA 3FT2B 5TTRA 1ZGLM 1DQQA 2A4ZA 2PW1A 1LE9A 1F4WH 3LV3B 4XGZB 3ULVC 5FHAH 5D71H 4LIQL 4QXUH 2QQNH 1CFVH 3K46A 3WEBA 1UCBH 3N42F 3RFRA 5C0BB 2BNRD 4LCIL 1KCRH 1KG0A 3OGOE 4BCZA 3SBPA 3QH3A 4QAMB 4AMWA 5EU6A 1JXDA 4DPRA 3QWRA 4HFUL 5ESAA 4FQLH 4PHZA 4X99A 3OMAB 1A5FH 1PW3A 2FGWH 1XO8A 3B3IB 3K4ZA 3LNFA 4C58B 3VFMA 2VMCA 4H7VA 5AAMC 1EHNA 4MYWB 2J71A 4XMUA 1EANA 5D1QA 3N5AA 5E9DA 1LEIA 4DW2H 3HI6H 3CD4A 3FOMA 1Z0NA 3M1BA 1LK2B 2BSSB 1DN0B 5CBAB 4RX4D 4Y5VC 4FTVA 1CI5A 5EC2A 1A5FL 4YQXL 2YEQA 3LY6A 4RESB 4AUYA 3OLEA 3GSXA 4WTZG 2RBLA 4EN3D 4UQBA 5D6CA 3SOBL 3MACL 4KQ3L 3D06A 5DK3A 5DHMC 4BFEA 1S7QA 3KPSE 1JIBA 5CO1A 4QGTA 5F1SA 5FCSH 4YHZL 2A6IA 2ICEA 5GS1A 1KJ2A 3FB7B 5F7UA 3LNDA 2N3JA 1BD2D 5JPNB 3K91A 4X6DF 2H7WA 2BLFA 4DKAA 1FYTD 4TOYL 1RUAL 3C87A 3VYNA 1MCFA 3V7AE 1CLCA 1U91A 7FABH 5EF1A 4UTAA 1ZSHA 1TETL 3MRMB 1OW0A 3ILEA 4HFWB 4HIIA 5TDOB 4AIXA 3QW9A 3T0EE 4AOFA 3UJJH 1FZKB 1T66C 2AXWA 3MRDB 1UATA 4U1NA 5DJDB 1QSEE 1SJVA 5SWZD 3SDDC 5J13B 2R56H 3V4PH 4P5TD 5JIQA 1UT9A 3AS3A 5E03A 1HJBC 2DQJL 1BD2E 4M5YH 5AW4B 4R2GC 3ZHNA 2IQ9H 3OWEA 3QO1A 5BJTB 3K5SA 3CFEB 1Q9LA 1TVHA 4P4KB 5IHZA 5JMOC 3GLAA 3WFCL 5AW9B 5BMFL 4OCWL 4QXUL 2EABA 5ABAA 3V0GA 1KOAA 3EGXA 4NBZB 4YIQA 2DY2A 3C5ZD 4YLBA 3MV8A 1V27A 4XNDA 2CDEB 1OCZB 3CE1A 3H9SA 5SWSA 3T2NL 4QCIB 3UP6A 2WNGA 5E9AA 3KLAA 4IKNA 3LH8A 3ULAB 3SDAD 4N0UE 4BWTA 4FTVD 3BAEH 3JSSA 5DJ8B 3MBED 4OGYL 3UYRH 1KBVA 2XZAL 3MZTA 3VA6A 1KEGL 1YMMB 3O3DB 3B9DA 1MZZA 5E4AA 2BO0A 5I73C 3WXWL 1BF5A 1MNUH 1ND0B 2R1XA 4WHTA 5LLIC 1SXBA 3PP4L 2Z92B 3AU1B 3WOVA 5D7IF 3I9PA 1YEHL 3VRJB 3ARDC 3B2PA 4MXQC 5JXAH 