3IWWA

Crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dbibzl, a urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Bioisosterism of urea-based GCPII inhibitors: Synthesis and structure-activity relationship studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3iwwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iwwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3iwwA02
2ZOFA 2CIJA 4EFDA 2Q51A 4JYWA 5LYIA 1ZG7A 4R8FA 2VL1A 3PFEA 2FVGA 3B35A 3KHXA 4FUUA 2RB7A 3CPXA 1RTQA 2PIZA 1H8LA 4C85A 4PXBA 3B2YA 2PJ8A 4OC3A 3FEDA 2PJ7A 3WABA 1ZLHA 2BO9A 4ONWA 2PJAA 4NJRA 3GB0A 2PJCA 3KASA 4C9RA 1IGBA 4PPZA 3VARA 2O53A 4NGRA 1XRYA 3SJFA 1KWMA 2V8DA 3FECA 1JQGA 1LANA 3B7IA 5LRJA 2IQ6A 2PCUA 4ZX8A 4R76A 2OOTA 1AMPA 4OC5A 4C8PA 2XEFA 4DJLA 3N5FA 3CPAA 5J1QA 3NH5A 4GM5A 3IO1A 3ISZA 3BI1A 1OBRA 3T8WA 4W9YA 3D7HA 1TKHA 4C8CA 2PVVA 1DTDA 2OR4A 3PBBA 4MXUA 3CDXA 1TF8A 4KNGE 4MCRA 4C8TA 5HVGA 5CBMA 4P4IA 2ZENA 4PXCA 3PRTA 4F8ZA 3NH8A 1XJOA 3PEIA 4UEEA 1R43A 2XEGA 2V8HA 3KR5A 4NGMA 1XBUA 1XFOA 1CP6A 5THWA 1GYTA 3FX6A 3PFOA 3IIBA 2I3CA 1VIXA 5JGFA 4OC4A 4WJBA 4MCSA 3V38A 2ZEPA 3D7DA 3IWWA 4X8IA 2PJBA 1TF9A 3PB9X 2PJ2A 4Q7AA 4A37A 4C9VA 2EWBA 4UEFA 4A39A 2HC9A 2QVPA 3L2NA 4ZX9A 3K2KA 4PXDA 3VATA 4RUHA 1HDUA 1F57A 5K8OA 5D8NA 3NFZA 4H2KA 4OKOA 3GLJA 1Z2LA 7CPAA 4ZY0A 3MN8A 2JEWA 4FAIA 4UF4A 2AFUA 1V6CA 4NFRA 1Y9ZA 3ICUA 3VH9A 2IMOA 1Y7EA 1IY7A 4IHMA 2Q4ZA 2PJ4A 4YN3A 2PJ3A 1Y0RA 4P44A 2NSMA 1YMEA 2WYRA 3SJXA 5K8PA 4MCPA 2CF4A 2AFWA 1F2OA 1YW4A 2QYVA 4KSIA 1TKFA 3SI0A 2BOAA 3FMCA 1HDQA 3GUXA 1BPMA 4C9UA 2AFZA 5HVFA 4P4FA 3BI0A 1FT7A 5JM6A 4MRIA 2GLFA 2BCOA 4A94A 3KGQA 3PB7X 1HEEA 3D4UA 4UEZA 5LYLA 4MCQA 2PJ6A 3BXMA 1LCPA 3WC7A 1ZLIA 1UWYA 1ARLA 4EMEA 3SI2A 4NGTA 2Q43A 6CPAA 4CDJA 1TKJA 3KR4A 1LAMA 4OC1A 2ZEHA 4EWTA 3ISXA 2AFMA 2ZEMA 2QJ8A 3WC5A 4C8FA 3DLJA 4P6YA 3D7GA 4NGSA 3BHXA 1F2PA 4X2TA 4R6TA 3QNVA 3IFEA 3TC8A 4PQAA 1ZG9A 2GLJA 3KL9A 3PB8X 2EK8A 4DYOA 2PJ1A 5IB9A 4K3NA 3IEHA 2IJZA 2F7VA 4FBEA 4NGPA 3PB4X 4P45A 4ZI6A 5K8MA 1VHOA 4BD9A 2AFSA 1Z8LA 1BPNA 4OIDA 2J9AA 3FJUA 2F8HA 4ZY1A 3I6SA 1XF1A 3KQZA 3D66A 4TJVA 1Y0YA 3D67A 4FWUA 4MHYA 2PJ5A 1NSAA 3JRUA 8CPAA 3KQXA 4Z65A 2V77A 1YSJA 4P10A 5I4MA 3PB6X 4AXVA 4C86A 1LOKA 2RFHA 2PIYA 5DS0A 4P4DA 1ELMP 1CP7A 4R7MA 4YWYA 4IK2A 3S9LA 1EE3P 3KHZA 3EIFA 4MHPA 1YW6A 5HXDA 2POKA 2ZEEA 4IAVA 5LYDA 2WZNA 4X3RA 2ABZA 1ZG8A 3VTAA 1LAPA 2C6GA 2XEJA 1PCAA 1R3NA 1Q7LA 4C8UA 3WC6A 1BLLE 3FVLA 4JZ0A 4WWVA 2CTCA 2C6PA 4OP4A 1CBXA 3I1UA 2JBKA 1ARMA 3H8GA 3HUVA 1DE4C 4ZYQA 3B3WA 1CX8A 1BAVA 3H8FA 1LFWA 3NA6A 5LRKA 3B3SA 2PJ9A 3RAMA 1AYEA 2PJ0A 2ANPA 2CTBA 2XEIA 4C9AA 3KZWA 1TXRA 3IJ3A 4MHNA 2V8GA 4A38A 3CT9A 3NH4A 2DEAA 4P4JA 3B3VA 4P4BA 3SI1A 3WT4A 4F9UA 4OC0A 2AFXA 1QQ9A 3B3TA 3MRUA 4MMOA 2ZEGA 2G9DA 2GREA 1Z5RA 4C9EA 4UIAA 1PYTB 3I74A 2ZEDA 4P4EA 4NJQA 4MHZA 4LQGA 2C6CA 3DGVA 4DUKA 2O4HA 1XMBA 4G1PA 5LRGA 5D29A 4C8AA 3FF3A 3H8EA 2PE3A 4F9VA 2ZEOA 2ZEFA 2V8VA 4CPAA 3B3CA 1CPXA 1CG2A 1M4LA 1CPSA 5CPAA 2EK9A 3TX8A 4ZY2A 3RBUA 1FNOA 4TWEA 4TJXA 4PXEA 3LMSA 4OMEA 4CDKA 4NGNA 4NGQA 1ELLP 2NYQA 3RZAA 1VHEA 3S9NA 3SJGA 3SJEA 3FEEA 4B6ZA 2C1CA 2GU2A 4C84A 4TNUA 5K8NA 4OIWA 5HVHA 3HLPA 2HB6A 3IC1A 3V7ZA 2ZELA 2ZOGA 2AFOA 1QMUA 3KI9A 1WVMA 5ELYA 4UIBA 3D7FA 4OC2A 2JBJA 3K9TA 2PRQA 5JH9A 4C99A 2PVWA 3D68A 4YU9A 4O23A 5F09A 3S9MA 5LYFA 1YLOA 3LWUA 3FH4A 1VGYA 3PBEA
chains in the Genus database with same CATH superfamily
1XOVA 2WSAA 5A28A 2G3TA 2ZOFA 3SHPA 4E8OA 4C7IA 4RR2B 5IB0A 3R95A 4ONUA 3PP9A 2CIJA 4EFDA 1M44A 4KLVA 2Q51A 4XPLA 4JYWA 2FIWA 2YNCC 5LYIA 1ZG7A 4R8FA 4B5PB 2VL1A 3PFEA 2FVGA 4Q38A 5JYBA 2YNCA 4BMHA 3B35A 3KHXA 2Q4YA 4FUUA 2RB7A 2EUIA 2I00A 3CPXA 4KOTA 3RO0A 1RTQA 2PIZA 1H8LA 2IL4A 3DSBA 2OZUA 2Y1MA 2P0WA 2JDDA 2VBQA 3DR6A 4PXBA 3TYXA 3B2YA 4B14A 4CO9A 5AGEA 2PJ8A 2ZPAA 2GFQA 3QAHA 4OC3A 3FEDA 2PJ7A 3WABA 1ZLHA 2BO9A 2AJ6A 2PJAA 4NJRA 4ONWA 1EZBA 1IIDA 5F46A 2ZW6A 2PJCA 3GB0A 4PK3A 3KASA 3BJ8A 2Z3OA 5H84A 1XIXA 1LRZA 4M8DA 1EZAA 1VBGA 3VRRA 4IIXA 3I9SA 4C9RA 1IGBA 2NMTA 4PPZA 4KOVA 3VARA 4CAXA 2O53A 1NSLA 4NGRA 1XRYA 5EBVA 3EFAA 2DF5A 3SJFA 1KWMA 2V8DA 3FECA 1JQGA 3NOJA 1LANA 4KOUA 3S6GA 4B13A 4CRYB 3B7IA 4XPDB 2IQ6A 5LRJA 4B10A 1Z4RA 2PCUA 4ZX8A 1Z9UA 3SXNA 3KKWA 4R76A 4AG9A 2VEZA 2OOTA 1AMPA 4R87A 4OC5A 2FT0A 1NXJA 