3IWWA

Crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dbibzl, a urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bioisosterism of urea-based GCPII inhibitors: Synthesis and structure-activity relationship studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3iwwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iwwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3iwwA02
2AFXA 2JBKA 4MHYA 2ZEPA 1LAPA 3RAMA 2ZEEA 2PCUA 4JZ0A 4B6ZA 2ANPA 4NFRA 1YMEA 3PB4X 2EWBA 3K9TA 4A38A 4R76A 2ZEHA 1KWMA 2AFMA 4NGMA 2RB7A 4IHMA 1Z5RA 4F8ZA 5DS0A 1CPXA 1HEEA 1ARMA 1TF8A 3KGQA 7CPAA 3S9LA 1AYEA 4DJLA 2F7VA 4AXVA 1FT7A 4C8TA 4C8CA 4ZY1A 4KNGE 2PJAA 3FX6A 4C9RA 3KQXA 1ZLIA 1LCPA 3FJUA 3PBEA 1YSJA 3IJ3A 4P4FA 2PE3A 1ELMP 2PVVA 4OC3A 1CPSA 3IO1A 3PFOA 2WZNA 4LQGA 3SJGA 5LRJA 2CIJA 2V8HA 2C6GA 2C1CA 4ZY2A 4OMEA 2PJ5A 4UEZA 3IIBA 4MCRA 2PJ7A 1Y0RA 2ZOGA 5JGFA 1NSAA 3DLJA 2PJ2A 3WT4A 5I4MA 2GREA 5LYLA 3FVLA 3ISXA 5JM6A 4NGQA 4UEEA 2C6CA 2PRQA 4FAIA 4UIBA 4K3NA 2HC9A 4F9VA 3LMSA 1VGYA 3VH9A 2JBJA 1ARLA 4JYWA 4NGRA 1ZG7A 2POKA 2I3CA 3V38A 1VHEA 5IB9A 4IK2A 3H8FA 3D7DA 1BPNA 3MN8A 3FECA 2ZEOA 3SI1A 3HLPA 2BCOA 2NYQA 1XRYA 3WABA 3KZWA 2O4HA 3SI2A 1CP7A 1M4LA 2ZEDA 1R43A 1LANA 3CT9A 3BHXA 1FNOA 4NGSA 8CPAA 5D29A 4MHNA 2O53A 2PJ3A 4MHZA 2V8GA 2G9DA 4C9EA 2EK8A 3B3VA 4MCSA 1EE3P 4A94A 4FBEA 4X3RA 5HVFA 3I74A 1BAVA 3FMCA 1HDQA 2FVGA 2IMOA 2HB6A 4ZYQA 4MXUA 3KHZA 2OR4A 3WC6A 3PFEA 4PXBA 1YW4A 5D8NA 3B7IA 4DUKA 2DEAA 3TX8A 3SJFA 2ZEFA 3KR4A 5CBMA 3RZAA 4ONWA 4IAVA 1CX8A 4WJBA 3K2KA 2GLJA 3NH5A 2AFUA 2F8HA 1ZG8A 3VTAA 4C8AA 1CP6A 1ELLP 4NGPA 1DTDA 2GU2A 3NA6A 3FEEA 4MMOA 4C9AA 4OIWA 3JRUA 4ZY0A 1Q7LA 1WVMA 2PJ6A 4OIDA 1XFOA 3S9MA 2XEJA 4C8UA 4F9UA 5JH9A 3CPAA 4PQAA 4ZI6A 4C8PA 2PJBA 4G1PA 5LRKA 5K8OA 1Z8LA 4CDJA 5LYDA 2C6PA 1BPMA 4P44A 2NSMA 4P4IA 3D7FA 4C84A 1Y7EA 3KASA 2PJ0A 2Q43A 3LWUA 1VIXA 3NH4A 4X2TA 6CPAA 4UIAA 3SJEA 2QJ8A 4C86A 3L2NA 2ABZA 2BOAA 1LAMA 3B3TA 4OC4A 3FF3A 5CPAA 4R8FA 3SJXA 1GYTA 1TXRA 1HDUA 3KQZA 4WWVA 4YN3A 4MCPA 3GLJA 3QNVA 3HUVA 3WC5A 5HVHA 3D67A 4P45A 2AFZA 3D4UA 4EWTA 3IEHA 2ZEGA 3BXMA 4PXEA 4OC0A 4TNUA 1F2PA 3B2YA 5J1QA 3KL9A 3ISZA 1F57A 4A37A 1XJOA 1PCAA 4OC5A 4P4BA 2IJZA 1YLOA 4ZX8A 3V7ZA 1QQ9A 1XMBA 4PXCA 4FUUA 5ELYA 2CTCA 4EMEA 2RFHA 1F2OA 4C99A 2QYVA 3PB9X 4C9VA 4P4DA 4OKOA 2CTBA 5K8PA 3D68A 2AFWA 2CF4A 4TJXA 4MCQA 5LYIA 4NJRA 3NFZA 4MHPA 1OBRA 3EIFA 1ZG9A 2V77A 5HXDA 3D7HA 3WC7A 1LFWA 4YU9A 4Z65A 1YW6A 1ZLHA 4Q7AA 4P4JA 1AMPA 3IC1A 4C8FA 1XBUA 4C9UA 1Y9ZA 1VHOA 2V8VA 4FWUA 4P4EA 1V6CA 3TC8A 2GLFA 3FEDA 3PB8X 4PXDA 4UEFA 3I1UA 3IFEA 5HVGA 1H8LA 4RUHA 3CPXA 5K8NA 1TKJA 2PIYA 4OC2A 3GB0A 2WYRA 4X8IA 2AFSA 2IQ6A 2XEIA 3RBUA 3KR5A 5LRGA 3BI1A 4MRIA 4A39A 2QVPA 3N5FA 4CPAA 2OOTA 3H8GA 2Q51A 1IY7A 3PEIA 3BI0A 3IWWA 1UWYA 3H8EA 1TF9A 3DGVA 3D7GA 2JEWA 2PIZA 4OC1A 4GM5A 1PYTB 4UF4A 2ZEMA 1TKFA 3PRTA 1CBXA 3SI0A 3PB7X 5F09A 4TJVA 1RTQA 4PPZA 4OP4A 2PJ1A 3B3WA 1Z2LA 3PBBA 1CG2A 4O23A 2ZOFA 1IGBA 4NGNA 3FH4A 2PVWA 1DE4C 3VARA 4ZX9A 1JQGA 4H2KA 2Q4ZA 4R7MA 3NH8A 2XEGA 4TWEA 1QMUA 2PJ8A 3S9NA 2PJ4A 3ICUA 4NJQA 5K8MA 2VL1A 4YWYA 3B3CA 3PB6X 2BO9A 1TKHA 2EK9A 4W9YA 4CDKA 4P10A 3VATA 3D66A 1LOKA 4P6YA 2XEFA 4EFDA 4NGTA 1Y0YA 3MRUA 5THWA 3B3SA 3B35A 3KHXA 1XF1A 4C85A 2PJCA 4DYOA 1BLLE 2ZENA 4KSIA 3GUXA 4R6TA 5LYFA 4BD9A 2V8DA 3T8WA 2J9AA 3I6SA 1R3NA 2PJ9A 3CDXA 2AFOA 3KI9A 2ZELA
chains in the Genus database with same CATH superfamily
1A2ZA 2G3TA 2AFXA 4R57A 1YVHA 2JBKA 1YGHA 4MHYA 4Q38A 2ZEPA 1LAPA 2P6FA 5CNPA 3RAMA 3EZAA 2ZEEA 2PCUA 1S3ZA 4JZ0A 3H4QA 4B6ZA 2OZHA 4BTFA 2ANPA 3F0AA 2R7HA 4NFRA 4QC6A 4A32A 3GJZA 3TLCA 1YMEA 3PB4X 4X5KA 1B87A 2EWBA 3RNZA 3K9TA 4CAWA 4A38A 1T36B 2B0AA 4XNHC 4R76A 2ZEHA 4CYQA 1KWMA 3D2MA 2AFMA 4NGMA 2ZXVA 1P4NA 2B5GB 1M1DA 3DR6A 5I0CA 2YNEA 4XPLA 2RB7A 4IHMA 1Z5RA 2B4DB 1I21A 3EO4A 4RN7A 2Q04A 4F8ZA 3TLZA 2EBJA 1M4IA 2I79A 5DS0A 4I49A 4L8AA 3OAKA 2WPXA 3IU2A 3H5ZA 2Z10A 1CPXA 1HEEA 2CNTA 4UCPA 3P2FA 2KCWA 1ARMA 1TF8A 2GFQA 3IWEA 3NE7A 2D0PA 3KGQA 1MJAA 1NE9A 5J3XA 4JJXA 3S9LA 1AYEA 4UA3A 4DJLA 4BPWB 2REEA 1VBGA 1IOFA 5C88A 4H1HA 4YFJA 3IU1A 4QVTA 2JDCA 2QIRA 3PLFB 2F7VA 4AXVA 2O28A 1FT7A 4CRZB 4C8CA 4C8TA 4ZY1A 4B11A 2PJAA 3FX6A 1NXJA 4KNGE 4C9RA 4C2YA 2PR1A 3KQXA 4MFLA 1ZLIA 5F47A 1LCPA 3FJUA 3QB8A 1BOBA 2CNSA 1YSJA 