3IWWA

Crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dbibzl, a urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
molecule tags Hydrolase
source organism Homo sapiens
publication title Bioisosterism of urea-based GCPII inhibitors: Synthesis and structure-activity relationship studies.
pubmed doi rcsb
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3iwwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iwwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3iwwA02
3L2NA 4ZI6A 2ABZA 4OC1A 2ZENA 3VTAA 3T8WA 5HVFA 2C6GA 1OBRA 2CTBA 4PQAA 2PE3A 4GM5A 5K8PA 1HDQA 1R43A 3IC1A 4NGPA 1F57A 2PJ6A 3KQXA 4X3RA 1ZLIA 2PCUA 2GLJA 3TX8A 1V6CA 3VATA 3B7IA 4A37A 1VHEA 4NGTA 2PJ3A 2Q51A 1XBUA 3KHZA 4C8UA 4OC0A 3NH5A 4X8IA 2C6CA 4NGSA 2BO9A 3PB7X 4MXUA 1CPSA 3I74A 1Z8LA 1TKJA 2NYQA 2V8DA 3NH8A 1CX8A 4P6YA 4EFDA 4YWYA 2PIZA 3BHXA 3SI1A 5THWA 1FNOA 2GREA 3NFZA 3WC6A 4UEEA 1Z2LA 4MCRA 5DS0A 2EWBA 4TJXA 4OP4A 1CG2A 1ZG7A 3IEHA 2PJ8A 4R7MA 3V38A 3KR5A 3B2YA 4EWTA 5IB9A 4NGNA 4C9AA 2AFUA 3QNVA 1ZLHA 2V8GA 4DYOA 3KHXA 2ANPA 4MRIA 1ARLA 3GUXA 4FWUA 3FH4A 4P4DA 2OR4A 4DUKA 1XJOA 2PVWA 4WJBA 4FBEA 3B3SA 4OKOA 4ZX8A 4PXBA 3CT9A 3I6SA 2XEJA 4MMOA 2WZNA 3PB8X 3RZAA 2QYVA 3CPXA 4LQGA 3ISXA 2PJ4A 3GB0A 4Z65A 4YN3A 4RUHA 3WT4A 1LAPA 5HXDA 1TXRA 3D67A 3RAMA 4UIBA 4CPAA 3B3WA 3IO1A 5CBMA 5HVHA 2AFZA 3IIBA 3D4UA 5CPAA 4W9YA 2PJ7A 4WWVA 3PFOA 1DE4C 1LANA 3MRUA 4P4IA 3PB4X 1XRYA 6CPAA 2PJ5A 2AFXA 1CP6A 4ZY1A 2F8HA 1TF8A 4KNGE 2PVVA 2PJ1A 5LRKA 5JH9A 3DLJA 1YSJA 3PB9X 1ELMP 2O4HA 2ZOGA 2OOTA 2C6PA 1PYTB 1F2OA 3S9NA 2PJ2A 4TNUA 4H2KA 4R8FA 3FECA 3FEEA 4C8CA 3H8FA 2ZOFA 4P4FA 2BCOA 4YU9A 2IMOA 2FVGA 4DJLA 2QVPA 2ZEFA 4B6ZA 3I1UA 2XEFA 2F7VA 3IWWA 1FT7A 2AFWA 4NJRA 4EMEA 3K2KA 2ZEDA 4AXVA 4IAVA 4UEFA 3CDXA 2V8VA 1ZG9A 4NFRA 1EE3P 1VGYA 1XMBA 3V7ZA 3KASA 4OIDA 1Y9ZA 2ZEHA 2G9DA 1JQGA 4JYWA 1IY7A 3KL9A 4MHNA 4PPZA 3D7DA 1F2PA 4C8TA 1YW6A 1YLOA 1Y0RA 2JBKA 3NA6A 1KWMA 5LYLA 2PJ0A 2ZEGA 2BOAA 1LOKA 1BAVA 5I4MA 2PJ9A 3D7GA 4UIAA 4PXEA 2I3CA 4P4JA 2XEGA 3B35A 5JGFA 5LYDA 3SJXA 1RTQA 1NSAA 2ZEOA 3SI2A 3WC5A 2ZEPA 1QMUA 1CP7A 3HLPA 2EK9A 3D66A 2AFOA 3EIFA 3JRUA 1CBXA 1Y0YA 3PRTA 4ONWA 4A39A 1XF1A 4C9EA 3FX6A 1YMEA 3KZWA 3H8EA 1DTDA 3TC8A 3CPAA 4P4BA 2ZELA 3ICUA 4K3NA 4NGQA 4P10A 2CIJA 2ZEEA 2AFSA 2V8HA 2IJZA 3D7FA 5ELYA 3RBUA 5JM6A 2PJCA 2CTCA 4OMEA 3SJEA 2O53A 4PXCA 5K8NA 3GLJA 2GLFA 2EK8A 4IK2A 3D68A 2PRQA 5K8OA 1BPMA 3PB6X 1GYTA 8CPAA 4CDKA 3FF3A 3KI9A 4C99A 3B3TA 4R76A 4F9VA 5K8MA 3BI0A 4C9RA 3SJFA 3BXMA 5LRGA 3NH4A 4UEZA 1ELLP 5HVGA 3B3CA 3DGVA 4NGRA 1R3NA 2PJBA 3K9TA 5D8NA 4ZX9A 4F9UA 2PJAA 4CDJA 4P44A 1UWYA 4MCSA 2CF4A 3PBBA 3IFEA 4C9VA 3PBEA 1PCAA 1TF9A 4FAIA 3S9MA 1QQ9A 4C86A 4MCQA 5LYFA 1TKFA 1AMPA 4MHYA 1H8LA 2Q4ZA 2J9AA 4TJVA 2JBJA 5J1QA 4G1PA 1Q7LA 1YW4A 4Q7AA 4ZYQA 1Y7EA 1HDUA 4OC2A 4F8ZA 2RB7A 4JZ0A 4MCPA 4R6TA 3N5FA 3KR4A 2JEWA 3KGQA 4KSIA 3D7HA 3SJGA 7CPAA 2HB6A 4A38A 1CPXA 3FVLA 2GU2A 4C84A 3BI1A 4ZY2A 4C8FA 3HUVA 3LWUA 5F09A 4BD9A 4OC4A 4NGMA 4MHZA 3VH9A 3PFEA 5LRJA 4UF4A 2C1CA 2Q43A 3FEDA 4ZY0A 4OC5A 1IGBA 1HEEA 4NJQA 1LFWA 2QJ8A 3KQZA 1BPNA 4X2TA 4P4EA 2POKA 4OIWA 1BLLE 1LCPA 1Z5RA 1VHOA 4IHMA 3LMSA 4TWEA 4OC3A 3H8GA 2XEIA 4A94A 3MN8A 4C8PA 3IJ3A 3FJUA 2DEAA 3B3VA 1XFOA 1WVMA 5LYIA 2VL1A 2IQ6A 2V77A 2ZEMA 3FMCA 1TKHA 3VARA 5D29A 4P45A 3WC7A 3PEIA 3S9LA 1M4LA 4O23A 1ARMA 2AFMA 4C85A 2RFHA 2PIYA 1VIXA 2NSMA 4C8AA 1AYEA 4PXDA 1LAMA 2WYRA 1ZG8A 4MHPA 3WABA 3ISZA 4FUUA 3SI0A 2HC9A 4C9UA
chains in the Genus database with same CATH superfamily
3L2NA 3TOBA 2X7BA 4ZI6A 1EZAA 5JPHA 2ABZA 4OC1A 2ZENA 3DR6A 3VTAA 2N3AB 3T8WA 1S5KA 5HVFA 4CRZB 2C6GA 1OBRA 2CTBA 4BBHA 1WK4A 3PZJA 4PQAA 2PE3A 1FY7A 1S7NA 4GM5A 4NJQA 5FVJA 5K8PA 1HDQA 1R43A 2FL4A 3IC1A 4NGPA 4Y49B 1F57A 2CNSA 2PJ6A 4X3RA 3KQXA 1ZLIA 3JTKA 2PCUA 3VRQA 1N71A 4M6GA 5F47A 3BJ7A 2Q0YA 2GLJA 3TX8A 1V6CA 4CAFA 3VATA 2DIKA 3B7IA 2AJ6A 3VWEA 1T36B 3SR3A 4A37A 4MBUA 1VHEA 4NGTA 2PJ3A 4MFZA 1KUXA 1UFHA 4PSWA 2DLAA 2Q51A 4KLVA 1XBUA 3B8GA 3KHZA 3V8IA 2G0BA 1Q2DA 4C2XA 4CS0B 2DF5A 4C8UA 5A27A 4OC0A 3NH5A 3TO9A 4X8IA 1WJTA 2C6CA 4NGSA 1YVHA 3EZBA 4E94A 2BO9A 3PB7X 3QAHA 5DWNA 4MXUA 3TT2A 1CPSA 1KUYA 3H4QA 3NE7A 4F0XA 1V0CA 4CYQA 4AVCA 2WPXA 1Z8LA 1TKJA 2NYQA 2V8DA 3I74A 2G3TA 3NH8A 1CE8B 4Y49C 1KZFA 2PC1A 2FS5A 1CX8A 2H5MA 4JD6A 