3IWWA

Crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dbibzl, a urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Bioisosterism of urea-based GCPII inhibitors: Synthesis and structure-activity relationship studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3iwwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3iwwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3iwwA02
1XRYA 4TWEA 2HB6A 2PJ1A 3SJFA 2NYQA 1VIXA 1ARMA 3D68A 4EMEA 3B3CA 1UWYA 5HVGA 1EE3P 4PXCA 5J1QA 1HDQA 1R43A 4TJXA 1GYTA 5DS0A 4X3RA 2GREA 1BLLE 4FBEA 3FEDA 3D7GA 1Y7EA 3CDXA 1YLOA 4ZI6A 2Q43A 2GLFA 3VARA 1LAMA 4UEZA 4OIDA 4ZY1A 2PJCA 3I6SA 1PCAA 1ZG9A 2ZEMA 4GM5A 2ZEHA 3PB7X 4JZ0A 2CF4A 1ARLA 2GU2A 3I1UA 4MHZA 2V8DA 4R6TA 2IJZA 4C9VA 1ZLIA 1LOKA 4C8TA 2RB7A 1TKJA 3CPXA 3LMSA 3FX6A 4NJRA 2Q4ZA 4NGMA 3FJUA 4PXBA 3N5FA 2PVWA 5LRJA 3HUVA 2XEGA 4A94A 3D4UA 3D67A 4C85A 3BI0A 3S9NA 1Y9ZA 2JEWA 4DJLA 3S9LA 3BI1A 3B3VA 5THWA 1Y0RA 3BHXA 5JGFA 4ZX8A 4R8FA 4JYWA 4PXEA 3WC6A 4BD9A 4OC5A 4CDJA 4MCRA 3CT9A 4A38A 1BAVA 3WC7A 1M4LA 2QVPA 5CBMA 2ZEOA 1AYEA 4P4IA 2PJ7A 4F9VA 4CDKA 1AMPA 1F2OA 6CPAA 3GB0A 2J9AA 2O4HA 5F09A 4MCPA 4NGNA 3NH8A 4EFDA 4FWUA 3K2KA 2ZEEA 4IAVA 4C84A 4B6ZA 2XEFA 8CPAA 4C9UA 3ISXA 2PRQA 5K8MA 3SI1A 1ZG8A 4FAIA 1XFOA 5LYDA 4OC3A 4X8IA 2XEJA 4PXDA 4UEFA 4ZYQA 4DUKA 3FF3A 3PB9X 2C6CA 3D7HA 4YU9A 4A39A 4NGRA 1VGYA 4UIAA 3VTAA 2AFWA 2ANPA 2IQ6A 5LRGA 2F7VA 4X2TA 3I74A 2AFUA 4C8CA 1Z8LA 5K8OA 3V38A 4OMEA 4MCQA 4W9YA 3L2NA 2AFOA 4UIBA 4EWTA 4NGQA 3PFEA 4LQGA 3DLJA 2ZEFA 2PJ4A 5D29A 5K8NA 3JRUA 3EIFA 5HXDA 2ABZA 3KASA 1F2PA 1XBUA 3IJ3A 1IY7A 3V7ZA 2C6PA 4FUUA 1NSAA 2PJ6A 4NGTA 3B3WA 4C9RA 1LAPA 3H8EA 1VHEA 3IO1A 1Q7LA 2AFMA 2PIZA 4NGPA 4ZY0A 4KNGE 4RUHA 2I3CA 5JH9A 3D7FA 5LYLA 4TJVA 3NH5A 4NJQA 3IC1A 1TKFA 4CPAA 1XMBA 3DGVA 1F57A 1TXRA 2CIJA 1XJOA 1CG2A 4R7MA 1QMUA 1KWMA 4UF4A 4YN3A 3KQXA 2OR4A 5LYIA 3PB6X 4PPZA 4YWYA 2EK9A 1HDUA 4PQAA 3KHZA 5I4MA 3FEEA 2C6GA 3NFZA 1YMEA 2V8GA 3D66A 3SJGA 2C1CA 1YW4A 3T8WA 3KQZA 4OC2A 4ONWA 4AXVA 2PJ9A 2RFHA 4IK2A 4Q7AA 2AFSA 3PRTA 5ELYA 1ELMP 4C8AA 1BPMA 7CPAA 1TF9A 3B3TA 3PBBA 4C8FA 1V6CA 1LANA 4R76A 4MMOA 3RBUA 3IWWA 2HC9A 3ISZA 4A37A 4Z65A 2G9DA 3PBEA 5D8NA 1XF1A 3KZWA 3IEHA 4IHMA 2FVGA 4C86A 3KGQA 1HEEA 4MHYA 3KI9A 3RAMA 3WC5A 1FNOA 4MXUA 5HVFA 3IIBA 4C8PA 1Y0YA 2V8HA 4MHNA 3SI2A 1CPSA 4F8ZA 3K9TA 4KSIA 2ZOGA 3SJXA 3H8GA 2CTBA 3PEIA 2O53A 4DYOA 4C9EA 4O23A 2F8HA 3FECA 1CBXA 3MN8A 1DE4C 2QYVA 4MCSA 2PJ2A 3SI0A 2EWBA 1ELLP 2QJ8A 2WZNA 4P4JA 1RTQA 2AFXA 3H8FA 1CX8A 3SJEA 1OBRA 3PB4X 4NFRA 3NH4A 1DTDA 1WVMA 1ZLHA 2PVVA 2PJ8A 4P10A 4C8UA 3FMCA 2PJBA 5CPAA 1JQGA 3RZAA 4NGSA 3VH9A 3KL9A 1IGBA 2PCUA 4H2KA 2DEAA 2VL1A 3S9MA 1YW6A 3FVLA 1Z2LA 4OIWA 3D7DA 2AFZA 4WJBA 3ICUA 1ZG7A 4K3NA 5K8PA 3KHXA 2V8VA 3NA6A 2WYRA 2ZENA 2IMOA 4OC0A 2BO9A 1VHOA 3TX8A 2EK8A 3B2YA 4OC1A 4P4FA 2PJAA 3FH4A 3GLJA 2ZELA 4P4BA 3MRUA 1FT7A 4C99A 3GUXA 3HLPA 2PJ0A 4MRIA 4WWVA 2ZEDA 5LRKA 2OOTA 4C9AA 2PJ3A 1R3NA 3B7IA 2PJ5A 4TNUA 3IFEA 3PFOA 4UEEA 2POKA 4OP4A 3QNVA 1PYTB 2JBJA 1CPXA 2ZOFA 2Q51A 4F9UA 2ZEGA 2NSMA 3KR5A 3WT4A 2BCOA 1CP7A 2JBKA 1Z5RA 4P4DA 1CP6A 2BOAA 2PE3A 3VATA 2ZEPA 5JM6A 4P45A 3LWUA 1LFWA 2PIYA 4OKOA 2CTCA 3WABA 2V77A 2GLJA 1H8LA 3B3SA 1TF8A 5HVHA 3B35A 4ZY2A 4OC4A 4P6YA 1TKHA 4P44A 2XEIA 4G1PA 4P4EA 5IB9A 4MHPA 5LYFA 4ZX9A 1YSJA 3TC8A 3PB8X 1QQ9A 1LCPA 3CPAA 3BXMA 1BPNA 3KR4A
chains in the Genus database with same CATH superfamily
4KOTA 2UV8G 1B6BA 1VKCA 2N3AB 1S7NA 1XRYA 3QAHA 3GY9A 1JWQA 4TWEA 2HB6A 2OH1A 5G20A 4JXQA 4FD6A 4AVCA 3TYXA 4BPUB 2PJ1A 3WR7A 1V0CA 3SJFA 1YVKA 5HMNA 2CBLA 2NYQA 2ODFA 1VIXA 1ARMA 1A9XB 2D0OA 1Q5XA 3D68A 5H84A 4EMEA 3B3CA 2GANA 2JLMA 3G3SA 3KKWA 1UWYA 5IB0A 5IR2A 5HVGA 3TLCA 2YNDA 1EE3P 2ZPAA 3F8KA 4L8AA 4PXCA 3VRNA 5J1QA 1HDQA 1M4DA 1R43A 1C3OB 4TJXA 1GYTA 1NBWA 5DS0A 4X3RA 2GREA 3JVNA 1I21A 5C82A 1JDBC 1BLLE 1GHEA 3GKRA 3QB8A 4MFKA 1Q2CA 4LX9A 3FEDA 3SXNA 3D7GA 1X10A 4C7IA 1Y7EA 4KVME 4CAVA 4FBEA 1IU8A 3CDXA 4ZGYB 1YLOA 2Q0YA 2Q43A 4ZI6A 2GLFA 4R3KA 3VARA 1KUXA 1LAMA 4UEZA 4OIDA 2Q04A 3T9YA 1NE9A 2PJCA 1MJ9A 4ZY1A 3I6SA 3OAKA 1PCAA 4KVXA 3R95A 4M6HA 4BPXB 1ZG9A 4INJA 2ZEMA 3T90A 4JVOA 3RYOA 5AG6A 2VZZA 2BSWA 4GM5A 2ZEHA 4R9MA 4KLVA 5AGEA 4JWPA 3PB7X 4IIYA 1CM0A 3GIUA 4JZ0A 2CF4A 2B4DA 5JYBA 1ARLA 3LODA 2GU2A 3I1UA 