4C8PA 4F6AA 2XEFA 2ATRA 4DJLA 2EZCA 3N5FA 3CPAA 4KLWA 5J1QA 3NH5A 4GM5A 3IO1A 3ISZA 3BI1A 5F48A 1OBRA 4B5PA 2D0OA 3T8WA 3TT2A 4C2ZA 4W9YA 3D7HA 1TKHA 2DPTA 3JVNA 3VWEA 2PVVA 4JJXA 1DTDA 1B6BA 2EO8A 4YGOA 2OR4A 4UBRA 3PBBA 3EZBA 2B0AA 1GHEA 4MXUA 4A33A 3R96A 2P6GA 3CDXA 4LUAA 5DWMA 1TF8A 2J8MA 4KNGE 4MCRA 1A9XB 4JLYA 4C8TA 2Q4VA 3BUOB 5HVGA 2PSWA 5CBMA 4P4IA 2ZENA 1CS0B 2C27A 4PXCA 3ZZIA 3PRTA 1VKCA 2Z3KA 4F8ZA 2DIKA 5KTDA 3FNCA 3NH8A 1BO4A 1CE8B 4JXQA 1XJOA 3S6FA 2PC1A 4PSXA 4MFLA 3PEIA 2D4PA 4UEEA 1R43A 2XEGA 2V8HA 3KR5A 4NGMA 4MFZA 1XBUA 4B5OA 5FD8A 1KBLA 4HNYB 1XFOA 1CP6A 5THWA 4H1HA 1VI4A 2ZW7A 3PT1A 1GYTA 4Q36A 4MFPA 3FX6A 3IWGA 1MJBA 3PFOA 3IIBA 2I3CA 2Q0YA 1JWQA 1FY7A 5J8CA 1VIXA 5JGFA 4OC4A 4HNXB 2B5GB 2B4JC 4WJBA 4UCMA 4CAEA 4A30A 2CXAA 4FD5A 3VROA 2GE3A 1T36B 4MCSA 5A27A 3D3SA 3V38A 4B11A 5IX3A 2Z3NA 5JVLA 2ZEPA 2AUMA 5F9MA 3D7DA 3IWWA 4X8IA 2VI7A 2R7HA 3T9YA 2PJBA 3K9UA 5EMIA 1TF9A 3HMJG 5KTCA 3PB9X 3EY5A 2KCWA 4FD7A 2BEIA 2PJ2A 2FL4A 4CGPA 3F0AA 3LACA 4BINA 2X7BA 4Q7AA 5KTAA 4A37A 2BUEA 4C9VA 4AG7A 4KOXA 2EWBA 4UEFA 4A39A 2HC9A 2QVPA 3L2NA 1V0CA 4M85A 5G1ZA 4FD4A 5AG6A 4DNCA 4ZX9A 3K2KA 1KUXA 1MJAA 1Z8XA 4PXDA 1KC7A 3RYOA 3VATA 4RUHA 3ZNIA 1HDUA 3MGDA 1F57A 1IOFA 2QECA 3P2HA 5K8OA 1PUAA 1IICA 5D8NA 2D0PA 1M4GA 2JEVA 3NFZA 3TO6A 4QBJA 4H2KA 4OKOA 3GLJA 3TLZA 1Z2LA 2OU2A 1Z9EA 7CPAA 2B5GA 3B8GA 4ZY0A 3BUXB 5G21A 3MN8A 2JEWA 2B4BA 4HNWB 4FAIA 4UF4A 3VRQA 2AFUA 1V6CA 4NFRA 3BUMB 1Y9ZA 3ICUA 2G0BA 3VH9A 3A9LA 1Q2DA 5F13A 1ZL0A 3G3SA 1Z8TA 1XEBA 2IMOA 1Y7EA 3NE7A 4U9YA 5C82A 1IY7A 3IU1A 2DLAA 1Y7RA 4IHMA 5IV0A 5F5XA 2AE6A 2PCNA 2Q4ZA 1IB1E 2PJ4A 2VKZG 2G3AA 4YN3A 2PJ3A 1Y0RA 1VHSA 2HWGA 4U9ZA 4P44A 2NSMA 3GYAA 4KSAA 2YJTA 4XNHB 1YMEA 4YRHA 2WYRA 4NCZA 3CXPA 4M3SA 3SJXA 3T05A 5K8PA 4MCPA 3LODA 5F49A 1VBHA 3U1BA 5IR2A 3F5BA 4EYSA 2CF4A 2AFWA 1F2OA 1YW4A 2QYVA 4C2XA 4JWPA 4KSIA 1YVHA 5EC4A 4CRZB 3VTAA 4RI1A 4PV6A 1TKFA 5AG4A 3SI0A 4JVOA 1I1DA 2BOAA 1HDQA 3FMCA 3GUXA 1BPMA 4KZTA 4QC6A 4UA3A 4UCNA 4CGMA 4C9UA 1YGHA 2AFZA 3HPGG 3EO4A 4MBUA 5HVFA 4P4FA 3DNSA 3BI0A 1FT7A 5JM6A 1S3ZA 4M6HA 3G8WA 2Y1NA 2H5MA 4MRIA 1EO0A 2GLFA 4COBA 2BCOA 4A94A 3EZEA 3KGQA 3PB7X 4E94A 3TLBA 1HEEA 2GANA 3D4UA 4UEZA 2XPNA 1IU8A 2F5IA 5LYLA 2P6EA 4CGLA 2PDOA 3VRPA 4BBHA 1JDBC 4KS9A 4MCQA 1S5KA 2PJ6A 3E0KA 2N3AB 3NE8A 1YX0A 3BXMA 1LCPA 2P6FA 4L8AA 1ZLIA 4XNHC 3WC7A 5E96A 1UWYA 2OLSA 1ARLA 4EMEA 3SI2A 3TO7A 4NGTA 1ZRSA 3OP0A 1YVKA 2Q43A 6CPAA 1CJWA 1ZO0A 4CDJA 1Q2CA 1TKJA 5F1YA 4UFXA 3KR4A 1LAMA 1KZFA 4OC1A 3TLEA 4H89A 2ZEHA 4CS0B 4EWTA 1I12A 1N71A 3ISXA 2AFMA 2VZYA 4KOSA 2ZEMA 2QJ8A 3WC5A 4C8FA 3DLJA 4HPSA 2R1IA 4P6YA 4HKFA 3D7GA 3JTKA 4NGSA 1XF8A 4R9MA 1QSOA 1RXTA 2BL1A 2JLMA 3BHXA 1M6VB 3TO9A 3I3GA 4E0AA 1F2PA 4F0XA 4COGA 4X2TA 3P2FA 4XPDC 4CYQA 3FB3A 3QNVA 3VGOA 3IFEA 4R6TA 1C3OB 4RS2A 3TC8A 4PQAA 1ZG9A 3TLAA 2GLJA 3GIUA 3KL9A 3PB8X 2EK8A 4C7HA 5BY0A 2UV8G 4MFQA 1M4DA 4DYOA 2B4DB 2PJ1A 3F8KA 3EC4A 3F9KC 3TLGB 5IB9A 4K3NA 2ZW4A 5AXIA 3IEHA 4CZ1A 2IJZA 1S7KA 2K5TA 2F7VA 2WUUA 4FBEA 3O8ZA 4NGPA 3PB4X 4KUBA 3PLFB 2PR1A 2PR8A 4QUSA 5F47A 1S60A 4P45A 4ZI6A 5K8MA 1VHOA 4BD9A 2AFSA 4MJ8A 3EZAA 4JD6A 1Z8LA 1BPNA 5K99A 4BPUB 4OIDA 2J9AA 3FJUA 4UFVA 4PK2A 2F8HA 2PRBA 3LD2A 4ZY1A 2AUNA 1XF1A 2R82A 3KQZA 3I6SA 2QIRA 3D8PA 3T5MA 3R9FA 3D66A 4TJVA 1U6MA 1Y0YA 1TIQA 3V8IA 2J8RA 3TCVA 3D67A 4FWUA 4MFKA 4MHYA 5GCNA 2PJ5A 1NSAA 3TOAA 1J3LA 3JRUA 8CPAA 2REEA 3KQXA 4CAFA 4Z65A 2V77A 1YSJA 3DDDA 4P10A 1M4IA 1Q2YA 4KORA 5I4MA 1Y9WA 1BOBA 2CNMA 3PB6X 5HH1A 3IWEA 4R3LA 4AXVA 2Q44A 4C86A 3GY9A 3IU2A 3OAKA 1LOKA 2B4DA 5H86A 3R9GA 1YVOA 2GIVA 4CYNA 1AUGA 3TLGA 4A95A 2HI6A 4CYPA 4CAWA 2RFHA 2PIYA 1X10A 5DS0A 4P4DA 1ELMP 4IIYA 5G20A 1CP7A 2YGWA 4R7MA 4C85A 1XE4A 5HKWA 4YWYA 4IK2A 3W6XA 3S9LA 1EE3P 1NE9A 3KHZA 3EIFA 1NMTA 4AVCA 4MHPA 2Z10A 2Q7SA 3T0TA 1KUYA 1YW6A 1A2ZA 5HXDA 2POKA 4I49A 2ZEEA 2EBJA 4IAVA 4BTFA 4KSFA 2WZNA 4QVTA 5LYDA 4X3RA 2ABZA 3SR3A 1ZG8A 2B58A 2R98A 5DWNA 4IF5A 1LAPA 4MJXA 1K4JA 1QSTA 1SQHA 4XPKA 2C6GA 3W91A 4INJA 2XEJA 2WPXA 1PCAA 1R3NA 1P0HA 4CYOA 4YFJA 1X12A 1Q7LA 3VWDA 4OADA 1DIKA 4C8UA 1QSRA 4KOWA 3WC6A 1B47A 1BLLE 2XPOA 3FVLA 4QB9A 1WWZA 3D2MA 4A32A 4JZ0A 3PGPA 4WWVA 3BUNB 1XMTA 4E5SA 2CTCA 2C6PA 1FBVA 4OP4A 2PQ8A 2YJVA 1CBXA 2FIAA 2BSWA 3I1UA 3FBUA 2EVNA 2CY2A 2JBKA 1ARMA 