4KVXA 4MFQA 4P6YA 4YWYA 4B10A 2PIZA 4EFDA 3BHXA 3SI1A 4A32A 5THWA 3PLFB 2MP0A 5KTAA 1FNOA 5CNPA 4QVTA 2GREA 2AE6A 1RO5A 2VXKA 3NFZA 4NSQA 4R57A 3WC6A 4UEEA 1GGOA 3HMJG 5F1YA 2YNCC 5F5XA 2B4BA 1CS0B 1Z2LA 3IWEA 4XPDB 4MCRA 3IWGA 5DS0A 5EC4A 4C2ZA 2B5GB 2EWBA 1GHEA 1YK3A 4KLWA 4TJXA 1YR0A 2REEA 2Z3OA 5H86A 4OP4A 1CG2A 2EUIA 2HI6A 5G1ZA 4M85A 3S6GA 1ZG7A 3IEHA 3I3GA 3DDDA 3GYAA 2PJ8A 4KOYA 1CM0A 4FD4A 4NF1A 3KR5A 3B2YA 4R7MA 3SXOA 3TCVA 1JWQA 3V38A 4EWTA 5IB9A 4J0NA 2B5GA 4NGNA 4X5KA 1BXRB 4C9AA 2OLSA 2AFUA 3CXPA 3FIXA 1L0CA 1IYKA 1ON0A 2WSAA 1ZLHA 3QNVA 1M4IA 2V8GA 3KHXA 3DNSA 4U5YA 3RNZA 2ANPA 4DYOA 3BJ8A 1VBHA 4RN7A 4MRIA 2EO8A 4CGOA 1ARLA 3GUXA 3EZAA 3VRNA 1Y7RA 3FH4A 2J8MA 4FWUA 4P4DA 2FSRA 2OR4A 4DUKA 2HV2A 1B47A 1QSTA 1XJOA 2PVWA 1S3ZA 1IIDA 4M6IA 3NOJA 2I79A 4U9ZA 4WJBA 4FBEA 3FB3A 3B3SA 4KUBA 4OKOA 4ZX8A 3NFQA 2J8RA 4PXBA 2J8NA 3W6SA 1M6VB 3CT9A 4R3LA 4CGMA 4C8AA 4UA3A 2XEJA 3I6SA 4MMOA 2WZNA 3PB8X 2OZGA 3TO6A 4B12A 2PR1A 4A4BA 5DWMA 3FBUA 2QYVA 4FD7A 2ZW5A 2VZZA 4LQGA 3CPXA 3ISXA 4H6ZA 3D2MA 4UWJA 3TOAA 4BPUB 4YRHA 2YJVA 1YREA 3PFVA 2G3AA 2PJ4A 1Q5XA 3GB0A 1YGHA 4LQ6A 4PSXA 4R3KA 4RUHA 4Z65A 3WT4A 4YN3A 1LAPA 3TO7A 5HXDA 4LUAA 1YVOA 1TXRA 3D67A 1NSLA 1JDBC 3OB1B 3D8PA 3R1KA 3RAMA 4UIBA 1YVKA 4CPAA 3B3WA 3IO1A 2GFQA 5CBMA 5HVHA 2AFZA 5E96A 4Q38A 3IIBA 3D4UA 4IF5A 3K9UA 4F0YA 2XPNA 4B5PA 3PT1A 3BUXB 5CPAA 2GE3A 4PK3A 4H6UA 4W9YA 2PJ7A 2YGWA 4RI1A 4CAXA 4WWVA 3PFOA 1DE4C 5AGEA 1LANA 1MJ9A 2Z0ZA 3MRUA 4P4IA 3PB4X 1XRYA 5EMIA 5KTCA 4HNYB 1X10A 6CPAA 2PJ5A 2AFXA 1CP6A 4ZY1A 2F8HA 2PQ8A 1TF8A 2Z3LA 4KNGE 4H89A 3TFYA 2PVVA 2PJ1A 3G8WA 4KVME 3OWCA 5LRKA 1S7LA 2B4DA 3P2FA 4KORA 1KEEB 5JH9A 5HKZA 1IYLA 3DLJA 5HMNA 1YSJA 2QIRA 2WUUA 5JYBA 3PB9X 4KOUA 3O8ZA 1ELMP 2O4HA 2ZOGA 3BLNA 2OOTA 3EO4A 2I00A 2C6PA 2Q4VA 2VQYA 4CYOA 5F13A 1PYTB 4COGA 1BO4A 1F2OA 3FNCA 1M1DA 3S9NA 2PJ2A 4TNUA 4C68A 4H2KA 4C7HA 3LACA 1Z4RA 4R8FA 3K4IA 3FECA 1OZPA 2DPSA 2Y1NA 3FEEA 1NXJA 3TLGB 1K4JA 3F0AA 4CGPA 4C2YA 4C8CA 5G21A 3H8FA 2ZOFA 3LD2A 4P4FA 2BCOA 2EBJA 4YU9A 3KKWA 2IMOA 5F48A 2AUMA 2FVGA 4DJLA 3ZNIA 2QVPA 4QB9A 4MJXA 2ZEFA 3TTHA 1ZO0A 4B6ZA 4CAEA 2FE7A 4HPSA 3SHPA 3I1UA 4AB7A 3TLAA 2XEFA 2F7VA 3IWWA 1FT7A 4A4CA 2AFWA 4NJRA 4UFXA 1J3LA 3TLGA 4EMEA 3FYNA 2Z3KA 3K2KA 2ZEDA 4KZTA 1FBVA 4AXVA 4IAVA 4CRYB 2YJTA 4UEFA 2WPWA 3BUWB 1P4NA 1I1DA 3CDXA 4UWIA 3S6KA 5EBVA 4H1HA 2AUNA 2V8VA 1ZG9A 3GY9A 1EE3P 4NFRA 1VGYA 1XMBA 3V7ZA 3KASA 4OIDA 1Y9ZA 2C27A 4Q36A 2ZEHA 1KBLA 1VI4A 1YQEA 1NE9A 2G9DA 2B4DB 1JQGA 4JYWA 4BPXB 3C8OA 1IY7A 1LRZA 1YX0A 3VROA 3KL9A 4MHNA 4KOVA 4MJ8A 4PPZA 5GCNA 3D7DA 1F2PA 2B0AA 1S7FA 2ZW7A 4KSAA 1S60A 1QSOA 4CGLA 4C8TA 3DR8A 3HPHE 1AUGA 1YW6A 1YLOA 1U6MA 1Y0RA 4RR2B 2JBKA 1MJBA 1KWMA 1R57A 3NA6A 2PJ0A 1Z9EA 2Q4YA 2BOAA 2ZEGA 4L8AA 2FIAA 4OAEA 4XPDC 5C88A 1LOKA 3GJZA 1BAVA 4JJXA 5I4MA 4J3GA 3TE4A 4BINA 3VWDA 2PJ9A 3D7GA 3VRPA 4PXEA 4UIAA 2I3CA 3EY5A 4R87A 4P4JA 2P6EA 2E28A 2B4JC 4LX9A 1R61A 4ONUA 4HNXB 2XEGA 3B35A 5JGFA 5IB0A 1IU8A 2D4OA 2YNCA 1XF8A 5LYDA 2O28A 4RS2A 2C5QA 4IIYA 4R9MA 4NXYA 3T5MA 3SJXA 3IU2A 1X12A 4I49A 4HKFA 4BMHA 4B5OA 1C30B 1ZYMA 1RTQA 2OB0A 1NSAA 3TLCA 3T0TA 4OLLA 2ARHA 2ZEOA 1CJWA 3SI2A 4IIXA 3ZZIA 1C3OB 3WC5A 1KC7A 4MFPA 2ZEPA 1QMUA 3D3SA 4M8DA 1EO0A 4E2AA 1CP7A 3JVNA 3HLPA 2EK9A 1Z9UA 5BY0A 3D66A 2AFOA 3I9SA 5J8CA 3HPGG 3EIFA 2ZXVA 4IUSA 3JRUA 1CBXA 1Y0YA 3PRTA 4ONWA 4A39A 1XF1A 4C9EA 3FX6A 1YMEA 4A33A 2ZPAA 3KRVA 4BPWB 3KZWA 3H8EA 1XIXA 2JDCA 1VBGA 4ZBGA 1DTDA 3DSBA 2FIWA 5HH1A 2CNTA 3TC8A 4II9A 3WR7A 3CPAA 2B3UA 1WWZA 2Y1MA 3CZXA 1BOBA 3A9LA 4P4BA 2ZELA 1IICA 2EZCA 3ICUA 1B6BA 4K3NA 4NGQA 4XNHB 1RXTA 4P10A 2CIJA 2ZEEA 1XOVA 2AFSA 2V8HA 2JDDA 2IJZA 2HWGA 3D7FA 5J8FA 4YFJA 4AVBA 5ELYA 2YNEA 3RBUA 5JM6A 2GP4A 2P6GA 2RC4A 4COBA 4ZGYB 2PJCA 2DXQA 4U9YA 2CTCA 4OMEA 3SJEA 2OZUA 2FCKA 3C26A 2EZBA 4B14A 2O53A 2PR8A 4PXCA 4MI1A 2VZYA 4UCPA 4CYPA 5K8NA 2HQYA 2IL4A 4OADA 1Q2CA 3GLJA 2GLFA 4A30A 2EK8A 3GIUA 4MHDA 3LODA 3W6XA 2QECA 3MGDA 3D68A 4IK2A 4GS4A 4ORFA 3TLBA 2PRQA 2R98A 5K8OA 1BPMA 3PB6X 1GYTA 2BL1A 8CPAA 3T05A 4CDKA 3S6FA 2B58A 3CXQA 2K5TA 2P0WA 3FF3A 3KI9A 4C99A 1Y9KA 3B3TA 4E5SA 4R76A 4F9VA 3BUNB 1YLEA 4KOXA 4L89A 3BI0A 4A95A 5K8MA 4KOTA 3T90A 3TLZA 3SJFA 4C9RA 3BXMA 2R1IA 5LRGA 5F49A 5H84A 2FM4A 3NH4A 4UEZA 1ELLP 5HVGA 5C82A 1Z4EA 3B3CA 4NGRA 1R3NA 2PJBA 