4MHZA 3TTHA 4F0XA 5ISVA 2X0SA 2V8DA 2KCWA 3BJ7A 3PT1A 4R6TA 1NSLA 2IJZA 2P0WA 5GCNA 2XPLA 3TLGA 4A2ZA 1IICA 4C9VA 5BY0A 1DIKA 2Z0ZA 1ZLIA 1LOKA 4C8TA 2FIAA 1IYLA 2RB7A 1TKJA 3CPXA 2P6FA 3LMSA 1Q2DA 4UWJA 4F0YA 3FX6A 1MK4A 2Q4ZA 4NJRA 4NGMA 2XPNA 4R57A 3R9EA 5F1YA 3FJUA 4PXBA 3TT2A 3BJ8A 2REEA 4PSXA 2HI6A 3N5FA 2PVWA 2Y1NA 5HH1A 5LRJA 5F5XA 1S3ZA 3HUVA 4KSFA 1MJAA 2XEGA 4A94A 4GXHA 3RNZA 2OLSA 2BEIA 5A28A 2REFA 4CYOA 4A95A 2F5IA 3D4UA 3D67A 5F49A 5KTDA 5JVLA 2FIWA 4C85A 3BI0A 3W6XA 3VGOA 3S9NA 3IWEA 4JJXA 1Y9ZA 2JEWA 4DJLA 3S9LA 4XPDC 1NMTA 3B8GA 3BI1A 4H1HA 3B3VA 5THWA 2ATRA 4CGOA 1Y0RA 1ZL0A 3BHXA 2R82A 2J8RA 5JGFA 2R7HA 4ZX8A 3T0TA 4R8FA 4JYWA 3I9SA 4PXEA 3WC6A 4BD9A 3HPHE 4OC5A 2D0PA 4CDJA 4QVTA 4IIXA 2OZUA 2J8NA 4MCRA 4U9YA 3CT9A 4A38A 1BAVA 1VHSA 4KOWA 4NF1A 3WC7A 1M4LA 2C27A 2EUIA 3TO7A 3BUWB 4L89A 2QVPA 5CBMA 3C8OA 2HROA 3D2MA 3TLAA 2B58A 4MBUA 2GE3A 2ZEOA 2J8MA 1AYEA 1S7KA 2O28A 1Y9KA 1ZYMA 5F46A 3TO6A 4P4IA 3OWCA 2PJ7A 2XPOA 3TLZA 4F9VA 4ONUA 4UFWA 2Q7SA 5JPHA 2DF5A 2FT0A 1T36B 1AMPA 1QSMA 3K9UA 4CDKA 1Y9WA 5EC4A 1F2OA 1XMTA 4XPDB 2EO8A 2Y0MA 6CPAA 3G8WA 3BUOB 4I49A 4U5YA 4Y49C 3GB0A 4MJXA 2J9AA 2O4HA 5F09A 4AB7A 4MCPA 4NGNA 1MJBA 2EZAA 2PCNA 4AG7A 5J3XA 2VXKA 2YNCA 3JTKA 1B47A 2D4OA 3NH8A 4EFDA 3PGPA 4FWUA 2VKZG 3K2KA 5C88A 4RR2B 2WPWA 2ZEEA 4IAVA 1QSOA 3LACA 4E0AA 1VI4A 4C84A 3RO0A 2JDDA 4B6ZA 4J0NA 2FSRA 2XEFA 4MFJA 8CPAA 4C9UA 2CNTA 2PRQA 3ISXA 5K8MA 3I3GA 3SI1A 3TO9A 1M44A 4M8DA 1ZG8A 4EYSA 4CAWA 4FAIA 1XFOA 3D2PA 1KUVA 1PU9A 2VBQA 4MHDA 1Z8TA 5LYDA 4OC3A 4X8IA 3S6FA 4B13A 3K4IA 1Q2YA 3P2HA 2FXFA 2XEJA 4KSAA 4PXDA 4UEFA 4Q36A 4Y49B 2VZYA 4ZYQA 3H5ZA 5HKWA 3V8IA 4KOUA 4DUKA 4NEXA 3FF3A 3PB9X 5FVJA 2C6CA 3D7HA 4YU9A 2G3TA 2QMLA 2Z3OA 4A39A 4NGRA 1VGYA 4UIAA 4B14A 1S7LA 2HWGA 3VTAA 2AFWA 2ANPA 2IQ6A 3EFAA 4IUSA 5LRGA 2F7VA 2WSAA 4X2TA 1IOFA 3EZAA 5DWMA 3I74A 3TE4A 1P4NA 4ORFA 4XPKA 2AFUA 2Q4YA 4C8CA 1Z8LA 3R9FA 5K8OA 3V38A 4XNHC 1J3LA 4OMEA 4MCQA 2WPXA 4W9YA 3L2NA 2AFOA 4UIBA 4YRHA 5J8FA 2Z3PA 4EWTA 2BUEA 4NGQA 4A4CA 4JXRA 3PFEA 4HKFA 4LQGA 3EC4A 1YLEA 2HUZA 3DLJA 3T05A 2ZEFA 2B3UA 2PJ4A 4MFPA 5H86A 5D29A 5K8NA 4LUAA 3D8PA 2B5GB 2FCKA 3JRUA 4E8OA 3EIFA 3OP0A 2ARHA 5KTCA 3EY5A 5HXDA 2ABZA 3KASA 1F2PA 3TOBA 1EO0A 1XBUA 3CXQA 1IY7A 3IGRA 3IJ3A 2ZXVA 3V7ZA 4NCZA 2C6PA 4FUUA 4COGA 2Q7BA 1NSAA 2PJ6A 4B5PB 4NGTA 4EVYA 3B3WA 4C9RA 1LAPA 2GIVA 2Z3LA 3H8EA 1VHEA 3EZBA 1YVOA 3IO1A 3IU1A 4UBRA 1Q7LA 2AFMA 4XNHB 3U1BA 4RN7A 4NXYA 2PIZA 4CAEA 4NGPA 4ZY0A 3GJZA 1XF8A 5G1ZA 4KNGE 1S60A 2X7BA 4RUHA 1WWZA 4QBJA 2I3CA 3DSBA 2R1IA 3OB1B 4CGPA 5JH9A 2B0AA 3D7FA 5LYLA 4TJVA 5I0CA 4H6UA 4QB9A 5AG5A 4C2YA 4KOSA 3NH5A 4C2ZA 2B4JC 3VROA 3F5BA 4AG9A 4PK2A 3DR8A 4E2AA 4JD6A 1CS0B 2DLAA 2PR1A 2E28A 3CZXA 4NJQA 1YR0A 3IC1A 4UFXA 3SHPA 1TKFA 5AXIA 4KUAA 5JQ4A 4JLYA 1CJWA 4CPAA 1XMBA 1I12A 1XOVA 3DGVA 1F57A 1XIXA 3R1KA 4BMHA 1TXRA 2CIJA 1XJOA 1CG2A 4R7MA 1LRZA 1QMUA 1KWMA 4UF4A 4M85A 4MFLA 2C5QA 4E5SA 4FD5A 4YN3A 1YX0A 4GS4A 2DPSA 2CNMA 3KQXA 5CNPA 1L0CA 2OR4A 5LYIA 3ZJ0A 3PB6X 4CGMA 4PPZA 1OZPA 2Z3MA 3TCVA 2I79A 4YWYA 1IYKA 2CNSA 2EK9A 1HDUA 4CYNA 2DIKA 4PQAA 1WK4A 3KHZA 3FBUA 4CO9A 5I4MA 3FEEA 2C6GA 1M4GA 3NFZA 1YMEA 3VRQA 2V8GA 3SJGA 2VI7A 1YVHA 2C1CA 3D66A 5HKZA 5G22A 1YW4A 3OB2B 4II9A 5HKYA 2QIRA 1YREA 3FNCA 2XPPA 1R57A 1RO5A 4COBA 2JDCA 3T8WA 2DXQA 2YNEA 4KLWA 3KQZA 4OC2A 2OU2A 4ONWA 4AXVA 4Q38A 1R61A 5F9MA 2PJ9A 2B3VA 2RFHA 4X5KA 4IK2A 4Q7AA 1Y7RA 3VRPA 2AFSA 3PRTA 5ELYA 1ELMP 1SQHA 3E0KA 4KOXA 4C8AA 1BPMA 7CPAA 4UFVA 4UA3A 5F47A 1TF9A 3B3TA 1NXJA 4A30A 1YK3A 3EO4A 3PBBA 4FD7A 4C8FA 3CXPA 1V6CA 3TLYA 3NE7A 3G23A 1K4JA 2P6GA 1FBVA 1LANA 4R76A 2Z3NA 4MFZA 4MMOA 1GGOA 4M6IA 3RBUA 1Z8XA 4BPWB 2AE6A 3IWWA 2HC9A 4M3SA 3ISZA 4H6ZA 4HNWB 2G9DA 3PBEA 5D8NA 4XPLA 3S6HA 4A37A 4Z65A 5IX3A 3NE8A 3GYAA 1XF1A 3F9KC 4M6GA 2Z3KA 3KZWA 3LD2A 3H4QA 3IEHA 4IHMA 2FVGA 1VBGA 2YGWA 1J4JA 1IB1E 4PK3A 4C86A 1KEEB 3DR6A 3KGQA 1HEEA 4MHYA 4MY3A 3KI9A 3TLBA 1JDEA 3TLEA 1M6VB 3EXNA 3RAMA 4OAEA 3WC5A 1FNOA 4MXUA 5HVFA 3IIBA 2NMTA 4C8PA 1Y0YA 2V8HA 4MHNA 5K99A 3SI2A 1CPSA 4F8ZA 4BTFA 3K9TA 4KSIA 2ZOGA 3D3SA 3BUXB 3SJXA 3H8GA 2CTBA 2CXAA 2O53A 3PEIA 1EZBA 4DYOA 2G3AA 4C9EA 1S7FA 4O23A 1XE4A 3R96A 2BL1A 2F8HA 4GPLB 4IF5A 2MP0A 3FECA 1CBXA 2B4DB 1DE4C 3MN8A 4HNXB 2QYVA 3C26A 4MCSA 1QSRA 3S6GA 