3IWXA

Crystal structure of cisplatin bound to a human copper chaperone (dimer)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of cisplatin bound to a human copper chaperone.
pubmed doi rcsb
molecule keywords Copper transport protein ATOX1
molecule tags Metal transport
source organism Homo sapiens
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iwxA00
4Y2IA 3FGVA 2ZDPA 5B0BA 3DCAA 2G9OA 2ROGA 1Y3JA 1CC7A 3K7RA 1JWWA 1TR0A 2K7KA 2BJDA 2EW9A 2RILA 3KKFA 3FMBA 3TOQA 1FD8A 2AJ0A 3WDOA 3BDEA 4Y2MA 2IYGA 3T9NA 2N4DA 1OSDA 2FHMA 1QUPA 1WD6A 4ZA1A 5T7LA 2ZDOA 1FVQA 1TL4A 1AW0A 1KQKA 2KKHA 2HQIA 3FRYA 2PD1A 3BF4A 4NPOA 3CJKB 1FEEA 2XMJA 2LDIA 1Q8BA 2W4DA 1FVSA 1W2IA 3HHLA 4OIXA 4OJ1A 1K0VA 2OKQA 2XMKA 5B0EA 2JDJA 1OPZA 2W4CA 1X0PA 3KG0A 4FNIA 1CPZA 2W4PA 5B0CA 2XMMA 4HH0A 2OMOA 1FE4A 2GO8A 2HIQA 1TUVA 2L3MA 5B0AA 5F0UA 2GGPA 2GV1A 2K2PA 3BM7A 2RMLA 5T7LB 2KYZA 4A4JA 2Q3PA 2OD6A 2XMWA 4A47A 1SI9A 3HHLD 3I9ZA 4U9RA 2RU9A 1Q4RA 3HDSA 5A6WA 1JK9B 1YJTA 2HLTA 4DL0C 3LGMA 2K1RA 1Y0HA 2LQBA 2VV5A 3HHLB 4Y2KA 1OQ3A 3KG1A 4HH1A 1N5SA 2QIFA 5B0FA 1YJUA 2FB0A 4HL9A 2QYCA 5B09A 4ZOSA 2AJ1A 1Q8LA 2BUNA 4EFAC 4FNHA 1XBWA 5A6PA 1N5VA 3TNVA 5IXUA 1Y3KA 1VQYA 1AFIA 1Q53A 1YJVA 2LXFA 4HI1A 2GGPB 2OFGX 3DXSX 3MZIA 3BR8A 4Q2LA 2ACYA 4HI2A 2FIUA 2XMUA 1V3ZA 2HFNA 3BB5A 2K1RB 3UDCA 2FTRA 3CJKA 1OQ6A 3HF5A 3MCSA 1LQ9A 3F44A 4QOTA 2BBEA 3BGUA 1MWZA 3HFKA 1P8GA 2IYIA 3GZ7A 5B08A 2XMTA 4DPOA 2N7YA 2QLWA 1S6OA 2IFXA 1TL5A 1APSA 2ASYA 2KT3A 1U7LA 1R6YA 2GCFA 2GA7A 3HHLC 1CC8A 4A46A 4OJGA 5B0GA 4Q2MA 1SB6A 1N5TA 3E8OA 2QLXA 3IWLA 2N4CA 1S6UA 3VTIA 2HLUA 1X7VA 1GXTA 5KAKA 2GFFA 1FE0A 1VQSA 2BYCA 2K7JA 1Y9OA 1RJJA 4NL5A 2CRLA 4OJ3A 2BJEA 3LO3A 1KVJA 2OAUA 4YDXA 2XMVA 1KVIA 2ROPA 1X8DA 2OFHX 3KNGA 4OJHA 2VH7A 1MWYA 3QMQA 5B0DA 3HX9A 4YEAA 4F67A 1ULRA 2KT2A 2LQ9A 5K9FA 1FESA 1URRA 1IUJA 2OD4A 3LGNA 4A48A 3IWXA 1YG0A 1YRXA 3BN7A 1YJRA 2AW0A 1AFJA 2HFOA 2RSQA 4DN9A 2OP5A 5F0WA 2PGCA 1P6TA 3TRGA 1N5QA 2AP6A 1GXUA 1SQEA 2ROEA 1TZ0A 3QGPA
chains in the Genus database with same CATH superfamily
1Y10A 3IXQA 4I69A 1H2UX 5AXNA 2ABYA 1W7WA 5IWAF 1E6YA 3H5XA 3BF4A 2UVWA 2MXYA 3M8RA 4ANCA 1FRMA 5KFHA 1U6FA 3SDEB 1AZSA 1ICEB 2DR9A 4E8UA 4YB1P 3CD0A 3M2RA 1CVJA 5D3GB 4C48A 4DZDA 2Q3PA 1WEYA 1JLBB 1Q0NA 4Q45A 2B7BB 3LPYA 2XSJB 1RTJA 3IR7B 1WKKA 3VAJA 3NNCA 3QGIA 4WFAQ 2F9DA 3AJ1A 5F9LA 2LA6A 3EM1A 5KT7A 4AUKA 2XCAA 2AKWB 3TJ8A 2OGUA 2XO6A 2C2DA 2O67A 3K8VA 5GAEI 3P5BP 5KFRA 1N32J 2CVEA 4DV7F 5KFMA 2UXDF 2DNGA 3DGPB 5J1PA 2I8EA 1S6QA 1XQIA 1YBAA 1RT3A 2HURA 3BPSP 1O6XA 1HNZJ 1D9FA 1B0VA 4O3PA 2A6MA 4FYDA 1EKRA 2F4VF 4DS5A 2BW7A 2IY5B 2DHXA 2HBQB 1TELA 1KOHA 4JI5F 2MQPA 3D5MA 3I4PA 3AB2B 2F1FA 5L1JA 5E0OA 1ZYQA 5EWGA 1NPRA 3A3PB 1BE4A 4BWMA 1VK3A 3O5TB 3GTYX 4XPCA 4DPTA 4Q8FA 1KNZA 1S0VA 1X4FA 3JTOA 3CCLS 5CD4H 5EDWA 1C0TA 3NBPB 4MIWA 2MZTA 3U1NA 2WK4A 4LQ9A 1LQ9A 2HWTA 4RBUA 1YRTA 2VC0A 1T11A 4PYAA 1PJ7A 2APOA 1K1QA 1C1BB 4F0MA 3UR3C 3N28A 4J9PA 4WWSA 2GIFA 1YK9A 3H5UA 2O5DA 1RT5B 1HYSA 1RAJA 3MM8B 4CLKA 2GJFA 3PIOQ 3KG4A 1P27B 1FESA 4C0BA 4C3MA 3UPFA 1NJWA 1LV5A 3EXCX 5GAGU 2ZDPA 1IM6A 1HWIA 3B54A 3DOMB 4CNZA 5IQQA 3BSNA 2YY3A 4KKOA 2F65A 1NK6A 3NCPA 1SJFA 5KG6A 4URGA 4B3TJ 2K3IA 4JI6F 3RU0A 5G4DA 3N6MA 5C25A 4ID8A 5HVFA 1CBKA 1ZAXA 4B3SF 2P5VA 4JV2A 2DHGA 4ZOSA 2XI3A 1UFLA 1C2PA 4DSKA 2Q6CA 4NA1A 3V2UC 4K4ZA 4J9QA 5FD1A 2WZ1A 1Q7YT 4HACA 2EXUA 3L7OA 1ZS6A 1NMEB 2CADA 4DSEA 4JOUA 1RA7A 5LJ5Y 1HPZA 2KYXA 3TAMA 3G6ES 4F04B 3QGPA 3DLHA 4J91A 5M2UA 4ZK7M 5T14A 1VR6A 1XR7A 2HIYA 1PAEX 1I94F 2HZAA 4JI1J 4K8RA 3KLIB 1K9MT 1JLEA 4YMEA 5L9NA 3KXDA 1KS2A 1RWUA 3FZBA 2FC8A 2OTLS 2MGZA 4ITSA 3C16B 3R5BA 2CQ1A 3GG1A 5SUHA 3O2IA 2LQBA 1ZPVA 4ZVQB 2YX7A 4QJVA 3X1LB 4ILRA 1R0CB 1VQ7S 4PXCA 5HAOA 2V4JA 1VBZA 2JVOA 1HD1A 4KQZA 3DDKA 2BX6A 3WZ0A 3TQ1A 1RHMB 1HIYA 5CD4A 1Q78A 2HNYA 2F7VA 3Q2TC 1T9UA 4X64J 3G8TA 3BKTA 1SBRA 3IP0A 3HHNB 3TARA 3D54A 2Y1IA 2ZBIA 5KFXA 4ED2A 2LCWA 4CH1A 3LF0A 2WSCC 2HHWA 4MT1A 4USKA 2CQCA 2RDDA 2QO3A 3CJ8A 1QUPA 3LQVA 1SKWA 4M5DA 3EGVA 3DFEA 1RYRA 4C11A 4USJC 1U1RA 2QC3A 4QR0A 1X4HA 3V81B 4OX8A 3MM7B 1CQNA 4FF3A 1L5UA 1RCXB 4ECRA 4NCGA 2LQJA 1F3VA 1XBWA 1TTHB 3AQPA 2EC0A 2V8DA 2CPHA 5CYQA 3DLEA 3FKBA 4WKRA 1HNIB 2L08A 2OO4A 2Q6BA 1N32F 3HK2A 4BHQA 3D6TB 2DXFA 6FDRA 