3PBEA 3S6GA 1S5KA 3VWDA 5KTAA 3HPHE 1Y9KA 2FIWA 3IJ3A 4P4FA 4MY3A 2WUUA 4CO9A 2PE3A 3BJ8A 3VRNA 3WR7A 4R9MA 1ELMP 2YJTA 1WWZA 4UWJA 2PQ8A 2PVVA 4OC3A 3LODA 3D8PA 2VBQA 3D3SA 1CPSA 2X0SA 2B58A 3IO1A 3IWGA 3PFOA 2WZNA 4LQGA 3SJGA 1IICA 2CIJA 2V8HA 5LRJA 2C6GA 1NMTA 2C1CA 2P0WA 4NCZA 2B3UA 3LD2A 1Z8TA 4ZY2A 3TTHA 1ZO0A 4YGOA 3W91A 1KC7A 4OMEA 4PSWA 2PJ5A 4UEZA 3IIBA 2AJ6A 4CAEA 4MCRA 1IOIA 1CM0A 2GANA 1QSMA 1Y0RA 2PJ7A 2YNCA 2Z3MA 2ZOGA 4YRHA 4AB7A 5JGFA 1N71A 4JXRA 2FXFA 3FBUA 4MFQA 1YK3A 2YNDA 1NSAA 3DLJA 2PJ2A 3WT4A 3EZBA 5I4MA 1BO4A 1YX0A 2GREA 1L0CA 4INJA 4AVBA 5LYLA 3FVLA 4C7IA 3ISXA 5JM6A 4A4BA 4JD6A 4M6GA 4ZBGA 3HPGG 4CGPA 4JWPA 4NGQA 4OAEA 3VGOA 2VZYA 4UEEA 5IX3A 2AUMA 2C6CA 2PRQA 2UV8G 5F49A 4FAIA 4U9YA 4UIBA 3O8ZA 4K3NA 1FY7A 5EC4A 2HC9A 2I00A 4F9VA 4UFWA 2BL1A 1VGYA 3LMSA 3VH9A 5F46A 1YVKA 2JBJA 1IYLA 3KRVA 1ARLA 4JYWA 4NGRA 2ZW5A 3EZEA 4BMHA 5JPHA 4IIYA 1ZG7A 2RC4A 2P6GA 2POKA 4ZGYB 4E5SA 2I3CA 3V38A 4M85A 1VHEA 5IB9A 4JLYA 4IK2A 1RXTA 3H8FA 4RI1A 3BJ7A 2Z0ZA 4PSXA 1EZAA 3D7DA 3W6SA 3ZZIA 1BPNA 4FD7A 3FECA 3MN8A 2ZEOA 3BUOB 3HLPA 2BCOA 4MFJA 2OZGA 1YVOA 2NYQA 1NSLA 3SI1A 1NBWA 1XRYA 3WABA 3KZWA 4M8DA 2O4HA 3OB2B 2B3VA 2CXAA 3SI2A 4MJXA 1CP7A 4CAVA 5EBVA 1M4LA 2ZEDA 2VZZA 1R43A 2XPNA 1LANA 2D4OA 3KKWA 4A30A 3CT9A 3BHXA 1FNOA 1ZRSA 4NGSA 8CPAA 5D29A 5GCNA 4MHNA 4CZ1A 3T0TA 2DXQA 4IIXA 3TLYA 4CRYB 2O53A 5JYBA 2PJ3A 1WJTA 2V8GA 2G9DA 1VHSA 2OH1A 4MHZA 3VRQA 1MJ9A 2ARHA 3TO9A 1YQEA 2EK8A 2BSWA 3B3VA 4R87A 3BUWB 2R1IA 4CGOA 4MCSA 1EE3P 2HV2A 3CXSA 4QB9A 4A94A 4MI1A 4FBEA 4KVME 4RR2B 4MBUA 3U88C 2FS5A 5F13A 3E0KA 4LX9A 1IYKA 4X3RA 3JVNA 1I1DA 5HVFA 3I74A 3ZNIA 1BAVA 4E2AA 4MY0A 4KOSA 2MP0A 3FMCA 3DR8A 1HDQA 2FVGA 3R9FA 2IMOA 2HB6A 4J0NA 2OZUA 3T05A 1QSTA 4CYNA 3JTKA 1PU9A 4MXUA 4ZYQA 4IUSA 5C82A 1BXRB 2OU2A 5IR2A 3KHZA 3S6HA 1U6MA 4Q36A 1IB1E 2OR4A 3R95A 3WC6A 4B14A 2R82A 1R57A 3TO6A 3PFEA 4PXBA 1YW4A 4MFZA 3VRRA 2BEIA 1Z9UA 1B6BA 1X10A 3TO7A 3G23A 5HKZA 5D8NA 3PGPA 3B7IA 1XIXA 4M3SA 4DUKA 2DEAA 3TOBA 4CAXA 3QAYA 3TX8A 3SJFA 2ZEFA 1C3OB 1S7KA 3KR4A 5CBMA 3RZAA 2H5MA 3FXTA 4ONWA 4IAVA 1CX8A 4KOXA 3K2KA 4WJBA 2EZBA 4XPKA 2HWGA 2FIAA 3BUXB 4GPLB 4UFXA 1YREA 3QAHA 2GLJA 4KSFA 2YJVA 1P0HA 4JVOA 4MJ8A 3NH5A 3NOJA 2AFUA 2F8HA 4E94A 1ZG8A 2DPSA 4MFPA 4KLVA 3VTAA 4C8AA 3RYOA 1CP6A 4OLLA 2AE6A 3T07A 4DNCA 4COGA 1IU8A 1ELLP 3FNCA 4NGPA 1DTDA 2GU2A 1KZFA 1UFHA 3NA6A 3FEEA 4AG7A 4AVAA 4MMOA 4II9A 3FRMA 4C9AA 4OIWA 3JRUA 4KUBA 4PK3A 4ZY0A 1Q7LA 5G1ZA 1WVMA 1CE8B 2K5TA 3C8OA 2PJ6A 4OIDA 3DSBA 1XFOA 3S9MA 5IB0A 2XPLA 4QUSA 3TT2A 2XEJA 4C8UA 4F9UA 1EZBA 2DLAA 5JH9A 2D4PA 2G0BA 3CPAA 4PQAA 4ZI6A 3T5MA 3TYXA 4E0AA 3PT1A 4C8PA 2PJBA 3EFAA 4G1PA 2JLMA 5LRKA 4E8OA 1Z8LA 5K8OA 1JDEA 4CDJA 1Q5XA 2X7BA 2HROA 1EO0A 5LYDA 4A31A 2JEVA 2C6PA 3VWEA 1BPMA 2Z3LA 4P44A 1B47A 1XMTA 2NSMA 4MI4A 4B12A 4C68A 3S6KA 5JVLA 4P4IA 5AXIA 2EVNA 2FCKA 4C7HA 5DWMA 1Z9EA 3D7FA 1Y7EA 3KASA 2PJ0A 2Q43A 2Q7SA 1VIXA 3DNSA 3JUWA 3LWUA 3NH4A 4X2TA 6CPAA 1WK4A 4UIAA 3SJEA 2CY2A 2QJ8A 5FD8A 1ZL0A 4C86A 3L2NA 4M6IA 2ABZA 4A4CA 1LAMA 2BOAA 3B3TA 1I12A 1SQHA 4BPXB 2GE3A 4LQ6A 5EMIA 2PCNA 4OC4A 4GS4A 3FF3A 5CPAA 4R8FA 3SJXA 1GYTA 1TXRA 4C2ZA 4KOYA 2AUNA 1KBLA 1HDUA 3G8WA 1S7NA 3KQZA 1RO5A 3A9LA 4J3GA 2DF5A 4UBRA 4WWVA 4YN3A 2Q4VA 4MCPA 2XPPA 1YR0A 3GLJA 5FVJA 3SHPA 3W6XA 3QNVA 3C26A 3HUVA 3WC5A 3T9YA 2YNCC 5A28A 5HVHA 2DPTA 2GP4A 2Y0MA 3D67A 3OB1B 4P45A 2AFZA 3D4UA 3R1KA 4FD5A 4AG9A 4EWTA 4UWIA 3IEHA 2ZEGA 3BXMA 4OADA 1KUXA 4LUAA 4PXEA 1Q2CA 2J8MA 5AG7A 3GKRA 4OC0A 1ON0A 5IV0A 1M44A 4TNUA 1F2PA 3B2YA 5J1QA 3KL9A 2E28A 3TLAA 3ISZA 4B10A 4PV6A 3G3SA 3R9GA 1F57A 5BWAB 4A37A 4ORFA 1XJOA 1CS0B 3NE8A 4KLWA 1R61A 1PCAA 4OC5A 2Z3NA 3K9UA 4KZTA 3K4IA 4P4BA 4NEXA 2IJZA 3MGDA 1YLOA 2HUZA 2C5QA 3SR3A 4ZX8A 4H89A 5G21A 2HI6A 2VKZG 4KVXA 3V7ZA 3N7ZA 1QQ9A 4L89A 2WPWA 1XMBA 1Z8WA 1YLEA 5HH1A 4PXCA 4FUUA 5ELYA 1PUAA 3PZJA 2Z3PA 4HPSA 4K30A 3BUMB 4BINA 2A4NA 3RO0A 4F6AA 5KTCA 3F9KC 2CTCA 5H86A 4EMEA 2RFHA 1F2OA 2Z11A 4C99A 5F9MA 2QYVA 3PB9X 4C9VA 4P4DA 2D0OA 3D2PA 1VBHA 4OKOA 4QBJA 1A9XB 2CTBA 5K99A 3ZJ0A 5K8PA 1FBVA 2AFWA 3D68A 4IF5A 2CF4A 1CJWA 5ISVA 4TJXA 4MCQA 5LYIA 1GGOA 4C84A 4NF1A 2QMLA 3CZXA 2OB0A 4NJRA 3NFZA 4MHPA 1OBRA 3EIFA 1J3LA 4MFKA 1TIQA 1XF8A 1ZG9A 2V77A 5HXDA 3D7HA 3WC7A 2GIVA 4H6UA 2Z3OA 3CXPA 3VRPA 