2REFA 2D4PA 3DGVA 3FRMA 3FXTA 3K9TA 5D8NA 4ZX9A 4F9UA 2PJAA 1I21A 4CDJA 4MY0A 4A2ZA 5A28A 3H5ZA 4P44A 1Z8WA 2PSWA 4PK2A 1UWYA 2OH1A 4MCSA 3EFAA 4MFKA 2Y0MA 5ISVA 2CF4A 1Z8TA 3PBBA 2D0OA 3IFEA 1P0HA 4CO9A 4UFVA 4QC6A 2B3VA 4C9VA 5J3XA 3PBEA 1PCAA 1TF9A 4FAIA 1MK4A 4DNCA 3S9MA 1QQ9A 4MFJA 5AG6A 1NBWA 2D0PA 2X0SA 4C86A 3QAYA 4MI4A 4MCQA 4K30A 1NMTA 3R95A 3G3SA 1IOFA 5LYFA 1TKFA 1AMPA 1A2ZA 2PDOA 2QMLA 4BTFA 1H8LA 4MHYA 1IOIA 3RZAA 2Q4ZA 4A31A 4CAVA 2J9AA 4TJVA 1M4GA 2CNMA 1IB1E 2JBJA 3EZEA 2XPOA 2GIVA 3PP9A 5IV0A 5J1QA 4G1PA 1Q7LA 3U88C 3EC4A 1YW4A 3TLYA 2EVNA 4Q7AA 1EZBA 4ZYQA 1Y7EA 4CAWA 4B11A 5AG7A 1HDUA 1QSMA 2R7HA 4CYNA 2HROA 3TLEA 2PRBA 3CXSA 1SQHA 2OZHA 2Z10A 3PGPA 5F46A 3R9EA 4OC2A 4JXRA 4F8ZA 2RB7A 4JZ0A 4MCPA 4HNWB 4R6TA 4AVAA 3N5FA 3KR4A 3OAKA 5HKWA 4UCNA 3RO0A 2JEWA 3KGQA 4MY3A 4KSIA 5IR2A 3D7HA 4INJA 3SJGA 1J4JA 4KUAA 7CPAA 2HB6A 4M6HA 4A38A 2ODFA 1CPXA 4JWPA 2NMTA 5HKYA 2Z3PA 3FVLA 2GU2A 3EXNA 4C84A 3F5BA 4XPLA 4EYSA 4XPKA 3SXNA 2EZAA 3BI1A 2OU2A 4AG9A 1A9XB 5JVLA 1S7KA 3U1BA 4ZY2A 4C8FA 5AG5A 1ZRSA 1Z8XA 2VI7A 4MFLA 2BUEA 3HUVA 2PCNA 3LWUA 5F09A 4UFWA 5LYLA 2ZW6A 4BD9A 4F6AA 4OC4A 2BEIA 3IGRA 4NGMA 4MHZA 3VH9A 1XMTA 3PFEA 4E0AA 4NEXA 5LRJA 3T9YA 5AXIA 4UF4A 3D2PA 2CBLA 2C1CA 1VHSA 3FEDA 3OP0A 2Q43A 3N7ZA 4KVOE 4YGOA 4OC5A 3VGOA 2Q44A 1IGBA 3JUWA 4NCZA 3R9GA 2Z3NA 1Y9WA 1HEEA 2A4NA 1LFWA 2Q7SA 2QJ8A 2Z3MA 1BPNA 3KQZA 1M4DA 1M44A 2ZW4A 2KCWA 5G22A 4EVYA 3E0KA 3TYXA 4FD5A 2R8VA 4X2TA 2VKZG 4P4EA 2POKA 3GKRA 4OIWA 1BLLE 3W91A 4AG7A 1Q2YA 1LCPA 1Z5RA 2ATRA 1VHOA 4IHMA 2YNDA 2Z11A 3QB8A 3LMSA 2UV8G 4OC3A 4TWEA 2XPPA 3F9KC 2VEZA 2XEIA 3H8GA 5JQ4A 4A94A 3MN8A 4C8PA 4B13A 2FT0A 3IJ3A 3FJUA 3R9FA 3UY5A 4QBJA 2DEAA 5G20A 5K99A 2HUZA 2P6FA 1PU9A 2VBQA 2Q7BA 3NE8A 4CZ1A 5FD8A 3B3VA 3BUOB 5BWAB 2BSWA 1XFOA 4E8OA 1WVMA 5LYIA 2VL1A 2DPTA 1MJAA 4ZY0A 5I0CA 2IQ6A 2V77A 3IU1A 2JLMA 3OB2B 4CGNA 4KS9A 5AG4A 3G23A 3S6HA 2Q04A 2ZEMA 3FMCA 1QSRA 1TKHA 4UBRA 4XNHC 3VARA 3ZJ0A 4KSFA 4GPLB 4GXHA 5D29A 3VRRA 4FD6A 4P45A 4KOSA 3BUMB 1QSNA 1VKCA 3WC7A 2FXFA 3T07A 3PEIA 3S9LA 1M4LA 4O23A 4UCMA 1ARMA 1KUVA 3R96A 2AFMA 4M3SA 4C85A 4JVOA 1B87A 2JEVA 2RFHA 4KOWA 4PV6A 1ZL0A 2PIYA 2F5IA 1I12A 1VIXA 1XE4A 2CY2A 2NSMA 2XPLA 4JLYA 4QUSA 3RYOA 4C7IA 1AYEA 5KTDA 2GANA 4PXDA 4B5PB 1LAMA 5F9MA 2WYRA 2R82A 1ZG8A 4MHPA 3WABA 2CXAA 3ISZA 1TIQA 5IX3A 1DIKA 1XEBA 3P2HA 4FUUA 1PUAA 3SI0A 4JXQA 2HC9A 4C9UA 1JDEA 3F8KA
chains in the Genus database with same CATH topology
3L2NA 4ZI6A 2ABZA 4OC1A 2ZENA 3VTAA 3T8WA 5HVFA 2C6GA 1OBRA 2CTBA 4PQAA 2PE3A 4GM5A 5K8PA 1HDQA 1R43A 3IC1A 4NGPA 1F57A 2PJ6A 3KQXA 4X3RA 1ZLIA 2PCUA 2GLJA 3TX8A 1V6CA 3VATA 3B7IA 4A37A 1VHEA 4NGTA 2PJ3A 2Q51A 1XBUA 3KHZA 4C8UA 4OC0A 3NH5A 4X8IA 2C6CA 4NGSA 2BO9A 3PB7X 4MXUA 1CPSA 3I74A 1Z8LA 1TKJA 2NYQA 2V8DA 3NH8A 1CX8A 4P6YA 4EFDA 4YWYA 2PIZA 3BHXA 3SI1A 5THWA 1FNOA 2GREA 3NFZA 3WC6A 4UEEA 1Z2LA 4MCRA 5DS0A 2EWBA 4TJXA 4OP4A 1CG2A 1ZG7A 3IEHA 2PJ8A 4R7MA 3V38A 3KR5A 3B2YA 4EWTA 5IB9A 4NGNA 4C9AA 2AFUA 3QNVA 1ZLHA 2V8GA 4DYOA 3KHXA 2ANPA 4MRIA 1ARLA 3GUXA 4FWUA 3FH4A 4P4DA 2OR4A 4DUKA 1XJOA 2PVWA 4WJBA 4FBEA 3B3SA 4OKOA 4ZX8A 4PXBA 3CT9A 3I6SA 2XEJA 4MMOA 2WZNA 3PB8X 3RZAA 2QYVA 3CPXA 4LQGA 3ISXA 2PJ4A 3GB0A 4Z65A 4YN3A 4RUHA 3WT4A 1LAPA 5HXDA 1TXRA 3D67A 3RAMA 4UIBA 4CPAA 3B3WA 3IO1A 5CBMA 5HVHA 2AFZA 3IIBA 3D4UA 5CPAA 4W9YA 2PJ7A 4WWVA 3PFOA 1DE4C 1LANA 3MRUA 4P4IA 3PB4X 1XRYA 6CPAA 2PJ5A 2AFXA 1CP6A 4ZY1A 2F8HA 1TF8A 4KNGE 2PVVA 2PJ1A 5LRKA 5JH9A 3DLJA 1YSJA 3PB9X 1ELMP 2O4HA 2ZOGA 2OOTA 2C6PA 1PYTB 1F2OA 3S9NA 2PJ2A 4TNUA 4H2KA 4R8FA 3FECA 3FEEA 4C8CA 3H8FA 2ZOFA 4P4FA 2BCOA 4YU9A 2IMOA 2FVGA 4DJLA 2QVPA 2ZEFA 4B6ZA 3I1UA 2XEFA 2F7VA 3IWWA 1FT7A 2AFWA 4NJRA 4EMEA 3K2KA 2ZEDA 4AXVA 4IAVA 4UEFA 3CDXA 2V8VA 1ZG9A 4NFRA 1EE3P 1VGYA 1XMBA 3V7ZA 3KASA 4OIDA 1Y9ZA 2ZEHA 2G9DA 1JQGA 4JYWA 1IY7A 3KL9A 4MHNA 4PPZA 3D7DA 1F2PA 4C8TA 1YW6A 1YLOA 1Y0RA 2JBKA 3NA6A 1KWMA 5LYLA 2PJ0A 2ZEGA 2BOAA 1LOKA 1BAVA 5I4MA 2PJ9A 3D7GA 4UIAA 4PXEA 2I3CA 4P4JA 2XEGA 3B35A 5JGFA 5LYDA 2C5QA 3SJXA 1RTQA 1NSAA 2ZEOA 3SI2A 3WC5A 2ZEPA 1QMUA 1CP7A 3HLPA 2EK9A 3D66A 2AFOA 3EIFA 3JRUA 1CBXA 1Y0YA 3PRTA 4ONWA 4A39A 1XF1A 4C9EA 3FX6A 1YMEA 3KZWA 3H8EA 1DTDA 3TC8A 3CPAA 4P4BA 2ZELA 3ICUA 4K3NA 4NGQA 4P10A 2CIJA 2ZEEA 2AFSA 2V8HA 2IJZA 3D7FA 5ELYA 3RBUA 5JM6A 