3C8KB 3DECA 3O2WL 3FT0A 2CU9A 4LEOB 4APXB 3FRPA 4FDWA 4ES9A 1JGEB 4E9SA 1MN4A 4QTHA 1U3HC 1AQKH 3BIBX 5I75C 1JSYA 5K1NA 5D1ZA 5IB2B 3U6RA 4GEJA 3FH7A 5GS0H 1MQKH 3S4SB 4AH2A 4NQXB 3D2UB 4M9OA 1MAML 5D96C 2OYKA 1PBYA 3CX2A 1M4KA 4ZSOE 4ZPTB 5EZOL 3ATBA 4HK3N 4U3XA 4HS6A 4L3CA 1IFHL 2YPVL 4YHOH 3RPIA 5A2FA 2IDSA 2UV3A 4JHUA 3DYOA 4MKMA 1AKJB 1MW0A 3G08B 4H4NA 4IGBA 5C0BD 1YCSA 3KCPB 4R4BA 1U92B 2IWEA 1TFHA 4HUVB 5B3JF 3C5ZA 2HVJB 2DLHA 4CN4A 1YAZA 1JHLH 4HWUA 5D1XC 1MFBL 2VR7A 1FG9C 2ZKHH 5FM5O 1E2VA 2NY5H 3VD3A 1E6JL 3B4NA 3MPCA 4GW5A 5L8LB 1NAKL 4TTDD 4P3WA 2WMPB 1MCRA 3BN3B 3TPUA 5I0XA 2L8AA 1MCOL 1WQVT 4L1TA 5IW6A 3JBG7 1IGMH 3HPJB 1QLEL 2GB2A 4UIMA 1OKEA 4PW4A 1W0WA 3BE1H 5FECA 2AV1B 1S7XB 1GS7A 4OF8A 2FL5B 1FFRA 3BUYB 2XFXA 1JCKA 1PS3A 3T4AB 4DP0X 2XA8H 3POHA 5D7SL 3F7YB 4I48A 5E5MA 4ZW5A 4JZJA 4OLYL 1TEGA 1ZXKA 5LCVH 3FOLA 4UU9B 2JVUA 1EEZA 5DD3L 7CGTA 2JJTC 3FTSA 3H9YA 1GGCH 3QUML 5DVPA 5GJTL 4DVRH 2F61A 5FYKD 4LO9A 1OF2B 2M8XA 3HZKA 4S1DD 2ZKWA 1QLFA 3BQUD 4NQSB 4J3XA 3FB6B 1WWCA 1ZA3B 1DQJA 5MHSE 3NPSC 1JFHA 1P4LA 5D9SB 1AYRA 1NDGB 5JHAA 1QSVA 3BD4A 1BAWA 1RUML 2VLLB 2DJUA 2EINB 4LRNH 4BD4A 4U6HB 1XMEB 4NQQA 3KWVA 3QZLA 2AANA 1GC1H 3CPLB 4KQ4L 1YPZB 3MLZL 2V8MA 6CGTA 5ANME 1OV8A 2X4OB 3NK3A 4Y4FD 4F27A 1OSZB 2YS4A 4M8UA 1ZS2A 2PABA 1I9RL 1NFAA 5AKRA 2G60L 5J5EA 3PDOB 4GQ9L 1HS6A 2BDNL 2ENJA 4MNHA 4QI3A 3BZFA 3N91A 3ZHDA 3FN9A 4ERSH 5F7HA 2P4AB 3VXOA 3PL6D 2OR8A 2EXSA 5FYKH 4GQPH 4XPFL 5T3ZD 4YHYC 5IUCA 3KLKA 12E8H 5LN4A 5TFSL 3KXFB 2R0LH 2Y0SA 2I60L 2F5AH 3AXIA 3X11A 3B83A 1Q9LB 1I8IB 2HRLA 2MSPA 1G5GA 1JRHI 5TF1L 2G5UA 1MQKL 