1LFWA 2N3AB 2Z3KA 2PRBA 3FYNA 5J8FA 4YU9A 3SXOA 4Z65A 1YW6A 4KOWA 4B5PB 1ZLHA 3TOAA 2Q4YA 4XPDC 4Y49B 4EVYA 4B13A 2B4JC 1KUYA 4HNXB 3TLEA 4Q7AA 4P4JA 1AMPA 1OZPA 3IC1A 5F1YA 4C8FA 2ODFA 1IIDA 2ATRA 1XBUA 4C9UA 1S7FA 1M6VB 1Y9ZA 3EY5A 1VHOA 1Y7RA 2V8VA 2FE7A 4FWUA 4KOVA 4P4EA 2VI7A 1V6CA 1Z4RA 3TC8A 2OLSA 5F5XA 2GLFA 3OWCA 4FD6A 4MHDA 1QSNA 5F48A 1XEBA 3FEDA 3EXNA 5AG4A 2C27A 3PB8X 2VXKA 2VQYA 4PXDA 4UEFA 3I1UA 4RS2A 4F0YA 4COBA 2R98A 3IFEA 4KS9A 2ZW6A 2Q0YA 5HVGA 1H8LA 2R8VA 4U5YA 3PP9A 4R3LA 5AG5A 1GHEA 2PDOA 3CPXA 4GXHA 4B5PA 4RUHA 2B4BA 5K8NA 1TKJA 2PIYA 3TE4A 4OC2A 3GB0A 2WYRA 4X8IA 3FB3A 2QECA 5JQ4A 2AFSA 2IQ6A 4U9ZA 3R9EA 4CGLA 5AG6A 2XEIA 3RBUA 3VROA 1AUGA 3KR5A 1Z4EA 4HKFA 5E96A 5LRGA 5J8CA 3BI1A 4MRIA 2G3AA 1Z8XA 4A39A 2PR8A 2QVPA 3N5FA 2OOTA 4CPAA 3IGRA 3H8GA 2Q51A 1IY7A 3PEIA 4KOTA 3BI0A 2YGWA 4NXYA 3IWWA 1UWYA 2PC1A 2CNMA 2REFA 2ZW4A 3CXQA 1MK4A 1TF9A 3H8EA 5KTDA 4B5OA 3DGVA 3D7GA 2JEWA 2JDDA 1M4DA 4OC1A 2PIZA 3SXNA 1QSRA 3OP0A 4GM5A 1Q2DA 4XPDB 1PYTB 2P6EA 4UF4A 3I9SA 3R96A 2Y1MA 4JXQA 3BUNB 4BPUB 2ZEMA 2BUEA 2FM4A 1TKFA 3PRTA 3F5BA 3GY9A 4CYPA 2ZPAA 1CBXA 3SI0A 3PB7X 4KUAA 2Q7BA 1DIKA 3GYAA 2Q44A 2WSAA 3P2HA 2FSRA 5F09A 1Q2YA 4CS0B 4TJVA 1RTQA 1XE4A 4PPZA 4OP4A 2PJ1A 1JDBC 1JWQA 5HKWA 1Z2LA 3B3WA 3V8IA 4A95A 3PBBA 3TLBA 1CG2A 4O23A 3I3GA 2ZOFA 1IGBA 4NGNA 2XPOA 3FH4A 2PVWA 1DE4C 3VARA 7CPAA 4ZX9A 2VEZA 1JQGA 4H2KA 4CGNA 2Q4ZA 4HNWB 3NH8A 1K4JA 4R7MA 4ONUA 4R3KA 3PFVA 2XEGA 4TWEA 4NSQA 4PK2A 2B5GA 4KORA 3TCVA 1QMUA 4C9EA 2PJ8A 3S9NA 4KOUA 2PJ4A 5H84A 4NJQA 4A2ZA 3ICUA 3NFQA 5HKYA 4FD4A 1QSOA 5K8MA 4C2XA 2VL1A 4KVOE 1VKCA 4YWYA 4BBHA 3B3CA 3PB6X 5G22A 2BO9A 2EZAA 3B8GA 3EC4A 2IL4A 1C30B 1TKHA 2EK9A 4W9YA 4CGMA 5DWNA 4UCNA 3TFYA 4CDKA 4P10A 3VATA 2B4DA 1J4JA 1LOKA 1M4GA 2XEFA 3D66A 3FIXA 4P6YA 4H6ZA 5G20A 4EFDA 4NGTA 1KUVA 1Y0YA 3MRUA 3UY5A 5THWA 3B3SA 4KSAA 3B35A 3KHXA 3U1BA 2Y1NA 3F8KA 1S60A 3GIUA 1XF1A 2J8RA 1LRZA 2PJCA 1KEEB 1ZYMA 4DYOA 4C85A 4HNYB 1BLLE 2ZENA 2EO8A 3BLNA 4KSIA 3GUXA 1MJBA 4R6TA 2DIKA 2EZCA 2EUIA 3TLGA 5LYFA 3TLGB 4BD9A 5A27A 5HMNA 4Y49C 2V8DA 3T8WA 3DDDA 4AVCA 3HMJG 2J9AA 4M6HA 3I6SA 2NMTA 2FL4A 1VI4A 1XOVA 2J8NA 3T90A 4EYSA 1V0CA 4UFVA 4F0XA 1R3NA 2PSWA 4CYOA 1S7LA 2PJ9A 2FT0A 3CDXA 4UCMA 4A33A 2AFOA 5BY0A 5AGEA 2ZW7A 2HQYA 3S6FA 2F5IA 3LACA 4XNHB 3KI9A 2ZELA 1X12A 1Y9WA 4CAFA 2CBLA
chains in the Genus database with same CATH topology
2AFXA 2C5QA 2JBKA 4MHYA 2ZEPA 1LAPA 3RAMA 2ZEEA 2PCUA 4JZ0A 4B6ZA 2ANPA 4NFRA 1YMEA 3PB4X 2EWBA 3K9TA 4A38A 4R76A 2ZEHA 1KWMA 2AFMA 4NGMA 2RB7A 4IHMA 1Z5RA 4F8ZA 5DS0A 1CPXA 1HEEA 1ARMA 1TF8A 3KGQA 7CPAA 3S9LA 1AYEA 4DJLA 2F7VA 4AXVA 1FT7A 4C8TA 4C8CA 4ZY1A 4KNGE 2PJAA 3FX6A 4C9RA 3KQXA 1ZLIA 1LCPA 3FJUA 3PBEA 1YSJA 3IJ3A 4P4FA 2PE3A 1ELMP 2PVVA 4OC3A 1CPSA 3IO1A 3PFOA 2WZNA 4LQGA 3SJGA 5LRJA 2CIJA 2V8HA 2C6GA 2C1CA 4ZY2A 4OMEA 2PJ5A 4UEZA 3IIBA 4MCRA 2PJ7A 1Y0RA 2ZOGA 5JGFA 1NSAA 3DLJA 2PJ2A 3WT4A 5I4MA 2GREA 5LYLA 3FVLA 3ISXA 5JM6A 4NGQA 4UEEA 2C6CA 2PRQA 4FAIA 4UIBA 4K3NA 2HC9A 4F9VA 3LMSA 1VGYA 3VH9A 2JBJA 1ARLA 4JYWA 4NGRA 1ZG7A 2POKA 2I3CA 3V38A 1VHEA 5IB9A 4IK2A 3H8FA 3D7DA 1BPNA 3MN8A 3FECA 2ZEOA 3SI1A 3HLPA 2BCOA 2NYQA 1XRYA 3WABA 3KZWA 2O4HA 3SI2A 1CP7A 1M4LA 2ZEDA 1R43A 1LANA 3CT9A 3BHXA 1FNOA 4NGSA 8CPAA 5D29A 4MHNA 2O53A 2PJ3A 4MHZA 2V8GA 2G9DA 4C9EA 2EK8A 3B3VA 4MCSA 1EE3P 4A94A 4FBEA 4X3RA 5HVFA 3I74A 1BAVA 3FMCA 1HDQA 2FVGA 2IMOA 2HB6A 4ZYQA 4MXUA 5IR2A 3KHZA 2OR4A 3WC6A 3PFEA 4PXBA 1YW4A 5D8NA 3B7IA 4DUKA 2DEAA 3TX8A 3SJFA 2ZEFA 3KR4A 5CBMA 3RZAA 4ONWA 4IAVA 1CX8A 4WJBA 3K2KA 2GLJA 3NH5A 2AFUA 2F8HA 1ZG8A 3VTAA 4C8AA 1CP6A 1ELLP 4NGPA 1DTDA 2GU2A 3NA6A 3FEEA 4MMOA 4C9AA 4OIWA 3JRUA 4ZY0A 1Q7LA 1WVMA 2PJ6A 4OIDA 1XFOA 3S9MA 2XEJA 4C8UA 4F9UA 5JH9A 3CPAA 4PQAA 4ZI6A 4C8PA 2PJBA 4G1PA 5LRKA 5K8OA 1Z8LA 4CDJA 5LYDA 2C6PA 1BPMA 4P44A 2NSMA 4P4IA 3D7FA 4C84A 1Y7EA 3KASA 2PJ0A 2Q43A 3LWUA 1VIXA 3NH4A 4X2TA 6CPAA 4UIAA 3SJEA 2QJ8A 4C86A 3L2NA 2ABZA 2BOAA 1LAMA 3B3TA 4OC4A 3FF3A 5CPAA 4R8FA 3SJXA 1GYTA 1TXRA 1HDUA 3KQZA 4WWVA 4YN3A 4MCPA 3GLJA 3QNVA 3HUVA 3WC5A 5HVHA 2GP4A 3D67A 4P45A 2AFZA 3D4UA 4EWTA 3IEHA 2ZEGA 3BXMA 4PXEA 4OC0A 4TNUA 1F2PA 3B2YA 5J1QA 3KL9A 3ISZA 1F57A 4A37A 1XJOA 1PCAA 4OC5A 4P4BA 2IJZA 1YLOA 4ZX8A 3V7ZA 1QQ9A 1XMBA 4PXCA 4FUUA 5ELYA 2CTCA 4EMEA 2RFHA 1F2OA 