1B0PA 4NLYA 4WBFA 4OZNA 1LFPA 2JVRA 4QWAA 1WELA 5KFGA 5H9FJ 1GFWB 1HNZF 1CSJA 3HZEA 4YDXA 4PEOA 3V4MA 3OXGA 5F8JA 1QSLA 1CULB 2MSSA 4TY9A 2J6SA 2AWZA 3P49B 3HVTA 4EEYA 4DJBA 4HHJA 3US5A 4CM2A 2VL1A 3TOQA 5F8GA 3BQ1A 2HVHA 3PEHA 2KKHA 4RL1A 2JSXA 6FD1A 4FXVA 4HHHA 3W9JA 1RTHA 4NXMF 2DRAA 3ZTOA 3JSYA 5CZVA 3FDSA 2HVDA 2E1MC 3KK3B 4U9RA 1UZHA 3QQCD 2R8IA 3WX4A 1T7PA 3CIZA 1PCAA 3QRRA 1RBOB 3KUEA 3PZPA 4B9MA 2PMWA 2PIIA 2HQDA 2FTRA 2NSBA 4LRDA 4RWWA 1WHXA 3Q8VA 2N7YA 1FXDA 4M5JA 3GV5B 3D4JA 3O8WA 1KQSR 1QLNA 3VTIA 2W9CA 1HW8A 3FQLA 3HI9A 2XBPA 2VBXA 2IAJA 4K0KJ 1O8BA 2O1PA 4K7QA 2R2RA 3QPIA 3PACA 4DR2J 3GIKA 5BR8J 3N9UC 1VFJA 4B3TF 3K7RA 2B6AA 4M5NA 3DM2B 3T5LA 2GAHC 3DHWC 1N5YA 1MSWD 3GJTB 1N88A 2N4DA 1UVLA 3OT9A 2ADBA 3CCMS 2E9TA 1WI6A 4OV6A 3DDIA 1W2BR 2B51A 4QYZK 2ZBQA 3KG0A 1U09A 3CULA 2NR0A 3ITHA 3U1LA 3BM7A 3OFEA 5LSOA 2G0IA 3KK1A 2QLFB 3UQSA 1ZTTA 3W1YC 4OI1A 4A8YA 4IQXA 3W61A 1V5IB 1TL3A 3G96A 3QFHA 1TK8A 5CCLA 4FKXA 3OV7A 1R6VA 4WKYA 1RAAB 2UVUA 5B0GA 2OSRA 2BKPA 3AXMA 1YI2S 3OSNA 4MMOA 2UXBJ 2X3DA 1FXRA 1BLUA 1PYSB 3VAMA 3QSYB 8RUCA 4MIAA 3LANA 3VWSA 2ZZNA 3PW0A 2RSQA 2KJWA 2JRSA 4JI1F 2MKCA 4X4SA 3BQ2A 1OY6A 1IKWA 1N33J 4NPOA 3KK2A 3B4MA 2FVSA 4JI4J 2V9KA 1LXNA 2HEKA 1XTZA 2XTJP 4F4ZA 2ZHBA 2G0JA 2G4BA 3PYEA 2WTFA 3MMCA 5I42B 2YKMA 3CW2C 4X64F 2BZ2A 1PKUA 4UOFA 3ZTPA 4KJIA 3UW1A 4Q43A 4YB6A 3R27A 5J1EB 2V5HG 1WJ9A 2ASYA 1Q8KA 4OYWA 2Y0SD 4A8QA 2QLXA 3GILA 3CVKA 4L74A 2E7XA 3H20A 3NNAA 4MIBA 4UOHA 1RT1B 2DH7A 4ZP9A 3J80Y 4UTGA 2CQIA 2ZKTA 5MAOA 2ZOMA 2VBZA 2JNJA 1N5QA 1S1UA 2CJBA 2YKQA 2OPSA 3DOKB 1VIXA 5DDRC 2M88A 2CDQA 1ZBTA 2W24A 2ZE2A 4N56A 1FE4A 2RU3A 3LP2A 3IG1A 1ZZNA 3KOAA 2KZMA 4ZMMA 1TU0B 2Y8WA 5J2PA 2CXEA 1HNXJ 1X9WA 3CCWA 1M5PC 5JMNA 4ZPBA 2GQQA 2HHVA 2UZAA 4ECSA 4G1QB 5DQGA 3A3OB 4PUOA 3MI7X 3NNHA 3M05A 4X62J 3H90A 4H54A 3ZZYA 2FJXA 1KR4A 2CZ9A 2A2DA 3OTBA 2NXNA 2XLJA 2NXJA 1UFKA 3AJ2A 1REVB 1WF0A 2ZD1A 4ECWA 4NYPA 1RWNB 3EPGA 3TI0A 4R0EA 3CCRS 2HHTA 2CG8A 4NL5A 1U0HB 3GIJA 3MAAA 3M8QA 4O4GA 2ROPA 2HPUA 2A2CA 3W2WB 1Q5YA 3LGNA 1Z2LA 1QAYA 3MCOA 3EZ5A 4WFBQ 1WTFA 3DKDA 2YBVA 4WXOA 2R8GA 1P1TA 5KFLA 5K8MA 4H4OB 3MEDB 2VD3A 5EN1A 1RWMB 3MUVP 2RKIB 4RNHA 4BWJA 1HFEL 4UZBA 3OL8A 4F3OA 1BY9A 5CYMA 4KFBB 2Z2LA 4KYZA 2QEXS 1G2EA 4CO3A 4L3KA 1HBNA 4LF2A 2FB0A 3KJQB 4C2MA 5LXYA 1PG5B 4NRUA 2OFGX 4CZCA 4OX9J 2AMCB 4K4XA 4ICLA 1WSVA 2BE9B 1RAHB 2EBEA 1RAFB 4IO1A 4K0KF 1FFWB 5HROA 4USWA 3WIUA 3RUBL 1NNDA 1PILA 4DG1A 3K5LA 1VJWA 2HNZB 2E29A 3N4WA 1FTRA 4YR3A 2OPQB 1FA0A 3TR5A 1YTYA 3OJSA 3D3CJ 2VA2A 1RE1B 4ZITA 3FCHA 1MW7A 4JV5J 4IR1A 1U1QA 1JKHA 1ZH5A 2P9CA 2P6TA 3PFOA 1N36F 2LU1A 3TA2A 1U1LA 3VVUA 1NSQA 4KR0B 2HNDB 2B0GA 8AT1B 4ZHRB 2QLJB 2AJ2A 1NLKL 1KN6A 3A8JA 2BMBA 1OS5A 2RMLA 4ECYA 2AX1A 1S1TA 5G0RB 2C3YA 5F8MA 3E01A 3IAM9 1Y7PA 3RG6A 3HFZB 3R5AA 4ZP8A 1WKLA 5KFAA 4EYIB 1CJUB 4DV5J 2UXBF 3M2UB 3HFKA 4KSEB 3DRRA 3I5CA 1T02A 3GMGA 1S6OA 4QWDA 2HRUA 3W60A 2GCFA 4QR2A 4ETXA 1WG4A 2GIRA 5LMNJ 2J0SD 1EARA 4Q0BB 2WONB 1ZM9A 2YPZA 1LK5A 3OVBA 2ZOGA 1S49A 1TFYA 4CT9A 4NZ6A 3CWJA 2V94A 1N33F 3KWMA 2M8HA 3QLHA 3NRBA 2AHOB 4PPDA 1TV6A 4GKKJ 2BKOA 4JI4F 4G1PA 1HBOB 1OO0B 2HFSA 2V63A 2E5GA 4RNNA 2PD1A 3BR9A 2J6TA 4EBEA 2GVZB 1T9VA 4EO6A 2DCLA 1S1WB 1TUVA 3Q23A 4DCPB 2IM3A 4LBPA 1BHNA 4GO7X 2YNHA 2DNRA 4M8LA 1QVGR 3G8QA 3D68A 1R89A 2LMIA 1T3OA 1WC1A 5K5MA 2A1BA 2BBEA 4PABA 2DR7A 2ZC3A 1X0FA 2PI5A 4DSIA 3TQEA 1D9DA 5IQ6A 3RRKA 2XULA 2IIHA 3I4HX 2MTLA 4CYUA 3JXOA 3NS5A 2AQ4A 3QAEA 3M9NB 3MMBA 3ISNC 2RS8A 2XWYA 1XWLA 2CJ9A 2IRXA 1X5SA 2P9EA 1K0TA 3ET6B 2R2SA 1SV5A 1FD8A 3BDEA 4YR2A 1R8AA 3BBFA 4UY8T 4F50A 1U8SA 3KLFA 2M7SA 2YWKA 5GMKa 3RBZA 2L41A 3TJ9A 3IS9B 4KO0B 3G2XA 1C4CA 5GMEA 3D67A 1NK9A 1QAJA 3HCXA 4V19X 4X62F 3HHLB 1YDLA 1Y5IB 4KGXB 3SFGA 3DYAA 3P6YC 2Z57B 2HAIA 4WP8A 1D9AA 1JNZB 2FIUA 5HJXA 4PWWA 5E3AA 2CNLB 2PMZD 3PX6A 1JXLA 1TL5A 1LWXA 1TL7A 2QFJA 2GNKA 4QU7A 2GA7A 2BE2A 2ZBRA 1LXJA 3NWRA 3H4DA 1X60A 3CDUA 5HQMA 2B8PA 2MZRA 2D3ZA 1GMVA 3MECA 4OHYA 4DFKA 2FJBB 3ZZPA 3DC2A 5GADI 2LYVA 4RWXA 2GQCA 1J5OA 4A8XA 2DRDA 2CPXA 3CPWR 1P9YA 2X3GA 1C1CB 1G4CA 3EE3A 4RUHA 5LT5A 5GAHU 4UW2A 3T19A 3CEDA 1HR0J 2ZH3A 1BGXT 1OMSA 5I3UB 4DBQA 3UD5A 4C8MA 2RRNA 4U6PA 4IDKA 4OX9F 2WVEA 1RADB 3RAMA 2E1PA 4I6WA 2XMAA 3VVTA 1IKYA 4NLDA 4I2QA 5DDOC 