3R1KA 3H8GA 2REFA 1M1DA 4UFWA 3H4QA 3HUVA 1DE4C 5HKZA 2O28A 4AB7A 4ZYQA 3B3WA 4MY3A 1CX8A 1I21A 2FSRA 3R9EA 4MI4A 2FM4A 1BAVA 1MJ9A 2OH1A 5FVJA 3H8FA 1LFWA 3NA6A 4NXYA 5LRKA 4J0NA 3KRVA 3HPHE 1B87A 4OAEA 3B3SA 2HQYA 2PJ9A 3FRMA 2XPLA 4LQ6A 3RAMA 4CAVA 1R61A 1AYEA 2PJ0A 4NEXA 5JPHA 2ANPA 3C8OA 2EZBA 2CTBA 4F0YA 2XEIA 2Z11A 4NF1A 3KZWA 2VZZA 1TXRA 3IJ3A 4MHNA 2DXQA 2V8GA 4ORFA 3CT9A 3RNZA 3NH4A 2DEAA 2ZXVA 4A38A 1QSNA 4P4JA 3U88C 3B3VA 2HUZA 4UCPA 4P4BA 4EVYA 3SI1A 3WT4A 2DPSA 4X5KA 4BPWB 4F9UA 4OC0A 1KUVA 2AFXA 4Y49B 2GP4A 1QQ9A 2Z3MA 3B3TA 3MRUA 3C26A 4MMOA 5CNPA 4A2ZA 2ZEGA 2HV2A 3ZJ0A 3QAYA 2G9DA 4JXRA 2GREA 1QSMA 2OB0A 2CNSA 4KVOE 1Z5RA 2Y0MA 4C9EA 4UIAA 1JDEA 4NSQA 1WK4A 2X0SA 3TLCA 1PYTB 4C9AA 1L0CA 5G22A 2E28A 1PU9A 3I74A 1OZPA 2XPPA 4H6ZA 2ZEDA 4P4EA 4NJQA 1IYKA 4A4CA 2Z3LA 3CXQA 4GS4A 4MHZA 4LQGA 2C6CA 5I0CA 4M6IA 4A4BA 3DGVA 2FS5A 2CBLA 4DUKA 2B3VA 3CZXA 3SXOA 2I79A 1IYLA 2O4HA 3T07A 5HMNA 1XMBA 3NFQA 1YR0A 4G1PA 3W6SA 5LRGA 1J4JA 3IGRA 5D29A 5J3XA 3FYNA 4ZGYB 4GPLB 1GGOA 4C8AA 3FF3A 3GKRA 1P4NA 3T90A 3H8EA 2PE3A 4F9VA 3QB8A 4MY0A 4A31A 2C5QA 2ZEOA 4Y49C 2Z0ZA 2A4NA 3TTHA 2ODFA 3OB1B 2ZEFA 4C8CA 2V8VA 1C30B 3H5ZA 3PZJA 2RC4A 4CPAA 3B3CA 1CPXA 1CG2A 2FE7A 1ZYMA 3CXSA 4R57A 1M4LA 4B12A 3G23A 4KVME 4II9A 5JQ4A 1CPSA 5CPAA 1MK4A 2EK9A 4M6GA 3TX8A 4ZY2A 4E2AA 3TE4A 3K4IA 4H6UA 3RBUA 1FNOA 2JDCA 4PSWA 4TWEA 4TJXA 4PXEA 1YQEA 3DR8A 1WJTA 3LMSA 2Q04A 4OMEA 3FXTA 4GXHA 4U5YA 1Z8WA 4CGNA 4MI1A 4ZBGA 4KOYA 3WR7A 1YK3A 4NGNA 4NGQA 1ELLP 2B3UA 4R3KA 3S6HA 2OZGA 3GJZA 5BWAB 4L89A 2NYQA 5C88A 4CDKA 3RZAA 2MP0A 1S7FA 1VHEA 4UWJA 3OB2B 3BUWB 2YNEA 3S9NA 3EXNA 1CM0A 3SJGA 2J8NA 4LX9A 3SJEA 3FEEA 4FD6A 4B6ZA 2FCKA 2YNDA 2Z3PA 3BJ7A 1RO5A 3N7ZA 2C1CA 2GU2A 2D4OA 1KEEB 4C84A 4KUAA 2R8VA 4TNUA 1R57A 5K8NA 3OWCA 4OIWA 1S7NA 5HVHA 4AVBA 2QMLA 3HLPA 4KVXA 2HB6A 3IC1A 2VXKA 3V7ZA 2ZELA 2ZOGA 2AFOA 1Z4EA 3BLNA 1QMUA 3PFVA 1YLEA 4C2YA 3KI9A 1BXRB 1Y9KA 1WVMA 3TLYA 5ELYA 4MHDA 2VQYA 4K30A 4UIBA 3D7FA 5ISVA 4OC2A 1S7LA 3UY5A 3JUWA 2JBJA 2ZW5A 1Q5XA 3K9TA 4BPXB 4MFJA 3TOBA 2PRQA 3VRNA 1UFHA 1YREA 2Q7BA 5HKYA 3FIXA 5JH9A 3TFYA 4C99A 2PVWA 3D68A 4YU9A 2OZHA 3D2PA 1IOIA 4C68A 2HROA 4O23A 3S6KA 5F09A 4CGOA 2FXFA 4UWIA 2CNTA 2WPWA 4OLLA 4IUSA 4J3GA 4RN7A 1ON0A 5J8FA 3S9MA 5LYFA 2EZAA 5AG7A 1YLOA 3LWUA 4AVAA 3FH4A 2ARHA 5AG5A 1VGYA 3PBEA 1NBWA
chains in the Genus database with same CATH topology
2ZOFA 2CIJA 4EFDA 2Q51A 4JYWA 5LYIA 1ZG7A 4R8FA 2VL1A 3PFEA 2FVGA 3B35A 3KHXA 4FUUA 2RB7A 3CPXA 1RTQA 2PIZA 1H8LA 4C85A 4PXBA 3B2YA 2PJ8A 4OC3A 3FEDA 2PJ7A 3WABA 1ZLHA 2BO9A 4ONWA 2PJAA 4NJRA 3GB0A 2PJCA 3KASA 4C9RA 1IGBA 4PPZA 3VARA 2O53A 4NGRA 1XRYA 3SJFA 1KWMA 2V8DA 3FECA 1JQGA 1LANA 3B7IA 5LRJA 2IQ6A 2PCUA 4ZX8A 4R76A 2OOTA 1AMPA 4OC5A 4C8PA 2XEFA 4DJLA 3N5FA 3CPAA 5J1QA 3NH5A 4GM5A 3IO1A 3ISZA 3BI1A 1OBRA 3T8WA 4W9YA 3D7HA 1TKHA 4C8CA 2PVVA 1DTDA 2OR4A 3PBBA 4MXUA 3CDXA 1TF8A 4KNGE 4MCRA 4C8TA 5HVGA 5CBMA 4P4IA 2ZENA 4PXCA 3PRTA 4F8ZA 3NH8A 1XJOA 3PEIA 4UEEA 1R43A 2XEGA 2V8HA 3KR5A 4NGMA 1XBUA 1XFOA 1CP6A 5THWA 1GYTA 3FX6A 3PFOA 3IIBA 2I3CA 1VIXA 5JGFA 4OC4A 4WJBA 4MCSA 3V38A 2ZEPA 3D7DA 3IWWA 4X8IA 2PJBA 1TF9A 3PB9X 2PJ2A 4Q7AA 4A37A 4C9VA 2EWBA 4UEFA 4A39A 2HC9A 2QVPA 3L2NA 4ZX9A 3K2KA 4PXDA 3VATA 4RUHA 1HDUA 1F57A 5K8OA 5D8NA 3NFZA 4H2KA 4OKOA 3GLJA 1Z2LA 7CPAA 4ZY0A 3MN8A 2JEWA 4FAIA 4UF4A 2AFUA 1V6CA 4NFRA 1Y9ZA 3ICUA 3VH9A 2IMOA 1Y7EA 1IY7A 4IHMA 2Q4ZA 2PJ4A 4YN3A 2PJ3A 1Y0RA 4P44A 2NSMA 1YMEA 2WYRA 3SJXA 5K8PA 4MCPA 5IR2A 2CF4A 2AFWA 1F2OA 1YW4A 2QYVA 4KSIA 1TKFA 3SI0A 2BOAA 3FMCA 1HDQA 3GUXA 1BPMA 4C9UA 2AFZA 5HVFA 4P4FA 3BI0A 1FT7A 5JM6A 4MRIA 2GLFA 2BCOA 4A94A 3KGQA 3PB7X 1HEEA 3D4UA 4UEZA 5LYLA 4MCQA 2PJ6A 3BXMA 1LCPA 3WC7A 1ZLIA 1UWYA 1ARLA 4EMEA 3SI2A 4NGTA 2Q43A 6CPAA 4CDJA 1TKJA 3KR4A 1LAMA 4OC1A 2ZEHA 4EWTA 3ISXA 2AFMA 2ZEMA 2QJ8A 3WC5A 4C8FA 3DLJA 4P6YA 3D7GA 4NGSA 3BHXA 1F2PA 4X2TA 4R6TA 3QNVA 3IFEA 3TC8A 4PQAA 1ZG9A 2GLJA 3KL9A 3PB8X 2EK8A 4DYOA 2PJ1A 5IB9A 4K3NA 3IEHA 2IJZA 2F7VA 4FBEA 4NGPA 3PB4X 4P45A 4ZI6A 5K8MA 1VHOA 4BD9A 2AFSA 1Z8LA 1BPNA 4OIDA 2J9AA 3FJUA 2F8HA 4ZY1A 3I6SA 1XF1A 3KQZA 3D66A 4TJVA 1Y0YA 3D67A 4FWUA 4MHYA 2PJ5A 1NSAA 3JRUA 8CPAA 3KQXA 4Z65A 2V77A 1YSJA 4P10A 5I4MA 3PB6X 4AXVA 4C86A 1LOKA 2RFHA 2PIYA 5DS0A 4P4DA 1ELMP 1CP7A 4R7MA 4YWYA 4IK2A 