3KLAB 1RXLA 4HT1H 4H2CA 4A1RA 5L9DL 2LAGB 3GI9L 3G5YA 4GB9A 4F5CE 1THAA 2EC9T 4ZFZA 4F20A 5JHDB 4QRQB 1AIZA 5CUSL 2BNQE 2ZG1A 5CJ8A 1HWHB 1X5MA 3RPKA 1CE1L 4Y7MA 4F8TA 1T2JA 3ULVE 5HJBA 3FU7A 4JFYA 2F53A 4ZFGL 3U2IA 3ZY7A 5K9KB 4JDZA 1XDTT 2VJ0A 3MLXH 4EI5B 4NIYE 3X1GA 5IR1A 2CDFB 1IZJA 3RB5A 2HMIC 2PUQT 4PRNA 3WXWH 3MR9B 1UD8A 4Y4HD 3HG1A 2KQMA 4KXAA 3CFIC 4B9IA 3BAEL 3Q6FA 2BNQD 3D12B 1Q1JH 1WS7A 2F7QA 3MFGB 3NABH 2FJFA 4OZHE 4Q14A 5HD8C 3WTSA 2GI0A 1ACXA 1ZHNB 4B9FA 2OJEB 2HRPL 1L0XA 3V8OA 5H35A 2OMVB 4NQXA 4FTVB 1EEYB 5JO5B 3CZJA 4DN3H 4PJBF 3GRGA 1L7IL 4EMZA 5GISL 4TSBL 4OGXH 4OIIL 2X42A 1IILE 4KTYA 2WBJC 5J56B 3MNVB 2W0PA 3LEYL 1CLVA 3PABA 4PI0A 2NY6D 2R15A 3LVEA 2XJKA 1S8DB 4QOKD 4WFEE 1ZV5A 5DK0B 2ZCHL 2KMWA 3P9LA 5FEBA 4ZYKB 5ID0A 1C5CL 1TQCB 3T09A 3GSOA 4QYOB 1TO5A 2XWTB 4CL7A 1BVLA 4KKAD 3MV9B 1XXFC 3HE7B 1SDAB 5EFIA 3SE3C 5EN2B 1PQZA 2H6PA 5F88A 5IEHB 1BYOA 1BHGA 2OMYA 2WWKT 1GPOL 2WVUA 3VXUE 4GW5B 1BYNA 2PYFB 3DGGB 5TF1H 2WUBH 1RZJH 3B56A 3IRCA 1A3LH 2UXFA 2J25A 2VLKE 4S10A 3Q3GB 4GO8A 4KKRA 4GG8A 4TF4A 2XPZA 4UV4H 3RX9A 5FYKL 4FFZH 5F9OL 3F7VB 1FG2B 2LVCA 2V2XA 3WCYA 4AIOA 2E9BA 2NXZD 3D0LA 3QIBA 4QRRB 1DJYA 2D7OA 1TU2B 4TULH 1COBA 2MPAH 3FRUB 1EBAA 4HPYL 4U1LB 3SE3A 5A16A 4KRNA 1A25A 1OIOA 3RWGA 1VGEH 3GHPA 2IO5A 3EXLA 4WW2A 4ZQTA 5EBGA 4YSAA 1LXMA 3FZUC 3FUDA 2DQEH 3QEQB 1YPZA 4JRWA 1J0HA 1A7RH 2QGCA 2QR0B 1KY6A 3GXUB 3O8XC 4OLYH 1HCFX 1OHZA 4P46D 2WW8A 1X9LA 5I74B 3S96A 2VO5A 4O2FA 3ABZA 1HIMH 3NQKA 5J6HB 2LR4A 2A6KA 4AEIH 5BZDA 4PWHA 4ZTOH 4KTDL 3PWUA 1GMEA 2WBJA 4MMXC 1A7PH 3LPFA 4QRSB 4OZGE 5E70A 1BV8A 4KK9C 