2JLEA 5IT9U 4FS1A 3G6VA 4KGZB 2IYIA 4DS4A 2H48B 1WG1A 1ELOA 1NK7A 2LQ5A 1S9EB 1U0SA 4W4MA 5ETVA 3IRWP 4C8LA 1ROFA 2R8JA 2IBOA 5IT9Y 2Q79A 2LA4A 1DTTB 1EQMA 1YG0A 4WFZA 3E2EA 3RR7A 2E9RX 3LOUA 1SQEA 3QRPA 1S57A 2VFSA 3DGVA 4B17A 4J9VA 3OR1B 4DR5J 2BM1A 3RZAA 4I7FA 3G71S 4ILLA 3GCXP 1NK0A 4P2MA 1RP5A 4LRAA 2DNYA 1PGZA 3Q8YA 3PHTA 3MXHP 4QZVB 3MEKA 3UWTA 3PV8A 1KLNA 2I9SA 3OQ2A 4C0HA 4OHZA 1LWCB 4DV6F 3PJ9A 3ZC4A 4DV5F 1LWFB 1Y0HA 2VQFJ 2C3OA 2BUNA 3IBWA 2HRYA 3PYGA 2QG9B 1V3RA 2WAQD 1YSJA 5LMNF 2XM3A 1JNRB 4Q44A 1VISA 4DR4J 2CWXA 1D8ZA 1UPPA 3VHQA 1AUSL 2MGZB 4ZVFA 2MYFA 2C2ZB 4NE9C 2AEJA 4M5LA 4I68A 3K5PA 3BYPA 3K57A 5E3CA 1YJ9S 4GKKF 3I0SA 2CFXA 3SEOA 4KC5A 4X2BA 1XN9A 1UA1A 2N3LA 2DYAA 3T6JA 4Y28C 5HO4A 5HQ8A 3CC7S 4J9OA 2LECA 2VKRA 2EFVA 4XIUA 1FKPB 3I6PA 3MTJA 4JYAJ 1VBKA 2UU9J 4DI6A 1EP4A 4DX7A 5FIIA 2DPIA 2W2NP 2WSEC 3QFWA 2FVQA 2MLZA 1M5SA 2MB0B 1U2FA 3D0IE 4J9SA 1R0BG 4X4TA 5LMUJ 1V3ZA 2R7OA 3W2VB 1H3DA 4N7TA 2C2OB 1TMMA 2XMTA 2Q43A 4J37A 3LALA 2J9DE 4C11B 4B9NA 2UV8A 4FPIA 4ZJLA 3OL9A 1L3UA 5HSPA 2C2MB 2DTJA 3TEHB 5ETOA 4HYKA 4A8OA 4KE5A 1YWXA 2YKAA 4OYIA 2C2EA 4KPYA 1WHVA 1RTDB 1WTBA 4RW6B 1O51A 3D7SB 3TZZA 1HWKA 2J0XA 3C2PA 1VLYA 1BQMA 3EVMA 4XDCA 3TO8A 5M2PA 3SIPB 4C8ZA 1OSCA 3PCOB 1T03A 3BBBA 2GHWA 2YNIB 2KVQE 3GFXA 2VDIA 2JL9A 3ENVA 3MHYA 2VBWA 4RU2A 2X1AA 5KG2A 3EGNA 1R8PA 1HA1A 5I3PA 1OWXA 2DB1A 3FK4A 3DLKB 3OTDA 4UQGA 2ZJRQ 1KFSA 1JLFA 3L7PA 2HFVA 4JV1A 2SXLA 1PAUB 5A8WB 3Q22A 2GX8A 4YB7A 1IKXB 2PI4A 4FBTA 4OMFG 5J2QB 3N0VA 2NZ4A 4I6YA 3HJFA 1RKIA 2HZVA 5KG7A 1X5TA 1HBMA 1NBEB 3G6XA 2W9BB 3EGZA 4PCQA 2DR8A 2BRKA 3C6UA 4LFCJ 2JJ4D 4LBHA 2YWGA 4AQYJ 1SIWB 3V6DB 2D7SA 3K17A 4F26A 2U1AA 4QYZJ 1HR0F 4CT8A 1XMQJ 3OPKA 5C42B 1VQMS 4DL3A 1RABB 4Y34A 4PG5A 3C14B 4DL6A 3PFEA 1RT7A 3POTA 3JSBA 1V9OA 2ZKUA 5LJ3Y 3RB6A 5HATA 3MMAA 5ETLA 1KFDA 3I0RA 4IUFA 3J81U 5KFJA 3UN2A 2D9OA 5CA5A 2A10A 3KMSA 3FMWA 1T0TV 3TJAA 4LBIA 2F8HA 3W64A 3MUTP 3MM9B 4B3OB 1F5AA 3MTKA 3CO0P 4J9RA 3LAMA 1BQXA 5LOQA 1XEZA 2JC1A 3NOGA 2ZBPA 5FJ4A 2HHXA 3WC0A 1UEUA 4HI2A 2LFVA 4XAKA 5H9EJ 3QIPA 1KD1T 1BC6A 1IQZA 1C4AA 4CLUA 1IBKF 2LDYA 1UAWA 1FK9B 4WP3A 2QV6A 5A2QU 3D9BA 2GMJA 1REGX 2UP1A 4F3MA 3ITHB 1HHQA 4Y0FA 1JJCB 2HLUA 2ASLA 3OUYA 2XY6A 1VRUA 4DR5F 4DL2A 2J5AA 4I67A 1AFJA 3H0PA 5A2QY 1S72S 4LVNP 4AT1B 3JSRA 2ZEJA 4IG0A 2WOMA 1S1VA 3WDOA 1FJ7A 1X4GA 2VQFF 1IJEB 3NXZA 3M6VA 1IBLJ 4IRDA 2Z2ZA 1KONA 4NI2A 1VI7A 1Q16B 2L3MA 4J9MA 3ADAC 2MHNA 3M2VA 1IKVA 3FSXA 4FPRA 5A0YA 1N5VA 2FZGB 2GGPB 2AZ1A 2GVDB 5CAAA 1X9SA 3FEYB 1FD2A 1QUVA 4CCHA 2J8AA 2ZH9A 2VHGA 3QJPA 4Q2MA 1SB6A 5IM0B 3MMJA 1ZM3A 3NS7B 2M3DA 4NLUA 3FEXB 2K7JA 4PG8A 1VIOA 3O6QA 4FBUA 2QE5A 2OIHA 3HT3A 3PRBA 1A0OB 2B5JA 1IUJA 1IN0A 2E66A 2O3DA 3PHEA 2V2VA 2WCXA 3UR0A 2BE7D 1SKSA 4LF9J 1S0OA 4GRSA 2EVZA 3E51A 5D0HA 4JYAF 4HLBA 1RWXB 2UU9F 5L1IA 1RSCA 4ID5B 3HVAA 2NPFA 4MKVA 1IXKA 4DSFA 1S97A 3SXLA 3Q8UA 1Y11A 4DF8A 4B3RJ 3DDNA 2JLFA 5MLCV 3AJDA 5LMUF 1DBDA 3MR7A 2K1RA 3I9V9 3CB4A 2A6OA 3EVOA 2OPPB 2YNFA 2C3UA 2HHQA 1XMBA 3GR0A 1EZZB 2DGXA 1UVKA 3HF5A 1OPIA 4I2PA 1NXIA 3ENWA 5KFNA 3HULA 5C5JA 2J7WA 2LU2A 4YOEA 1IVZA 3AA8A 1RKJA 1FT8A 2HBRB 4KV8A 3A13A 4RW4B 4QU6A 4CTAA 1R0AA 1S0MA 5K9FA 4WJBA 3R6LB 4PUOB 4LSLA 2FPHX 4MFBB 2I5JA 3BGUA 2NYHA 3FGVA 1HBUB 4R0JA 4ZDNA 5AE1A 3JYTB 1FWPA 2KI2A 4ED1A 3MUMP 1E6VB 2I38A 2XYPB 1UZDA 1GK8A 3GR1A 4WTOB 1VYAA 4F4AA 4ZIWA 3B6BA 3EYZA 4PWUA 5EUHA 1J5EJ 3CMAS 1M1HA 2YWFA 4TVAB 4O4GB 1J2VA 2HK2A 4DZ6A 2EFNA 4P9SA 4OZ2A 1R31A 5ITHA 1LWEB 1S12A 3KG1A 4UOGA 3PW2A 1Q53A 1QE1A 4DUYJ 4X84A 5DDPC 5K14B 3AD8C 3A12A 3FJ2A 3SQOP 4QOTA 4KHRA 3PO5A 4PQUB 4ED8A 2UVRA 4R8UA 1JXEA 1TKTB 3PDNA 5KFEA 4AQYF 3KLEA 4WZQA 5CYMB 5H9FK 5E5NA 1GXTA 4OYBA 2R4FA 4P73A 2WVBA 2V4QA 3G82A 2MQMA 3LO3A 2DIUA 4WXWA 1FKOB 5BYRA 4GVBA 3JS9A 2BQUA 1WUUA 3VF0B 2BANA 4IG3B 4QCLA 3MEEB 5EGYA 3B82A 2WVCA 3OLBA 2ZWPA 3AOBA 2EKNA 2DNQA 2YQ1A 3VAHA 2RILA 4X65J 5ETMA 4IFYA 4KGMA 2LDIA 4Z37A 4CO5A 3FFIA 4UUWA 1UVNA 5HMZA 2CZVC 4DQIA 1HMVA 3DMJA 2GW8A 3BSOA 1IWGA 2BQ3A 5D78A 3T3FA 2LEBA 3C8YA 2HWIA 3KHLA 1KDNA 2BV3A 4IFVB 3QRQA 4HR2A 2KU7A 3HPOA 3DRSA 3RB4A 2ZZTA 3MM6B 3SCJE 4M95A 2W1BA 4PWDB 2R7QA 4DQRA 4IRCA 3GZ7A 4RU9A 2VFRA 2RDIA 1KKHA 2F8MA 3C15B 2W2MP 1N0UA 4U8VA 5E41A 1DLOB 3KJNB 3PKYA 3UD4P 2HQGA 4CH7A 1RT6A 