4C2XA 4CGLA 2PJ2A 3SI0A 2EWBA 1ELLP 3T5MA 2QJ8A 2WZNA 2Q4VA 1BXRB 2R8VA 1YGHA 4P4JA 1RTQA 2AFXA 4B11A 2QECA 4B5OA 3H8FA 3BUMB 1CE8B 1BOBA 4FD4A 3N7ZA 2Q44A 3TLGB 3FYNA 1BO4A 1KUYA 1CX8A 2GP4A 1S5KA 3EZEA 3SJEA 1I1DA 4CS0B 2ZW4A 4ZBGA 2FS5A 4CYPA 5EBVA 1IOIA 4MFQA 1OBRA 3PB4X 4NFRA 4A31A 3KRVA 1AUGA 3NH4A 2FE7A 4KZTA 2YJTA 1DTDA 1WVMA 4AVAA 1ZLHA 2PVVA 2PJ8A 4P10A 4C8UA 3FMCA 2PJBA 4MY0A 5CPAA 2RC4A 5AG7A 5IV0A 1JQGA 4UWIA 4NGSA 3RZAA 4MI4A 3VH9A 3KL9A 3VWDA 3MGDA 1IGBA 3PLFB 3DDDA 1IIDA 2PCUA 1ZRSA 4H2KA 4HPSA 2DEAA 3O8ZA 4KOYA 2VL1A 3S9MA 3NOJA 4LQ6A 2I00A 1YW6A 3FVLA 3BUNB 1Z4RA 1Z2LA 2VEZA 4OIWA 3PFVA 3D7DA 2D4PA 2OB0A 1A2ZA 5G21A 2AFZA 4BINA 4WJBA 2AUNA 3IU2A 3S6KA 1TIQA 1ZG7A 3ICUA 4K3NA 4A32A 2WUUA 4R87A 1M1DA 4NSQA 3T07A 1KBLA 5K8PA 2Z11A 3KHXA 2V8VA 1WJTA 2ZW6A 3NA6A 2WYRA 2YNCC 3W91A 4K30A 2ZENA 1KZFA 2IMOA 4OC0A 2PDOA 2BO9A 1VHOA 3TX8A 1VBHA 4CAFA 2EK8A 4DNCA 2PRBA 1PUAA 3B2YA 4KOVA 4OC1A 4P4FA 2PJAA 3FH4A 3HMJG 2H5MA 3GLJA 4UCPA 1RXTA 2ZELA 4H89A 4P4BA 3MRUA 1FY7A 2PQ8A 3UY5A 1FT7A 4C99A 1QSTA 3GUXA 3HLPA 2FL4A 2PJ0A 1QSNA 4MRIA 4MI1A 4WWVA 2ZEDA 1Z4EA 5LRKA 4OLLA 2B5GA 2OOTA 4J3GA 5A27A 4C9AA 3IWGA 2HQYA 2PJ3A 2B4BA 4F6AA 2ZW7A 1R3NA 3B7IA 2PC1A 2PJ5A 5DWNA 4TNUA 4B5PA 1UFHA 5J8CA 2FM4A 5F13A 3IFEA 3R9GA 4U9ZA 4CRYB 3NFQA 3PFOA 2PR8A 1M4IA 2POKA 3QNVA 2VQYA 4OP4A 4UEEA 1C30B 1PYTB 1KC7A 2JBJA 2EVNA 5BWAB 1XEBA 1CPXA 4HNYB 2CY2A 2ZOFA 2DPTA 4A4BA 1YQEA 4R3LA 1B87A 3U88C 2Q51A 4C7HA 4CYQA 2ZEGA 4F9UA 3CXSA 2NSMA 3A9LA 3KR5A 3WT4A 4QC6A 2BCOA 2EBJA 3BLNA 3TOAA 4CAXA 1CP7A 1P0HA 2JBKA 3F0AA 2OZGA 3HPGG 1Z5RA 3FB3A 5EMIA 4CGNA 4E94A 2ZW5A 3JUWA 2GFQA 2Z10A 3SR3A 4RS2A 4P4DA 1CP6A 1ON0A 2BOAA 2PE3A 3VRRA 2ZEPA 4OADA 3VATA 4YFJA 5JM6A 4P45A 4UCMA 3LWUA 1Z9UA 4RI1A 1LFWA 4KUBA 1U6MA 3QAYA 2YJVA 4PSWA 5FD8A 2PIYA 3PP9A 4OKOA 4YGOA 2P6EA 4CRZB 2CTCA 2IL4A 3WABA 2V77A 2GLJA 2G0BA 1Z8WA 1H8LA 3DNSA 4MJ8A 2EZBA 3B3SA 4B12A 2AUMA 1TF8A 5HVHA 3B35A 4ZY2A 3FXTA 2Y1MA 3TFYA 4OC4A 3SXOA 4P6YA 1TKHA 4PV6A 5E96A 5F48A 4P44A 1X12A 4AVBA 4KORA 2XEIA 3PZJA 2HV2A 4G1PA 3VWEA 1EZAA 4B10A 4P4EA 4KS9A 4KVOE 5IB9A 3FRMA 3W6SA 3P2FA 2OZHA 4A33A 4MHPA 5LYFA 1Z9EA 3ZNIA 4BBHA 5AG4A 1N71A 4UCNA 4ZX9A 4CZ1A 1YSJA 3ZZIA 3TC8A 2PSWA 2A4NA 2R98A 3PB8X 4QUSA 1QQ9A 2JEVA 1LCPA 3CPAA 4C68A 1ZO0A 2EZCA 3BXMA 2AJ6A 3FIXA 2K5TA 1BPNA 5KTAA 3KR4A
chains in the Genus database with same CATH topology
1XRYA 4TWEA 2HB6A 2PJ1A 3SJFA 2NYQA 1VIXA 1ARMA 3D68A 4EMEA 3B3CA 5IR2A 1UWYA 5HVGA 1EE3P 4PXCA 5J1QA 1HDQA 1R43A 4TJXA 1GYTA 5DS0A 4X3RA 2GREA 1BLLE 4FBEA 3FEDA 3D7GA 1Y7EA 3CDXA 1YLOA 4ZI6A 2Q43A 2GLFA 3VARA 1LAMA 4UEZA 4OIDA 4ZY1A 2PJCA 3I6SA 1PCAA 1ZG9A 2ZEMA 4GM5A 2ZEHA 3PB7X 4JZ0A 2CF4A 1ARLA 2GU2A 3I1UA 4MHZA 2V8DA 4R6TA 2IJZA 4C9VA 1ZLIA 1LOKA 4C8TA 2RB7A 1TKJA 3CPXA 3LMSA 3FX6A 4NJRA 2Q4ZA 4NGMA 3FJUA 4PXBA 3N5FA 2PVWA 5LRJA 3HUVA 2XEGA 4A94A 3D4UA 3D67A 4C85A 3BI0A 3S9NA 1Y9ZA 2JEWA 4DJLA 3S9LA 3BI1A 3B3VA 5THWA 1Y0RA 3BHXA 5JGFA 4ZX8A 4R8FA 4JYWA 4PXEA 3WC6A 4BD9A 4OC5A 4CDJA 4MCRA 3CT9A 4A38A 1BAVA 3WC7A 1M4LA 2QVPA 5CBMA 2ZEOA 1AYEA 4P4IA 2PJ7A 4F9VA 4CDKA 1AMPA 1F2OA 6CPAA 3GB0A 2J9AA 2O4HA 5F09A 4MCPA 4NGNA 3NH8A 4EFDA 4FWUA 3K2KA 2ZEEA 4IAVA 4C84A 4B6ZA 2XEFA 8CPAA 4C9UA 3ISXA 2PRQA 5K8MA 3SI1A 1ZG8A 4FAIA 1XFOA 5LYDA 4OC3A 4X8IA 2XEJA 4PXDA 4UEFA 4ZYQA 4DUKA 3FF3A 3PB9X 2C6CA 3D7HA 4YU9A 4A39A 4NGRA 1VGYA 4UIAA 3VTAA 2AFWA 2ANPA 2IQ6A 5LRGA 2F7VA 4X2TA 3I74A 2AFUA 4C8CA 1Z8LA 5K8OA 3V38A 4OMEA 4MCQA 4W9YA 3L2NA 2AFOA 4UIBA 4EWTA 4NGQA 3PFEA 4LQGA 3DLJA 2ZEFA 2PJ4A 5D29A 5K8NA 3JRUA 3EIFA 5HXDA 2ABZA 3KASA 1F2PA 1XBUA 3IJ3A 1IY7A 3V7ZA 2C6PA 4FUUA 1NSAA 2PJ6A 4NGTA 3B3WA 4C9RA 1LAPA 3H8EA 1VHEA 3IO1A 1Q7LA 2AFMA 2PIZA 4NGPA 4ZY0A 4KNGE 4RUHA 2I3CA 5JH9A 3D7FA 5LYLA 4TJVA 3NH5A 4NJQA 3IC1A 1TKFA 4CPAA 1XMBA 3DGVA 1F57A 1TXRA 2CIJA 1XJOA 1CG2A 4R7MA 1QMUA 1KWMA 4UF4A 2C5QA 4YN3A 3KQXA 2OR4A 5LYIA 3PB6X 4PPZA 4YWYA 2EK9A 1HDUA 4PQAA 3KHZA 5I4MA 3FEEA 2C6GA 3NFZA 1YMEA 2V8GA 3D66A 3SJGA 2C1CA 1YW4A 3T8WA 3KQZA 4OC2A 4ONWA 4AXVA 2PJ9A 2RFHA 4IK2A 4Q7AA 2AFSA 3PRTA 5ELYA 1ELMP 4C8AA 1BPMA 7CPAA 1TF9A 3B3TA 3PBBA 4C8FA 1V6CA 1LANA 4R76A 4MMOA 3RBUA 3IWWA 2HC9A 3ISZA 4A37A 4Z65A 2G9DA 3PBEA 5D8NA 1XF1A 3KZWA 3IEHA 4IHMA 2FVGA 4C86A 3KGQA 1HEEA 4MHYA 3KI9A 3RAMA 3WC5A 1FNOA 4MXUA 