3F65A 3HR5B 4R7NB 3PDGA 2FH8A 5BVJA 1HI6B 1IGCH 4ONFH 4O9HL 5D7SH 2OYPA 4B3VA 5J12B 4K71B 4UYPA 2JKRM 4OJAA 1FC1A 1CT8B 4P59H 4UM8B 2ICWA 2WNXA 3AG1B 5I1CH 2VN4A 4YHYB 4AXWB 3MRNB 4YHKH 4HISA 5KJRH 2ITCB 3TESA 1JTTA 3N85H 4OKVA 1IQWL 3PPEA 4HAGA 4XMLL 3ULUF 2I5YH 4N1HB 1XH3A 3SDXB 1PCSA 3UROR 3M86A 3O6FB 4KU1A 5EA0H 2QSQA 1MFBH 2CIIA 4U1MA 4XMPL 4Z3GA 3BMVA 5GRWA 3G5XA 4KKCC 5CZVL 5IQ9A 3SYPA 4D9LH 4JK0D 2ZXDA 2LLLA 4DP9X 1ZT7A 1OT2A 4JEGB 3D09A 1VZHA 3PNWB 3ILPB 2BSTA 2FQDA 1TJHL 2G4GA 2FJFB 1NFIB 2OTPA 4PJ6A 4R2GB 4RGNC 3RVXD 4C55A 1V55B 2FO8A 1T1WA 3DOSA 3C5XA 4XBMA 4MNGE 5E94B 2PXYD 4PJ5D 1HE7A 1CLYL 3QZWG 4DH2A 2PW2A 5ERWA 2IDCA 4YHPB 5LGJA 3FF8A 3P69A 3T8MA 5AYUL 1CN4A 4KMTL 5LDSA 1SOQA 4JZJB 4HJEA 4GINA 1EH9A 1FL3B 4JFYB 2PWDA 4BV1A 1E40A 3QNYB 4PLJC 3V6OE 2H41A 5DC9B 1DJXA 1IEBB 1A4AA 5JXAL 3X3FH 3S98A 3K71A 1N5AB 1V8HA 2E46A 2PXYC 1JZ8A 4LAQL 3VRIB 1KGWA 3ELAT 3QI9B 1U42A 1KWGA 2DKUA 3ATFA 4JW3A 2X4SA 1MFAH 4H88H 1MH5A 4PVMA 3ZYOA 1HHGB 5T3ZH 2QQKH 4EN2A 2F8OA 2EXYD 1BPLB 1FSKC 3FQXB 3CAFA 4YSEA 2FBJH 5EZLA 2H5UA 4Q6IC 5HHMD 1GAFH 4KKCD 4OF6A 2UY7A 4FNLL 3OSKA 3ZT6A 3FPYA 4YHIA 3SYQA 2XUWA 2QL1A 3RJQB 2VKWA 2Z7WA 4GT0A 1OT1A 3L13A 1YZZA 4K0OA 1GTFA 2WKLA 5DHDA 5CZKA 1KT2A 1G0YR 4JKWA 4OI7A 5D96B 4M4PA 3GSUB 4LGRB 3WGUB 2Y5TB 1CDGA 1ZLSL 2FATH 3ZYZA 3TA3C 1DUZB 3HLAB 4EQ3A 43CAA 4RFNB 5CZRA 1NKOA 1LHZA 3Q5YA 4PGDB 2VERN 1VLXA 4AT6B 2BSEA 1I3VA 3QQ9C 4LPVA 5D1XA 5AB9A 5JIIA 3FQUA 1CDBA 1FNAA 1EEZB 1S7VB 2XXFA 4QHMA 5I1EH 2DDQH 4FNUA 4EZLA 1KBBA 3ISYA 1JZJA 1R5VA 4AK1A 1INQA 1BXXA 4U3CA 1BIIB 2Q76A 1TSRA 5DJ6B 3II3A 3VTTA 4BH7A 