3A1YG 2C3MA 1X9MA 3IWXA 3KHRA 3I55S 1QAIA 4MJKA 4D3HA 2J7UA 2XYGB 4RPFA 4PXBA 1TK5A 1JLAA 4NEZA 1IBLF 3T5JA 2WVDA 1XNQJ 1SUQA 4QIGA 4OLOA 4F8RA 4L3NA 1AYEA 2M0GB 2RQKA 3TP2A 2QL7B 4NLWA 5DO2A 1TKZA 5L8RC 2BRLA 3NGSA 1Q79A 2JX2A 2OD6A 1CJKB 2J76E 2HLTA 4WYWA 2DCUB 3M6WA 1L3TA 3DLBA 4HKQA 2YNGB 4H4MB 5J2MA 2ACYA 1QTMA 2C2RA 3TUJC 1FJCA 2MQQA 1F9FA 2OLWA 1EAYC 4O44B 3GIRA 4KBIA 5IV3A 1WWHA 3GJSB 3UVJA 1GX6A 1GQEA 2X1BA 4LF9F 1U2CA 5KT3A 5HVHA 3ZZOA 1RB0A 1S9GB 4YY3J 2IDEA 2XSFA 1JB0C 1XK8A 1IBCB 1N54B 2GO9A 2ZVIA 3NEKA 3OVSA 4JV0A 4ZIVA 4QWBA 1P6TA 2ROEA 1VJQA 3GJQB 3UI3A 4Z7CA 3I56S 3RYLA 2FHKA 1RGVA 3DRPB 2KHDA 1TL4A 2VODA 1B7YB 1V5VA 2Q1LA 1DTQA 3VAIA 1MLAA 2AD9A 3K58A 3GONA 4E2FB 3KJVB 1KTQA 4I64A 4DFJA 2WW4A 1NDLA 3BSCA 5D15A 4C8OA 3GWCA 4G3IA 1PJ6A 1WOOA 2CQDA 4KIAA 5E3RA 4RNFA 5J2NA 1ZA2B 4DF4A 3KLGB 2G1HA 2V2ZA 2IDLA 2FUG9 4CIOA 5HLFB 3J81j 4ED4A 4O3OA 1VRTA 1UVJA 5EX3A 4ED7A 3R2CJ 4ELUA 4RW9B 4F2RA 3GYGA 5HI7A 2FVPA 2ASDA 4EMDA 3A8KA 4FP9A 1YJNS 2JOQA 3ILIA 4PYDA 4NEYA 4XK8C 2RD5C 4JI0J 4ZVSB 4M5GA 3AHPA 5E2QA 2MPUA 4NZ7A 4USMA 5F8LA 1FWKA 2YX1A 3CIMA 2F4VJ 2PFDA 3H98A 1S10A 5FDLB 2UUAJ 4JUZA 4DR1J 4R25A 5D4OA 2OPRA 3KKFA 4ATNA 4ZN1A 3J7ZT 4LR9A 1GMUA 2RUSA 3DLGB 3X3UA 2IC3A 1MU2A 2UUBJ 2D41A 2HHUA 5HJYA 5KFUA 4M5IA 2ZJPQ 1I5OB 1JJ2R 4Q8EA 1KLMB 3T9ZA 3PIPQ 2CQ0A 4WTYA 4EGLA 1WHWA 2HBZB 3TVYA 2PC6A 1U8WA 4F0KA 4LUBA 3QZ7A 4GKJF 2G1DA 2GHVC 3ENQA 1X4DA 2A18A 3HHLC 4C7QA 4QW9A 1FDBA 3G9CA 5D8HB 4ETZA 4ECXA 1PO6A 3RJMB 2CJXB 1NSPA 2MEWA 2MKHA 3OVAA 3PVXA 1EQ0A 1FTCA 4X65F 3H25A 1S6PA 1F1BB 2NSCA 4FVMA 2L9DA 3TW0A 3M7VA 1UWBA 3C66A 4OV1A 5IT0A 4X66J 3OBIA 1UW9A 1S1XA 3M1VB 2OEMA 1TVRB 2LKZA 3W62A 3CJKB 1LKZA 3BJYA 1U45A 1HQEB 1KQFB 2EK1A 2HMIB 2ZZMA 1TKXA 2L9NA 1FNXH 4B3SJ 2K3KA 3GFYA 4DUZJ 2P8IA 2DO4A 2Z2YB 4NLOA 2CZ4A 4X4UA 4OZ3A 4IOBA 1FXLA 2ZVSA 3ETOA 3R5DA 1VBXA 3JSMB 3M8PB 3VALA 2Z8QA 1NB2A 3UDCA 4CLTA 1RTIA 1UWAA 5HP1B 4PZVA 4QIWD 3EUNA 4ZVGA 1VLOA 3VAFA 4KPCA 1PC5A 2GJ2A 2FLOA 3QYYA 2VQEJ 3FVYA 3TAQA 5DQIA 3QMQA 2LP4A 4NX9A 4DFMA 4HDGA 1YRXA 1OJ4A 4IO9Q 5KG0A 1TAUA 1B0TA 1BQNB 2B9EA 1NRKA 4PR6A 3SDEA 3DOLB 2B8QA 2ZUAA 4MK8A 5D3GA 3CJTA 4TKTA 4DMZA 1ZTWA 3BO4A 1H72C 1JLBA 2MDAA 3M32B 3MFIA 1CPZA 2AJFE 5IV4A 1WI8A 4ER8A 2FLPA 3CJSA 5D0GA 4A4JA 4NLGA 1SKRA 2HQCA 3OD2A 3PM9A 4OZ1A 2BABA 1WDTA 2MZ1A 1N5SA 2QIFA 4DV0J 3P96A 3CJ3A 4FN5A 2KXNB 4DXLA 4HT7A 3MEGB 2XY5A 4L72B 4DX8H 4K4UA 1SC3B 5A8RB 4ZCIA 1DQAA 3DGPA 1WC5A 3HSJA 3PXGa 1EP4B 2M70A 2WRMA 2EWHA 2WB4A 1CS4B 1D09B 2PFFB 2XCPA 3QJLA 3MAQA 4RJVA 2FJEB 1B4SA 2IMWP 2E44A 9RUBA 1Q5VA 4NASA 4TLQA 1D3WA 1SJ4P 2KDOA 4TYBA 1G7CB 5DGBA 2PDAA 2HFUA 3HHEA 2V0NA 3DRYA 3FRYA 3GE9A 1X4AA 2BQRA 1FHTA 3NCRA 1RHUB 1U02A 4ZP6A 2XLKA 3OL7A 2OELA 2V34A 5B0CA 1WDDA 7AT1B 2GMLA 3LP1B 4DFPA 2VC1A 3FBEA 4QBUA 2QYGA 2FD2A 1N34J 1SVDA 2IM0A 1C1BA 4LSNB 5KT4A 2DGTA 1C0UB 3OTEA 2XEXA 5DRKA 1VQ9S 1KOOA 1BQMB 1NHUA 3TVKA 4CQ1A 1RT5A 3BO3A 4JI0F 3MM8A 1CEZA 2QRRA 4IH7A 1YGYA 1T05B 4USUA 3IGNA 1I3OB 4ECVA 2UUAF 3DOMA 1HQ2A 1MMNA 4LSZB 4DR1F 2BR0A 2H5IB 4DV4J 2KG1A 3CC2S 2PGCA 1JIHA 2W25A 4QYRA 2UUBF 4TY8B 4RZRA 1Z2ZA 1H6KX 5HVGA 4NXMJ 2CPDA 2CPZA 3MPUB 2W4DA 3MM5B 2JDJA 2CQ4A 4BC9A 4P2XA 1U4BA 2PO4A 2AU0A 3AODA 1YJTA 1EETA 1KC8T 1A9NB 1FRLA 4B9UA 4CLLA 4RW8B 4RR5A 1UMJA 4OLPA 2Y3YA 2IJFA 3I5AA 4WFYA 3R5CA 4DCJB 4YR0A 3K5MA 1GX5A 3CO9A 3O44A 5HMYA 3K5OA 1FO1A 2QX0A 2E1RA 4X66F 2XMVA 1WC0A 3AOCA 3UDVA 1QDUB 3UFCX 4ELTA 3FCVA 4NLQA 1SL2A 3KLIA 3W63A 4EUVA 2ZFHA 3KJFB 3HD2A 1AUDA 1TFWA 1NB7A 2XGQA 3GG0A 3C16A 1WD6A 1MMDA 4DUZF 3CXCR 5HBMB 4OJ1A 3OHBA 1VRUB 3OR2B 2CNOB 2FVCA 1ZAWA 4MAKA 4N47A 1NKCA 3RB0A 4H4KC 5L9XA 3EJMA 1NEEA 5CXTA 1WEXA 3R7BB 4I4BA 1M0SA 2VQEF 3MD3A 3K89A 3SI8A 4V19J 3MCMA 1X7VA 3BV8A 4LFBJ 1Y9OA 5EWEA 4EU0A 3TA0A 3D0GE 2J7KA 2EI5A 4ZPTR 2CA9A 1UCNA 4B08A 2HFOA 4MYTA 2XZTB 3FZ2A 5GMDA 2LLZA 4YS2A 3V81A 3MM7A 7FD1A 3D66A 4B9VA 3BSAA 3I32A 1ZM4A 4DV0F 2W4PA 2V9WA 2N3OA 2OMOA 4DR3J 3HJVA 1NK5A 1UW4A 1WKJA 1HNIA 3PO4A 2FJAB 3TNVA 1CJVB 3BR8A 2AEFA 4QPXA 1U24A 3TX8A 4YP3A 3I87A 4UF4A 2VPYB 1TAQA 5BXIA 1U1KA 1UJ5A 4U8YA 2FGCA 4V1Ak 1CULA 3K8WA 3TUIC 5DG8A 2XC9A 3M30B 5AJ3J 2GHPA 1HNVB 1AROP 2BJEA 4ZP7A 3UCGA 2OAUA 5KFCA 1K1SA 1X8DA 1HQUB 4X4RA 2EFPA 2KB2A 1MWYA 4IR9A 2DJWA 4TNOA 4M5KA 4L73A 