5HVFA 3IIBA 4C8PA 1Y0YA 2V8HA 4MHNA 3SI2A 1CPSA 4F8ZA 3K9TA 4KSIA 2ZOGA 3SJXA 3H8GA 2CTBA 3PEIA 2O53A 4DYOA 4C9EA 4O23A 2F8HA 3FECA 1CBXA 3MN8A 1DE4C 2QYVA 4MCSA 2PJ2A 3SI0A 2EWBA 1ELLP 2QJ8A 2WZNA 4P4JA 1RTQA 2AFXA 3H8FA 1CX8A 2GP4A 3SJEA 1OBRA 3PB4X 4NFRA 3NH4A 1DTDA 1WVMA 1ZLHA 2PVVA 2PJ8A 4P10A 4C8UA 3FMCA 2PJBA 5CPAA 1JQGA 3RZAA 4NGSA 3VH9A 3KL9A 1IGBA 2PCUA 4H2KA 2DEAA 2VL1A 3S9MA 1YW6A 3FVLA 1Z2LA 4OIWA 3D7DA 2AFZA 4WJBA 3ICUA 1ZG7A 4K3NA 5K8PA 3KHXA 2V8VA 3NA6A 2WYRA 2ZENA 2IMOA 4OC0A 2BO9A 1VHOA 3TX8A 2EK8A 3B2YA 4OC1A 4P4FA 2PJAA 3FH4A 3GLJA 2ZELA 4P4BA 3MRUA 1FT7A 4C99A 3GUXA 3HLPA 2PJ0A 4MRIA 4WWVA 2ZEDA 5LRKA 2OOTA 4C9AA 2PJ3A 1R3NA 3B7IA 2PJ5A 4TNUA 3IFEA 3PFOA 4UEEA 2POKA 4OP4A 3QNVA 1PYTB 2JBJA 1CPXA 2ZOFA 2Q51A 4F9UA 2ZEGA 2NSMA 3KR5A 3WT4A 2BCOA 1CP7A 2JBKA 1Z5RA 4P4DA 1CP6A 2BOAA 2PE3A 3VATA 2ZEPA 5JM6A 4P45A 3LWUA 1LFWA 2PIYA 4OKOA 2CTCA 3WABA 2V77A 2GLJA 1H8LA 3B3SA 1TF8A 5HVHA 3B35A 4ZY2A 4OC4A 4P6YA 1TKHA 4P44A 2XEIA 4G1PA 4P4EA 5IB9A 4MHPA 5LYFA 4ZX9A 1YSJA 3TC8A 3PB8X 1QQ9A 1LCPA 3CPAA 3BXMA 1BPNA 3KR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRY A;  4TWE A;  2HB6 A;  2PJ1 A;  3SJF A;  2NYQ A;  1VIX A;  1ARM A;  3D68 A;  4EME A;  3B3C A;  1UWY A;  5HVG A;  1EE3 P;  4PXC A;  5J1Q A;  1HDQ A;  1R43 A;  4TJX A;  1GYT A;  5DS0 A;  4X3R A;  2GRE A;  1BLL E;  4FBE A;  3FED A;  3D7G A;  1Y7E A;  3CDX A;  1YLO A;  4ZI6 A;  2Q43 A;  2GLF A;  3VAR A;  1LAM A;  4UEZ A;  4OID A;  4ZY1 A;  2PJC A;  3I6S A;  1PCA A;  1ZG9 A;  2ZEM A;  4GM5 A;  2ZEH A;  3PB7 X;  4JZ0 A;  2CF4 A;  1ARL A;  2GU2 A;  3I1U A;  4MHZ A;  2V8D A;  4R6T A;  2IJZ A;  4C9V A;  1ZLI A;  1LOK A;  4C8T A;  2RB7 A;  1TKJ A;  3CPX A;  3LMS A;  3FX6 A;  4NJR A;  2Q4Z A;  4NGM A;  3FJU A;  4PXB A;  3N5F A;  2PVW A;  5LRJ A;  3HUV A;  2XEG A;  4A94 A;  3D4U A;  3D67 A;  4C85 A;  3BI0 A;  3S9N A;  1Y9Z A;  2JEW A;  4DJL A;  3S9L A;  3BI1 A;  3B3V A;  5THW A;  1Y0R A;  3BHX A;  5JGF A;  4ZX8 A;  4R8F A;  4JYW A;  4PXE A;  3WC6 A;  4BD9 A;  4OC5 A;  4CDJ A;  4MCR A;  3CT9 A;  4A38 A;  1BAV A;  3WC7 A;  1M4L A;  2QVP A;  5CBM A;  2ZEO A;  1AYE A;  4P4I A;  2PJ7 A;  4F9V A;  4CDK A;  1AMP A;  1F2O A;  6CPA A;  3GB0 A;  2J9A A;  2O4H A;  5F09 A;  4MCP A;  4NGN A;  3NH8 A;  4EFD A;  4FWU A;  3K2K A;  2ZEE A;  4IAV A;  4C84 A;  4B6Z A;  2XEF A;  8CPA A;  4C9U A;  3ISX A;  2PRQ A;  5K8M A;  3SI1 A;  1ZG8 A;  4FAI A;  1XFO A;  5LYD A;  4OC3 A;  4X8I A;  2XEJ A;  4PXD A;  4UEF A;  4ZYQ A;  4DUK A;  3FF3 A;  3PB9 X;  2C6C A;  3D7H A;  4YU9 A;  4A39 A;  4NGR A;  1VGY A;  4UIA A;  3VTA A;  2AFW A;  2ANP A;  2IQ6 A;  5LRG A;  2F7V A;  4X2T A;  3I74 A;  2AFU A;  4C8C A;  1Z8L A;  5K8O A;  3V38 A;  4OME A;  4MCQ A;  4W9Y A;  3L2N A;  2AFO A;  4UIB A;  4EWT A;  4NGQ A;  3PFE A;  4LQG A;  3DLJ A;  2ZEF A;  2PJ4 A;  5D29 A;  5K8N A;  3JRU A;  3EIF A;  5HXD A;  2ABZ A;  3KAS A;  1F2P A;  1XBU A;  3IJ3 A;  1IY7 A;  3V7Z A;  2C6P A;  4FUU A;  1NSA A;  2PJ6 A;  4NGT A;  3B3W A;  4C9R A;  1LAP A;  3H8E A;  1VHE A;  3IO1 A;  1Q7L A;  2AFM A;  2PIZ A;  4NGP A;  4ZY0 A;  4KNG E;  4RUH A;  2I3C A;  5JH9 A;  3D7F A;  5LYL A;  4TJV A;  3NH5 A;  4NJQ A;  3IC1 A;  1TKF A;  4CPA A;  1XMB A;  3DGV A;  1F57 A;  1TXR A;  2CIJ A;  1XJO A;  1CG2 A;  4R7M A;  1QMU A;  1KWM A;  4UF4 A;  4YN3 A;  3KQX A;  2OR4 A;  5LYI A;  3PB6 X;  4PPZ A;  4YWY A;  2EK9 A;  1HDU A;  4PQA A;  3KHZ A;  5I4M A;  3FEE A;  2C6G A;  3NFZ A;  1YME A;  2V8G A;  3D66 A;  3SJG A;  2C1C A;  1YW4 A;  3T8W A;  3KQZ A;  4OC2 A;  4ONW A;  4AXV A;  2PJ9 A;  2RFH A;  4IK2 A;  4Q7A A;  2AFS A;  3PRT A;  5ELY A;  1ELM P;  4C8A A;  1BPM A;  7CPA A;  1TF9 A;  3B3T A;  3PBB A;  4C8F A;  1V6C A;  1LAN A;  4R76 A;  4MMO A;  3RBU A;  3IWW A;  2HC9 A;  3ISZ A;  4A37 A;  4Z65 A;  2G9D A;  3PBE A;  5D8N A;  1XF1 A;  3KZW A;  3IEH A;  4IHM A;  2FVG A;  4C86 A;  3KGQ A;  1HEE A;  4MHY A;  3KI9 A;  3RAM A;  3WC5 A;  1FNO A;  4MXU A;  5HVF A;  3IIB A;  4C8P A;  1Y0Y A;  2V8H A;  4MHN A;  3SI2 A;  1CPS A;  4F8Z A;  3K9T A;  4KSI A;  2ZOG A;  3SJX A;  3H8G A;  2CTB A;  3PEI A;  2O53 A;  4DYO A;  4C9E A;  4O23 A;  2F8H A;  3FEC A;  1CBX A;  3MN8 A;  1DE4 C;  2QYV A;  4MCS A;  2PJ2 A;  3SI0 A;  2EWB A;  1ELL P;  2QJ8 A;  2WZN A;  4P4J A;  1RTQ A;  2AFX