4H44C 3PDDA 4D9QD 2ZOKB 1ZTMA 2ZP0T 5F7FA 2XTJD 2WVSA 1HOEA 3QUZD 3CVHB 5DRZB 3OQRA 5F8RC 4JGNA 3NJLA 2H0FA 2QV4A 1MWAH 3HVNA 4KUCF 5L88L 1EZVY 4YR6A 5L2KB 1KLFB 3VXSE 3WKYA 4UCFA 2G5RA 1K8IB 5E8PB 3GXDA 3FTZA 2CGYA 1U3HA 5ACLA 5J6GA 1T0OA 3JYCA 2NXZC 2XKUA 2VUOA 1BQUA 3ZE2B 3SPVB 1I85A 2GSIA 1KIQA 1DQML 1MCSA 1SJEB 5TDNA 2HN7A 2QQNL 1GR7A 2XXMB 4TULL 4G9FD 2UZIH 4WV1B 2VLME 3O6FD 1H8SA 2Q6WB 3BVTA 1UJ3A 5I1GH 1MRDH 1RUQH 3MRFB 1BFVH 1TTUA 1UACH 3GINA 2L7UA 1UM4H 1NCDH 4MJIE 5DQJA 5F70A 4IIZA 3HC0A 3ULUH 4KKAC 4TPRL 4UM8A 2DOCA 3L7FB 4NJAL 2GJZB 5K9QG 3GJEA 1D5BA 4KKNA 4RGMC 1CD9B 3PNWA 3HHSA 1U8CB 4X4ME 5IEKA 3N0AA 2K78A 3CVIL 3JTSB 4X9BA 1AR2A 2FHCA 4RDBA 3M7FB 4PU2A 1DVYA 5FM4A 3WY4A 1WC7B 3L3JB 3RY6C 3MLRH 3MREA 1C5BL 2P5EE 1EGJL 4UQ2B 5C0RH 2AEOA 1BCIA 1W72H 2E75C 2R0KH 1UWYA 1ZY9A 4FYQA 4IGBD 4U1IA 3QAQA 5KYXA 1VIWA 1R3KA 2BH0A 1DUYB 3NDYE 2V7NA 2FIKA 6PCYA 1FGNL 3MX0A 2NY2B 4MTMA 1MKFA 3BAIA 3UP1A 3FU5A 4M7ZC 2IH3B 3PGFH 3HRZA 4A68A 4K5LA 1Z9NA 4Y8DC 3OKDA 1HN1A 4PJ7B 4YIQB 4ZD3L 5I18H 3LEXA 1F1DA 5HYSG 1KULA 4F7KA 5DUMH 4N0YH 1RL1A 4LSRH 5JNYB 5C0CD 5B39G 2FX9H 3AT8A 3UO1H 4BKLA 2JXMA 4E41E 1FAIH 3EO1B 1E3ZA 2QFPA 4OF5A 3SE6A 1CI3M 4Q6IB 4DFIA 3ZDXB 3HPLB 2AEIT 2P3YA 1M9SA 1SN0A 4CKQA 2AP2A 1JNLL 1FO0L 3V5KB 1KLGB 3NZ8A 3W39B 4OAWA 2CNZA 3JWDL 4BZYA 4DUWA 5BS0A 3TYGH 3VSQA 5DJYA 4L9LB 5DJ6A 3MOBL 3VU1A 3DUUB 3OMIB 3W0WA 2WO3B 3Q43A 5CUSH 2KKQA 1UD6A 4WU7B 4HXAH 2VZVA 3F8UB 3ASOB 4H20H 2MCPL 4ZOBA 1Y1DA 5FW6A 3JYBA 3B2VH 4NUMA 2CHDA 4S2SA 1RUKL 2CPCA 1LQBC 1XCQB 5F7MC 4LOFA 3F7VA 4FQPA 4PREB 2K0RA 5EBMB 3BZDA 1RJZB 1I9IH 