4C99A 2QYVA 3PB9X 4C9VA 4P4DA 4OKOA 2CTBA 5K8PA 3D68A 2AFWA 2CF4A 4TJXA 4MCQA 5LYIA 4NJRA 3NFZA 4MHPA 1OBRA 3EIFA 1ZG9A 2V77A 5HXDA 3D7HA 3WC7A 1LFWA 4YU9A 4Z65A 1YW6A 1ZLHA 4Q7AA 4P4JA 1AMPA 3IC1A 4C8FA 1XBUA 4C9UA 1Y9ZA 1VHOA 2V8VA 4FWUA 4P4EA 1V6CA 3TC8A 2GLFA 3FEDA 3PB8X 4PXDA 4UEFA 3I1UA 3IFEA 5HVGA 1H8LA 4RUHA 3CPXA 5K8NA 1TKJA 2PIYA 4OC2A 3GB0A 2WYRA 4X8IA 2AFSA 2IQ6A 2XEIA 3RBUA 3KR5A 5LRGA 3BI1A 4MRIA 4A39A 2QVPA 3N5FA 4CPAA 2OOTA 3H8GA 2Q51A 1IY7A 3PEIA 3BI0A 3IWWA 1UWYA 3H8EA 1TF9A 3DGVA 3D7GA 2JEWA 2PIZA 4OC1A 4GM5A 1PYTB 4UF4A 2ZEMA 1TKFA 3PRTA 1CBXA 3SI0A 3PB7X 5F09A 4TJVA 1RTQA 4PPZA 4OP4A 2PJ1A 3B3WA 1Z2LA 3PBBA 1CG2A 4O23A 2ZOFA 1IGBA 4NGNA 3FH4A 2PVWA 1DE4C 3VARA 4ZX9A 1JQGA 4H2KA 2Q4ZA 4R7MA 3NH8A 2XEGA 4TWEA 1QMUA 2PJ8A 3S9NA 2PJ4A 3ICUA 4NJQA 5K8MA 2VL1A 4YWYA 3B3CA 3PB6X 2BO9A 1TKHA 2EK9A 4W9YA 4CDKA 4P10A 3VATA 3D66A 1LOKA 4P6YA 2XEFA 4EFDA 4NGTA 1Y0YA 3MRUA 5THWA 3B3SA 3B35A 3KHXA 1XF1A 4C85A 2PJCA 4DYOA 1BLLE 2ZENA 4KSIA 3GUXA 4R6TA 5LYFA 4BD9A 2V8DA 3T8WA 2J9AA 3I6SA 1R3NA 2PJ9A 3CDXA 2AFOA 3KI9A 2ZELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFX A;  2JBK A;  4MHY A;  2ZEP A;  1LAP A;  3RAM A;  2ZEE A;  2PCU A;  4JZ0 A;  4B6Z A;  2ANP A;  4NFR A;  1YME A;  3PB4 X;  2EWB A;  3K9T A;  4A38 A;  4R76 A;  2ZEH A;  1KWM A;  2AFM A;  4NGM A;  2RB7 A;  4IHM A;  1Z5R A;  4F8Z A;  5DS0 A;  1CPX A;  1HEE A;  1ARM A;  1TF8 A;  3KGQ A;  7CPA A;  3S9L A;  1AYE A;  4DJL A;  2F7V A;  4AXV A;  1FT7 A;  4C8T A;  4C8C A;  4ZY1 A;  4KNG E;  2PJA A;  3FX6 A;  4C9R A;  3KQX A;  1ZLI A;  1LCP A;  3FJU A;  3PBE A;  1YSJ A;  3IJ3 A;  4P4F A;  2PE3 A;  1ELM P;  2PVV A;  4OC3 A;  1CPS A;  3IO1 A;  3PFO A;  2WZN A;  4LQG A;  3SJG A;  5LRJ A;  2CIJ A;  2V8H A;  2C6G A;  2C1C A;  4ZY2 A;  4OME A;  2PJ5 A;  4UEZ A;  3IIB A;  4MCR A;  2PJ7 A;  1Y0R A;  2ZOG A;  5JGF A;  1NSA A;  3DLJ A;  2PJ2 A;  3WT4 A;  5I4M A;  2GRE A;  5LYL A;  3FVL A;  3ISX A;  5JM6 A;  4NGQ A;  4UEE A;  2C6C A;  2PRQ A;  4FAI A;  4UIB A;  4K3N A;  2HC9 A;  4F9V A;  3LMS A;  1VGY A;  3VH9 A;  2JBJ A;  1ARL A;  4JYW A;  4NGR A;  1ZG7 A;  2POK A;  2I3C A;  3V38 A;  1VHE A;  5IB9 A;  4IK2 A;  3H8F A;  3D7D A;  1BPN A;  3MN8 A;  3FEC A;  2ZEO A;  3SI1 A;  3HLP A;  2BCO A;  2NYQ A;  1XRY A;  3WAB A;  3KZW A;  2O4H A;  3SI2 A;  1CP7 A;  1M4L A;  2ZED A;  1R43 A;  1LAN A;  3CT9 A;  3BHX A;  1FNO A;  4NGS A;  8CPA A;  5D29 A;  4MHN A;  2O53 A;  2PJ3 A;  4MHZ A;  2V8G A;  2G9D A;  4C9E A;  2EK8 A;  3B3V A;  4MCS A;  1EE3 P;  4A94 A;  4FBE A;  4X3R A;  5HVF A;  3I74 A;  1BAV A;  3FMC A;  1HDQ A;  2FVG A;  2IMO A;  2HB6 A;  4ZYQ A;  4MXU A;  3KHZ A;  2OR4 A;  3WC6 A;  3PFE A;  4PXB A;  1YW4 A;  5D8N A;  3B7I A;  4DUK A;  2DEA A;  3TX8 A;  3SJF A;  2ZEF A;  3KR4 A;  5CBM A;  3RZA A;  4ONW A;  4IAV A;  1CX8 A;  4WJB A;  3K2K A;  2GLJ A;  3NH5 A;  2AFU A;  2F8H A;  1ZG8 A;  3VTA A;  4C8A A;  1CP6 A;  1ELL P;  4NGP A;  1DTD A;  2GU2 A;  3NA6 A;  3FEE A;  4MMO A;  4C9A A;  4OIW A;  3JRU A;  4ZY0 A;  1Q7L A;  1WVM A;  2PJ6 A;  4OID A;  1XFO A;  3S9M A;  2XEJ A;  4C8U A;  4F9U A;  5JH9 A;  3CPA A;  4PQA A;  4ZI6 A;  4C8P A;  2PJB A;  4G1P A;  5LRK A;  5K8O A;  1Z8L A;  4CDJ A;  5LYD A;  2C6P A;  1BPM A;  4P44 A;  2NSM A;  4P4I A;  3D7F A;  4C84 A;  1Y7E A;  3KAS A;  2PJ0 A;  2Q43 A;  3LWU A;  1VIX A;  3NH4 A;  4X2T A;  6CPA A;  4UIA A;  3SJE A;  2QJ8 A;  4C86 A;  3L2N A;  2ABZ A;  2BOA A;  1LAM A;  3B3T A;  4OC4 A;  3FF3 A;  5CPA A;  4R8F A;  3SJX A;  1GYT A;  1TXR A;  1HDU A;  3KQZ A;  4WWV A;  4YN3 A;  4MCP A;  3GLJ A;  3QNV A;  3HUV A;  3WC5 A;  5HVH A;  3D67 A;  4P45 A;  2AFZ A;  3D4U A;  4EWT A;  3IEH A;  2ZEG A;  3BXM A;  4PXE A;  4OC0 A;  4TNU A;  1F2P A;  3B2Y A;  5J1Q A;  3KL9 A;  3ISZ A;  1F57 A;  4A37 A;  1XJO A;  1PCA A;  4OC5 A;  4P4B A;  2IJZ A;  1YLO A;  4ZX8 A;  3V7Z A;  1QQ9 A;  1XMB A;  4PXC A;  4FUU A;  5ELY A;  2CTC A;  4EME A;  2RFH A;  1F2O A;  4C99 A;  2QYV A;  3PB9 X;  4C9V A;  4P4D A;  4OKO A;  2CTB A;  5K8P A;  3D68 A;  2AFW A;  2CF4 A;  4TJX A;  4MCQ A;  5LYI A;  4NJR A;  3NFZ A;  4MHP A;  1OBR A;  3EIF A;  1ZG9 A;  2V77 A;  5HXD A;  3D7H A;  3WC7 A;  1LFW A;  4YU9 A;  4Z65 A;  1YW6 A;  1ZLH A;  4Q7A A;  4P4J A;  1AMP A;  3IC1 A;  4C8F A;  1XBU A;  4C9U A;  1Y9Z