2GP4A 2PJCA 2CTCA 4OMEA 3SJEA 2O53A 4PXCA 5K8NA 3GLJA 2GLFA 2EK8A 4IK2A 3D68A 2PRQA 5K8OA 1BPMA 3PB6X 1GYTA 8CPAA 4CDKA 3FF3A 3KI9A 4C99A 3B3TA 4R76A 4F9VA 5K8MA 3BI0A 4C9RA 3SJFA 3BXMA 5LRGA 3NH4A 4UEZA 1ELLP 5HVGA 3B3CA 3DGVA 4NGRA 1R3NA 2PJBA 3K9TA 5D8NA 4ZX9A 4F9UA 2PJAA 4CDJA 4P44A 1UWYA 4MCSA 2CF4A 3PBBA 3IFEA 4C9VA 3PBEA 1PCAA 1TF9A 4FAIA 3S9MA 1QQ9A 4C86A 4MCQA 5LYFA 1TKFA 1AMPA 4MHYA 1H8LA 2Q4ZA 2J9AA 4TJVA 2JBJA 5J1QA 4G1PA 1Q7LA 1YW4A 4Q7AA 4ZYQA 1Y7EA 1HDUA 4OC2A 4F8ZA 2RB7A 4JZ0A 4MCPA 4R6TA 3N5FA 3KR4A 2JEWA 3KGQA 4KSIA 5IR2A 3D7HA 3SJGA 7CPAA 2HB6A 4A38A 1CPXA 3FVLA 2GU2A 4C84A 3BI1A 4ZY2A 4C8FA 3HUVA 3LWUA 5F09A 4BD9A 4OC4A 4NGMA 4MHZA 3VH9A 3PFEA 5LRJA 4UF4A 2C1CA 2Q43A 3FEDA 4ZY0A 4OC5A 1IGBA 1HEEA 4NJQA 1LFWA 2QJ8A 3KQZA 1BPNA 4X2TA 4P4EA 2POKA 4OIWA 1BLLE 1LCPA 1Z5RA 1VHOA 4IHMA 3LMSA 4TWEA 4OC3A 3H8GA 2XEIA 4A94A 3MN8A 4C8PA 3IJ3A 3FJUA 2DEAA 3B3VA 1XFOA 1WVMA 5LYIA 2VL1A 2IQ6A 2V77A 2ZEMA 3FMCA 1TKHA 3VARA 5D29A 4P45A 3WC7A 3PEIA 3S9LA 1M4LA 4O23A 1ARMA 2AFMA 4C85A 2RFHA 2PIYA 1VIXA 2NSMA 4C8AA 1AYEA 4PXDA 1LAMA 2WYRA 1ZG8A 4MHPA 3WABA 3ISZA 4FUUA 3SI0A 2HC9A 4C9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2N A;  4ZI6 A;  2ABZ A;  4OC1 A;  2ZEN A;  3VTA A;  3T8W A;  5HVF A;  2C6G A;  1OBR A;  2CTB A;  4PQA A;  2PE3 A;  4GM5 A;  5K8P A;  1HDQ A;  1R43 A;  3IC1 A;  4NGP A;  1F57 A;  2PJ6 A;  3KQX A;  4X3R A;  1ZLI A;  2PCU A;  2GLJ A;  3TX8 A;  1V6C A;  3VAT A;  3B7I A;  4A37 A;  1VHE A;  4NGT A;  2PJ3 A;  2Q51 A;  1XBU A;  3KHZ A;  4C8U A;  4OC0 A;  3NH5 A;  4X8I A;  2C6C A;  4NGS A;  2BO9 A;  3PB7 X;  4MXU A;  1CPS A;  3I74 A;  1Z8L A;  1TKJ A;  2NYQ A;  2V8D A;  3NH8 A;  1CX8 A;  4P6Y A;  4EFD A;  4YWY A;  2PIZ A;  3BHX A;  3SI1 A;  5THW A;  1FNO A;  2GRE A;  3NFZ A;  3WC6 A;  4UEE A;  1Z2L A;  4MCR A;  5DS0 A;  2EWB A;  4TJX A;  4OP4 A;  1CG2 A;  1ZG7 A;  3IEH A;  2PJ8 A;  4R7M A;  3V38 A;  3KR5 A;  3B2Y A;  4EWT A;  5IB9 A;  4NGN A;  4C9A A;  2AFU A;  3QNV A;  1ZLH A;  2V8G A;  4DYO A;  3KHX A;  2ANP A;  4MRI A;  1ARL A;  3GUX A;  4FWU A;  3FH4 A;  4P4D A;  2OR4 A;  4DUK A;  1XJO A;  2PVW A;  4WJB A;  4FBE A;  3B3S A;  4OKO A;  4ZX8 A;  4PXB A;  3CT9 A;  3I6S A;  2XEJ A;  4MMO A;  2WZN A;  3PB8 X;  3RZA A;  2QYV A;  3CPX A;  4LQG A;  3ISX A;  2PJ4 A;  3GB0 A;  4Z65 A;  4YN3 A;  4RUH A;  3WT4 A;  1LAP A;  5HXD A;  1TXR A;  3D67 A;  3RAM A;  4UIB A;  4CPA A;  3B3W A;  3IO1 A;  5CBM A;  5HVH A;  2AFZ A;  3IIB A;  3D4U A;  5CPA A;  4W9Y A;  2PJ7 A;  4WWV A;  3PFO A;  1DE4 C;  1LAN A;  3MRU A;  4P4I A;  3PB4 X;  1XRY A;  6CPA A;  2PJ5 A;  2AFX A;  1CP6 A;  4ZY1 A;  2F8H A;  1TF8 A;  4KNG E;  2PVV A;  2PJ1 A;  5LRK A;  5JH9 A;  3DLJ A;  1YSJ A;  3PB9 X;  1ELM P;  2O4H A;  2ZOG A;  2OOT A;  2C6P A;  1PYT B;  1F2O A;  3S9N A;  2PJ2 A;  4TNU A;  4H2K A;  4R8F A;  3FEC A;  3FEE A;  4C8C A;  3H8F A;  2ZOF A;  4P4F A;  2BCO A;  4YU9 A;  2IMO A;  2FVG A;  4DJL A;  2QVP A;  2ZEF A;  4B6Z A;  3I1U A;  2XEF A;  2F7V A;  3IWW A;  1FT7 A;  2AFW A;  4NJR A;  4EME A;  3K2K A;  2ZED A;  4AXV A;  4IAV A;  4UEF A;  3CDX A;  2V8V A;  1ZG9 A;  4NFR A;  1EE3 P;  1VGY A;  1XMB A;  3V7Z A;  3KAS A;  4OID A;  1Y9Z A;  2ZEH A;  2G9D A;  1JQG A;  4JYW A;  1IY7 A;  3KL9 A;  4MHN A;  4PPZ A;  3D7D A;  1F2P A;  4C8T A;  1YW6 A;  1YLO A;  1Y0R A;  2JBK A;  3NA6 A;  1KWM A;  5LYL A;  2PJ0 A;  2ZEG A;  2BOA A;  1LOK A;  1BAV A;  5I4M A;  2PJ9 A;  3D7G A;  4UIA A;  4PXE A;  2I3C A;  4P4J A;  2XEG A;  3B35 A;  5JGF A;  5LYD A;  3SJX A;  1RTQ A;  1NSA A;  2ZEO A;  3SI2 A;  3WC5 A;  2ZEP A;  1QMU A;  1CP7 A;  3HLP A;  2EK9 A;  3D66 A;  2AFO A;  3EIF A;  3JRU A;  1CBX A;  1Y0Y A;  3PRT A;  4ONW A;  4A39 A;  1XF1 A;  4C9E A;  3FX6 A;  1YME A;  3KZW A;  3H8E A;  1DTD A;  3TC8 A;  3CPA A;  4P4B A;  2ZEL A;  3ICU A;  4K3N A;  4NGQ A;  4P10 A;  2CIJ A;  2ZEE A;  2AFS A;  2V8H A;  2IJZ A;  3D7F A;  5ELY A;  3RBU A;  5JM6 A;  2PJC A;  2CTC A;  4OME A;  3SJE A;  2O53 A;  4PXC A;  5K8N A;  3GLJ A;  2GLF A;  2EK8 A;  4IK2 A;  3D68 A;  2PRQ A;  5K8O A;  1BPM A;  3PB6 X;  1GYT A;  8CPA A;  4CDK A;  3FF3 A;  3KI9 A;  4C99 A;  3B3T A;  4R76 A;  4F9V A;  5K8M A;  3BI0 A;  4C9R A;  3SJF A;  3BXM A;  5LRG A;  3NH4 A;  4UEZ A;  1ELL P;  5HVG A;  3B3C A;  3DGV A;  4NGR A;  1R3N A;  2PJB