1XXDC 4TSAL 5C9KA 4PJGB 1BQ5A 1NCJA 1QEWA 4N2MA 4GY4A 4JFFE 5TFSH 5CLYA 1BVOA 4UT6A 2W65B 4A2EA 4WI0A 2JE8A 4JPWL 4P99A 5H37A 3KPMB 3IFOA 2FX7H 2EXWD 2CKBB 4X4KA 4G83A 2BCMA 5JUEL 2ZKXA 4W4NA 3GNML 4BGLA 1WJ3A 3G5ZA 3GIZL 4HUWB 3UG4A 2QADB 1S9VB 1NBQA 3C60A 3QCUL 4AWJC 4NZFA 4M7KL 3F7RA 3LMJL 4OBRA 1LD9B 1BFSA 4JM0A 1HILB 1CL7H 4JG1H 4XP1H 4X5XA 4NXKA 3UYOD 1AP2B 1ODUA 2R2EB 1J8HB 1W72A 4LDCA 2Y36H 2FB4L 2NXZB 4J6RH 3FSZA 5D6DA 1SLVA 3X1NA 1I9EA 5EORL 1Y6KR 1E7UA 2WLKA 4AEIL 2MQCA 4PV9B 1U2CA 3QT2A 1HIML 4JHVA 4PGCB 2A74A 3P3TA 3VFPA 1DQDH 1RZIA 4R97C 1BOGB 3ARVA 1L0QA 3GS7A 3FO0H 3HG1D 3QRLA 3WXVL 3UIZA 5F44A 1TVBA 4XOAA 4XPHL 3KBHE 1KBGH 3KEDA 4Y1AE 3T0WA 4CADA 4KRMB 2KLTA 1OAJA 2GIYA 2JB6A 2CR3A 6FABH 1MJ8L 4X0KA 2ZKMX 2GJPA 4TUKH 2Y2TA 2VB5A 3BP5B 3BUQA 4MZRA 2NNAB 2PO6C 1DL7L 5FC9A 3DK2A 2EKSA 4JRYA 1T0NB 3BISA 1YDPB 3DJ9A 5KS9F 3NYKA 1E43A 2AJUL 2GITB 3K2UH 3UPAA 1KZYA 4IMKA 4PB9L 1T4WA 1KCBA 3QNFA 5HPMA 3ARGA 2FEEI 4N4YB 1H6EA 2NNFA 3U82B 1Y1UA 5DDHA 5F7EH 1N3NA 1SHXA 2HLEB 3HC2A 4B7LA 2IWKA 4N6RA 1XGTA 4ZAKD 4Y4FB 5BOJA 3HI1B 5CLTA 3CU1A 1QRND 5D7KE 2EADA 3C2SA 1O5PA 2CBMA 3L7EA 5ID1A 3IB4A 1XGYH 5KN5B 4R0LB 4OV6F 2G2RA 5D7LD 4XNYL 1J8RA 3OGCB 4ODWB 1KIUA 3PWNA 1Q9OA 1AS7A 3LRMA 3KGRA 1IM3A 3X1FA 4GFTB 1E27B 3UTSE 4GXVL 3Q9QA 3BN9D 4F7MA 3LKNA 1HHHB 2RFXB 2EUVA 1AGCA 3DVFA 1A7QL 1INQB 4K7FB 5EBWA 3NZHL 1IC5L 3UG5A 3OKKB 4OZIA 4Q89A 3W0WE 2YGOA 1JV5A 2VDKL 4MB4A 5FECB 3AQZA 1I85C 2ZYRA 3Q2CA 1TCRA 1OP5K 3RI5F 5JZ7C 5MI0B 1B2WL 1BWMA 3BN9C 3L5XL 3B1UA 4HKZA 4PRHA 3TO4B 5AOLA 2NYYC 1XT5A 1U8HA 2AS5M 4EXKA 4D94A 1L7IH 2NUPB 2DYSB 