3S9LA 1EE3P 3KHZA 3EIFA 4MHPA 1YW6A 5HXDA 2POKA 2ZEEA 4IAVA 5LYDA 2WZNA 4X3RA 2ABZA 1ZG8A 3VTAA 1LAPA 2C6GA 2XEJA 1PCAA 1R3NA 1Q7LA 4C8UA 3WC6A 1BLLE 3FVLA 4JZ0A 4WWVA 2CTCA 2C6PA 4OP4A 1CBXA 3I1UA 2JBKA 1ARMA 3H8GA 3HUVA 1DE4C 4ZYQA 3B3WA 1CX8A 1BAVA 3H8FA 1LFWA 3NA6A 5LRKA 3B3SA 2PJ9A 3RAMA 1AYEA 2PJ0A 2ANPA 2CTBA 2XEIA 4C9AA 3KZWA 1TXRA 3IJ3A 4MHNA 2V8GA 4A38A 3CT9A 3NH4A 2DEAA 4P4JA 3B3VA 4P4BA 3SI1A 3WT4A 4F9UA 4OC0A 2AFXA 2GP4A 1QQ9A 3B3TA 3MRUA 4MMOA 2ZEGA 2G9DA 2GREA 1Z5RA 4C9EA 4UIAA 1PYTB 3I74A 2ZEDA 4P4EA 4NJQA 4MHZA 4LQGA 2C6CA 3DGVA 4DUKA 2O4HA 1XMBA 4G1PA 5LRGA 5D29A 4C8AA 3FF3A 3H8EA 2PE3A 4F9VA 2C5QA 2ZEOA 2ZEFA 2V8VA 4CPAA 3B3CA 1CPXA 1CG2A 1M4LA 1CPSA 5CPAA 2EK9A 3TX8A 4ZY2A 3RBUA 1FNOA 4TWEA 4TJXA 4PXEA 3LMSA 4OMEA 4CDKA 4NGNA 4NGQA 1ELLP 2NYQA 3RZAA 1VHEA 3S9NA 3SJGA 3SJEA 3FEEA 4B6ZA 2C1CA 2GU2A 4C84A 4TNUA 5K8NA 4OIWA 5HVHA 3HLPA 2HB6A 3IC1A 3V7ZA 2ZELA 2ZOGA 2AFOA 1QMUA 3KI9A 1WVMA 5ELYA 4UIBA 3D7FA 4OC2A 2JBJA 3K9TA 2PRQA 5JH9A 4C99A 2PVWA 3D68A 4YU9A 4O23A 5F09A 3S9MA 5LYFA 1YLOA 3LWUA 3FH4A 1VGYA 3PBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOF A;  2CIJ A;  4EFD A;  2Q51 A;  4JYW A;  5LYI A;  1ZG7 A;  4R8F A;  2VL1 A;  3PFE A;  2FVG A;  3B35 A;  3KHX A;  4FUU A;  2RB7 A;  3CPX A;  1RTQ A;  2PIZ A;  1H8L A;  4C85 A;  4PXB A;  3B2Y A;  2PJ8 A;  4OC3 A;  3FED A;  2PJ7 A;  3WAB A;  1ZLH A;  2BO9 A;  4ONW A;  2PJA A;  4NJR A;  3GB0 A;  2PJC A;  3KAS A;  4C9R A;  1IGB A;  4PPZ A;  3VAR A;  2O53 A;  4NGR A;  1XRY A;  3SJF A;  1KWM A;  2V8D A;  3FEC A;  1JQG A;  1LAN A;  3B7I A;  5LRJ A;  2IQ6 A;  2PCU A;  4ZX8 A;  4R76 A;  2OOT A;  1AMP A;  4OC5 A;  4C8P A;  2XEF A;  4DJL A;  3N5F A;  3CPA A;  5J1Q A;  3NH5 A;  4GM5 A;  3IO1 A;  3ISZ A;  3BI1 A;  1OBR A;  3T8W A;  4W9Y A;  3D7H A;  1TKH A;  4C8C A;  2PVV A;  1DTD A;  2OR4 A;  3PBB A;  4MXU A;  3CDX A;  1TF8 A;  4KNG E;  4MCR A;  4C8T A;  5HVG A;  5CBM A;  4P4I A;  2ZEN A;  4PXC A;  3PRT A;  4F8Z A;  3NH8 A;  1XJO A;  3PEI A;  4UEE A;  1R43 A;  2XEG A;  2V8H A;  3KR5 A;  4NGM A;  1XBU A;  1XFO A;  1CP6 A;  5THW A;  1GYT A;  3FX6 A;  3PFO A;  3IIB A;  2I3C A;  1VIX A;  5JGF A;  4OC4 A;  4WJB A;  4MCS A;  3V38 A;  2ZEP A;  3D7D A;  3IWW A;  4X8I A;  2PJB A;  1TF9 A;  3PB9 X;  2PJ2 A;  4Q7A A;  4A37 A;  4C9V A;  2EWB A;  4UEF A;  4A39 A;  2HC9 A;  2QVP A;  3L2N A;  4ZX9 A;  3K2K A;  4PXD A;  3VAT A;  4RUH A;  1HDU A;  1F57 A;  5K8O A;  5D8N A;  3NFZ A;  4H2K A;  4OKO A;  3GLJ A;  1Z2L A;  7CPA A;  4ZY0 A;  3MN8 A;  2JEW A;  4FAI A;  4UF4 A;  2AFU A;  1V6C A;  4NFR A;  1Y9Z A;  3ICU A;  3VH9 A;  2IMO A;  1Y7E A;  1IY7 A;  4IHM A;  2Q4Z A;  2PJ4 A;  4YN3 A;  2PJ3 A;  1Y0R A;  4P44 A;  2NSM A;  1YME A;  2WYR A;  3SJX A;  5K8P A;  4MCP A;  2CF4 A;  2AFW A;  1F2O A;  1YW4 A;  2QYV A;  4KSI A;  1TKF A;  3SI0 A;  2BOA A;  3FMC A;  1HDQ A;  3GUX A;  1BPM A;  4C9U A;  2AFZ A;  5HVF A;  4P4F A;  3BI0 A;  1FT7 A;  5JM6 A;  4MRI A;  2GLF A;  2BCO A;  4A94 A;  3KGQ A;  3PB7 X;  1HEE A;  3D4U A;  4UEZ A;  5LYL A;  4MCQ A;  2PJ6 A;  3BXM A;  1LCP A;  3WC7 A;  1ZLI A;  1UWY A;  1ARL A;  4EME A;  3SI2 A;  4NGT A;  2Q43 A;  6CPA A;  4CDJ A;  1TKJ A;  3KR4 A;  1LAM A;  4OC1 A;  2ZEH A;  4EWT A;  3ISX A;  2AFM A;  2ZEM A;  2QJ8 A;  3WC5 A;  4C8F A;  3DLJ A;  4P6Y A;  3D7G A;  4NGS A;  3BHX A;  1F2P A;  4X2T A;  4R6T A;  3QNV A;  3IFE A;  3TC8 A;  4PQA A;  1ZG9 A;  2GLJ A;  3KL9 A;  3PB8 X;  2EK8 A;  4DYO A;  2PJ1 A;  5IB9 A;  4K3N A;  3IEH A;  2IJZ A;  2F7V A;  4FBE A;  4NGP A;  3PB4 X;  4P45 A;  4ZI6 A;  5K8M A;  1VHO A;  4BD9 A;  2AFS A;  1Z8L A;  1BPN A;  4OID A;  2J9A A;  3FJU A;  2F8H A;  4ZY1 A;  3I6S A;  1XF1 A;  3KQZ A;  3D66 A;  4TJV A;  1Y0Y A;  3D67 A;  4FWU A;  4MHY A;  2PJ5 A;  1NSA A;  3JRU A;  8CPA A;  3KQX A;  4Z65 A;  2V77 A;  1YSJ A;  4P10 A;  5I4M A;  3PB6 X;  4AXV A;  4C86 A;  1LOK A;  2RFH A;  2PIY A;  5DS0 A;  4P4D A;  1ELM P;  1CP7 A;  4R7M A;  4YWY A;  4IK2 A;  3S9L A;  1EE3 P;  3KHZ A;  3EIF A;  4MHP A;  1YW6 A;  5HXD A;  2POK A;  2ZEE A;  4IAV A;  5LYD A;  2WZN A;  4X3R A;  2ABZ A;  1ZG8 A;  3VTA A;  1LAP A;  2C6G A;  2XEJ A;  1PCA A;  1R3N A;  1Q7L A;  4C8U A;  3WC6 A;  1BLL E;  3FVL A;  4JZ0 A;  4WWV A;  2CTC A;  2C6P A;  4OP4 A;  1CBX A;  3I1U A;  2JBK A;  1ARM