1GTHA 4BS2A 2VPZB 3HFVA 2JEIA 2KH9A 1Q81T 3MURP 4NOHA 4OFZA 2VG6B 4NA2A 3KFWX 4KH0B 4DV2J 4U7UK 4KT0C 3THTA 1WACA 2XI2A 1MROB 4K4VA 3KK3A 3RRHA 4DQPA 1N34F 1Q8BA 2N7CA 2MHEA 4FNIA 4FYXB 4CTAB 3A8IA 4USIA 1JJ4A 4QIEA 2KYZA 1DJ0A 1A7GE 4R5PB 3EPIA 3PW7A 2CNKB 1ZZFA 4O3SA 1LW0B 1ZAVA 1FERA 4KH1B 2UUCJ 3KUHA 4RUBA 4YDDB 1RWPB 4ZLLA 3L95X 4LR8A 3B8HA 2DNLA 2J0QD 3PYFA 3NS6A 1LNQA 2CAJA 1FFGB 4DV4F 3S01A 4ZVTB 1RT2B 5CABA 3NCQA 1KVIA 5JVHQ 2NUHA 4YB5A 3DM2A 1TQLA 5C24B 4DPXA 2OP5A 1RWVB 4P74A 1R43A 2MLXA 4YN3B 3UDLA 2CJKA 2DHHA 2FJWA 4U96A 3CTRA 4DSJA 4RKUC 3UNYA 2OHDA 2RF2B 1SJ3P 4ECUA 3TUZC 2VDHA 1RDRA 5AXMA 2KN4A 5A8KA 3BS9A 1T95A 1M90T 4OZ0A 2RHSB 2DT9A 1GAOA 4EZ9A 1B99A 2FJDB 1T9XA 2MSTA 2IPOB 1SJQA 2UXCJ 2ZHOA 4WIQA 2YKNB 2ZH1A 2DO0A 4ZPWR 4ZJQA 3BKFA 3GJRB 2G2ZA 2V69A 3IR5B 3R6GB 3O1LA 1HMVB 4UUXA 4C8NA 4MYUA 4ZVPB 3MR5A 1U1MA 2E5IA 1GXUA 2X51A 4EK2A 2HAFA 2C2KB 1TUWA 2QMXA 1N36J 5KFZA 3ULHA 1SQGA 3CD5A 3CE8A 4C3KA 2KXHA 3B4DA 4DX5A 4NA3A 2LQ8A 5D0EA 3FSYA 5I42A 5LM7E 5T7LB 2DGVA 4DCOB 1SI9A 2CNNB 4MKAA 5J1EA 2L9WA 4KB7A 2H3EB 2FC9A 2FHJD 1X4CA 1QM9A 5H9EK 4ANDA 4LFBF 5LSRA 1SIZA 1Y00A 1RT1A 2GAGC 4HTIA 4RUAA 4P6QA 2MY7A 1VCTA 2N4CA 1HLWA 1ZETA 1FJEB 1Q95G 1KRPA 4B02A 3R8YA 7FDRA 1DURA 1FDNA 1FX2A 2VH7A 3DOKA 2OD4A 5KFQA 3P45B 1RT4B 1G3OA 4ZCKA 2JLGA 2NXUA 2B56A 4I56A 2GC8A 4DR3F 4N5SA 3MOZA 3DI6B 1SC1B 4NWBA 4WFXA 3IRXB 5D4LA 3D28A 4G1QA 2V67A 3CSKA 3HSGA 4Y2KA 1RHQB 1YJUA 1D8YA 3QT8A 1REVA 1WG5A 3IBFB 3LW5C 3LAKA 2E5HA 2HGNA 3KLHB 5AJ3F 1U0HA 4ILMA 2BW2A 3CDAA 5ETNA 3W2WA 2HRTA 3J7YU 2OI2A 2HS3A 4DSLA 2RH3A 5ETSA 5EWFA 4DV2F 4H4OA 3MEDA 1CG2A 3RW6A 2PA8D 1DAXA 5IT4A 3T1AA 3DHXA 4LF6J 1YRUA 2RKIA 3ZTSA 1F5CA 2AJ0A 4KFBA 3IC1A 4ZCMA 5BYQA 4U7UD 3C19A 3KMQA 5FLXU 3NGKA 1LW2B 2EC2A 3VGUA 3GSIA 2D1CA 2UUCF 3OHAA 1HHSA 2D3UA 1EKSA 4TN2A 3GU0A 2VICA 1UFWA 2VPWB 2NQPA 1DRZA 4FNHA 1M5KC 3MD1A 4WCEQ 2OH2A 2IVFB 3L7UA 1FEHA 5THWA 3QT6A 2PA3A 1FFSB 2HNZA 3RR8A 2DGOA 2OPQA 2KFZA 4UQTA 1NDKA 2F63A 2KVIA 3FQKA 4N76A 4DPWA 2GFFA 3Q89A 2BYCA 1RJJA 2Z0GA 3BREA 3SCKE 5F3ZA 2G2OA 4DWIA 1L3VA 1JLGB 4F2SA 3I5BA 4TQRA 2YX4A 1ZA1B 5IC4B 1KBRA 3BN7A 3OFHA 4IQMA 2DISA 2RE1A 1N6QA 3C6TB 3UN5A 5D6GA 2RIJA 2HNDA 4ZHRA 4DR7F 1HARA 2JEGA 3QO9B 2FHMA 4J9UE 1WOSA 4LT6A 5G0RA 5KFSA 4B9TA 1O5JA 1RI7A 1X4BA 2VG7B 4DDFA 2A3JA 3MPYA 2XWXA 4FF2A 1QVFR 1TL1B 1JK9B 2AJ4A 4HEA9 4WYLA 3M2UA 3OTOJ 2UXCF 1JLQB 4K4WA 5KFIA 3H8YA 2HKEA 2G2YA 2XS7A 2W7PA 3W5YA 1NHKL 3H42A 4CNYA 1R8BA 4DPUA 4Q0BA 2WONA 3SV4A 2ZJQQ 5DM7Q 3HVRA 5B7WA 3PG9A 4PKDB 3AXKA 3CCZA 1YQHA 1QJHA 1K8AT 5IC6B 3SQGB 4TYAA 3L3CA 1HBOA 3KHHA 4N8OA 1R27B 4C8YA 2VB6A 2YXLA 2H65B 2KTQA 2UUWA 2ZUGA 3NKYA 3CDEA 3W3SA 4FZVA 1FRKA 5ETRA 1PSDA 2GVZA 1S1WA 1EJ7L 1FVQA 1F9EB 1RUSA 3ZO7A 1FEEA 2LVWA 1KHVA 1W2IA 3Q24A 2W8KA 4DV6J 3M8YA 3H2VE 1HWJA 1U47A 2L48A 3GPAA 1QSYA 6AT1B 1XNRF 1MNEA 1NJIT 5F8HA 2DITA 3SMZA 5IXUA 4MH8A 1CJTB 2ILYA 2VG5B 4CLZA 3A4TA 3W7BA 4X4PA 2FY8A 1WHYA 4ZN3A 1F5BA 4NLPA 2BJ7A 5D0RA 1EX8A 4P52A 2K8GA 1Q86T 1UEKA 3LP0B 3BGRB 3NMAA 4ECQA 2GIQA 3ONQA 1I1GA 3ET6A 3CC4S 3CCTA 3QNWB 3LTOA 1UJ6A 2AW0A 4XTTA 2DY9A 3TRGA 4DR6J 4Y2AA 1A6LA 2ZOFA 5JUMA 3IS9A 4KO0A 3N79A 2CPYA 4O0IA 4HHUA 2HZCA 2DNOA 2EFGA 1D0EA 2PT0A 3HHLA 5KFWA 4RBVA 2HIQA 3AT1B 3EMTA 1S9FA 1E6YB 2AGPA 2Z30B 1AZSB 1OQ3A 3T6BA 2Z2MA 2UV8G 4XDDA 3M2RB 1VQKS 4ECZA 5ETTA 3T1YJ 2Y1LB 3R5GA 2ACMA 2HFNA 4OYXA 2NUUG 1MWZA 1WSRA 3CCJS 5B08A 1WF2A 4EYHB 1IQTA 1R6YA 1RTJB 1CC8A 3ZNJ1 3IWLA 2JZ5A 1RU2A 2YTCA 3R7SB 4Y00A 2HSEB 4LF6F 1H38A 1OY8A 3UCUP 1C1CA 2DXEA 1DQ9A 2DH9A 3V6KA 4W98A 1IBMJ 4WE1A 4JI7F 3HHKA 2ZITA 3BYRA 4ES3A 1H7WA 4UY85 5BYSA 3RTVA 2KRRA 5I3UA 5KG5A 5DM6Q 4O23A 1S6QB 2VA3A 3HVWA 1RT3B 2ZDOA 2PSZA 3P8BB 4OZJA 2D3O1 1VC6A 3FBFA 1FVSA 1V6HA 4OX6A 2AJQA 4C98A 5KFFA 2GO8A 3HM9A 3BH6B 3Q83A 5F0UA 2BDPA 4N41A 2CKWA 1L3SA 5CYJA 1QSSA 1UKUA 3RAXA 4D3GA 3CCVS 4GVLA 2ZH4A 1S9EA 4OYOA 5HANA 1S48A 2XYHB 2AGOA 2WVFA 2VOPA 1APSA 2PE8A 4FYYB 2CJAA 1C0TB 2KZZA 1DTTA 2R8HA 5H1SV 1WNEA 1S77D 3U1MA 4MKBA 1WC6A 5K8PA 3OR1A 1NAQA 1EETB 2LQ9A 2OEKA 1URRA 4KHMA 1GH8A 3HSDA 1NH8A 2YKOA 1HYSB 2DR6A 4DL7A 2HS4A 1CC7A 2B7CB 1X5PA 2ALZA 1FRIA 1S59A 1NSKL 4LREA 4DL5A 3M9OB 4BBYA 3IA0A 1LWCA 2B9XA 4Z7YA 1KQKA 4PG7A 4DQQA 1LWFA 5HQLA 3OTOF 1HI0P 1SH0A 4DU8A 4F4KA 