A;  3K9T A;  5D8N A;  4ZX9 A;  4F9U A;  2PJA A;  4CDJ A;  4P44 A;  1UWY A;  4MCS A;  2CF4 A;  3PBB A;  3IFE A;  4C9V A;  3PBE A;  1PCA A;  1TF9 A;  4FAI A;  3S9M A;  1QQ9 A;  4C86 A;  4MCQ A;  5LYF A;  1TKF A;  1AMP A;  4MHY A;  1H8L A;  2Q4Z A;  2J9A A;  4TJV A;  2JBJ A;  5J1Q A;  4G1P A;  1Q7L A;  1YW4 A;  4Q7A A;  4ZYQ A;  1Y7E A;  1HDU A;  4OC2 A;  4F8Z A;  2RB7 A;  4JZ0 A;  4MCP A;  4R6T A;  3N5F A;  3KR4 A;  2JEW A;  3KGQ A;  4KSI A;  3D7H A;  3SJG A;  7CPA A;  2HB6 A;  4A38 A;  1CPX A;  3FVL A;  2GU2 A;  4C84 A;  3BI1 A;  4ZY2 A;  4C8F A;  3HUV A;  3LWU A;  5F09 A;  4BD9 A;  4OC4 A;  4NGM A;  4MHZ A;  3VH9 A;  3PFE A;  5LRJ A;  4UF4 A;  2C1C A;  2Q43 A;  3FED A;  4ZY0 A;  4OC5 A;  1IGB A;  1HEE A;  4NJQ A;  1LFW A;  2QJ8 A;  3KQZ A;  1BPN A;  4X2T A;  4P4E A;  2POK A;  4OIW A;  1BLL E;  1LCP A;  1Z5R A;  1VHO A;  4IHM A;  3LMS A;  4TWE A;  4OC3 A;  3H8G A;  2XEI A;  4A94 A;  3MN8 A;  4C8P A;  3IJ3 A;  3FJU A;  2DEA A;  3B3V A;  1XFO A;  1WVM A;  5LYI A;  2VL1 A;  2IQ6 A;  2V77 A;  2ZEM A;  3FMC A;  1TKH A;  3VAR A;  5D29 A;  4P45 A;  3WC7 A;  3PEI A;  3S9L A;  1M4L A;  4O23 A;  1ARM A;  2AFM A;  4C85 A;  2RFH A;  2PIY A;  1VIX A;  2NSM A;  4C8A A;  1AYE A;  4PXD A;  1LAM A;  2WYR A;  1ZG8 A;  4MHP A;  3WAB A;  3ISZ A;  4FUU A;  3SI0 A;  2HC9 A;  4C9U A; 
#chains in the Genus database with same CATH topology
 3L2N A;  3TOB A;  2X7B A;  4ZI6 A;  1EZA A;  5JPH A;  2ABZ A;  4OC1 A;  2ZEN A;  3DR6 A;  3VTA A;  2N3A B;  3T8W A;  1S5K A;  5HVF A;  4CRZ B;  2C6G A;  1OBR A;  2CTB A;  4BBH A;  1WK4 A;  3PZJ A;  4PQA A;  2PE3 A;  1FY7 A;  1S7N A;  4GM5 A;  4NJQ A;  5FVJ A;  5K8P A;  1HDQ A;  1R43 A;  2FL4 A;  3IC1 A;  4NGP A;  4Y49 B;  1F57 A;  2CNS A;  2PJ6 A;  4X3R A;  3KQX A;  1ZLI A;  3JTK A;  2PCU A;  3VRQ A;  1N71 A;  4M6G A;  5F47 A;  3BJ7 A;  2Q0Y A;  2GLJ A;  3TX8 A;  1V6C A;  4CAF A;  3VAT A;  2DIK A;  3B7I A;  2AJ6 A;  3VWE A;  1T36 B;  3SR3 A;  4A37 A;  4MBU A;  1VHE A;  4NGT A;  2PJ3 A;  4MFZ A;  1KUX A;  1UFH A;  4PSW A;  2DLA A;  2Q51 A;  4KLV A;  1XBU A;  3B8G A;  3KHZ A;  3V8I A;  2G0B A;  1Q2D A;  4C2X A;  4CS0 B;  2DF5 A;  4C8U A;  5A27 A;  4OC0 A;  3NH5 A;  3TO9 A;  4X8I A;  1WJT A;  2C6C A;  4NGS A;  1YVH A;  3EZB A;  4E94 A;  2BO9 A;  3PB7 X;  3QAH A;  5DWN A;  4MXU A;  3TT2 A;  1CPS A;  1KUY A;  3H4Q A;  3NE7 A;  4F0X A;  1V0C A;  4CYQ A;  4AVC A;  2WPX A;  1Z8L A;  1TKJ A;  2NYQ A;  2V8D A;  3I74 A;  2G3T A;  3NH8 A;  1CE8 B;  4Y49 C;  1KZF A;  2PC1 A;  2FS5 A;  1CX8 A;  2H5M A;  4JD6 A;  4KVX A;  4MFQ A;  4P6Y A;  4YWY A;  4B10 A;  2PIZ A;  4EFD A;  3BHX A;  3SI1 A;  4A32 A;  5THW A;  3PLF B;  2MP0 A;  5KTA A;  1FNO A;  5CNP A;  4QVT A;  2GRE A;  2AE6 A;  1RO5 A;  2VXK A;  3NFZ A;  4NSQ A;  4R57 A;  3WC6 A;  4UEE A;  1GGO A;  3HMJ G;  5F1Y A;  2YNC C;  5F5X A;  2B4B A;  1CS0 B;  1Z2L A;  3IWE A;  4XPD B;  4MCR A;  3IWG A;  5DS0 A;  5EC4 A;  4C2Z A;  2B5G B;  2EWB A;  1GHE A;  1YK3 A;  4KLW A;  4TJX A;  1YR0 A;  2REE A;  2Z3O A;  5H86 A;  4OP4 A;  1CG2 A;  2EUI A;  2HI6 A;  5G1Z A;  4M85 A;  3S6G A;  1ZG7 A;  3IEH A;  3I3G A;  3DDD A;  3GYA A;  2PJ8 A;  4KOY A;  1CM0 A;  4FD4 A;  4NF1 A;  3KR5 A;  3B2Y A;  4R7M A;  3SXO A;  3TCV A;  1JWQ A;  3V38 A;  4EWT A;  5IB9 A;  4J0N A;  2B5G A;  4NGN A;  4X5K A;  1BXR B;  4C9A A;  2OLS A;  2AFU A;  3CXP A;  3FIX A;  1L0C A;  1IYK A;  1ON0 A;  2WSA A;  1ZLH A;  3QNV A;  1M4I A;  2V8G A;  3KHX A;  3DNS A;  4U5Y A;  3RNZ A;  2ANP A;  4DYO A;  3BJ8 A;  1VBH A;  4RN7 A;  4MRI A;  2EO8 A;  4CGO A;  1ARL A;  3GUX A;  3EZA A;  3VRN A;  1Y7R A;  3FH4 A;  2J8M A;  4FWU A;  4P4D A;  2FSR A;  2OR4 A;  4DUK A;  2HV2 A;  1B47 A;  1QST A;  1XJO A;  2PVW A;  1S3Z A;  1IID A;  4M6I A;  3NOJ A;  2I79 A;  4U9Z A;  4WJB A;  4FBE A;  3FB3 A;  3B3S A;  4KUB A;  4OKO A;  4ZX8 A;  3NFQ A;  2J8R A;  4PXB A;  2J8N A;  3W6S A;  1M6V B;  3CT9 A;  4R3L A;  4CGM A;  4C8A A;  4UA3 A;  2XEJ A;  3I6S A;  4MMO A;  2WZN A;  3PB8 X;  2OZG A;  3TO6 A;  4B12 A;  2PR1 A;  4A4B A;  5DWM A;  3FBU A;  2QYV A;  4FD7 A;  2ZW5 A;  2VZZ A;  4LQG A;  3CPX A;  3ISX A;  4H6Z A;  3D2M A;  4UWJ A;  3TOA A;  4BPU B;  4YRH A;  2YJV A;  1YRE A;  3PFV A;  2G3A A;  2PJ4 A;  1Q5X A;  3GB0 A;  1YGH A;  4LQ6 A;  4PSX A;  4R3K A;  4RUH A;  4Z65 A;  3WT4 A;  