A;  1VHO A;  2V8V A;  4FWU A;  4P4E A;  1V6C A;  3TC8 A;  2GLF A;  3FED A;  3PB8 X;  4PXD A;  4UEF A;  3I1U A;  3IFE A;  5HVG A;  1H8L A;  4RUH A;  3CPX A;  5K8N A;  1TKJ A;  2PIY A;  4OC2 A;  3GB0 A;  2WYR A;  4X8I A;  2AFS A;  2IQ6 A;  2XEI A;  3RBU A;  3KR5 A;  5LRG A;  3BI1 A;  4MRI A;  4A39 A;  2QVP A;  3N5F A;  4CPA A;  2OOT A;  3H8G A;  2Q51 A;  1IY7 A;  3PEI A;  3BI0 A;  3IWW A;  1UWY A;  3H8E A;  1TF9 A;  3DGV A;  3D7G A;  2JEW A;  2PIZ A;  4OC1 A;  4GM5 A;  1PYT B;  4UF4 A;  2ZEM A;  1TKF A;  3PRT A;  1CBX A;  3SI0 A;  3PB7 X;  5F09 A;  4TJV A;  1RTQ A;  4PPZ A;  4OP4 A;  2PJ1 A;  3B3W A;  1Z2L A;  3PBB A;  1CG2 A;  4O23 A;  2ZOF A;  1IGB A;  4NGN A;  3FH4 A;  2PVW A;  1DE4 C;  3VAR A;  4ZX9 A;  1JQG A;  4H2K A;  2Q4Z A;  4R7M A;  3NH8 A;  2XEG A;  4TWE A;  1QMU A;  2PJ8 A;  3S9N A;  2PJ4 A;  3ICU A;  4NJQ A;  5K8M A;  2VL1 A;  4YWY A;  3B3C A;  3PB6 X;  2BO9 A;  1TKH A;  2EK9 A;  4W9Y A;  4CDK A;  4P10 A;  3VAT A;  3D66 A;  1LOK A;  4P6Y A;  2XEF A;  4EFD A;  4NGT A;  1Y0Y A;  3MRU A;  5THW A;  3B3S A;  3B35 A;  3KHX A;  1XF1 A;  4C85 A;  2PJC A;  4DYO A;  1BLL E;  2ZEN A;  4KSI A;  3GUX A;  4R6T A;  5LYF A;  4BD9 A;  2V8D A;  3T8W A;  2J9A A;  3I6S A;  1R3N A;  2PJ9 A;  3CDX A;  2AFO A;  3KI9 A;  2ZEL A; 
#chains in the Genus database with same CATH topology
 1A2Z A;  2G3T A;  2AFX A;  4R57 A;  1YVH A;  2JBK A;  1YGH A;  4MHY A;  4Q38 A;  2ZEP A;  1LAP A;  2P6F A;  5CNP A;  3RAM A;  3EZA A;  2ZEE A;  2PCU A;  1S3Z A;  4JZ0 A;  3H4Q A;  4B6Z A;  2OZH A;  4BTF A;  2ANP A;  3F0A A;  2R7H A;  4NFR A;  4QC6 A;  4A32 A;  3GJZ A;  3TLC A;  1YME A;  3PB4 X;  4X5K A;  1B87 A;  2EWB A;  3RNZ A;  3K9T A;  4CAW A;  4A38 A;  1T36 B;  2B0A A;  4XNH C;  4R76 A;  2ZEH A;  4CYQ A;  1KWM A;  3D2M A;  2AFM A;  4NGM A;  2ZXV A;  1P4N A;  2B5G B;  1M1D A;  3DR6 A;  5I0C A;  2YNE A;  4XPL A;  2RB7 A;  4IHM A;  1Z5R A;  2B4D B;  1I21 A;  3EO4 A;  4RN7 A;  2Q04 A;  4F8Z A;  3TLZ A;  2EBJ A;  1M4I A;  2I79 A;  5DS0 A;  4I49 A;  4L8A A;  3OAK A;  2WPX A;  3IU2 A;  3H5Z A;  2Z10 A;  1CPX A;  1HEE A;  2CNT A;  4UCP A;  3P2F A;  2KCW A;  1ARM A;  1TF8 A;  2GFQ A;  3IWE A;  3NE7 A;  2D0P A;  3KGQ A;  1MJA A;  1NE9 A;  5J3X A;  4JJX A;  3S9L A;  1AYE A;  4UA3 A;  4DJL A;  4BPW B;  2REE A;  1VBG A;  1IOF A;  5C88 A;  4H1H A;  4YFJ A;  3IU1 A;  4QVT A;  2JDC A;  2QIR A;  3PLF B;  2F7V A;  4AXV A;  2O28 A;  1FT7 A;  4CRZ B;  4C8C A;  4C8T A;  4ZY1 A;  4B11 A;  2PJA A;  3FX6 A;  1NXJ A;  4KNG E;  4C9R A;  4C2Y A;  2PR1 A;  3KQX A;  4MFL A;  1ZLI A;  5F47 A;  1LCP A;  3FJU A;  3QB8 A;  1BOB A;  2CNS A;  1YSJ A;  3PBE A;  3S6G A;  1S5K A;  3VWD A;  5KTA A;  3HPH E;  1Y9K A;  2FIW A;  3IJ3 A;  4P4F A;  4MY3 A;  2WUU A;  4CO9 A;  2PE3 A;  3BJ8 A;  3VRN A;  3WR7 A;  4R9M A;  1ELM P;  2YJT A;  1WWZ A;  4UWJ A;  2PQ8 A;  2PVV A;  4OC3 A;  3LOD A;  3D8P A;  2VBQ A;  3D3S A;  1CPS A;  2X0S A;  2B58 A;  3IO1 A;  3IWG A;  3PFO A;  2WZN A;  4LQG A;  3SJG A;  1IIC A;  2CIJ A;  2V8H A;  5LRJ A;  2C6G A;  1NMT A;  2C1C A;  2P0W A;  4NCZ A;  2B3U A;  3LD2 A;  1Z8T A;  4ZY2 A;  3TTH A;  1ZO0 A;  4YGO A;  3W91 A;  1KC7 A;  4OME A;  4PSW A;  2PJ5 A;  4UEZ A;  3IIB A;  2AJ6 A;  4CAE A;  4MCR A;  1IOI A;  1CM0 A;  2GAN A;  1QSM A;  1Y0R A;  2PJ7 A;  2YNC A;  2Z3M A;  2ZOG A;  4YRH A;  4AB7 A;  5JGF A;  1N71 A;  4JXR A;  2FXF A;  3FBU A;  4MFQ A;  1YK3 A;  2YND A;  1NSA A;  3DLJ A;  2PJ2 A;  3WT4 A;  3EZB A;  5I4M A;  1BO4 A;  1YX0 A;  2GRE A;  1L0C A;  4INJ A;  4AVB A;  5LYL A;  3FVL A;  4C7I A;  3ISX A;  5JM6 A;  4A4B A;  4JD6 A;  4M6G A;  4ZBG A;  3HPG G;  4CGP A;  4JWP A;  4NGQ A;  4OAE A;  3VGO A;  2VZY A;  4UEE A;  5IX3 A;  2AUM A;  2C6C A;  2PRQ A;  2UV8 G;  5F49 A;  4FAI A;  4U9Y A;  4UIB A;  3O8Z A;  4K3N A;  1FY7 A;  5EC4 A;  2HC9 A;  2I00 A;  4F9V A;  4UFW A;  2BL1 A;  1VGY A;  3LMS A;  3VH9 A;  5F46 A;  1YVK A;  2JBJ A;  1IYL A;  3KRV A;  1ARL A;  4JYW A;  4NGR A;  2ZW5 A;  3EZE A;  4BMH A;  5JPH A;  4IIY A;  1ZG7 A;  2RC4 A;  2P6G A;  2POK A;  4ZGY B;  4E5S A;  2I3C A;  3V38 A;  4M85 A;  1VHE A;  5IB9 A;  4JLY A;  4IK2 A;  1RXT A;  3H8F A;  4RI1 A;  3BJ7 A;  2Z0Z A;  4PSX A;  1EZA A;  3D7D A;  3W6S A;  3ZZI A;  1BPN A;  4FD7 A;  3FEC A;  3MN8 A;  2ZEO A;  3BUO B;  3HLP A;  2BCO A;  