A;  3H8F A;  1CX8 A;  3SJE A;  1OBR A;  3PB4 X;  4NFR A;  3NH4 A;  1DTD A;  1WVM A;  1ZLH A;  2PVV A;  2PJ8 A;  4P10 A;  4C8U A;  3FMC A;  2PJB A;  5CPA A;  1JQG A;  3RZA A;  4NGS A;  3VH9 A;  3KL9 A;  1IGB A;  2PCU A;  4H2K A;  2DEA A;  2VL1 A;  3S9M A;  1YW6 A;  3FVL A;  1Z2L A;  4OIW A;  3D7D A;  2AFZ A;  4WJB A;  3ICU A;  1ZG7 A;  4K3N A;  5K8P A;  3KHX A;  2V8V A;  3NA6 A;  2WYR A;  2ZEN A;  2IMO A;  4OC0 A;  2BO9 A;  1VHO A;  3TX8 A;  2EK8 A;  3B2Y A;  4OC1 A;  4P4F A;  2PJA A;  3FH4 A;  3GLJ A;  2ZEL A;  4P4B A;  3MRU A;  1FT7 A;  4C99 A;  3GUX A;  3HLP A;  2PJ0 A;  4MRI A;  4WWV A;  2ZED A;  5LRK A;  2OOT A;  4C9A A;  2PJ3 A;  1R3N A;  3B7I A;  2PJ5 A;  4TNU A;  3IFE A;  3PFO A;  4UEE A;  2POK A;  4OP4 A;  3QNV A;  1PYT B;  2JBJ A;  1CPX A;  2ZOF A;  2Q51 A;  4F9U A;  2ZEG A;  2NSM A;  3KR5 A;  3WT4 A;  2BCO A;  1CP7 A;  2JBK A;  1Z5R A;  4P4D A;  1CP6 A;  2BOA A;  2PE3 A;  3VAT A;  2ZEP A;  5JM6 A;  4P45 A;  3LWU A;  1LFW A;  2PIY A;  4OKO A;  2CTC A;  3WAB A;  2V77 A;  2GLJ A;  1H8L A;  3B3S A;  1TF8 A;  5HVH A;  3B35 A;  4ZY2 A;  4OC4 A;  4P6Y A;  1TKH A;  4P44 A;  2XEI A;  4G1P A;  4P4E A;  5IB9 A;  4MHP A;  5LYF A;  4ZX9 A;  1YSJ A;  3TC8 A;  3PB8 X;  1QQ9 A;  1LCP A;  3CPA A;  3BXM A;  1BPN A;  3KR4 A; 
#chains in the Genus database with same CATH topology
 4KOT A;  2UV8 G;  1B6B A;  1VKC A;  2N3A B;  1S7N A;  1XRY A;  3QAH A;  3GY9 A;  1JWQ A;  4TWE A;  2HB6 A;  2OH1 A;  5G20 A;  4JXQ A;  4FD6 A;  4AVC A;  3TYX A;  4BPU B;  2PJ1 A;  3WR7 A;  1V0C A;  3SJF A;  1YVK A;  5HMN A;  2CBL A;  2NYQ A;  2ODF A;  1VIX A;  1ARM A;  1A9X B;  2D0O A;  1Q5X A;  3D68 A;  5H84 A;  4EME A;  3B3C A;  2GAN A;  2JLM A;  3G3S A;  3KKW A;  1UWY A;  5IB0 A;  5IR2 A;  5HVG A;  3TLC A;  2YND A;  1EE3 P;  2ZPA A;  3F8K A;  4L8A A;  4PXC A;  3VRN A;  5J1Q A;  1HDQ A;  1M4D A;  1R43 A;  1C3O B;  4TJX A;  1GYT A;  1NBW A;  5DS0 A;  4X3R A;  2GRE A;  3JVN A;  1I21 A;  5C82 A;  1JDB C;  1BLL E;  1GHE A;  3GKR A;  3QB8 A;  4MFK A;  1Q2C A;  4LX9 A;  3FED A;  3SXN A;  3D7G A;  1X10 A;  4C7I A;  1Y7E A;  4KVM E;  4CAV A;  4FBE A;  1IU8 A;  3CDX A;  4ZGY B;  1YLO A;  2Q0Y A;  2Q43 A;  4ZI6 A;  2GLF A;  4R3K A;  3VAR A;  1KUX A;  1LAM A;  4UEZ A;  4OID A;  2Q04 A;  3T9Y A;  1NE9 A;  2PJC A;  1MJ9 A;  4ZY1 A;  3I6S A;  3OAK A;  1PCA A;  4KVX A;  3R95 A;  4M6H A;  4BPX B;  1ZG9 A;  4INJ A;  2ZEM A;  3T90 A;  4JVO A;  3RYO A;  5AG6 A;  2VZZ A;  2BSW A;  4GM5 A;  2ZEH A;  4R9M A;  4KLV A;  5AGE A;  4JWP A;  3PB7 X;  4IIY A;  1CM0 A;  3GIU A;  4JZ0 A;  2CF4 A;  2B4D A;  5JYB A;  1ARL A;  3LOD A;  2GU2 A;  3I1U A;  4MHZ A;  3TTH A;  4F0X A;  5ISV A;  2X0S A;  2V8D A;  2KCW A;  3BJ7 A;  3PT1 A;  4R6T A;  1NSL A;  2IJZ A;  2P0W A;  5GCN A;  2XPL A;  3TLG A;  4A2Z A;  1IIC A;  4C9V A;  5BY0 A;  1DIK A;  2Z0Z A;  1ZLI A;  1LOK A;  4C8T A;  2FIA A;  1IYL A;  2RB7 A;  1TKJ A;  3CPX A;  2P6F A;  3LMS A;  1Q2D A;  4UWJ A;  4F0Y A;  3FX6 A;  1MK4 A;  2Q4Z A;  4NJR A;  4NGM A;  2XPN A;  4R57 A;  3R9E A;  5F1Y A;  3FJU A;  4PXB A;  3TT2 A;  3BJ8 A;  2REE A;  4PSX A;  2HI6 A;  3N5F A;  2PVW A;  2Y1N A;  5HH1 A;  5LRJ A;  5F5X A;  1S3Z A;  3HUV A;  4KSF A;  1MJA A;  2XEG A;  4A94 A;  4GXH A;  3RNZ A;  2OLS A;  2BEI A;  5A28 A;  2REF A;  4CYO A;  4A95 A;  2F5I A;  3D4U A;  3D67 A;  5F49 A;  5KTD A;  5JVL A;  2FIW A;  4C85 A;  3BI0 A;  3W6X A;  3VGO A;  3S9N A;  3IWE A;  4JJX A;  1Y9Z A;  2JEW A;  4DJL A;  3S9L A;  4XPD C;  1NMT A;  3B8G A;  3BI1 A;  4H1H A;  3B3V A;  5THW A;  2ATR A;  4CGO A;  1Y0R A;  1ZL0 A;  3BHX A;  2R82 A;  2J8R A;  5JGF A;  2R7H A;  4ZX8 A;  3T0T A;  4R8F A;  4JYW A;  3I9S A;  4PXE A;  3WC6 A;  4BD9 A;  3HPH E;  4OC5 A;  2D0P A;  4CDJ A;  4QVT A;  4IIX A;  2OZU A;  2J8N A;  4MCR A;  4U9Y A;  3CT9 A;  4A38 A;  1BAV A;  1VHS A;  4KOW A;  4NF1 A;  3WC7 A;  1M4L A;  2C27 A;  2EUI A;  3TO7 A;  3BUW B;  4L89 A;  2QVP A;  5CBM A;  3C8O A;  2HRO A;  3D2M A;  3TLA A;  2B58 A;  4MBU A;  2GE3 A;  2ZEO A;  2J8M A;  1AYE A;  1S7K A;  2O28 A;  1Y9K A;  1ZYM A;  5F46 A;  3TO6 A;  4P4I A;  3OWC A;  2PJ7 A;  2XPO A;  3TLZ A;  4F9V A;  4ONU A;  4UFW A;  2Q7S A;  5JPH A;  2DF5 A;  2FT0 A;  1T36 B;  1AMP A;  1QSM A;  3K9U A;  4CDK A;  1Y9W A;  5EC4 A;  1F2O A;  1XMT A;  4XPD B;  2EO8 A;  