4NYOA 4C4WA 5ETPA 1UPMB 3R3TA 1NZ8A 4KKOB 5F3TA 2CYYA 4ZPAA 4A47A 4JI2J 2DHSA 4CLYA 3SSRA 1XERA 1K44A 4J9KA 4HL9A 2MQOA 4WK1A 4WK3A 3KDNA 1VQYA 3EWGA 1VRQC 5C25B 3SFUA 2Q66A 1UVIA 1IBKJ 2ERRA 2P9GA 3TZXA 1HW9A 2YWEA 1JJHA 4YQWA 2H4WB 3TVZA 1FJGJ 3GIIA 3Q2SC 2EFQA 3S1TA 4P2SA 2XZWA 2QL9B 3M4XA 3EX7B 4ZVUB 2CG4A 3S7RA 3H2UB 4EBDA 4OJ3A 4MK9A 4DV3J 3EGWB 1SC4B 1ZPWX 4HACB 5F8IA 5DGAA 4CO0A 3KYLA 2YWWA 1QTNB 2KRBA 2R7SA 4P75A 3U02A 4M1KA 2W01A 1HPZB 4W92B 1FKPA 2MQ8A 3TAMB 3NAIA 2VJUA 2JH3A 2WBRA 4ES2A 4NZ0A 1K0VA 5I4MA 1RK8A 3K2YA 2PMHA 2DGUA 3N5BA 1KVKA 1DFDA 1XMOJ 3W2VA 1JLEB 5C2CA 2NYIA 2EG2A 2AYEA 2XS2A 4ZLJA 4F4WA 3MZIA 4ECTA 4EBCA 1URNA 5LL6d 3F44A 3H2LA 2R7XA 2Y9HA 3S8SA 2CQBA 2AGQA 5I3QA 2V4JB 5DZ7A 2XO7A 1VMBA 1RTDA 4RW6A 2D3OR 2CQ3A 2E7WA 2HNYB 4DR6F 1YITS 4XO0A 3R1HA 2WHOA 2QSWA 4U95A 4ZCLA 1OPZA 3V4IA 1NSAA 1MWQA 2E1AA 1TR0A 3EZUA 3AQOA 2FHJA 2RT3A 2YNIA 3PNIA 4TU8A 2ALYB 3L9ZA 3ZZ0A 1FRHA 2W4CA 1U2RA 1YJ7A 1K47A 3DLKA 4USVA 1Z4UA 4DQSA 3VR1A 3T1YF 2FGOA 3FUYA 2V8GA 3G4SS 4M5DB 3OXFA 5A8WA 3Q8QB 2DKOB 1IKXA 1EHWA 1KQGB 5J2QA 4LMZA 4ERDA 2DBBA 3VGTA 3RBXA 1OQ6A 4LRCA 4C9DA 3UDEA 4NCGB 2W9BA 3IR6B 4ZVOB 2IFXA 3QBCA 4K2JA 3SYZA 1S79A 4HDHA 5CYQB 3DLEB 3V6DA 1IBMF 3KNAA 2DNPA 4LIRA 2C42A 2IM2A 4UZCA 3MGJA 3IWNC 3IGVA 4OJHA 3I31A 1VDHA 4H4KA 5C42A 3C3LA 4O3NA 3TANA 3C14A 3CGIA 3H59A 4PXDA 2M5YA 3ZZTA 3QJJA 1QY7A 3HVTB 2HBYB 4QR1A 3MM9A 4B3OA 4P7VA 3TYTA 2BKNA 2FJVA 1S76D 2EKYA 4QWEA 2JEFA 1VC0A 3ICLA 1N56A 9ATCB 4OI2A 4AL6A 2IA6A 1M5OC 1RTHB 3M8SA 4KRWA 2NPIA 1FK9A 2ZBCA 3Q0AA 2GJIA 3V6HA 4KTQA 3ISND 2OSQA 1V3SA 2FZKB 3NOCA 4QIVA 2B4PA 1FNOA 1B64A 4L75A 3OFFA 1F60B 5JVGQ 4K4TA 5E3PA 1PBAA 2HYIB 5A8KB 2NXEA 3IFEA 1RXOB 3H4BA 4F67A 4RLEA 3PRDA 3ETMA 2ZNYA 4O0NA 5M2RA 2W9CB 1RU1A 2CJQA 4ZKAA 3MWBA 3HP6A 2G9OA 2RRAA 3NMRA 2IAJB 1F3FA 4CLSA 2QTWA 4AXIA 4K5SA 4JI2F 4AE5A 3W9HA 2XMJA 2B6AB 3FSIA 5KFDA 4NLSA 1N5YB 2GGPA 1N4LA 1NKEA 2GVDA 3RW7A 3J81Y 3LGMA 3IBCB 1T9YA 2YH0A 1FJGF 2MLYA 2EFOA 1YHQS 3N5FA 3H7HB 2CPFA 2QMUB 5IM0A 1NH7A 2HQ3A 3MCSA 3KK1B 4JI3J 4LQ3A 4Z2XA 4DV3F 1VGYA 5KFTA 3JAMU 4P72A 1RAIB 3BGFA 1TL3B 4LF7J 2JFDA 3AY0A 5GAEU 2XZDB 4RBTA 3J80U 3ENAA 2CPJA 2IA0A 4CRJA 3M6XA 3ZNUA 5F41A 4GC7A 2H54B 5E33A 3JAMY 4FF1A 4ID5A 1S99A 3VCDA 1N52B 4AD6A 1JWWA 3CCQS 2FYXA 4NCAA 3OTCA 1Q7LB 3ISZA 2QA4S 2EEYA 3OXLA 1XMOF 1RLDA 3CUNA 2VJVA 1F6TA 1Y5LB 3C46A 2RNEA 3SBMA 4PQAA 2OPPA 4FXDA 3ELHA 2WSFC 2ZM6J 4LF4J 4I0WA 4OYPA 5C2GA 1IKWB 5T41A 2E9ZA 3JQJA 2RU9A 3KK2B 4DL0C 1P1LA 2VV5A 4LF1A 5KG4A 1SH2A 3GV7B 2H51B 2DGSA 2V8PA 2CWKA 3CJQA 1Z1ZA 1X4EA 5IOLA 2VASA 3MMCB 4C97A 4YUDA 1F9HA 2YKMB 4RW4A 5D4NA 4IH6A 2R7VA 2R7UA 1YZ7A 4QPTA 3BBCA 5DZ6A 1NDPA 4URSA 4MFBA 2GZOA 2KO1A 1GT8A 2ZH7A 3ILJA 2KM8C 1HBUA 1KHWA 1GNKA 3FCWA 3JYTA 3ZZZA 4ZLNA 3Q8RB 1E6VA 4OHXA 4PXEA 2ATLA 5KG1A 5ADZA 3M6UA 3NLCA 3H5YA 4FS2A 4ZA1A 2HGMA 3BDPA 2UUTA 1S1UB 3OSPA 2C3PA 3OW2R 1LWEA 2OPSB 2QFIA 2VPXB 1QAXA 3QSIA 1YIJS 2FZCB 5K14A 4J9NA 3W65A 3D6HB 1FCAA 4DPYA 4PQUA 2B9WA 2ZE2B 4WF9Q 3CCES 2Y0BB 3LP2B 3IG1B 2DNNA 2LXFA 4M5HA 1TKTA 2XMUA 2XB2D 3BB5A 5J2PB 1W25A 4CWBA 4ZPCA 2RQCA 1VBYA 4E0DA 1FKOA 1RHJB 3D3BJ 2R42A 4OYMA 3WC2A 2O01C 3VAGA 1WEZA 4IG3A 2F8EX 2FQQB 3FRZA 3MEEA 5KFBA 1PBUA 4K4YA 3BH7B 2DY1A 3THVA 2Y8YA 3CCUS 3HX9A 4I1TA 3IO1A 2ZD1B 1Q8IA 4A48A 4RUCA 3K59A 4NLRA 1TKDA 3M8QB 3MAAB 1MMLA 1VC5A 2C2NA 1MN7A 3JTPA 5KFPA 4DR2F 2NLWA 5BR8F 4ED3A 3EZOA 4Y2MA 3FC9A 1OSDA 3QWUA 2ZH5A 2IVYA 1FNMA 2KXFA 4HT5A 1JLCA 4N8NA 2XMMA 2MKSA 4URQU 5B0AA 1R3NA 4W90B 4IFVA 2VFUA 3PY8A 5JJBA 2V6AA 1N6QB 3MM6A 4PWDA 5LSLA 3AOAA 4ZVRB 3CJ2A 1NK4A 3U7JA 3B78A 3C15A 4EI2A 4GKJJ 1SH3A 1Y5NB 1DLOA 1YX2A 3QAUA 4G6VB 1HBNB 3OJUA 2KHCA 1VQ4S 2QLWA 1RA6A 3IAS9 4KGKA 2EPIA 1NCLA 2KFYA 5E7OB 1TMJA 1HL6A 1U26A 1YKWA 4LIWA 1LK7A 4ICLB 1B70B 2JFKA 4OX7A 5HK4A 1KVJA 2DNZA 3RB3A 3FBCA 3G6YA 2AIRB 2YQ0A 5HROB 4J7CA 4K59A 3GYXB 1BWEA 1ACMB 4DG1B 4M5MA 3AH6A 1H2TZ 4RW7A 2K7KA 2J9DA 2V4RA 2DHAA 1RISA 1IM4A 1R7IA 4O4RA 1CJKA 2I6WA 1HI1A 1JKHB 3BPDA 4C6AA 2BXJA 3QT7A 2QGFB 3KDOA 1GXLA 1X0PA 2YNGA 4CO4A 3P4UB 1RCOB 4H4MA 5C7PA 2M4MA 4EO8A 2M52A 4U67Q 3I96A 4JI3F 1AB8A 2F4FA 4DN0A 2POKA 3W5ZA 4O44A 2IBKA 4WU2A 5A76A 2QT7A 3IM8A 2DD8S 4LF7F 5KT2A 3GQCA 1J27A 2HVIA 2MKYA 4J90A 1S1TB 4OZ5A 1RHKB 1TUGB 1AA1B 