4MFJ A;  2OZG A;  1YVO A;  2NYQ A;  1NSL A;  3SI1 A;  1NBW A;  1XRY A;  3WAB A;  3KZW A;  4M8D A;  2O4H A;  3OB2 B;  2B3V A;  2CXA A;  3SI2 A;  4MJX A;  1CP7 A;  4CAV A;  5EBV A;  1M4L A;  2ZED A;  2VZZ A;  1R43 A;  2XPN A;  1LAN A;  2D4O A;  3KKW A;  4A30 A;  3CT9 A;  3BHX A;  1FNO A;  1ZRS A;  4NGS A;  8CPA A;  5D29 A;  5GCN A;  4MHN A;  4CZ1 A;  3T0T A;  2DXQ A;  4IIX A;  3TLY A;  4CRY B;  2O53 A;  5JYB A;  2PJ3 A;  1WJT A;  2V8G A;  2G9D A;  1VHS A;  2OH1 A;  4MHZ A;  3VRQ A;  1MJ9 A;  2ARH A;  3TO9 A;  1YQE A;  2EK8 A;  2BSW A;  3B3V A;  4R87 A;  3BUW B;  2R1I A;  4CGO A;  4MCS A;  1EE3 P;  2HV2 A;  3CXS A;  4QB9 A;  4A94 A;  4MI1 A;  4FBE A;  4KVM E;  4RR2 B;  4MBU A;  3U88 C;  2FS5 A;  5F13 A;  3E0K A;  4LX9 A;  1IYK A;  4X3R A;  3JVN A;  1I1D A;  5HVF A;  3I74 A;  3ZNI A;  1BAV A;  4E2A A;  4MY0 A;  4KOS A;  2MP0 A;  3FMC A;  3DR8 A;  1HDQ A;  2FVG A;  3R9F A;  2IMO A;  2HB6 A;  4J0N A;  2OZU A;  3T05 A;  1QST A;  4CYN A;  3JTK A;  1PU9 A;  4MXU A;  4ZYQ A;  4IUS A;  5C82 A;  1BXR B;  2OU2 A;  5IR2 A;  3KHZ A;  3S6H A;  1U6M A;  4Q36 A;  1IB1 E;  2OR4 A;  3R95 A;  3WC6 A;  4B14 A;  2R82 A;  1R57 A;  3TO6 A;  3PFE A;  4PXB A;  1YW4 A;  4MFZ A;  3VRR A;  2BEI A;  1Z9U A;  1B6B A;  1X10 A;  3TO7 A;  3G23 A;  5HKZ A;  5D8N A;  3PGP A;  3B7I A;  1XIX A;  4M3S A;  4DUK A;  2DEA A;  3TOB A;  4CAX A;  3QAY A;  3TX8 A;  3SJF A;  2ZEF A;  1C3O B;  1S7K A;  3KR4 A;  5CBM A;  3RZA A;  2H5M A;  3FXT A;  4ONW A;  4IAV A;  1CX8 A;  4KOX A;  3K2K A;  4WJB A;  2EZB A;  4XPK A;  2HWG A;  2FIA A;  3BUX B;  4GPL B;  4UFX A;  1YRE A;  3QAH A;  2GLJ A;  4KSF A;  2YJV A;  1P0H A;  4JVO A;  4MJ8 A;  3NH5 A;  3NOJ A;  2AFU A;  2F8H A;  4E94 A;  1ZG8 A;  2DPS A;  4MFP A;  4KLV A;  3VTA A;  4C8A A;  3RYO A;  1CP6 A;  4OLL A;  2AE6 A;  3T07 A;  4DNC A;  4COG A;  1IU8 A;  1ELL P;  3FNC A;  4NGP A;  1DTD A;  2GU2 A;  1KZF A;  1UFH A;  3NA6 A;  3FEE A;  4AG7 A;  4AVA A;  4MMO A;  4II9 A;  3FRM A;  4C9A A;  4OIW A;  3JRU A;  4KUB A;  4PK3 A;  4ZY0 A;  1Q7L A;  5G1Z A;  1WVM A;  1CE8 B;  2K5T A;  3C8O A;  2PJ6 A;  4OID A;  3DSB A;  1XFO A;  3S9M A;  5IB0 A;  2XPL A;  4QUS A;  3TT2 A;  2XEJ A;  4C8U A;  4F9U A;  1EZB A;  2DLA A;  5JH9 A;  2D4P A;  2G0B A;  3CPA A;  4PQA A;  4ZI6 A;  3T5M A;  3TYX A;  4E0A A;  3PT1 A;  4C8P A;  2PJB A;  3EFA A;  4G1P A;  2JLM A;  5LRK A;  4E8O A;  1Z8L A;  5K8O A;  1JDE A;  4CDJ A;  1Q5X A;  2X7B A;  2HRO A;  1EO0 A;  5LYD A;  4A31 A;  2JEV A;  2C6P A;  3VWE A;  1BPM A;  2Z3L A;  4P44 A;  1B47 A;  1XMT A;  2NSM A;  4MI4 A;  4B12 A;  4C68 A;  3S6K A;  5JVL A;  4P4I A;  5AXI A;  2EVN A;  2FCK A;  4C7H A;  5DWM A;  1Z9E A;  3D7F A;  1Y7E A;  3KAS A;  2PJ0 A;  2Q43 A;  2Q7S A;  1VIX A;  3DNS A;  3JUW A;  3LWU A;  3NH4 A;  4X2T A;  6CPA A;  1WK4 A;  4UIA A;  3SJE A;  2CY2 A;  2QJ8 A;  5FD8 A;  1ZL0 A;  4C86 A;  3L2N A;  4M6I A;  2ABZ A;  4A4C A;  1LAM A;  2BOA A;  3B3T A;  1I12 A;  1SQH A;  4BPX B;  2GE3 A;  4LQ6 A;  5EMI A;  2PCN A;  4OC4 A;  4GS4 A;  3FF3 A;  5CPA A;  4R8F A;  3SJX A;  1GYT A;  1TXR A;  4C2Z A;  4KOY A;  2AUN A;  1KBL A;  1HDU A;  3G8W A;  1S7N A;  3KQZ A;  1RO5 A;  3A9L A;  4J3G A;  2DF5 A;  4UBR A;  4WWV A;  4YN3 A;  2Q4V A;  4MCP A;  2XPP A;  1YR0 A;  3GLJ A;  5FVJ A;  3SHP A;  3W6X A;  3QNV A;  3C26 A;  3HUV A;  3WC5 A;  3T9Y A;  2YNC C;  5A28 A;  5HVH A;  2DPT A;  2GP4 A;  2Y0M A;  3D67 A;  3OB1 B;  4P45 A;  2AFZ A;  3D4U A;  3R1K A;  4FD5 A;  4AG9 A;  4EWT A;  4UWI A;  3IEH A;  2ZEG A;  3BXM A;  4OAD A;  1KUX A;  4LUA A;  4PXE A;  1Q2C A;  2J8M A;  5AG7 A;  3GKR A;  4OC0 A;  1ON0 A;  5IV0 A;  1M44 A;  4TNU A;  1F2P A;  3B2Y A;  5J1Q A;  3KL9 A;  2E28 A;  3TLA A;  3ISZ A;  4B10 A;  4PV6 A;  3G3S A;  3R9G A;  1F57 A;  5BWA B;  4A37 A;  4ORF A;  1XJO A;  1CS0 B;  3NE8 A;  4KLW A;  1R61 A;  1PCA A;  4OC5 A;  2Z3N A;  3K9U A;  4KZT A;  3K4I A;  4P4B A;  4NEX A;  2IJZ A;  3MGD A;  1YLO A;  2HUZ A;  2C5Q A;  3SR3 A;  4ZX8 A;  4H89 A;  5G21 A;  2HI6 A;  2VKZ G;  4KVX A;  3V7Z A;  3N7Z A;  1QQ9 A;  4L89 A;  2WPW A;  1XMB A;  1Z8W A;  1YLE A;  5HH1 A;  4PXC A;  4FUU A;  5ELY A;  1PUA A;  3PZJ A;  2Z3P A;  4HPS A;  4K30 A;  3BUM B;  4BIN A;  2A4N A;  3RO0 A;  4F6A A;  5KTC A;  3F9K C;  2CTC A;  5H86 A;  4EME A;  2RFH A;  1F2O A;  