4YN3 A;  1LAP A;  3TO7 A;  5HXD A;  4LUA A;  1YVO A;  1TXR A;  3D67 A;  1NSL A;  1JDB C;  3OB1 B;  3D8P A;  3R1K A;  3RAM A;  4UIB A;  1YVK A;  4CPA A;  3B3W A;  3IO1 A;  2GFQ A;  5CBM A;  5HVH A;  2AFZ A;  5E96 A;  4Q38 A;  3IIB A;  3D4U A;  4IF5 A;  3K9U A;  4F0Y A;  2XPN A;  4B5P A;  3PT1 A;  3BUX B;  5CPA A;  2GE3 A;  4PK3 A;  4H6U A;  4W9Y A;  2PJ7 A;  2YGW A;  4RI1 A;  4CAX A;  4WWV A;  3PFO A;  1DE4 C;  5AGE A;  1LAN A;  1MJ9 A;  2Z0Z A;  3MRU A;  4P4I A;  3PB4 X;  1XRY A;  5EMI A;  5KTC A;  4HNY B;  1X10 A;  6CPA A;  2PJ5 A;  2AFX A;  1CP6 A;  4ZY1 A;  2F8H A;  2PQ8 A;  1TF8 A;  2Z3L A;  4KNG E;  4H89 A;  3TFY A;  2PVV A;  2PJ1 A;  3G8W A;  4KVM E;  3OWC A;  5LRK A;  1S7L A;  2B4D A;  3P2F A;  4KOR A;  1KEE B;  5JH9 A;  5HKZ A;  1IYL A;  3DLJ A;  5HMN A;  1YSJ A;  2QIR A;  2WUU A;  5JYB A;  3PB9 X;  4KOU A;  3O8Z A;  1ELM P;  2O4H A;  2ZOG A;  3BLN A;  2OOT A;  3EO4 A;  2I00 A;  2C6P A;  2Q4V A;  2VQY A;  4CYO A;  5F13 A;  1PYT B;  4COG A;  1BO4 A;  1F2O A;  3FNC A;  1M1D A;  3S9N A;  2PJ2 A;  4TNU A;  4C68 A;  4H2K A;  4C7H A;  3LAC A;  1Z4R A;  4R8F A;  3K4I A;  3FEC A;  1OZP A;  2DPS A;  2Y1N A;  3FEE A;  1NXJ A;  3TLG B;  1K4J A;  3F0A A;  4CGP A;  4C2Y A;  4C8C A;  5G21 A;  3H8F A;  2ZOF A;  3LD2 A;  4P4F A;  2BCO A;  2EBJ A;  4YU9 A;  3KKW A;  2IMO A;  5F48 A;  2AUM A;  2FVG A;  4DJL A;  3ZNI A;  2QVP A;  4QB9 A;  4MJX A;  2ZEF A;  3TTH A;  1ZO0 A;  4B6Z A;  4CAE A;  2FE7 A;  4HPS A;  3SHP A;  3I1U A;  4AB7 A;  3TLA A;  2XEF A;  2F7V A;  3IWW A;  1FT7 A;  4A4C A;  2AFW A;  4NJR A;  4UFX A;  1J3L A;  3TLG A;  4EME A;  3FYN A;  2Z3K A;  3K2K A;  2ZED A;  4KZT A;  1FBV A;  4AXV A;  4IAV A;  4CRY B;  2YJT A;  4UEF A;  2WPW A;  3BUW B;  1P4N A;  1I1D A;  3CDX A;  4UWI A;  3S6K A;  5EBV A;  4H1H A;  2AUN A;  2V8V A;  1ZG9 A;  3GY9 A;  1EE3 P;  4NFR A;  1VGY A;  1XMB A;  3V7Z A;  3KAS A;  4OID A;  1Y9Z A;  2C27 A;  4Q36 A;  2ZEH A;  1KBL A;  1VI4 A;  1YQE A;  1NE9 A;  2G9D A;  2B4D B;  1JQG A;  4JYW A;  4BPX B;  3C8O A;  1IY7 A;  1LRZ A;  1YX0 A;  3VRO A;  3KL9 A;  4MHN A;  4KOV A;  4MJ8 A;  4PPZ A;  5GCN A;  3D7D A;  1F2P A;  2B0A A;  1S7F A;  2ZW7 A;  4KSA A;  1S60 A;  1QSO A;  4CGL A;  4C8T A;  3DR8 A;  3HPH E;  1AUG A;  1YW6 A;  1YLO A;  1U6M A;  1Y0R A;  4RR2 B;  2JBK A;  1MJB A;  1KWM A;  1R57 A;  3NA6 A;  2PJ0 A;  1Z9E A;  2Q4Y A;  2BOA A;  2ZEG A;  4L8A A;  2FIA A;  4OAE A;  4XPD C;  5C88 A;  1LOK A;  3GJZ A;  1BAV A;  4JJX A;  5I4M A;  4J3G A;  3TE4 A;  4BIN A;  3VWD A;  2PJ9 A;  3D7G A;  3VRP A;  4PXE A;  4UIA A;  2I3C A;  3EY5 A;  4R87 A;  4P4J A;  2P6E A;  2E28 A;  2B4J C;  4LX9 A;  1R61 A;  4ONU A;  4HNX B;  2XEG A;  3B35 A;  5JGF A;  5IB0 A;  1IU8 A;  2D4O A;  2YNC A;  1XF8 A;  5LYD A;  2O28 A;  4RS2 A;  2C5Q A;  4IIY A;  4R9M A;  4NXY A;  3T5M A;  3SJX A;  3IU2 A;  1X12 A;  4I49 A;  4HKF A;  4BMH A;  4B5O A;  1C30 B;  1ZYM A;  1RTQ A;  2OB0 A;  1NSA A;  3TLC A;  3T0T A;  4OLL A;  2ARH A;  2ZEO A;  1CJW A;  3SI2 A;  4IIX A;  3ZZI A;  1C3O B;  3WC5 A;  1KC7 A;  4MFP A;  2ZEP A;  1QMU A;  3D3S A;  4M8D A;  1EO0 A;  4E2A A;  1CP7 A;  3JVN A;  3HLP A;  2EK9 A;  1Z9U A;  5BY0 A;  3D66 A;  2AFO A;  3I9S A;  5J8C A;  3HPG G;  3EIF A;  2ZXV A;  4IUS A;  3JRU A;  1CBX A;  1Y0Y A;  3PRT A;  4ONW A;  4A39 A;  1XF1 A;  4C9E A;  3FX6 A;  1YME A;  4A33 A;  2ZPA A;  3KRV A;  4BPW B;  3KZW A;  3H8E A;  1XIX A;  2JDC A;  1VBG A;  4ZBG A;  1DTD A;  3DSB A;  2FIW A;  5HH1 A;  2CNT A;  3TC8 A;  4II9 A;  3WR7 A;  3CPA A;  2B3U A;  1WWZ A;  2Y1M A;  3CZX A;  1BOB A;  3A9L A;  4P4B A;  2ZEL A;  1IIC A;  2EZC A;  3ICU A;  1B6B A;  4K3N A;  4NGQ A;  4XNH B;  1RXT A;  4P10 A;  2CIJ A;  2ZEE A;  1XOV A;  2AFS A;  2V8H A;  2JDD A;  2IJZ A;  2HWG A;  3D7F A;  5J8F A;  4YFJ A;  4AVB A;  5ELY A;  2YNE A;  3RBU A;  5JM6 A;  2GP4 A;  2P6G A;  2RC4 A;  4COB A;  4ZGY B;  2PJC A;  2DXQ A;  4U9Y A;  2CTC A;  4OME A;  3SJE A;  2OZU A;  2FCK A;  3C26 A;  2EZB A;  4B14 A;  2O53 A;  2PR8 A;  4PXC A;  4MI1 A;  2VZY A;  4UCP A;  4CYP A;  5K8N A;  2HQY A;  2IL4 A;  4OAD A;  1Q2C A;  3GLJ A;  2GLF A;  4A30 A;  2EK8 A;  3GIU A;  4MHD A;  3LOD A;  3W6X A;  2QEC A;  3MGD A;  3D68 A;  4IK2 A;  4GS4 A;  4ORF A;  3TLB A;  2PRQ A;  2R98 A;  5K8O A;  1BPM A;  3PB6 X;  1GYT A;  2BL1 A;  8CPA