3PP4H 4WWPA 5I18L 1E30A 1M6OB 1V7NH 5KYYB 5IJKC 5J6SA 3PWPE 3WJLA 4FXKC 1CCZA 3FTXA 3A6BL 3LIZH 1B4LA 4WFFD 4BSWB 2A6KB 4OCLC 2V5YA 5I73B 3SGJC 1FVDA 4HLJA 2OYMA 4TUJB 3SKJL 1Q0XL 3WFHB 3MCYA 3OZKA 1MI5B 3BP7B 3D7PA 3VSTA 3PV7A 5L8JB 2VJ8A 4GLRH 4XMZA 3U46A 2RCSL 5F7LB 4R2GD 4XTRD 3VXOB 1RURL 3VMPA 4N1EA 2ITDA 3W2DH 3H2QA 5GGQL 3EJQA 5IJVB 1DQMH 4EI5A 3GJFK 3PDOA 4U6VH 2EEFA 5GGTA 4U0QB 1NGQL 1KJMB 3DO3A 5DUJA 1GRWA 1K6QH 3LXUX 4N0UA 1M7XA 4D9RD 3NZ8B 1A9EB 3W9DB 4CDHA 1G1OA 1SEQL 1XIWA 3O41B 4QOKE 4GXFA 4WFED 1H3PH 2FLMA 3MUY1 3O6FC 1E4HA 3KPOA 4AQ1C 4MKTA 4NGHL 4JZNB 3VE0A 3SDCB 3NRQA 5I19H 2E9GA 2VMFA 4LSTH 1OTUD 4ZUVB 1P6AB 2V4LA 3HFML 4GG6B 3QFDB 5DRXB 1HU8A 4LZKA 3HR6A 4U1KB 2DDQL 1U3YA 3DUHA 2QSCH 2R2EA 4MJ5A 1NC4D 4GBXA 3OAWA 1LM8V 1YYLH 2V17L 3ULUC 4N2IA 1DLFH 3HS8A 4OUUB 5G4MA 2R23A 5KSBB 3QUZC 2F1AA 4PLOB 3VW3L 2DQHL 2RTTA 2PXYA 1KELL 5I82A 5BRZA 4WHYG 5B3NA 4XNQA 2WTRB 3SB3A 2YOCA 1OXYA 3BHBA 3DI2B 4H8WL 3PS6A 3C9NA 2YEVB 2PF6A 4Z6AT 1GMIA 5EDSA 2VKXA 4N9GA 5LCVL 5ACMA 4NKDA 4BK4A 1P53A 1E9PB 3HE6B 2JK5B 3JUZA 1WHOA 4ZX4A 3ULVD 2OK0H 1CD1A 1C1EH 4J3WA 4OLWH 2HKFH 3L7FA 2C3XA 2YJQA 2ZX9A 3MJ8A 4L4VB 1G7QA 5F21B 4WFGE 4Y1SA 4KO7A 3PV6B 4KGLA 4NWUL 2Y7QB 4IK7A 1OGAB 3HNTH 3T0DA 1R3LB 4N25A 1BFOB 1NAKH 1HJCA 4DP6X 2NUPA 1QFUH 2NZ9C 2VDRB 1U3JA 3RGVC 1QHOA 3PWNB 1KEML 1XGPA 1Z0MA 4G8FA 3GBMH 3C5ZB 3ARPA 3G6JE 4GBXD 2UZPA 3ZU8A 4HJIA 1ZPUA 1H6UA 4ODTL 4AL8H 4EZJA 1U8PA 5FAAA 5IQ7H 4K3DH 2EYRA 2A73A 2IGLA 3TBBA 5H2BB 3TH4T 2ID5A 3ECBB 3NH7H 1PZDA 3JWNC 2ZF8A 5DK2A 5I5JA 1PNDA 4DAGL 1I7ZA 2HJLB 3OKLB 4LLAA 4HD9A 2JH2A 4NRYA 