3E01B 5KFVA 2IJNA 1FKAF 1S9GA 5U47A 2BOAA 3KTQA 1M5HA 3UE2A 4EZ6A 5GAGI 4RNOA 3DRRB 4X4OA 4ED5A 2A0FB 2FLNA 4Q7AA 5KOXA 2J9CA 2DGWA 4ZVEA 4CH0S 4DOZA 1I51B 3Q8PB 3TUPA 3DRPA 3D0HE 2V2KA 1RQ0A 5F0WA 1FDAA 5B0BA 3G87A 1T9WA 4TXSA 4CLWA 4EWTA 2MY8A 4TQSA 4MK7A 4CLPA 2ZM6F 4LF4F 3ZTRA 3KJVA 3LUYA 3PEJA 1DQ8A 5RUBA 1IR1A 3QLHB 3RBDA 1JX4A 2OKQA 2CPIA 4PPZA 1TV6B 4DEZA 4F4XA 4IOCQ 3R1LA 4HH0A 1FRJA 1NPKA 4OQJA 2DRBA 3KLGA 2K2PA 2X1FA 3DLLQ 5CZXA 2DEJA 1Y4ZB 5HLFA 1XR6A 1HNWJ 4HH1A 3UCZP 1YJWS 3PR4A 5A6PA 3EICA 1HNXF 2BM0A 4HI1A 1M1KT 4RW9A 1VHFA 1LEOA 4PG6A 3FEZA 2YNHB 3QWPA 2KG0A 2R9LA 3PX0A 4FKYA 2VFVA 1SCJB 1U7LA 4WU3A 4LF5J 5D4PA 1RTZA 1MN9A 1N0VC 3QGHA 2VONA 5FDLA 2Z56B 5LXRA 3NGDA 2W2PP 2ASJA 4ES1A 1KWMA 1PYTA 3DLGA 3JB9k 3AD9C 4CYUB 3AB4B 4USTA 4OHWA 1P9QC 3MMBB 4MKYA 2ZC4A 2XNQA 1KLMA 2DK2A 2VIHA 4GMKA 3DNCA 1RZMA 1SV5B 2H5JB 3E3XA 2J0WA 3KLFB 4FDFA 4WE1B 3ZTQA 2VBYA 2HK3A 3Q86A 2QYCA 2MKIA 4Q2LA 2AEMA 1DY3A 3TWZA 2DNKA 3DYAB 2W7OA 2CQPA 4G1IA 1B3TA 2COLA 3D1OA 2ZWOA 1SQFA 1H74A 4NLXA 1AT1B 2RS2A 2DIVA 2ZH8A 5B0DA 1TL7B 1ULRA 3A8EA 1NJYA 2BE2B 2AT1B 3T1HJ 2KFNA 2BJ8A 3LGHA 3M1VA 5DDQC 1TVRA 2UVVA 2DH8A 3L09A 1WF1A 3NP5A 3CJKA 2ROGA 3J7Z5 2P6SA 4JV5F 3VAKA 1HQEA 2F9JA 5IFMA 5IS2A 3MECB 2FHOB 1EB0A 2ILZA 2HHHJ 2HMIA 2DNMA 4C3LA 1AW0A 3WQPA 1J5OB 3CT9A 3CDWA 1NDCA 2ZH2A 3K0JA 5DQHA 4GO5X 2G0CA 4Y65A 3I9ZA 3JSMA 1Q4RA 3M8PA 1I6JA 2V8HA 5L39A 1ITPA 4K5RA 5HP1A 4IDKB 1R8CA 4F36A 5DG7A 1YZ6A 1IKYB 2AYGA 1VQOS 2F3JA 3UNGC 2DGQA 2C22A 4I2QB 3ZFVA 3CF5Q 1GMWD 3E8OA 2ZHAA 3DN9A 1B7FA 2VU5A 3R97A 3MPWA 4F3QA 1ZOTA 1BQNA 3TA1A 2MQNA 2OMLA 2O66A 1NZAA 3DOLA 2AX0A 2XQCA 4AYBD 1ZM2A 2AYBA 1KSPA 2WBMA 1JXVA 3MPVA 2K06A 1JMTA 5DLGA 2EG1A 3M32A 4CP5A 4A8WA 2MJNA 3W66A 2Y1RI 2U2FA 2KT5A 2IJRA 4I7FB 1TP7A 2OEJA 2RJZA 5F8NA 3MEGA 1D1UA 1OIAA 2GS8A 3ZZUA 3PYDA 2CQ2A 3DLJA 2AV5A 5B09A 5A8RA 2LEPA 1FX4A 5DLFA 1Y3KA 5HMWA 4DX6A 3BO2A 4DLEA 1TK0A 3VQSA 1U49A 4OZLA 4DU7A 2IHR1 4DPOA 3T5HA 1CS4A 1DZ5A 1L3KA 1T94A 3LWMA 1BUXA 4X4QA 1VQ6S 1RWWB 1O0PA 1GEHA 3GYNA 1H7XA 2CVIA 2JWNA 4K4SA 1RYSA 2CPEA 3JQMA 2OTJS 3F41A 1UVMA 2XSJA 5BJRA 3H40A 3I0SB 4BCAA 3FMBA 3LP1A 4PRFA 1RWOB 3L4BC 3F73A 3HLUA 5L38A 5J1NA 3LA0A 1HNWF 1N48A 3CJRA 4L76A 4LSNA 4Y2CA 2ZH6A 3BGLA 1C0UA 2XMWA 4WIIA 4Y3CA 3DU5A 2V50A 1FWLA 3LPEA 2BA9A 3V4IB 2DR5A 1KP6A 3KUGA 5KTQA 4LF5F 1U6ZA 1T05A 5KOWA 3OL6A 3KLVA 1PYOB 2WB1D 2QLBB 4TU9A 4B9SA 3S6EA 2MKKA 3GIMA 1H98A 3W5XA 1PC4A 4FXWA 2B9YA 1U1PA 4OHVA 4P2FA 4TY8A 4RX6A 5HMXA 3FBBA 4U7CA 2XLIA 4WFNQ 1WC3A 1YJRA 3PW5A 4ZLPA 3P5TL 3GCWP 3MR3A 4ZS6A 3SSQA 2I2YA 4OYAA 2FY1A 3MM5A 2BJDA 2BEFA 3NBPA 4B3MJ 1UP1A 3MOJB 3EDQB 3HD1A 3JTNA 2E1CA 3MCNA 4ED0A 1Q1KA 2QN6B 2XMKA 2MZSA 1SXLA 4RW8A 1SL1A 4ELVA 4CM0A 2BJ9A 5A6WA 1G6BA 3BQ0A 3SCIE 1T03B 4NCBA 3EVWA 3F56A 2VZ9A 3DXSX 4A8FA 5HL7Q 2MZQA 1VHIA 2B4VA 4HVZA 1LOUA 3F0NA 3K5NA 1WC4A 3CNQP 2QL5B 1JLFB 1RWKB 2GQ2A 1NKBA 3T1HF 3J7YI 2ZNZA 3UN3A 3R2DJ 2XG8A 2XY7A 4CDIA 1N8RT 2IRUA 1MG7A 3VGSA 3HT0A 2AYMA 1K73T 2HHHF 2C1EB 5JXSA 1HBMB 3ILLA 3MPDA 4G65A 4DV1J 5HBMA 3PR5B 2BVZA 3C6UB 1IJFB 4P71A 1VQNS 2I1RA 3OR2A 4CO2A 1S4FA 1YLXA 3CMES 1S4EA 1HD0A 4FF4A 3WBZA 4DLGA 1RT7B 3POTB 2HFZA 3QATA 1CLFA 4LRFA 5K8OA 3BN4A 4XPEA 3MMAB 4HTJA 3CD7A 3I0RB 4PG4A 4F4YA 1M5VC 3JQKA 3MR6A 2NZCA 4BC7A 3M8WA 2FVRA 2N82B 2B4UA 3SV3A 4DR4F 3QIPB 4NMLA 1X5OA 3PRVA 2OFHX 2XHCA 2QA2A 2JEJA 3QGGA 1RAGB 3OUYB 3CJ5A 3CDBA 2DEIA 4IH5A 2JC0A 3M9MB 3NWGA 2YKPA 1U48A 3G8SA 4OIXA 2IMOA 4IG0B 4J9LA 2WOMB 1S1VB 3HO1A 1CJVA 3TAPA 1IWAA 2BJ1A 3HHLD 4OI3A 3AA9A 3WX8A 2CUYA 3V5RA 3THPA 1VQLS 4NI2B 5AE3A 2AF6A 2J6UA 4F7VA 1OYDA 2W2QP 3M2VB 5KG3A 4CLFA 1IKVB 3M30A 4JI8J 1HNVA 2C28A 5A0YB 3BEGB 4QWCA 1HQUA 1T8EA 2RQMA 4NXNJ 2HHSA 3PJWA 3LH2S 3HSZA 1HI8A 4DUTA 3GFZA 4USHA 4OI0A 3Q8SB 3CMQA 2VG6A 5KT6A 3N6LA 1RBLA 5GADU 2E5JA 2EK6A 1RBAA 2LXIA 1MROA 1H0HB 1NU4A 1TZ0A 3HXMA 3J7A1 1BMQB 1NJXA 1XJWB 2B5JB 4DHVA 1DHMA 2QZ8A 4O3RA 2IYGA 5F9NA 4KHPJ 3MR2A 2B43A 2KL8A 2PEHA 1R8HA 4NMXA 5AE2A 2XGPA 2YPYA 4R5PA 2HW3A 1LW0A 1UL3A 2Z58B 5SZTA 1SL0A 2BACA 4ZJOA 2OUGA 1LFWA 1JQGA 1NUEA 2XHWA 2RUGA 1UA0A 4IOAQ 2NXCA 3SCLE 2M2BA 2HVZA 3CCSS 4I6AA 1SC6A 2K1RB 1XIQA 4YFUA 1RT2A 4A8SA 4DL4A 5KFOA 5KT5A 1OYEA 2YNFB 3T5KA 5C24A 3N01A 3VZHA 4C0OC 5ETQA 2IVMA 4KGVB 1VS3A 1FE0A 