A;  3T05 A;  4CDK A;  3S6F A;  2B58 A;  3CXQ A;  2K5T A;  2P0W A;  3FF3 A;  3KI9 A;  4C99 A;  1Y9K A;  3B3T A;  4E5S A;  4R76 A;  4F9V A;  3BUN B;  1YLE A;  4KOX A;  4L89 A;  3BI0 A;  4A95 A;  5K8M A;  4KOT A;  3T90 A;  3TLZ A;  3SJF A;  4C9R A;  3BXM A;  2R1I A;  5LRG A;  5F49 A;  5H84 A;  2FM4 A;  3NH4 A;  4UEZ A;  1ELL P;  5HVG A;  5C82 A;  1Z4E A;  3B3C A;  4NGR A;  1R3N A;  2PJB A;  2REF A;  2D4P A;  3DGV A;  3FRM A;  3FXT A;  3K9T A;  5D8N A;  4ZX9 A;  4F9U A;  2PJA A;  1I21 A;  4CDJ A;  4MY0 A;  4A2Z A;  5A28 A;  3H5Z A;  4P44 A;  1Z8W A;  2PSW A;  4PK2 A;  1UWY A;  2OH1 A;  4MCS A;  3EFA A;  4MFK A;  2Y0M A;  5ISV A;  2CF4 A;  1Z8T A;  3PBB A;  2D0O A;  3IFE A;  1P0H A;  4CO9 A;  4UFV A;  4QC6 A;  2B3V A;  4C9V A;  5J3X A;  3PBE A;  1PCA A;  1TF9 A;  4FAI A;  1MK4 A;  4DNC A;  3S9M A;  1QQ9 A;  4MFJ A;  5AG6 A;  1NBW A;  2D0P A;  2X0S A;  4C86 A;  3QAY A;  4MI4 A;  4MCQ A;  4K30 A;  1NMT A;  3R95 A;  3G3S A;  1IOF A;  5LYF A;  1TKF A;  1AMP A;  1A2Z A;  2PDO A;  2QML A;  4BTF A;  1H8L A;  4MHY A;  1IOI A;  3RZA A;  2Q4Z A;  4A31 A;  4CAV A;  2J9A A;  4TJV A;  1M4G A;  2CNM A;  1IB1 E;  2JBJ A;  3EZE A;  2XPO A;  2GIV A;  3PP9 A;  5IV0 A;  5J1Q A;  4G1P A;  1Q7L A;  3U88 C;  3EC4 A;  1YW4 A;  3TLY A;  2EVN A;  4Q7A A;  1EZB A;  4ZYQ A;  1Y7E A;  4CAW A;  4B11 A;  5AG7 A;  1HDU A;  1QSM A;  2R7H A;  4CYN A;  2HRO A;  3TLE A;  2PRB A;  3CXS A;  1SQH A;  2OZH A;  2Z10 A;  3PGP A;  5F46 A;  3R9E A;  4OC2 A;  4JXR A;  4F8Z A;  2RB7 A;  4JZ0 A;  4MCP A;  4HNW B;  4R6T A;  4AVA A;  3N5F A;  3KR4 A;  3OAK A;  5HKW A;  4UCN A;  3RO0 A;  2JEW A;  3KGQ A;  4MY3 A;  4KSI A;  5IR2 A;  3D7H A;  4INJ A;  3SJG A;  1J4J A;  4KUA A;  7CPA A;  2HB6 A;  4M6H A;  4A38 A;  2ODF A;  1CPX A;  4JWP A;  2NMT A;  5HKY A;  2Z3P A;  3FVL A;  2GU2 A;  3EXN A;  4C84 A;  3F5B A;  4XPL A;  4EYS A;  4XPK A;  3SXN A;  2EZA A;  3BI1 A;  2OU2 A;  4AG9 A;  1A9X B;  5JVL A;  1S7K A;  3U1B A;  4ZY2 A;  4C8F A;  5AG5 A;  1ZRS A;  1Z8X A;  2VI7 A;  4MFL A;  2BUE A;  3HUV A;  2PCN A;  3LWU A;  5F09 A;  4UFW A;  5LYL A;  2ZW6 A;  4BD9 A;  4F6A A;  4OC4 A;  2BEI A;  3IGR A;  4NGM A;  4MHZ A;  3VH9 A;  1XMT A;  3PFE A;  4E0A A;  4NEX A;  5LRJ A;  3T9Y A;  5AXI A;  4UF4 A;  3D2P A;  2CBL A;  2C1C A;  1VHS A;  3FED A;  3OP0 A;  2Q43 A;  3N7Z A;  4KVO E;  4YGO A;  4OC5 A;  3VGO A;  2Q44 A;  1IGB A;  3JUW A;  4NCZ A;  3R9G A;  2Z3N A;  1Y9W A;  1HEE A;  2A4N A;  1LFW A;  2Q7S A;  2QJ8 A;  2Z3M A;  1BPN A;  3KQZ A;  1M4D A;  1M44 A;  2ZW4 A;  2KCW A;  5G22 A;  4EVY A;  3E0K A;  3TYX A;  4FD5 A;  2R8V A;  4X2T A;  2VKZ G;  4P4E A;  2POK A;  3GKR A;  4OIW A;  1BLL E;  3W91 A;  4AG7 A;  1Q2Y A;  1LCP A;  1Z5R A;  2ATR A;  1VHO A;  4IHM A;  2YND A;  2Z11 A;  3QB8 A;  3LMS A;  2UV8 G;  4OC3 A;  4TWE A;  2XPP A;  3F9K C;  2VEZ A;  2XEI A;  3H8G A;  5JQ4 A;  4A94 A;  3MN8 A;  4C8P A;  4B13 A;  2FT0 A;  3IJ3 A;  3FJU A;  3R9F A;  3UY5 A;  4QBJ A;  2DEA A;  5G20 A;  5K99 A;  2HUZ A;  2P6F A;  1PU9 A;  2VBQ A;  2Q7B A;  3NE8 A;  4CZ1 A;  5FD8 A;  3B3V A;  3BUO B;  5BWA B;  2BSW A;  1XFO A;  4E8O A;  1WVM A;  5LYI A;  2VL1 A;  2DPT A;  1MJA A;  4ZY0 A;  5I0C A;  2IQ6 A;  2V77 A;  3IU1 A;  2JLM A;  3OB2 B;  4CGN A;  4KS9 A;  5AG4 A;  3G23 A;  3S6H A;  2Q04 A;  2ZEM A;  3FMC A;  1QSR A;  1TKH A;  4UBR A;  4XNH C;  3VAR A;  3ZJ0 A;  4KSF A;  4GPL B;  4GXH A;  5D29 A;  3VRR A;  4FD6 A;  4P45 A;  4KOS A;  3BUM B;  1QSN A;  1VKC A;  3WC7 A;  2FXF A;  3T07 A;  3PEI A;  3S9L A;  1M4L A;  4O23 A;  4UCM A;  1ARM A;  1KUV A;  3R96 A;  2AFM A;  4M3S A;  4C85 A;  4JVO A;  1B87 A;  2JEV A;  2RFH A;  4KOW A;  4PV6 A;  1ZL0 A;  2PIY A;  2F5I A;  1I12 A;  1VIX A;  1XE4 A;  2CY2 A;  2NSM A;  2XPL A;  4JLY A;  4QUS A;  3RYO A;  4C7I A;  1AYE A;  5KTD A;  2GAN A;  4PXD A;  4B5P B;  1LAM A;  5F9M A;  2WYR A;  2R82 A;  1ZG8 A;  4MHP A;  3WAB A;  2CXA A;  3ISZ A;  1TIQ A;  5IX3 A;  1DIK A;  1XEB A;  3P2H A;  4FUU A;  1PUA A;  3SI0 A;  4JXQ A;  2HC9 A;  4C9U A;  1JDE A;  3F8K A; 
#chains in the Genus database with same CATH homology