2Y0M A;  6CPA A;  3G8W A;  3BUO B;  4I49 A;  4U5Y A;  4Y49 C;  3GB0 A;  4MJX A;  2J9A A;  2O4H A;  5F09 A;  4AB7 A;  4MCP A;  4NGN A;  1MJB A;  2EZA A;  2PCN A;  4AG7 A;  5J3X A;  2VXK A;  2YNC A;  3JTK A;  1B47 A;  2D4O A;  3NH8 A;  4EFD A;  3PGP A;  4FWU A;  2VKZ G;  3K2K A;  5C88 A;  4RR2 B;  2WPW A;  2ZEE A;  4IAV A;  1QSO A;  3LAC A;  4E0A A;  1VI4 A;  4C84 A;  3RO0 A;  2JDD A;  4B6Z A;  4J0N A;  2FSR A;  2XEF A;  4MFJ A;  8CPA A;  4C9U A;  2CNT A;  2PRQ A;  3ISX A;  5K8M A;  3I3G A;  3SI1 A;  3TO9 A;  1M44 A;  4M8D A;  1ZG8 A;  4EYS A;  4CAW A;  4FAI A;  1XFO A;  3D2P A;  1KUV A;  1PU9 A;  2VBQ A;  4MHD A;  1Z8T A;  5LYD A;  4OC3 A;  4X8I A;  3S6F A;  4B13 A;  3K4I A;  1Q2Y A;  3P2H A;  2FXF A;  2XEJ A;  4KSA A;  4PXD A;  4UEF A;  4Q36 A;  4Y49 B;  2VZY A;  4ZYQ A;  3H5Z A;  5HKW A;  3V8I A;  4KOU A;  4DUK A;  4NEX A;  3FF3 A;  3PB9 X;  5FVJ A;  2C6C A;  3D7H A;  4YU9 A;  2G3T A;  2QML A;  2Z3O A;  4A39 A;  4NGR A;  1VGY A;  4UIA A;  4B14 A;  1S7L A;  2HWG A;  3VTA A;  2AFW A;  2ANP A;  2IQ6 A;  3EFA A;  4IUS A;  5LRG A;  2F7V A;  2WSA A;  4X2T A;  1IOF A;  3EZA A;  5DWM A;  3I74 A;  3TE4 A;  1P4N A;  4ORF A;  4XPK A;  2AFU A;  2Q4Y A;  4C8C A;  1Z8L A;  3R9F A;  5K8O A;  3V38 A;  4XNH C;  1J3L A;  4OME A;  4MCQ A;  2WPX A;  4W9Y A;  3L2N A;  2AFO A;  4UIB A;  4YRH A;  5J8F A;  2Z3P A;  4EWT A;  2BUE A;  4NGQ A;  4A4C A;  4JXR A;  3PFE A;  4HKF A;  4LQG A;  3EC4 A;  1YLE A;  2HUZ A;  3DLJ A;  3T05 A;  2ZEF A;  2B3U A;  2PJ4 A;  4MFP A;  5H86 A;  5D29 A;  5K8N A;  4LUA A;  3D8P A;  2B5G B;  2FCK A;  3JRU A;  4E8O A;  3EIF A;  3OP0 A;  2ARH A;  5KTC A;  3EY5 A;  5HXD A;  2ABZ A;  3KAS A;  1F2P A;  3TOB A;  1EO0 A;  1XBU A;  3CXQ A;  1IY7 A;  3IGR A;  3IJ3 A;  2ZXV A;  3V7Z A;  4NCZ A;  2C6P A;  4FUU A;  4COG A;  2Q7B A;  1NSA A;  2PJ6 A;  4B5P B;  4NGT A;  4EVY A;  3B3W A;  4C9R A;  1LAP A;  2GIV A;  2Z3L A;  3H8E A;  1VHE A;  3EZB A;  1YVO A;  3IO1 A;  3IU1 A;  4UBR A;  1Q7L A;  2AFM A;  4XNH B;  3U1B A;  4RN7 A;  4NXY A;  2PIZ A;  4CAE A;  4NGP A;  4ZY0 A;  3GJZ A;  1XF8 A;  5G1Z A;  4KNG E;  1S60 A;  2X7B A;  4RUH A;  1WWZ A;  4QBJ A;  2I3C A;  3DSB A;  2R1I A;  3OB1 B;  4CGP A;  5JH9 A;  2B0A A;  3D7F A;  5LYL A;  4TJV A;  5I0C A;  4H6U A;  4QB9 A;  5AG5 A;  4C2Y A;  4KOS A;  3NH5 A;  4C2Z A;  2B4J C;  3VRO A;  3F5B A;  4AG9 A;  4PK2 A;  3DR8 A;  4E2A A;  4JD6 A;  1CS0 B;  2DLA A;  2PR1 A;  2E28 A;  3CZX A;  4NJQ A;  1YR0 A;  3IC1 A;  4UFX A;  3SHP A;  1TKF A;  5AXI A;  4KUA A;  5JQ4 A;  4JLY A;  1CJW A;  4CPA A;  1XMB A;  1I12 A;  1XOV A;  3DGV A;  1F57 A;  1XIX A;  3R1K A;  4BMH A;  1TXR A;  2CIJ A;  1XJO A;  1CG2 A;  4R7M A;  1LRZ A;  1QMU A;  1KWM A;  4UF4 A;  4M85 A;  4MFL A;  2C5Q A;  4E5S A;  4FD5 A;  4YN3 A;  1YX0 A;  4GS4 A;  2DPS A;  2CNM A;  3KQX A;  5CNP A;  1L0C A;  2OR4 A;  5LYI A;  3ZJ0 A;  3PB6 X;  4CGM A;  4PPZ A;  1OZP A;  2Z3M A;  3TCV A;  2I79 A;  4YWY A;  1IYK A;  2CNS A;  2EK9 A;  1HDU A;  4CYN A;  2DIK A;  4PQA A;  1WK4 A;  3KHZ A;  3FBU A;  4CO9 A;  5I4M A;  3FEE A;  2C6G A;  1M4G A;  3NFZ A;  1YME A;  3VRQ A;  2V8G A;  3SJG A;  2VI7 A;  1YVH A;  2C1C A;  3D66 A;  5HKZ A;  5G22 A;  1YW4 A;  3OB2 B;  4II9 A;  5HKY A;  2QIR A;  1YRE A;  3FNC A;  2XPP A;  1R57 A;  1RO5 A;  4COB A;  2JDC A;  3T8W A;  2DXQ A;  2YNE A;  4KLW A;  3KQZ A;  4OC2 A;  2OU2 A;  4ONW A;  4AXV A;  4Q38 A;  1R61 A;  5F9M A;  2PJ9 A;  2B3V A;  2RFH A;  4X5K A;  4IK2 A;  4Q7A A;  1Y7R A;  3VRP A;  2AFS A;  3PRT A;  5ELY A;  1ELM P;  1SQH A;  3E0K A;  4KOX A;  4C8A A;  1BPM A;  7CPA A;  4UFV A;  4UA3 A;  5F47 A;  1TF9 A;  3B3T A;  1NXJ A;  4A30 A;  1YK3 A;  3EO4 A;  3PBB A;  4FD7 A;  4C8F A;  3CXP A;  1V6C A;  3TLY A;  3NE7 A;  3G23 A;  1K4J A;  2P6G A;  1FBV A;  1LAN A;  4R76 A;  2Z3N A;  4MFZ A;  4MMO A;  1GGO A;  4M6I A;  3RBU A;  1Z8X A;  4BPW B;  2AE6 A;  3IWW A;  2HC9 A;  4M3S A;  3ISZ A;  4H6Z A;  4HNW B;  2G9D A;  3PBE A;  5D8N A;  4XPL A;  3S6H A;  4A37 A;  4Z65 A;  5IX3 A;  3NE8 A;  3GYA A;  1XF1 A;  3F9K C;  4M6G A;  2Z3K A;  3KZW A;  3LD2 A;  3H4Q A;  3IEH A;  4IHM A;  2FVG A;  1VBG A;  2YGW A;  1J4J A;  1IB1 E;  4PK3 A;  4C86 A;  1KEE B;  3DR6 A;  3KGQ A;  1HEE A;  4MHY A;  4MY3 A;  3KI9 A;  3TLB A;  1JDE A;  3TLE A;  1M6V B;  3EXN A;  