2Z11 A;  4C99 A;  5F9M A;  2QYV A;  3PB9 X;  4C9V A;  4P4D A;  2D0O A;  3D2P A;  1VBH A;  4OKO A;  4QBJ A;  1A9X B;  2CTB A;  5K99 A;  3ZJ0 A;  5K8P A;  1FBV A;  2AFW A;  3D68 A;  4IF5 A;  2CF4 A;  1CJW A;  5ISV A;  4TJX A;  4MCQ A;  5LYI A;  1GGO A;  4C84 A;  4NF1 A;  2QML A;  3CZX A;  2OB0 A;  4NJR A;  3NFZ A;  4MHP A;  1OBR A;  3EIF A;  1J3L A;  4MFK A;  1TIQ A;  1XF8 A;  1ZG9 A;  2V77 A;  5HXD A;  3D7H A;  3WC7 A;  2GIV A;  4H6U A;  2Z3O A;  3CXP A;  3VRP A;  1LFW A;  2N3A B;  2Z3K A;  2PRB A;  3FYN A;  5J8F A;  4YU9 A;  3SXO A;  4Z65 A;  1YW6 A;  4KOW A;  4B5P B;  1ZLH A;  3TOA A;  2Q4Y A;  4XPD C;  4Y49 B;  4EVY A;  4B13 A;  2B4J C;  1KUY A;  4HNX B;  3TLE A;  4Q7A A;  4P4J A;  1AMP A;  1OZP A;  3IC1 A;  5F1Y A;  4C8F A;  2ODF A;  1IID A;  2ATR A;  1XBU A;  4C9U A;  1S7F A;  1M6V B;  1Y9Z A;  3EY5 A;  1VHO A;  1Y7R A;  2V8V A;  2FE7 A;  4FWU A;  4KOV A;  4P4E A;  2VI7 A;  1V6C A;  1Z4R A;  3TC8 A;  2OLS A;  5F5X A;  2GLF A;  3OWC A;  4FD6 A;  4MHD A;  1QSN A;  5F48 A;  1XEB A;  3FED A;  3EXN A;  5AG4 A;  2C27 A;  3PB8 X;  2VXK A;  2VQY A;  4PXD A;  4UEF A;  3I1U A;  4RS2 A;  4F0Y A;  4COB A;  2R98 A;  3IFE A;  4KS9 A;  2ZW6 A;  2Q0Y A;  5HVG A;  1H8L A;  2R8V A;  4U5Y A;  3PP9 A;  4R3L A;  5AG5 A;  1GHE A;  2PDO A;  3CPX A;  4GXH A;  4B5P A;  4RUH A;  2B4B A;  5K8N A;  1TKJ A;  2PIY A;  3TE4 A;  4OC2 A;  3GB0 A;  2WYR A;  4X8I A;  3FB3 A;  2QEC A;  5JQ4 A;  2AFS A;  2IQ6 A;  4U9Z A;  3R9E A;  4CGL A;  5AG6 A;  2XEI A;  3RBU A;  3VRO A;  1AUG A;  3KR5 A;  1Z4E A;  4HKF A;  5E96 A;  5LRG A;  5J8C A;  3BI1 A;  4MRI A;  2G3A A;  1Z8X A;  4A39 A;  2PR8 A;  2QVP A;  3N5F A;  2OOT A;  4CPA A;  3IGR A;  3H8G A;  2Q51 A;  1IY7 A;  3PEI A;  4KOT A;  3BI0 A;  2YGW A;  4NXY A;  3IWW A;  1UWY A;  2PC1 A;  2CNM A;  2REF A;  2ZW4 A;  3CXQ A;  1MK4 A;  1TF9 A;  3H8E A;  5KTD A;  4B5O A;  3DGV A;  3D7G A;  2JEW A;  2JDD A;  1M4D A;  4OC1 A;  2PIZ A;  3SXN A;  1QSR A;  3OP0 A;  4GM5 A;  1Q2D A;  4XPD B;  1PYT B;  2P6E A;  4UF4 A;  3I9S A;  3R96 A;  2Y1M A;  4JXQ A;  3BUN B;  4BPU B;  2ZEM A;  2BUE A;  2FM4 A;  1TKF A;  3PRT A;  3F5B A;  3GY9 A;  4CYP A;  2ZPA A;  1CBX A;  3SI0 A;  3PB7 X;  4KUA A;  2Q7B A;  1DIK A;  3GYA A;  2Q44 A;  2WSA A;  3P2H A;  2FSR A;  5F09 A;  1Q2Y A;  4CS0 B;  4TJV A;  1RTQ A;  1XE4 A;  4PPZ A;  4OP4 A;  2PJ1 A;  1JDB C;  1JWQ A;  5HKW A;  1Z2L A;  3B3W A;  3V8I A;  4A95 A;  3PBB A;  3TLB A;  1CG2 A;  4O23 A;  3I3G A;  2ZOF A;  1IGB A;  4NGN A;  2XPO A;  3FH4 A;  2PVW A;  1DE4 C;  3VAR A;  7CPA A;  4ZX9 A;  2VEZ A;  1JQG A;  4H2K A;  4CGN A;  2Q4Z A;  4HNW B;  3NH8 A;  1K4J A;  4R7M A;  4ONU A;  4R3K A;  3PFV A;  2XEG A;  4TWE A;  4NSQ A;  4PK2 A;  2B5G A;  4KOR A;  3TCV A;  1QMU A;  4C9E A;  2PJ8 A;  3S9N A;  4KOU A;  2PJ4 A;  5H84 A;  4NJQ A;  4A2Z A;  3ICU A;  3NFQ A;  5HKY A;  4FD4 A;  1QSO A;  5K8M A;  4C2X A;  2VL1 A;  4KVO E;  1VKC A;  4YWY A;  4BBH A;  3B3C A;  3PB6 X;  5G22 A;  2BO9 A;  2EZA A;  3B8G A;  3EC4 A;  2IL4 A;  1C30 B;  1TKH A;  2EK9 A;  4W9Y A;  4CGM A;  5DWN A;  4UCN A;  3TFY A;  4CDK A;  4P10 A;  3VAT A;  2B4D A;  1J4J A;  1LOK A;  1M4G A;  2XEF A;  3D66 A;  3FIX A;  4P6Y A;  4H6Z A;  5G20 A;  4EFD A;  4NGT A;  1KUV A;  1Y0Y A;  3MRU A;  3UY5 A;  5THW A;  3B3S A;  4KSA A;  3B35 A;  3KHX A;  3U1B A;  2Y1N A;  3F8K A;  1S60 A;  3GIU A;  1XF1 A;  2J8R A;  1LRZ A;  2PJC A;  1KEE B;  1ZYM A;  4DYO A;  4C85 A;  4HNY B;  1BLL E;  2ZEN A;  2EO8 A;  3BLN A;  4KSI A;  3GUX A;  1MJB A;  4R6T A;  2DIK A;  2EZC A;  2EUI A;  3TLG A;  5LYF A;  3TLG B;  4BD9 A;  5A27 A;  5HMN A;  4Y49 C;  2V8D A;  3T8W A;  3DDD A;  4AVC A;  3HMJ G;  2J9A A;  4M6H A;  3I6S A;  2NMT A;  2FL4 A;  1VI4 A;  1XOV A;  2J8N A;  3T90 A;  4EYS A;  1V0C A;  4UFV A;  4F0X A;  1R3N A;  2PSW A;  4CYO A;  1S7L A;  2PJ9 A;  2FT0 A;  3CDX A;  4UCM A;  4A33 A;  2AFO A;  5BY0 A;  5AGE A;  2ZW7 A;  2HQY A;  3S6F A;  2F5I A;  3LAC A;  4XNH B;  3KI9 A;  2ZEL A;  1X12 A;  1Y9W A;  4CAF A;  2CBL A; 
#chains in the Genus database with same CATH homology