A;  3H8G A;  3HUV A;  1DE4 C;  4ZYQ A;  3B3W A;  1CX8 A;  1BAV A;  3H8F A;  1LFW A;  3NA6 A;  5LRK A;  3B3S A;  2PJ9 A;  3RAM A;  1AYE A;  2PJ0 A;  2ANP A;  2CTB A;  2XEI A;  4C9A A;  3KZW A;  1TXR A;  3IJ3 A;  4MHN A;  2V8G A;  4A38 A;  3CT9 A;  3NH4 A;  2DEA A;  4P4J A;  3B3V A;  4P4B A;  3SI1 A;  3WT4 A;  4F9U A;  4OC0 A;  2AFX A;  1QQ9 A;  3B3T A;  3MRU A;  4MMO A;  2ZEG A;  2G9D A;  2GRE A;  1Z5R A;  4C9E A;  4UIA A;  1PYT B;  3I74 A;  2ZED A;  4P4E A;  4NJQ A;  4MHZ A;  4LQG A;  2C6C A;  3DGV A;  4DUK A;  2O4H A;  1XMB A;  4G1P A;  5LRG A;  5D29 A;  4C8A A;  3FF3 A;  3H8E A;  2PE3 A;  4F9V A;  2ZEO A;  2ZEF A;  2V8V A;  4CPA A;  3B3C A;  1CPX A;  1CG2 A;  1M4L A;  1CPS A;  5CPA A;  2EK9 A;  3TX8 A;  4ZY2 A;  3RBU A;  1FNO A;  4TWE A;  4TJX A;  4PXE A;  3LMS A;  4OME A;  4CDK A;  4NGN A;  4NGQ A;  1ELL P;  2NYQ A;  3RZA A;  1VHE A;  3S9N A;  3SJG A;  3SJE A;  3FEE A;  4B6Z A;  2C1C A;  2GU2 A;  4C84 A;  4TNU A;  5K8N A;  4OIW A;  5HVH A;  3HLP A;  2HB6 A;  3IC1 A;  3V7Z A;  2ZEL A;  2ZOG A;  2AFO A;  1QMU A;  3KI9 A;  1WVM A;  5ELY A;  4UIB A;  3D7F A;  4OC2 A;  2JBJ A;  3K9T A;  2PRQ A;  5JH9 A;  4C99 A;  2PVW A;  3D68 A;  4YU9 A;  4O23 A;  5F09 A;  3S9M A;  5LYF A;  1YLO A;  3LWU A;  3FH4 A;  1VGY A;  3PBE A; 
#chains in the Genus database with same CATH topology
 1XOV A;  2WSA A;  5A28 A;  2G3T A;  2ZOF A;  3SHP A;  4E8O A;  4C7I A;  4RR2 B;  5IB0 A;  3R95 A;  4ONU A;  3PP9 A;  2CIJ A;  4EFD A;  1M44 A;  4KLV A;  2Q51 A;  4XPL A;  4JYW A;  2FIW A;  2YNC C;  5LYI A;  1ZG7 A;  4R8F A;  4B5P B;  2VL1 A;  3PFE A;  2FVG A;  4Q38 A;  5JYB A;  2YNC A;  4BMH A;  3B35 A;  3KHX A;  2Q4Y A;  4FUU A;  2RB7 A;  2EUI A;  2I00 A;  3CPX A;  4KOT A;  3RO0 A;  1RTQ A;  2PIZ A;  1H8L A;  2IL4 A;  3DSB A;  2OZU A;  2Y1M A;  2P0W A;  2JDD A;  2VBQ A;  3DR6 A;  4PXB A;  3TYX A;  3B2Y A;  4B14 A;  4CO9 A;  5AGE A;  2PJ8 A;  2ZPA A;  2GFQ A;  3QAH A;  4OC3 A;  3FED A;  2PJ7 A;  3WAB A;  1ZLH A;  2BO9 A;  2AJ6 A;  2PJA A;  4NJR A;  4ONW A;  1EZB A;  1IID A;  5F46 A;  2ZW6 A;  2PJC A;  3GB0 A;  4PK3 A;  3KAS A;  3BJ8 A;  2Z3O A;  5H84 A;  1XIX A;  1LRZ A;  4M8D A;  1EZA A;  1VBG A;  3VRR A;  4IIX A;  3I9S A;  4C9R A;  1IGB A;  2NMT A;  4PPZ A;  4KOV A;  3VAR A;  4CAX A;  2O53 A;  1NSL A;  4NGR A;  1XRY A;  5EBV A;  3EFA A;  2DF5 A;  3SJF A;  1KWM A;  2V8D A;  3FEC A;  1JQG A;  3NOJ A;  1LAN A;  4KOU A;  3S6G A;  4B13 A;  4CRY B;  3B7I A;  4XPD B;  2IQ6 A;  5LRJ A;  4B10 A;  1Z4R A;  2PCU A;  4ZX8 A;  1Z9U A;  3SXN A;  3KKW A;  4R76 A;  4AG9 A;  2VEZ A;  2OOT A;  1AMP A;  4R87 A;  4OC5 A;  2FT0 A;  1NXJ A;  4C8P A;  4F6A A;  2XEF A;  2ATR A;  4DJL A;  2EZC A;  3N5F A;  3CPA A;  4KLW A;  5J1Q A;  3NH5 A;  4GM5 A;  3IO1 A;  3ISZ A;  3BI1 A;  5F48 A;  1OBR A;  4B5P A;  2D0O A;  3T8W A;  3TT2 A;  4C2Z A;  4W9Y A;  3D7H A;  1TKH A;  2DPT A;  3JVN A;  3VWE A;  2PVV A;  4JJX A;  1DTD A;  1B6B A;  2EO8 A;  4YGO A;  2OR4 A;  4UBR A;  3PBB A;  3EZB A;  2B0A A;  1GHE A;  4MXU A;  4A33 A;  3R96 A;  2P6G A;  3CDX A;  4LUA A;  5DWM A;  1TF8 A;  2J8M A;  4KNG E;  4MCR A;  1A9X B;  4JLY A;  4C8T A;  2Q4V A;  3BUO B;  5HVG A;  2PSW A;  5CBM A;  4P4I A;  2ZEN A;  1CS0 B;  2C27 A;  4PXC A;  3ZZI A;  3PRT A;  1VKC A;  2Z3K A;  4F8Z A;  2DIK A;  5KTD A;  3FNC A;  3NH8 A;  1BO4 A;  1CE8 B;  4JXQ A;  1XJO A;  3S6F A;  2PC1 A;  4PSX A;  4MFL A;  3PEI A;  2D4P A;  4UEE A;  1R43 A;  2XEG A;  2V8H A;  3KR5 A;  4NGM A;  4MFZ A;  1XBU A;  4B5O A;  5FD8 A;  1KBL A;  4HNY B;  1XFO A;  1CP6 A;  5THW A;  4H1H A;  1VI4 A;  2ZW7 A;  3PT1 A;  1GYT A;  4Q36 A;  4MFP A;  3FX6 A;  3IWG A;  1MJB A;  3PFO A;  3IIB A;  2I3C A;  2Q0Y A;  1JWQ A;  1FY7 A;  5J8C A;  1VIX A;  5JGF A;  4OC4 A;  4HNX B;  2B5G B;  2B4J C;  4WJB A;  4UCM A;  4CAE A;  4A30 A;  2CXA A;  4FD5 A;  3VRO A;  2GE3 A;  1T36 B;  4MCS A;  5A27 A;  3D3S A;  3V38 A;  4B11 A;  5IX3 A;  2Z3N A;  5JVL A;  2ZEP A;  2AUM A;  5F9M A;  3D7D A;  3IWW A;  4X8I A;  2VI7 A;  2R7H A;  3T9Y A;  2PJB A;  3K9U A;  5EMI A;  1TF9 A;  3HMJ G;  5KTC A;  3PB9 X;  3EY5 A;  2KCW A;  4FD7 A;  2BEI A;  2PJ2 A;  2FL4 A;  4CGP A;  3F0A A;  3LAC A;  4BIN A;  2X7B A;  4Q7A A;  5KTA A;  4A37 A;  2BUE A;  4C9V A;  4AG7 A;  4KOX A;  2EWB A;  4UEF A;  4A39 A;  2HC9 A;  2QVP A;  