1F0LA 5HVHC 1NFDA 3D87B 3D18A 5CZVH 32C2A 4OV5B 2P5EB 5GPRA 4DK5A 5EO1A 3FB5A 4LHUA 4FKHA 4LCWE 1ASQA 3U30B 4ZTEA 2EDKA 3C5SA 4LKCA 4MA3B 3RFZA 3ARFB 3GHBH 2ZUTA 3A4AA 3CC5B 3U1QA 2GBAA 2KZWA 2YHGA 5DC0A 2I5YL 5E6IB 1DVFA 1OK8A 4I77L 2NW3A 2MWCA 5L7XH 5EUOF 4AEEA 1JPSH 2D3NA 1GY1A 2K70A 3U1PA 1LO5A 1MCDA 1WLHA 5D7IE 5I1KL 4MMZC 4E9YA 3CSPA 3QQXA 3SD2A 2LTQB 3VI4F 2GJ6D 2ZCZA 2YAEA 1UUSA 3UAJD 3WXVH 1HFUA 4FNPA 5E5LA 5FB8B 1D7FA 2X4QA 1ORSA 3FTUA 4JZNA 4L1DA 1UJ3B 4H0HB 2NY6B 4JVWA 1MHHA 1FNGA 3D25B 3K2MC 5ADPH 7PCYA 5ERWB 4WGVB 3CFBA 3VXQB 5FM8A 4UINH 5FYJL 3IDJB 3PUUA 3L5WB 3WEXA 5HYJE 1UC6A 3LEVL 4X0NA 1BLNB 3ZDXE 5HHVL 1MQ8A 3ZKSD 1RIUH 4L3EE 1IKOP 5A3ID 2OQJA 1FZMB 2HB0A 4Z7NE 4Y9CA 1B88A 3V0DA 4LLVA 1IQWH 2XZQH 4G8GD 2HX9A 1N8OE 3HG2A 1YECH 3CZUB 3V5DB 4Q0XL 1QO3B 3QEUB 5DJAB 1YYLL 1TQWA 4NN6B 2F7PA 4YDJA 1PG7L 4RA0C 4FABH 4NP4H 4Y2DD 4XVUD 5F7DA 4E41A 2VLMD 3NFNB 4P2AA 1JYXA 4KX8A 4J8RA 1BAFL 5DWUL 1G9MC 4HEPA 5KG9A 2VISA 1KN2H 4YHLH 4XVTL 5AOZA 1AXTL 2UWEE 2PNDA 5I76B 2IOOA 2Q7YA 2WLIA 4TNVK 5FDYA 5KEZA 5GGRA 5C0EA 1E0OB 4MSWB 1NUFA 5GRVK 3IU3B 3NCXA 1DQKA 1HNGA 4I88A 3BWUF 4ZW6A 5MEOA 3K6SA 2IGFL 1R24A 3BZ5A 2ARJA 1JPTL 3FFCD 2JK5A 5I71B 3VD4A 5HDBB 4MFHA 2BOBB 2AXHA 4BKLB 5DZNA 43CAB 3FFDA 4UT9H 2EEXA 3BP6A 3OAUH 4M4RB 4FJYA 4W9ZA 3KPRD 5AKSA 1SVZA 5A6IA 3ARQA 5HHNB 5IY5B 1BQHB 5FGSA 1K4DB 4YDIL 4PTTB 2JIXB 2OTUB 3SDXF 4X5WB 3PL6B 3FOLB 1QFPA 4I9WE 4JFZL 1I4FB 3R7RA 2DYPB 1J8HE 1X9UA 4M43H 4XPTL 2JELH 3RNKA 3VXMB 4OJFL 2WCPA 4AQ8C 5JR1L 1JF1B 1NC2A 3WUWA 3CPUA 3L3OB 1FN4A 1D5XA 1SDYA 3VSUA 3HZVA 1N59B 4HZLA 4IHOB 2IPUK 2VDQH