 2AFX A;  2C5Q A;  2JBK A;  4MHY A;  2ZEP A;  1LAP A;  3RAM A;  2ZEE A;  2PCU A;  4JZ0 A;  4B6Z A;  2ANP A;  4NFR A;  1YME A;  3PB4 X;  2EWB A;  3K9T A;  4A38 A;  4R76 A;  2ZEH A;  1KWM A;  2AFM A;  4NGM A;  2RB7 A;  4IHM A;  1Z5R A;  4F8Z A;  5DS0 A;  1CPX A;  1HEE A;  1ARM A;  1TF8 A;  3KGQ A;  7CPA A;  3S9L A;  1AYE A;  4DJL A;  2F7V A;  4AXV A;  1FT7 A;  4C8T A;  4C8C A;  4ZY1 A;  4KNG E;  2PJA A;  3FX6 A;  4C9R A;  3KQX A;  1ZLI A;  1LCP A;  3FJU A;  3PBE A;  1YSJ A;  3IJ3 A;  4P4F A;  2PE3 A;  1ELM P;  2PVV A;  4OC3 A;  1CPS A;  3IO1 A;  3PFO A;  2WZN A;  4LQG A;  3SJG A;  5LRJ A;  2CIJ A;  2V8H A;  2C6G A;  2C1C A;  4ZY2 A;  4OME A;  2PJ5 A;  4UEZ A;  3IIB A;  4MCR A;  2PJ7 A;  1Y0R A;  2ZOG A;  5JGF A;  1NSA A;  3DLJ A;  2PJ2 A;  3WT4 A;  5I4M A;  2GRE A;  5LYL A;  3FVL A;  3ISX A;  5JM6 A;  4NGQ A;  4UEE A;  2C6C A;  2PRQ A;  4FAI A;  4UIB A;  4K3N A;  2HC9 A;  4F9V A;  3LMS A;  1VGY A;  3VH9 A;  2JBJ A;  1ARL A;  4JYW A;  4NGR A;  1ZG7 A;  2POK A;  2I3C A;  3V38 A;  1VHE A;  5IB9 A;  4IK2 A;  3H8F A;  3D7D A;  1BPN A;  3MN8 A;  3FEC A;  2ZEO A;  3SI1 A;  3HLP A;  2BCO A;  2NYQ A;  1XRY A;  3WAB A;  3KZW A;  2O4H A;  3SI2 A;  1CP7 A;  1M4L A;  2ZED A;  1R43 A;  1LAN A;  3CT9 A;  3BHX A;  1FNO A;  4NGS A;  8CPA A;  5D29 A;  4MHN A;  2O53 A;  2PJ3 A;  4MHZ A;  2V8G A;  2G9D A;  4C9E A;  2EK8 A;  3B3V A;  4MCS A;  1EE3 P;  4A94 A;  4FBE A;  4X3R A;  5HVF A;  3I74 A;  1BAV A;  3FMC A;  1HDQ A;  2FVG A;  2IMO A;  2HB6 A;  4ZYQ A;  4MXU A;  5IR2 A;  3KHZ A;  2OR4 A;  3WC6 A;  3PFE A;  4PXB A;  1YW4 A;  5D8N A;  3B7I A;  4DUK A;  2DEA A;  3TX8 A;  3SJF A;  2ZEF A;  3KR4 A;  5CBM A;  3RZA A;  4ONW A;  4IAV A;  1CX8 A;  4WJB A;  3K2K A;  2GLJ A;  3NH5 A;  2AFU A;  2F8H A;  1ZG8 A;  3VTA A;  4C8A A;  1CP6 A;  1ELL P;  4NGP A;  1DTD A;  2GU2 A;  3NA6 A;  3FEE A;  4MMO A;  4C9A A;  4OIW A;  3JRU A;  4ZY0 A;  1Q7L A;  1WVM A;  2PJ6 A;  4OID A;  1XFO A;  3S9M A;  2XEJ A;  4C8U A;  4F9U A;  5JH9 A;  3CPA A;  4PQA A;  4ZI6 A;  4C8P A;  2PJB A;  4G1P A;  5LRK A;  5K8O A;  1Z8L A;  4CDJ A;  5LYD A;  2C6P A;  1BPM A;  4P44 A;  2NSM A;  4P4I A;  3D7F A;  4C84 A;  1Y7E A;  3KAS A;  2PJ0 A;  2Q43 A;  3LWU A;  1VIX A;  3NH4 A;  4X2T A;  6CPA A;  4UIA A;  3SJE A;  2QJ8 A;  4C86 A;  3L2N A;  2ABZ A;  2BOA A;  1LAM A;  3B3T A;  4OC4 A;  3FF3 A;  5CPA A;  4R8F A;  3SJX A;  1GYT A;  1TXR A;  1HDU A;  3KQZ A;  4WWV A;  4YN3 A;  4MCP A;  3GLJ A;  3QNV A;  3HUV A;  3WC5 A;  5HVH A;  2GP4 A;  3D67 A;  4P45 A;  2AFZ A;  3D4U A;  4EWT A;  3IEH A;  2ZEG A;  3BXM A;  4PXE A;  4OC0 A;  4TNU A;  1F2P A;  3B2Y A;  5J1Q A;  3KL9 A;  3ISZ A;  1F57 A;  4A37 A;  1XJO A;  1PCA A;  4OC5 A;  4P4B A;  2IJZ A;  1YLO A;  4ZX8 A;  3V7Z A;  1QQ9 A;  1XMB A;  4PXC A;  4FUU A;  5ELY A;  2CTC A;  4EME A;  2RFH A;  1F2O A;  4C99 A;  2QYV A;  3PB9 X;  4C9V A;  4P4D A;  4OKO A;  2CTB A;  5K8P A;  3D68 A;  2AFW A;  2CF4 A;  4TJX A;  4MCQ A;  5LYI A;  4NJR A;  3NFZ A;  4MHP A;  1OBR A;  3EIF A;  1ZG9 A;  2V77 A;  5HXD A;  3D7H A;  3WC7 A;  1LFW A;  4YU9 A;  4Z65 A;  1YW6 A;  1ZLH A;  4Q7A A;  4P4J A;  1AMP A;  3IC1 A;  4C8F A;  1XBU A;  4C9U A;  1Y9Z A;  1VHO A;  2V8V A;  4FWU A;  4P4E A;  1V6C A;  3TC8 A;  2GLF A;  3FED A;  3PB8 X;  4PXD A;  4UEF A;  3I1U A;  3IFE A;  5HVG A;  1H8L A;  4RUH A;  3CPX A;  5K8N A;  1TKJ A;  2PIY A;  4OC2 A;  3GB0 A;  2WYR A;  4X8I A;  2AFS A;  2IQ6 A;  2XEI A;  3RBU A;  3KR5 A;  5LRG A;  3BI1 A;  4MRI A;  4A39 A;  2QVP A;  3N5F A;  4CPA A;  2OOT A;  3H8G A;  2Q51 A;  1IY7 A;  3PEI A;  3BI0 A;  3IWW A;  1UWY A;  3H8E A;  1TF9 A;  3DGV A;  3D7G A;  2JEW A;  2PIZ A;  4OC1 A;  4GM5 A;  1PYT B;  4UF4 A;  2ZEM A;  1TKF A;  3PRT A;  1CBX A;  3SI0 A;  3PB7 X;  5F09 A;  4TJV A;  1RTQ A;  4PPZ A;  4OP4 A;  2PJ1 A;  3B3W A;  1Z2L A;  3PBB A;  1CG2 A;  4O23 A;  2ZOF A;  1IGB A;  4NGN A;  3FH4 A;  2PVW A;  1DE4 C;  3VAR A;  4ZX9 A;  1JQG A;  4H2K A;  2Q4Z A;  4R7M A;  3NH8 A;  2XEG A;  4TWE A;  1QMU A;  2PJ8 A;  3S9N A;  2PJ4 A;  3ICU A;  4NJQ A;  5K8M A;  2VL1 A;  4YWY A;  3B3C A;  3PB6 X;  2BO9 A;  1TKH A;  2EK9 A;  4W9Y A;  4CDK A;  4P10 A;  3VAT A;  3D66 A;  1LOK A;  4P6Y A;  2XEF A;  4EFD A;  4NGT A;  1Y0Y A;  3MRU A;  5THW A;  3B3S A;  3B35 A;  3KHX A;  1XF1 A;  4C85 A;  2PJC A;  4DYO A;  1BLL E;  2ZEN A;  4KSI A;  3GUX A;  4R6T A;  5LYF A;  4BD9 A;  2V8D A;  3T8W A;  2J9A A;  3I6S A;  1R3N A;  2PJ9 A;  3CDX A;  2AFO A;  3KI9 A;  2ZEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...