3L2N A;  1V0C A;  4M85 A;  5G1Z A;  4FD4 A;  5AG6 A;  4DNC A;  4ZX9 A;  3K2K A;  1KUX A;  1MJA A;  1Z8X A;  4PXD A;  1KC7 A;  3RYO A;  3VAT A;  4RUH A;  3ZNI A;  1HDU A;  3MGD A;  1F57 A;  1IOF A;  2QEC A;  3P2H A;  5K8O A;  1PUA A;  1IIC A;  5D8N A;  2D0P A;  1M4G A;  2JEV A;  3NFZ A;  3TO6 A;  4QBJ A;  4H2K A;  4OKO A;  3GLJ A;  3TLZ A;  1Z2L A;  2OU2 A;  1Z9E A;  7CPA A;  2B5G A;  3B8G A;  4ZY0 A;  3BUX B;  5G21 A;  3MN8 A;  2JEW A;  2B4B A;  4HNW B;  4FAI A;  4UF4 A;  3VRQ A;  2AFU A;  1V6C A;  4NFR A;  3BUM B;  1Y9Z A;  3ICU A;  2G0B A;  3VH9 A;  3A9L A;  1Q2D A;  5F13 A;  1ZL0 A;  3G3S A;  1Z8T A;  1XEB A;  2IMO A;  1Y7E A;  3NE7 A;  4U9Y A;  5C82 A;  1IY7 A;  3IU1 A;  2DLA A;  1Y7R A;  4IHM A;  5IV0 A;  5F5X A;  2AE6 A;  2PCN A;  2Q4Z A;  1IB1 E;  2PJ4 A;  2VKZ G;  2G3A A;  4YN3 A;  2PJ3 A;  1Y0R A;  1VHS A;  2HWG A;  4U9Z A;  4P44 A;  2NSM A;  3GYA A;  4KSA A;  2YJT A;  4XNH B;  1YME A;  4YRH A;  2WYR A;  4NCZ A;  3CXP A;  4M3S A;  3SJX A;  3T05 A;  5K8P A;  4MCP A;  3LOD A;  5F49 A;  1VBH A;  3U1B A;  5IR2 A;  3F5B A;  4EYS A;  2CF4 A;  2AFW A;  1F2O A;  1YW4 A;  2QYV A;  4C2X A;  4JWP A;  4KSI A;  1YVH A;  5EC4 A;  4CRZ B;  3VTA A;  4RI1 A;  4PV6 A;  1TKF A;  5AG4 A;  3SI0 A;  4JVO A;  1I1D A;  2BOA A;  1HDQ A;  3FMC A;  3GUX A;  1BPM A;  4KZT A;  4QC6 A;  4UA3 A;  4UCN A;  4CGM A;  4C9U A;  1YGH A;  2AFZ A;  3HPG G;  3EO4 A;  4MBU A;  5HVF A;  4P4F A;  3DNS A;  3BI0 A;  1FT7 A;  5JM6 A;  1S3Z A;  4M6H A;  3G8W A;  2Y1N A;  2H5M A;  4MRI A;  1EO0 A;  2GLF A;  4COB A;  2BCO A;  4A94 A;  3EZE A;  3KGQ A;  3PB7 X;  4E94 A;  3TLB A;  1HEE A;  2GAN A;  3D4U A;  4UEZ A;  2XPN A;  1IU8 A;  2F5I A;  5LYL A;  2P6E A;  4CGL A;  2PDO A;  3VRP A;  4BBH A;  1JDB C;  4KS9 A;  4MCQ A;  1S5K A;  2PJ6 A;  3E0K A;  2N3A B;  3NE8 A;  1YX0 A;  3BXM A;  1LCP A;  2P6F A;  4L8A A;  1ZLI A;  4XNH C;  3WC7 A;  5E96 A;  1UWY A;  2OLS A;  1ARL A;  4EME A;  3SI2 A;  3TO7 A;  4NGT A;  1ZRS A;  3OP0 A;  1YVK A;  2Q43 A;  6CPA A;  1CJW A;  1ZO0 A;  4CDJ A;  1Q2C A;  1TKJ A;  5F1Y A;  4UFX A;  3KR4 A;  1LAM A;  1KZF A;  4OC1 A;  3TLE A;  4H89 A;  2ZEH A;  4CS0 B;  4EWT A;  1I12 A;  1N71 A;  3ISX A;  2AFM A;  2VZY A;  4KOS A;  2ZEM A;  2QJ8 A;  3WC5 A;  4C8F A;  3DLJ A;  4HPS A;  2R1I A;  4P6Y A;  4HKF A;  3D7G A;  3JTK A;  4NGS A;  1XF8 A;  4R9M A;  1QSO A;  1RXT A;  2BL1 A;  2JLM A;  3BHX A;  1M6V B;  3TO9 A;  3I3G A;  4E0A A;  1F2P A;  4F0X A;  4COG A;  4X2T A;  3P2F A;  4XPD C;  4CYQ A;  3FB3 A;  3QNV A;  3VGO A;  3IFE A;  4R6T A;  1C3O B;  4RS2 A;  3TC8 A;  4PQA A;  1ZG9 A;  3TLA A;  2GLJ A;  3GIU A;  3KL9 A;  3PB8 X;  2EK8 A;  4C7H A;  5BY0 A;  2UV8 G;  4MFQ A;  1M4D A;  4DYO A;  2B4D B;  2PJ1 A;  3F8K A;  3EC4 A;  3F9K C;  3TLG B;  5IB9 A;  4K3N A;  2ZW4 A;  5AXI A;  3IEH A;  4CZ1 A;  2IJZ A;  1S7K A;  2K5T A;  2F7V A;  2WUU A;  4FBE A;  3O8Z A;  4NGP A;  3PB4 X;  4KUB A;  3PLF B;  2PR1 A;  2PR8 A;  4QUS A;  5F47 A;  1S60 A;  4P45 A;  4ZI6 A;  5K8M A;  1VHO A;  4BD9 A;  2AFS A;  4MJ8 A;  3EZA A;  4JD6 A;  1Z8L A;  1BPN A;  5K99 A;  4BPU B;  4OID A;  2J9A A;  3FJU A;  4UFV A;  4PK2 A;  2F8H A;  2PRB A;  3LD2 A;  4ZY1 A;  2AUN A;  1XF1 A;  2R82 A;  3KQZ A;  3I6S A;  2QIR A;  3D8P A;  3T5M A;  3R9F A;  3D66 A;  4TJV A;  1U6M A;  1Y0Y A;  1TIQ A;  3V8I A;  2J8R A;  3TCV A;  3D67 A;  4FWU A;  4MFK A;  4MHY A;  5GCN A;  2PJ5 A;  1NSA A;  3TOA A;  1J3L A;  3JRU A;  8CPA A;  2REE A;  3KQX A;  4CAF A;  4Z65 A;  2V77 A;  1YSJ A;  3DDD A;  4P10 A;  1M4I A;  1Q2Y A;  4KOR A;  5I4M A;  1Y9W A;  1BOB A;  2CNM A;  3PB6 X;  5HH1 A;  3IWE A;  4R3L A;  4AXV A;  2Q44 A;  4C86 A;  3GY9 A;  3IU2 A;  3OAK A;  1LOK A;  2B4D A;  5H86 A;  3R9G A;  1YVO A;  2GIV A;  4CYN A;  1AUG A;  3TLG A;  4A95 A;  2HI6 A;  4CYP A;  4CAW A;  2RFH A;  2PIY A;  1X10 A;  5DS0 A;  4P4D A;  1ELM P;  4IIY A;  5G20 A;  1CP7 A;  2YGW A;  4R7M A;  4C85 A;  1XE4 A;  5HKW A;  4YWY A;  4IK2 A;  3W6X A;  3S9L A;  1EE3 P;  1NE9 A;  3KHZ A;  3EIF A;  1NMT A;  4AVC A;  4MHP A;  2Z10 A;  2Q7S A;  3T0T A;  1KUY A;  1YW6 A;  1A2Z A;  5HXD A;  2POK A;  4I49 A;  2ZEE A;  2EBJ A;  4IAV A;  4BTF A;  4KSF A;  2WZN A;  4QVT A;  5LYD A;  4X3R A;  2ABZ A;  3SR3 A;  1ZG8 A;  2B58 A;  2R98 A;  5DWN A;  4IF5 A;  1LAP A;  4MJX A;  