 3L2N A;  4ZI6 A;  2ABZ A;  4OC1 A;  2ZEN A;  3VTA A;  3T8W A;  5HVF A;  2C6G A;  1OBR A;  2CTB A;  4PQA A;  2PE3 A;  4GM5 A;  5K8P A;  1HDQ A;  1R43 A;  3IC1 A;  4NGP A;  1F57 A;  2PJ6 A;  3KQX A;  4X3R A;  1ZLI A;  2PCU A;  2GLJ A;  3TX8 A;  1V6C A;  3VAT A;  3B7I A;  4A37 A;  1VHE A;  4NGT A;  2PJ3 A;  2Q51 A;  1XBU A;  3KHZ A;  4C8U A;  4OC0 A;  3NH5 A;  4X8I A;  2C6C A;  4NGS A;  2BO9 A;  3PB7 X;  4MXU A;  1CPS A;  3I74 A;  1Z8L A;  1TKJ A;  2NYQ A;  2V8D A;  3NH8 A;  1CX8 A;  4P6Y A;  4EFD A;  4YWY A;  2PIZ A;  3BHX A;  3SI1 A;  5THW A;  1FNO A;  2GRE A;  3NFZ A;  3WC6 A;  4UEE A;  1Z2L A;  4MCR A;  5DS0 A;  2EWB A;  4TJX A;  4OP4 A;  1CG2 A;  1ZG7 A;  3IEH A;  2PJ8 A;  4R7M A;  3V38 A;  3KR5 A;  3B2Y A;  4EWT A;  5IB9 A;  4NGN A;  4C9A A;  2AFU A;  3QNV A;  1ZLH A;  2V8G A;  4DYO A;  3KHX A;  2ANP A;  4MRI A;  1ARL A;  3GUX A;  4FWU A;  3FH4 A;  4P4D A;  2OR4 A;  4DUK A;  1XJO A;  2PVW A;  4WJB A;  4FBE A;  3B3S A;  4OKO A;  4ZX8 A;  4PXB A;  3CT9 A;  3I6S A;  2XEJ A;  4MMO A;  2WZN A;  3PB8 X;  3RZA A;  2QYV A;  3CPX A;  4LQG A;  3ISX A;  2PJ4 A;  3GB0 A;  4Z65 A;  4YN3 A;  4RUH A;  3WT4 A;  1LAP A;  5HXD A;  1TXR A;  3D67 A;  3RAM A;  4UIB A;  4CPA A;  3B3W A;  3IO1 A;  5CBM A;  5HVH A;  2AFZ A;  3IIB A;  3D4U A;  5CPA A;  4W9Y A;  2PJ7 A;  4WWV A;  3PFO A;  1DE4 C;  1LAN A;  3MRU A;  4P4I A;  3PB4 X;  1XRY A;  6CPA A;  2PJ5 A;  2AFX A;  1CP6 A;  4ZY1 A;  2F8H A;  1TF8 A;  4KNG E;  2PVV A;  2PJ1 A;  5LRK A;  5JH9 A;  3DLJ A;  1YSJ A;  3PB9 X;  1ELM P;  2O4H A;  2ZOG A;  2OOT A;  2C6P A;  1PYT B;  1F2O A;  3S9N A;  2PJ2 A;  4TNU A;  4H2K A;  4R8F A;  3FEC A;  3FEE A;  4C8C A;  3H8F A;  2ZOF A;  4P4F A;  2BCO A;  4YU9 A;  2IMO A;  2FVG A;  4DJL A;  2QVP A;  2ZEF A;  4B6Z A;  3I1U A;  2XEF A;  2F7V A;  3IWW A;  1FT7 A;  2AFW A;  4NJR A;  4EME A;  3K2K A;  2ZED A;  4AXV A;  4IAV A;  4UEF A;  3CDX A;  2V8V A;  1ZG9 A;  4NFR A;  1EE3 P;  1VGY A;  1XMB A;  3V7Z A;  3KAS A;  4OID A;  1Y9Z A;  2ZEH A;  2G9D A;  1JQG A;  4JYW A;  1IY7 A;  3KL9 A;  4MHN A;  4PPZ A;  3D7D A;  1F2P A;  4C8T A;  1YW6 A;  1YLO A;  1Y0R A;  2JBK A;  3NA6 A;  1KWM A;  5LYL A;  2PJ0 A;  2ZEG A;  2BOA A;  1LOK A;  1BAV A;  5I4M A;  2PJ9 A;  3D7G A;  4UIA A;  4PXE A;  2I3C A;  4P4J A;  2XEG A;  3B35 A;  5JGF A;  5LYD A;  2C5Q A;  3SJX A;  1RTQ A;  1NSA A;  2ZEO A;  3SI2 A;  3WC5 A;  2ZEP A;  1QMU A;  1CP7 A;  3HLP A;  2EK9 A;  3D66 A;  2AFO A;  3EIF A;  3JRU A;  1CBX A;  1Y0Y A;  3PRT A;  4ONW A;  4A39 A;  1XF1 A;  4C9E A;  3FX6 A;  1YME A;  3KZW A;  3H8E A;  1DTD A;  3TC8 A;  3CPA A;  4P4B A;  2ZEL A;  3ICU A;  4K3N A;  4NGQ A;  4P10 A;  2CIJ A;  2ZEE A;  2AFS A;  2V8H A;  2IJZ A;  3D7F A;  5ELY A;  3RBU A;  5JM6 A;  2GP4 A;  2PJC A;  2CTC A;  4OME A;  3SJE A;  2O53 A;  4PXC A;  5K8N A;  3GLJ A;  2GLF A;  2EK8 A;  4IK2 A;  3D68 A;  2PRQ A;  5K8O A;  1BPM A;  3PB6 X;  1GYT A;  8CPA A;  4CDK A;  3FF3 A;  3KI9 A;  4C99 A;  3B3T A;  4R76 A;  4F9V A;  5K8M A;  3BI0 A;  4C9R A;  3SJF A;  3BXM A;  5LRG A;  3NH4 A;  4UEZ A;  1ELL P;  5HVG A;  3B3C A;  3DGV A;  4NGR A;  1R3N A;  2PJB A;  3K9T A;  5D8N A;  4ZX9 A;  4F9U A;  2PJA A;  4CDJ A;  4P44 A;  1UWY A;  4MCS A;  2CF4 A;  3PBB A;  3IFE A;  4C9V A;  3PBE A;  1PCA A;  1TF9 A;  4FAI A;  3S9M A;  1QQ9 A;  4C86 A;  4MCQ A;  5LYF A;  1TKF A;  1AMP A;  4MHY A;  1H8L A;  2Q4Z A;  2J9A A;  4TJV A;  2JBJ A;  5J1Q A;  4G1P A;  1Q7L A;  1YW4 A;  4Q7A A;  4ZYQ A;  1Y7E A;  1HDU A;  4OC2 A;  4F8Z A;  2RB7 A;  4JZ0 A;  4MCP A;  4R6T A;  3N5F A;  3KR4 A;  2JEW A;  3KGQ A;  4KSI A;  5IR2 A;  3D7H A;  3SJG A;  7CPA A;  2HB6 A;  4A38 A;  1CPX A;  3FVL A;  2GU2 A;  4C84 A;  3BI1 A;  4ZY2 A;  4C8F A;  3HUV A;  3LWU A;  5F09 A;  4BD9 A;  4OC4 A;  4NGM A;  4MHZ A;  3VH9 A;  3PFE A;  5LRJ A;  4UF4 A;  2C1C A;  2Q43 A;  3FED A;  4ZY0 A;  4OC5 A;  1IGB A;  1HEE A;  4NJQ A;  1LFW A;  2QJ8 A;  3KQZ A;  1BPN A;  4X2T A;  4P4E A;  2POK A;  4OIW A;  1BLL E;  1LCP A;  1Z5R A;  1VHO A;  4IHM A;  3LMS A;  4TWE A;  4OC3 A;  3H8G A;  2XEI A;  4A94 A;  3MN8 A;  4C8P A;  3IJ3 A;  3FJU A;  2DEA A;  3B3V A;  1XFO A;  1WVM A;  5LYI A;  2VL1 A;  2IQ6 A;  2V77 A;  2ZEM A;  3FMC A;  1TKH A;  3VAR A;  5D29 A;  4P45 A;  3WC7 A;  3PEI A;  3S9L A;  1M4L A;  4O23 A;  1ARM A;  2AFM A;  4C85 A;  2RFH A;  2PIY A;  1VIX A;  2NSM A;  4C8A A;  1AYE A;  4PXD A;  1LAM A;  2WYR A;  1ZG8 A;  4MHP A;  3WAB A;  3ISZ A;  4FUU A;  3SI0 A;  2HC9 A;  4C9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...