3RAM A;  4OAE A;  3WC5 A;  1FNO A;  4MXU A;  5HVF A;  3IIB A;  2NMT A;  4C8P A;  1Y0Y A;  2V8H A;  4MHN A;  5K99 A;  3SI2 A;  1CPS A;  4F8Z A;  4BTF A;  3K9T A;  4KSI A;  2ZOG A;  3D3S A;  3BUX B;  3SJX A;  3H8G A;  2CTB A;  2CXA A;  2O53 A;  3PEI A;  1EZB A;  4DYO A;  2G3A A;  4C9E A;  1S7F A;  4O23 A;  1XE4 A;  3R96 A;  2BL1 A;  2F8H A;  4GPL B;  4IF5 A;  2MP0 A;  3FEC A;  1CBX A;  2B4D B;  1DE4 C;  3MN8 A;  4HNX B;  2QYV A;  3C26 A;  4MCS A;  1QSR A;  3S6G A;  4C2X A;  4CGL A;  2PJ2 A;  3SI0 A;  2EWB A;  1ELL P;  3T5M A;  2QJ8 A;  2WZN A;  2Q4V A;  1BXR B;  2R8V A;  1YGH A;  4P4J A;  1RTQ A;  2AFX A;  4B11 A;  2QEC A;  4B5O A;  3H8F A;  3BUM B;  1CE8 B;  1BOB A;  4FD4 A;  3N7Z A;  2Q44 A;  3TLG B;  3FYN A;  1BO4 A;  1KUY A;  1CX8 A;  2GP4 A;  1S5K A;  3EZE A;  3SJE A;  1I1D A;  4CS0 B;  2ZW4 A;  4ZBG A;  2FS5 A;  4CYP A;  5EBV A;  1IOI A;  4MFQ A;  1OBR A;  3PB4 X;  4NFR A;  4A31 A;  3KRV A;  1AUG A;  3NH4 A;  2FE7 A;  4KZT A;  2YJT A;  1DTD A;  1WVM A;  4AVA A;  1ZLH A;  2PVV A;  2PJ8 A;  4P10 A;  4C8U A;  3FMC A;  2PJB A;  4MY0 A;  5CPA A;  2RC4 A;  5AG7 A;  5IV0 A;  1JQG A;  4UWI A;  4NGS A;  3RZA A;  4MI4 A;  3VH9 A;  3KL9 A;  3VWD A;  3MGD A;  1IGB A;  3PLF B;  3DDD A;  1IID A;  2PCU A;  1ZRS A;  4H2K A;  4HPS A;  2DEA A;  3O8Z A;  4KOY A;  2VL1 A;  3S9M A;  3NOJ A;  4LQ6 A;  2I00 A;  1YW6 A;  3FVL A;  3BUN B;  1Z4R A;  1Z2L A;  2VEZ A;  4OIW A;  3PFV A;  3D7D A;  2D4P A;  2OB0 A;  1A2Z A;  5G21 A;  2AFZ A;  4BIN A;  4WJB A;  2AUN A;  3IU2 A;  3S6K A;  1TIQ A;  1ZG7 A;  3ICU A;  4K3N A;  4A32 A;  2WUU A;  4R87 A;  1M1D A;  4NSQ A;  3T07 A;  1KBL A;  5K8P A;  2Z11 A;  3KHX A;  2V8V A;  1WJT A;  2ZW6 A;  3NA6 A;  2WYR A;  2YNC C;  3W91 A;  4K30 A;  2ZEN A;  1KZF A;  2IMO A;  4OC0 A;  2PDO A;  2BO9 A;  1VHO A;  3TX8 A;  1VBH A;  4CAF A;  2EK8 A;  4DNC A;  2PRB A;  1PUA A;  3B2Y A;  4KOV A;  4OC1 A;  4P4F A;  2PJA A;  3FH4 A;  3HMJ G;  2H5M A;  3GLJ A;  4UCP A;  1RXT A;  2ZEL A;  4H89 A;  4P4B A;  3MRU A;  1FY7 A;  2PQ8 A;  3UY5 A;  1FT7 A;  4C99 A;  1QST A;  3GUX A;  3HLP A;  2FL4 A;  2PJ0 A;  1QSN A;  4MRI A;  4MI1 A;  4WWV A;  2ZED A;  1Z4E A;  5LRK A;  4OLL A;  2B5G A;  2OOT A;  4J3G A;  5A27 A;  4C9A A;  3IWG A;  2HQY A;  2PJ3 A;  2B4B A;  4F6A A;  2ZW7 A;  1R3N A;  3B7I A;  2PC1 A;  2PJ5 A;  5DWN A;  4TNU A;  4B5P A;  1UFH A;  5J8C A;  2FM4 A;  5F13 A;  3IFE A;  3R9G A;  4U9Z A;  4CRY B;  3NFQ A;  3PFO A;  2PR8 A;  1M4I A;  2POK A;  3QNV A;  2VQY A;  4OP4 A;  4UEE A;  1C30 B;  1PYT B;  1KC7 A;  2JBJ A;  2EVN A;  5BWA B;  1XEB A;  1CPX A;  4HNY B;  2CY2 A;  2ZOF A;  2DPT A;  4A4B A;  1YQE A;  4R3L A;  1B87 A;  3U88 C;  2Q51 A;  4C7H A;  4CYQ A;  2ZEG A;  4F9U A;  3CXS A;  2NSM A;  3A9L A;  3KR5 A;  3WT4 A;  4QC6 A;  2BCO A;  2EBJ A;  3BLN A;  3TOA A;  4CAX A;  1CP7 A;  1P0H A;  2JBK A;  3F0A A;  2OZG A;  3HPG G;  1Z5R A;  3FB3 A;  5EMI A;  4CGN A;  4E94 A;  2ZW5 A;  3JUW A;  2GFQ A;  2Z10 A;  3SR3 A;  4RS2 A;  4P4D A;  1CP6 A;  1ON0 A;  2BOA A;  2PE3 A;  3VRR A;  2ZEP A;  4OAD A;  3VAT A;  4YFJ A;  5JM6 A;  4P45 A;  4UCM A;  3LWU A;  1Z9U A;  4RI1 A;  1LFW A;  4KUB A;  1U6M A;  3QAY A;  2YJV A;  4PSW A;  5FD8 A;  2PIY A;  3PP9 A;  4OKO A;  4YGO A;  2P6E A;  4CRZ B;  2CTC A;  2IL4 A;  3WAB A;  2V77 A;  2GLJ A;  2G0B A;  1Z8W A;  1H8L A;  3DNS A;  4MJ8 A;  2EZB A;  3B3S A;  4B12 A;  2AUM A;  1TF8 A;  5HVH A;  3B35 A;  4ZY2 A;  3FXT A;  2Y1M A;  3TFY A;  4OC4 A;  3SXO A;  4P6Y A;  1TKH A;  4PV6 A;  5E96 A;  5F48 A;  4P44 A;  1X12 A;  4AVB A;  4KOR A;  2XEI A;  3PZJ A;  2HV2 A;  4G1P A;  3VWE A;  1EZA A;  4B10 A;  4P4E A;  4KS9 A;  4KVO E;  5IB9 A;  3FRM A;  3W6S A;  3P2F A;  2OZH A;  4A33 A;  4MHP A;  5LYF A;  1Z9E A;  3ZNI A;  4BBH A;  5AG4 A;  1N71 A;  4UCN A;  4ZX9 A;  4CZ1 A;  1YSJ A;  3ZZI A;  3TC8 A;  2PSW A;  2A4N A;  2R98 A;  3PB8 X;  4QUS A;  1QQ9 A;  2JEV A;  1LCP A;  3CPA A;  4C68 A;  1ZO0 A;  2EZC A;  3BXM A;  2AJ6 A;  3FIX A;  2K5T A;  1BPN A;  5KTA A;  3KR4 A; 
#chains in the Genus database with same CATH homology