1K4J A;  1QST A;  1SQH A;  4XPK A;  2C6G A;  3W91 A;  4INJ A;  2XEJ A;  2WPX A;  1PCA A;  1R3N A;  1P0H A;  4CYO A;  4YFJ A;  1X12 A;  1Q7L A;  3VWD A;  4OAD A;  1DIK A;  4C8U A;  1QSR A;  4KOW A;  3WC6 A;  1B47 A;  1BLL E;  2XPO A;  3FVL A;  4QB9 A;  1WWZ A;  3D2M A;  4A32 A;  4JZ0 A;  3PGP A;  4WWV A;  3BUN B;  1XMT A;  4E5S A;  2CTC A;  2C6P A;  1FBV A;  4OP4 A;  2PQ8 A;  2YJV A;  1CBX A;  2FIA A;  2BSW A;  3I1U A;  3FBU A;  2EVN A;  2CY2 A;  2JBK A;  1ARM A;  3R1K A;  3H8G A;  2REF A;  1M1D A;  4UFW A;  3H4Q A;  3HUV A;  1DE4 C;  5HKZ A;  2O28 A;  4AB7 A;  4ZYQ A;  3B3W A;  4MY3 A;  1CX8 A;  1I21 A;  2FSR A;  3R9E A;  4MI4 A;  2FM4 A;  1BAV A;  1MJ9 A;  2OH1 A;  5FVJ A;  3H8F A;  1LFW A;  3NA6 A;  4NXY A;  5LRK A;  4J0N A;  3KRV A;  3HPH E;  1B87 A;  4OAE A;  3B3S A;  2HQY A;  2PJ9 A;  3FRM A;  2XPL A;  4LQ6 A;  3RAM A;  4CAV A;  1R61 A;  1AYE A;  2PJ0 A;  4NEX A;  5JPH A;  2ANP A;  3C8O A;  2EZB A;  2CTB A;  4F0Y A;  2XEI A;  2Z11 A;  4NF1 A;  3KZW A;  2VZZ A;  1TXR A;  3IJ3 A;  4MHN A;  2DXQ A;  2V8G A;  4ORF A;  3CT9 A;  3RNZ A;  3NH4 A;  2DEA A;  2ZXV A;  4A38 A;  1QSN A;  4P4J A;  3U88 C;  3B3V A;  2HUZ A;  4UCP A;  4P4B A;  4EVY A;  3SI1 A;  3WT4 A;  2DPS A;  4X5K A;  4BPW B;  4F9U A;  4OC0 A;  1KUV A;  2AFX A;  4Y49 B;  2GP4 A;  1QQ9 A;  2Z3M A;  3B3T A;  3MRU A;  3C26 A;  4MMO A;  5CNP A;  4A2Z A;  2ZEG A;  2HV2 A;  3ZJ0 A;  3QAY A;  2G9D A;  4JXR A;  2GRE A;  1QSM A;  2OB0 A;  2CNS A;  4KVO E;  1Z5R A;  2Y0M A;  4C9E A;  4UIA A;  1JDE A;  4NSQ A;  1WK4 A;  2X0S A;  3TLC A;  1PYT B;  4C9A A;  1L0C A;  5G22 A;  2E28 A;  1PU9 A;  3I74 A;  1OZP A;  2XPP A;  4H6Z A;  2ZED A;  4P4E A;  4NJQ A;  1IYK A;  4A4C A;  2Z3L A;  3CXQ A;  4GS4 A;  4MHZ A;  4LQG A;  2C6C A;  5I0C A;  4M6I A;  4A4B A;  3DGV A;  2FS5 A;  2CBL A;  4DUK A;  2B3V A;  3CZX A;  3SXO A;  2I79 A;  1IYL A;  2O4H A;  3T07 A;  5HMN A;  1XMB A;  3NFQ A;  1YR0 A;  4G1P A;  3W6S A;  5LRG A;  1J4J A;  3IGR A;  5D29 A;  5J3X A;  3FYN A;  4ZGY B;  4GPL B;  1GGO A;  4C8A A;  3FF3 A;  3GKR A;  1P4N A;  3T90 A;  3H8E A;  2PE3 A;  4F9V A;  3QB8 A;  4MY0 A;  4A31 A;  2C5Q A;  2ZEO A;  4Y49 C;  2Z0Z A;  2A4N A;  3TTH A;  2ODF A;  3OB1 B;  2ZEF A;  4C8C A;  2V8V A;  1C30 B;  3H5Z A;  3PZJ A;  2RC4 A;  4CPA A;  3B3C A;  1CPX A;  1CG2 A;  2FE7 A;  1ZYM A;  3CXS A;  4R57 A;  1M4L A;  4B12 A;  3G23 A;  4KVM E;  4II9 A;  5JQ4 A;  1CPS A;  5CPA A;  1MK4 A;  2EK9 A;  4M6G A;  3TX8 A;  4ZY2 A;  4E2A A;  3TE4 A;  3K4I A;  4H6U A;  3RBU A;  1FNO A;  2JDC A;  4PSW A;  4TWE A;  4TJX A;  4PXE A;  1YQE A;  3DR8 A;  1WJT A;  3LMS A;  2Q04 A;  4OME A;  3FXT A;  4GXH A;  4U5Y A;  1Z8W A;  4CGN A;  4MI1 A;  4ZBG A;  4KOY A;  3WR7 A;  1YK3 A;  4NGN A;  4NGQ A;  1ELL P;  2B3U A;  4R3K A;  3S6H A;  2OZG A;  3GJZ A;  5BWA B;  4L89 A;  2NYQ A;  5C88 A;  4CDK A;  3RZA A;  2MP0 A;  1S7F A;  1VHE A;  4UWJ A;  3OB2 B;  3BUW B;  2YNE A;  3S9N A;  3EXN A;  1CM0 A;  3SJG A;  2J8N A;  4LX9 A;  3SJE A;  3FEE A;  4FD6 A;  4B6Z A;  2FCK A;  2YND A;  2Z3P A;  3BJ7 A;  1RO5 A;  3N7Z A;  2C1C A;  2GU2 A;  2D4O A;  1KEE B;  4C84 A;  4KUA A;  2R8V A;  4TNU A;  1R57 A;  5K8N A;  3OWC A;  4OIW A;  1S7N A;  5HVH A;  4AVB A;  2QML A;  3HLP A;  4KVX A;  2HB6 A;  3IC1 A;  2VXK A;  3V7Z A;  2ZEL A;  2ZOG A;  2AFO A;  1Z4E A;  3BLN A;  1QMU A;  3PFV A;  1YLE A;  4C2Y A;  3KI9 A;  1BXR B;  1Y9K A;  1WVM A;  3TLY A;  5ELY A;  4MHD A;  2VQY A;  4K30 A;  4UIB A;  3D7F A;  5ISV A;  4OC2 A;  1S7L A;  3UY5 A;  3JUW A;  2JBJ A;  2ZW5 A;  1Q5X A;  3K9T A;  4BPX B;  4MFJ A;  3TOB A;  2PRQ A;  3VRN A;  1UFH A;  1YRE A;  2Q7B A;  5HKY A;  3FIX A;  5JH9 A;  3TFY A;  4C99 A;  2PVW A;  3D68 A;  4YU9 A;  2OZH A;  3D2P A;  1IOI A;  4C68 A;  2HRO A;  4O23 A;  3S6K A;  5F09 A;  4CGO A;  2FXF A;  4UWI A;  2CNT A;  2WPW A;  4OLL A;  4IUS A;  4J3G A;  4RN7 A;  1ON0 A;  5J8F A;  3S9M A;  5LYF A;  2EZA A;  5AG7 A;  1YLO A;  3LWU A;  4AVA A;  3FH4 A;  2ARH A;  5AG5 A;  1VGY A;  3PBE A;  1NBW A; 
#chains in the Genus database with same CATH homology
 2ZOF A;  2CIJ A;  4EFD A;  2Q51 A;  4JYW A;  5LYI A;  1ZG7 A;  4R8F A;  2VL1 A;  3PFE A;  2FVG A;  3B35 A;  3KHX A;  4FUU A;  2RB7 A;  3CPX A;  1RTQ A;  2PIZ A;  1H8L A;  4C85 A;  4PXB A;  3B2Y A;  2PJ8 A;  4OC3 A;  3FED A;  2PJ7 A;  3WAB A;  1ZLH A;  2BO9 A;  4ONW A;  2PJA A;  4NJR A;  3GB0 A;  2PJC A;  3KAS A;  4C9R A;  1IGB A;  4PPZ A;  3VAR A;  2O53 A;  4NGR A;  1XRY A;  3SJF A;  1KWM A;  2V8D A;  3FEC A;  1JQG A;  1LAN A;  3B7I A;  5LRJ A;  2IQ6 A;  2PCU A;  4ZX8 A;  4R76 A;  2OOT A;  1AMP A;  4OC5 A;  4C8P A;  2XEF A;  4DJL A;  3N5F A;  3CPA A;  5J1Q A;  3NH5 A;  4GM5 A;  3IO1 A;  3ISZ A;  3BI1 A;  1OBR A;  3T8W A;  4W9Y A;  3D7H A;  1TKH A;  4C8C A;  2PVV A;  1DTD A;  2OR4 A;  3PBB A;  4MXU A;  3CDX A;  1TF8 A;  4KNG E;  4MCR A;  4C8T A;  5HVG A;  5CBM A;  4P4I A;  2ZEN A;  4PXC A;  3PRT A;  4F8Z A;  3NH8 A;  1XJO A;  3PEI A;  4UEE A;  1R43 A;  2XEG A;  2V8H A;  3KR5 A;  4NGM A;  1XBU A;  1XFO A;  1CP6 A;  5THW A;  1GYT A;  3FX6 A;  3PFO A;  3IIB A;  2I3C A;  1VIX A;  5JGF A;  4OC4 A;  4WJB A;  4MCS A;  3V38 A;  2ZEP A;  3D7D A;  3IWW A;  4X8I A;  2PJB A;  1TF9 A;  3PB9 X;  2PJ2 A;  4Q7A A;  4A37 A;  4C9V A;  2EWB A;  4UEF A;  4A39 A;  2HC9 A;  2QVP A;  3L2N A;  4ZX9 A;  3K2K A;  4PXD A;  3VAT A;  4RUH A;  1HDU A;  1F57 A;  5K8O A;  5D8N A;  3NFZ A;  4H2K A;  4OKO A;  3GLJ A;  1Z2L A;  7CPA A;  4ZY0 A;  3MN8 A;  2JEW A;  4FAI A;  4UF4 A;  2AFU A;  1V6C A;  4NFR A;  1Y9Z A;  3ICU A;  3VH9 A;  2IMO A;  1Y7E A;  1IY7 A;  4IHM A;  2Q4Z A;  2PJ4 A;  4YN3 A;  2PJ3 A;  1Y0R A;  4P44 A;  2NSM A;  1YME A;  2WYR A;  3SJX A;  5K8P A;  4MCP A;  5IR2 A;  2CF4 A;  2AFW A;  1F2O A;  1YW4 A;  2QYV A;  4KSI A;  1TKF A;  3SI0 A;  2BOA A;  3FMC A;  1HDQ A;  3GUX A;  1BPM A;  4C9U A;  2AFZ A;  5HVF A;  4P4F A;  3BI0 A;  1FT7 A;  5JM6 A;  4MRI A;  2GLF A;  2BCO A;  4A94 A;  3KGQ A;  3PB7 X;  1HEE A;  3D4U A;  4UEZ A;  5LYL A;  4MCQ A;  2PJ6 A;  3BXM A;  1LCP A;  3WC7 A;  1ZLI A;  1UWY A;  1ARL A;  4EME A;  3SI2 A;  4NGT A;  2Q43 A;  6CPA A;  4CDJ A;  1TKJ A;  3KR4 A;  1LAM A;  4OC1 A;  2ZEH A;  4EWT A;  3ISX A;  2AFM A;  2ZEM A;  2QJ8 A;  3WC5 A;  4C8F A;  3DLJ A;  4P6Y A;  3D7G A;  4NGS A;  3BHX A;  1F2P A;  4X2T A;  4R6T A;  3QNV A;  3IFE A;  3TC8 A;  4PQA A;  1ZG9 A;  2GLJ A;  3KL9 A;  3PB8 X;  2EK8 A;  4DYO A;  2PJ1 A;  5IB9 A;  4K3N A;  3IEH A;  2IJZ A;  2F7V A;  4FBE A;  4NGP A;  3PB4 X;  4P45 A;  4ZI6 A;  5K8M A;  1VHO A;  4BD9 A;  2AFS A;  1Z8L A;  1BPN A;  4OID A;  2J9A A;  3FJU A;  2F8H A;  4ZY1 A;  3I6S A;  1XF1 A;  3KQZ A;  3D66 A;  4TJV A;  1Y0Y A;  3D67 A;  4FWU A;  4MHY A;  2PJ5 A;  1NSA A;  3JRU A;  8CPA A;  3KQX A;  4Z65 A;  2V77 A;  1YSJ A;  4P10 A;  5I4M A;  3PB6 X;  4AXV A;  4C86 A;  1LOK A;  2RFH A;  2PIY A;  5DS0 A;  4P4D A;  1ELM P;  1CP7 A;  4R7M A;  4YWY A;  4IK2 A;  3S9L A;  1EE3 P;  3KHZ A;  3EIF A;  4MHP A;  1YW6 A;  5HXD A;  2POK A;  2ZEE A;  4IAV A;  5LYD A;  2WZN A;  4X3R A;  2ABZ A;  1ZG8 A;  3VTA A;  1LAP A;  2C6G A;  2XEJ A;  1PCA A;  1R3N A;  1Q7L A;  4C8U A;  3WC6 A;  1BLL E;  3FVL A;  4JZ0 A;  4WWV A;  2CTC A;  2C6P A;  4OP4 A;  1CBX A;  3I1U A;  2JBK A;  1ARM A;  3H8G A;  3HUV A;  1DE4 C;  4ZYQ A;  3B3W A;  1CX8 A;  1BAV A;  3H8F A;  1LFW A;  3NA6 A;  5LRK A;  3B3S A;  2PJ9 A;  3RAM A;  1AYE A;  2PJ0 A;  2ANP A;  2CTB A;  2XEI A;  4C9A A;  3KZW A;  1TXR A;  3IJ3 A;  4MHN A;  2V8G A;  4A38 A;  3CT9 A;  3NH4 A;  2DEA A;  4P4J A;  3B3V A;  4P4B A;  3SI1 A;  3WT4 A;  4F9U A;  4OC0 A;  2AFX A;  2GP4 A;  1QQ9 A;  3B3T A;  3MRU A;  4MMO A;  2ZEG A;  2G9D A;  2GRE A;  1Z5R A;  4C9E A;  4UIA A;  1PYT B;  3I74 A;  2ZED A;  4P4E A;  4NJQ A;  4MHZ A;  4LQG A;  2C6C A;  3DGV A;  4DUK A;  2O4H A;  1XMB A;  4G1P A;  5LRG A;  5D29 A;  4C8A A;  3FF3 A;  3H8E A;  2PE3 A;  4F9V A;  2C5Q A;  2ZEO A;  2ZEF A;  2V8V A;  4CPA A;  3B3C A;  1CPX A;  1CG2 A;  1M4L A;  1CPS A;  5CPA A;  2EK9 A;  3TX8 A;  4ZY2 A;  3RBU A;  1FNO A;  4TWE A;  4TJX A;  4PXE A;  3LMS A;  4OME A;  4CDK A;  4NGN A;  4NGQ A;  1ELL P;  2NYQ A;  3RZA A;  1VHE A;  3S9N A;  3SJG A;  3SJE A;  3FEE A;  4B6Z A;  2C1C A;  2GU2 A;  4C84 A;  4TNU A;  5K8N A;  4OIW A;  5HVH A;  3HLP A;  2HB6 A;  3IC1 A;  3V7Z A;  2ZEL A;  2ZOG A;  2AFO A;  1QMU A;  3KI9 A;  1WVM A;  5ELY A;  4UIB A;  3D7F A;  4OC2 A;  2JBJ A;  3K9T A;  2PRQ A;  5JH9 A;  4C99 A;  2PVW A;  3D68 A;  4YU9 A;  4O23 A;  5F09 A;  3S9M A;  5LYF A;  1YLO A;  3LWU A;  3FH4 A;  1VGY A;  3PBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...