 1XRY A;  4TWE A;  2HB6 A;  2PJ1 A;  3SJF A;  2NYQ A;  1VIX A;  1ARM A;  3D68 A;  4EME A;  3B3C A;  5IR2 A;  1UWY A;  5HVG A;  1EE3 P;  4PXC A;  5J1Q A;  1HDQ A;  1R43 A;  4TJX A;  1GYT A;  5DS0 A;  4X3R A;  2GRE A;  1BLL E;  4FBE A;  3FED A;  3D7G A;  1Y7E A;  3CDX A;  1YLO A;  4ZI6 A;  2Q43 A;  2GLF A;  3VAR A;  1LAM A;  4UEZ A;  4OID A;  4ZY1 A;  2PJC A;  3I6S A;  1PCA A;  1ZG9 A;  2ZEM A;  4GM5 A;  2ZEH A;  3PB7 X;  4JZ0 A;  2CF4 A;  1ARL A;  2GU2 A;  3I1U A;  4MHZ A;  2V8D A;  4R6T A;  2IJZ A;  4C9V A;  1ZLI A;  1LOK A;  4C8T A;  2RB7 A;  1TKJ A;  3CPX A;  3LMS A;  3FX6 A;  4NJR A;  2Q4Z A;  4NGM A;  3FJU A;  4PXB A;  3N5F A;  2PVW A;  5LRJ A;  3HUV A;  2XEG A;  4A94 A;  3D4U A;  3D67 A;  4C85 A;  3BI0 A;  3S9N A;  1Y9Z A;  2JEW A;  4DJL A;  3S9L A;  3BI1 A;  3B3V A;  5THW A;  1Y0R A;  3BHX A;  5JGF A;  4ZX8 A;  4R8F A;  4JYW A;  4PXE A;  3WC6 A;  4BD9 A;  4OC5 A;  4CDJ A;  4MCR A;  3CT9 A;  4A38 A;  1BAV A;  3WC7 A;  1M4L A;  2QVP A;  5CBM A;  2ZEO A;  1AYE A;  4P4I A;  2PJ7 A;  4F9V A;  4CDK A;  1AMP A;  1F2O A;  6CPA A;  3GB0 A;  2J9A A;  2O4H A;  5F09 A;  4MCP A;  4NGN A;  3NH8 A;  4EFD A;  4FWU A;  3K2K A;  2ZEE A;  4IAV A;  4C84 A;  4B6Z A;  2XEF A;  8CPA A;  4C9U A;  3ISX A;  2PRQ A;  5K8M A;  3SI1 A;  1ZG8 A;  4FAI A;  1XFO A;  5LYD A;  4OC3 A;  4X8I A;  2XEJ A;  4PXD A;  4UEF A;  4ZYQ A;  4DUK A;  3FF3 A;  3PB9 X;  2C6C A;  3D7H A;  4YU9 A;  4A39 A;  4NGR A;  1VGY A;  4UIA A;  3VTA A;  2AFW A;  2ANP A;  2IQ6 A;  5LRG A;  2F7V A;  4X2T A;  3I74 A;  2AFU A;  4C8C A;  1Z8L A;  5K8O A;  3V38 A;  4OME A;  4MCQ A;  4W9Y A;  3L2N A;  2AFO A;  4UIB A;  4EWT A;  4NGQ A;  3PFE A;  4LQG A;  3DLJ A;  2ZEF A;  2PJ4 A;  5D29 A;  5K8N A;  3JRU A;  3EIF A;  5HXD A;  2ABZ A;  3KAS A;  1F2P A;  1XBU A;  3IJ3 A;  1IY7 A;  3V7Z A;  2C6P A;  4FUU A;  1NSA A;  2PJ6 A;  4NGT A;  3B3W A;  4C9R A;  1LAP A;  3H8E A;  1VHE A;  3IO1 A;  1Q7L A;  2AFM A;  2PIZ A;  4NGP A;  4ZY0 A;  4KNG E;  4RUH A;  2I3C A;  5JH9 A;  3D7F A;  5LYL A;  4TJV A;  3NH5 A;  4NJQ A;  3IC1 A;  1TKF A;  4CPA A;  1XMB A;  3DGV A;  1F57 A;  1TXR A;  2CIJ A;  1XJO A;  1CG2 A;  4R7M A;  1QMU A;  1KWM A;  4UF4 A;  2C5Q A;  4YN3 A;  3KQX A;  2OR4 A;  5LYI A;  3PB6 X;  4PPZ A;  4YWY A;  2EK9 A;  1HDU A;  4PQA A;  3KHZ A;  5I4M A;  3FEE A;  2C6G A;  3NFZ A;  1YME A;  2V8G A;  3D66 A;  3SJG A;  2C1C A;  1YW4 A;  3T8W A;  3KQZ A;  4OC2 A;  4ONW A;  4AXV A;  2PJ9 A;  2RFH A;  4IK2 A;  4Q7A A;  2AFS A;  3PRT A;  5ELY A;  1ELM P;  4C8A A;  1BPM A;  7CPA A;  1TF9 A;  3B3T A;  3PBB A;  4C8F A;  1V6C A;  1LAN A;  4R76 A;  4MMO A;  3RBU A;  3IWW A;  2HC9 A;  3ISZ A;  4A37 A;  4Z65 A;  2G9D A;  3PBE A;  5D8N A;  1XF1 A;  3KZW A;  3IEH A;  4IHM A;  2FVG A;  4C86 A;  3KGQ A;  1HEE A;  4MHY A;  3KI9 A;  3RAM A;  3WC5 A;  1FNO A;  4MXU A;  5HVF A;  3IIB A;  4C8P A;  1Y0Y A;  2V8H A;  4MHN A;  3SI2 A;  1CPS A;  4F8Z A;  3K9T A;  4KSI A;  2ZOG A;  3SJX A;  3H8G A;  2CTB A;  3PEI A;  2O53 A;  4DYO A;  4C9E A;  4O23 A;  2F8H A;  3FEC A;  1CBX A;  3MN8 A;  1DE4 C;  2QYV A;  4MCS A;  2PJ2 A;  3SI0 A;  2EWB A;  1ELL P;  2QJ8 A;  2WZN A;  4P4J A;  1RTQ A;  2AFX A;  3H8F A;  1CX8 A;  2GP4 A;  3SJE A;  1OBR A;  3PB4 X;  4NFR A;  3NH4 A;  1DTD A;  1WVM A;  1ZLH A;  2PVV A;  2PJ8 A;  4P10 A;  4C8U A;  3FMC A;  2PJB A;  5CPA A;  1JQG A;  3RZA A;  4NGS A;  3VH9 A;  3KL9 A;  1IGB A;  2PCU A;  4H2K A;  2DEA A;  2VL1 A;  3S9M A;  1YW6 A;  3FVL A;  1Z2L A;  4OIW A;  3D7D A;  2AFZ A;  4WJB A;  3ICU A;  1ZG7 A;  4K3N A;  5K8P A;  3KHX A;  2V8V A;  3NA6 A;  2WYR A;  2ZEN A;  2IMO A;  4OC0 A;  2BO9 A;  1VHO A;  3TX8 A;  2EK8 A;  3B2Y A;  4OC1 A;  4P4F A;  2PJA A;  3FH4 A;  3GLJ A;  2ZEL A;  4P4B A;  3MRU A;  1FT7 A;  4C99 A;  3GUX A;  3HLP A;  2PJ0 A;  4MRI A;  4WWV A;  2ZED A;  5LRK A;  2OOT A;  4C9A A;  2PJ3 A;  1R3N A;  3B7I A;  2PJ5 A;  4TNU A;  3IFE A;  3PFO A;  4UEE A;  2POK A;  4OP4 A;  3QNV A;  1PYT B;  2JBJ A;  1CPX A;  2ZOF A;  2Q51 A;  4F9U A;  2ZEG A;  2NSM A;  3KR5 A;  3WT4 A;  2BCO A;  1CP7 A;  2JBK A;  1Z5R A;  4P4D A;  1CP6 A;  2BOA A;  2PE3 A;  3VAT A;  2ZEP A;  5JM6 A;  4P45 A;  3LWU A;  1LFW A;  2PIY A;  4OKO A;  2CTC A;  3WAB A;  2V77 A;  2GLJ A;  1H8L A;  3B3S A;  1TF8 A;  5HVH A;  3B35 A;  4ZY2 A;  4OC4 A;  4P6Y A;  1TKH A;  4P44 A;  2XEI A;  4G1P A;  4P4E A;  5IB9 A;  4MHP A;  5LYF A;  4ZX9 A;  1YSJ A;  3TC8 A;  3PB8 X;  1QQ9 A;  1LCP A;  3CPA A;  3BXM A;  1BPN A;  3KR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...