1VQSA 2QSFA 3QIDA 1XC9A 2G13A 3PKMA 4M94A 4I2PB 4B3MF 3OFGA 2IRYA 2I0XA 4AL5A 3PTWA 3NGUA 4LFCF 2DXDA 2RF2A 4KV8B 1S5ZA 4A46A 3ILOA 1HWUA 2D69A 1R0AB 3LWLA 1XMQF 4LSLB 4YHHJ 2I5JB 2H9ZA 1H73A 2YQ3A 2CIMA 4LFAJ 3RGIA 1U6BA 4F25A 3BKUA 3NG8A 4GC6A 3IM9A 4JBCA 2FLLA 3BZQA 4EFAC 2AJ1A 2LEAA 2YKNA 3W8PA 1S7IA 2HG4A 3DU6A 5D77A 1F0XA 2PEBA 4JP8A 3BGOP 4IRKA 4X4NA 1RHRB 2KJVA 2CJYB 5AXLA 3GV8B 1X31C 1CQMA 1U1NA 2QA4G 5AXKA 4BDPA 2R3VA 1QE1B 1NPPA 4Y6IA 2RAQA 4A8KA 2ADCA 1JLCB 1W26A 3A3NB 4DV1F 4K50A 2RRBA 3VZIA 3V6JA 2CQGA 5AT1B 4ALZA 5L46A 2YVSA 2E7VA 4YEAA 4R8UB 3PW4A 3KLEB 2EBGA 5L1KA 2RVJA 5EHHA 3G82B 2AP6A 3W9IA 2YH1A 1F2GA 4DR7J 4Y2IA 2H1YA 1RAEB 4LVOP 1Y3JA 1S0NA 4GVBB 3NY0A 3VGVA 4LRBA 3ZXWA 3MF5A 3TX0A 2YWHA 2B4OA 2BANB 5T7LA 1NM2A 3O3LA 3R9LA 3QT5A 2DPJA 3J7AN 2D9PA 4IFYB 4NLVA 1T3NA 4NYZA 2WW8A 3AFGA 4PAAA 3FFIB 1U25A 3PX4A 5DG9A 5B0FA 2R7RA 4L6V3 4RW7B 3GLJA 1M1GA 1RLCL 2BOPA 2HHPA 3N6NA 4RO0A 3W8GA 3DMJB 2XNRA 2W2OP 2D74B 2AZ3A 4OI6A 2CDRB 4UOCA 1XR5A 4OL8A 4OJGA 1UJ4A 3DRSB 1RT4A 4FVCA 5DJBA 3P3DA 2R7WA 2CRLA 2E5LJ 4CI0B 1UETA 5GAHI 4LF8J 4J5OA 1U1OA 4DN9A 3CJ4A 1Q82T 3DI6A 1RT6B 1VQPS 2H4YB 5DETA 3DCAA 2CQHA 3FNNA 5CCMA 3IRXA 4NLTA 3U27A 4A8MP 4CO1A 3T9NA 2HQIA 3HKZD 4O3QA 1T9TA 1JLAB 2M8DB 2J9EA 4P7TA 5B0EA 2KM8B 3HKWA 2OJ3A 1SUQB 3WHIA 1RACB 5IWAJ 1XNRJ 1NO8A 1GMWA 2R7TA 1NK8A 2HWHA 3EDRB 4B3RF 3RRGA 3VQTA 3KLHA 4JI8F 1H2VZ 1TKZB 3SSSA 5EX0A 1FF2A 1YJVA 4NXNF 3MFHA 2JHEA 1FDDA 4ZPDA 2VF3A 3CD6S 3T41A 3CJ0A 3D6MB 5DS7A 3GSDA 2RB7A 3RAQA 5J2MB 3AAWB 2W9AA 4LR7A 5CH7B 2HVEA 2HS0A 2QJ3A 2Y1JA 4NRTA 3UVJB 2W8LA 8ATCB 4ENOA 4K2XA 5K20B 3GB0A 4S0MA 4KHPF 3TZYA 1GTEA 1WORA 1UEVA 1EIYB 2M9KA 4QIFA 4DV7J 2ATCB 2RHQB 4B9LA 2UXDJ 1NHVA 1LW2A 2MJUA 5IZHA 3NL0A 2MMYA 2X7IA 1KEKA 3PJXA 1FI4A 2V68A 2FDNA 3HZGA 4KAIA 2J8SA 4Q5VA 5KFYA 1VQ5S 4WP9A 1J5EF 2GV1A 3R7NB 4JI5J 2H5EA 3UO0A 1DTQB 4OYZA 2QMWA 1AXQA 1BWVA 3MAHA 2GMHA 1WOPA 5K8NA 4DUYF 1RAOA 1P8GA 5J2NB 1PJ5A 4E98A 1JLGA 2F5GA 4AL7A 1IR2A 3DRXA 4UT4A 4QW8A 1N5TA 4X4VA 1S6UA 5E3QA 4RNMA 4AXJA 1VQ8S 3MDFA 3C6TA 1VRTB 4OI4A 1VOMA 3ZZRA 4JI7J 2X1GA 3WIVA 3QO9A 4TU7A 4YHHF 3KNGA 2Z4PA 4JB8B 2NREA 1BXNA 2VG7A 3OLAA 4LFAF 3D1HA 4IYQA 1QD1A 2BJ3A 2R2UA 3RBEA 2MQLA 1TL1A 1SJRA 5FLXY 3AD7C 2RDJA 3G86A 2OPRB 5CHCB 1JLQA 3VV2B 2NCKL 1YVFA 5HN0A 1YBTA 2VKZG 2IC3B 1MU2B 1G1XA 4TLRA 3IN5A 4MTPA 5CQGA 4JI6J 3HHDA 3KHGA 1SJ1A 3IMQJ 2MKJA 4ANEA 2KT3A 1SKUB 2VOOA 1HWLA 1VK8A 3SQGA 3NGTA 2DNHA 2V8VA 4KY3A 5KFKA 2DVIA 2R2TA 2RQ4A 2NS1B 3D2WA 2VFTA 2XS5A 2MZJA 1NJZA 3UD3P 4F0HA 1IR0A 4WPAA 1HHTP 2W7AA 2HGLA 2EW9A 3NAHA 1UTAA 2QA1A 2HQFA 1S6PB 1F2HA 1CJUA 3TEGA 1XNQF 3DXBA 3EXYA 4FYVB 1UWBB 2VUGA 2V2QA 3GFHA 3QZ8A 4QQBA 4IKAA 4FYWB 1S1XB 1CJTA 2B3TB 1HKAA 2VG5A 1YBUA 1PIEA 1I94J 1DARA 5GVQA 5ETKA 4C8KA 3HDSA 2F40A 1KTVA 2IM1A 4ZVHA 4LJMA 4P10A 3TZWA 1Q8LA 2PN6A 1AFIA 4WZMA 3D6FB 1TKXB 3I82A 3H5SA 4ED6A 3HMJG 1S7HA 2R8KA 3LP0A 3BGRA 3R5JB 3M8ZA 5L1LA 1SPBP 2E5LF 4M63A 3D1QA 4LF8F 4N77A 5KAKA 1BD6A 1RTIB 4BLGA 4ZPVR 4AFFA 3SZ2A 3GP9A 2KT2A 3NGRA 2P2CB 1FRXA 4F02A 4YY3F 2LXUA 1OY9A
chains in the Genus database with same CATH topology
3AH6A 1H2TZ 4RW7A 1HWKA 2J0XA 3IXQA 3C2PA 4I69A 3UDLA 2K7KA 1H2UX 2CJKA 2J9DA 2V4RA 1VLYA 2FJWA 5AXNA 3CTRA 2ABYA 4DSJA 4RKUC 2DHAA 5IWAF 1BQMA 1E6YA 1RISA 3H5XA 1IM4A 2RF2B 1R7IA 4XDCA 4O4RA 1SJ3P 3BF4A 3TO8A 2UVWA 2MXYA 5M2PA 1HI1A 3M8RA 5KFHA 1FRMA 1JKHB 1U6FA 3SDEB 4C8ZA 1OSCA 2DR9A 2BXJA 1T03A 1GXLA 1X0PA 4E8UA 2GHWA 2YNIB 4YB1P 3CD0A 3GFXA 3M2RA 1CVJA 2YNGA 5D3GB 4ECUA 2JL9A 3TUZC 4CO4A 1RDRA 3ENVA 4H4MA 2Q3PA 3MHYA 2VBWA 2KN4A 1WEYA 2M4MA 5AXMA 4RU2A 5A8KA 4EO8A 2M52A 3BS9A 1T95A 2X1AA 5KG2A 4U67Q 3I96A 4JI3F 3EGNA 1M90T 1JLBB 1R8PA 1HA1A 5I3PA 4DN0A 2POKA 1OWXA 4Q45A 4O44A 2DB1A 2IBKA 4WU2A 4OZ0A 2B7BB 3DLKB 2QT7A 3OTDA 3LPYA 4UQGA 2ZJRQ 2DD8S 1KFSA 2DT9A 1GAOA 1JLFA 2XSJB 4EZ9A 2FJDB 3L7PA 4LF7F 5KT2A 1RTJA 3GQCA 2HVIA 2MSTA 3IR7B 1S1TB 4OZ5A 3VAJA 3NNCA 3QGIA 4JV1A 2SXLA 1SJQA 5A8WB 4WFAQ 3Q22A 2F9DA 3AJ1A 2GX8A 2ZHOA 3E01B 4YB7A 5KFVA 5F9LA 2LA6A 2IJNA 1IKXB 2PI4A 4FBTA 2YKNB 1FKAF 5KT7A 2ZH1A 1S9GA 2DO0A 4AUKA 4OMFG 2XCAA 5J2QB 5U47A 3KTQA 3N0VA 4ZPWR 2NZ4A 4I6YA 3HJFA 1M5HA 3UE2A 1RKIA 4EZ6A 2C2DA 5KG7A 5GAGI 2O67A 1X5TA 3IR5B 3K8VA 1HBMA 5GAEI 4RNOA 5KFRA 2CVEA 3O1LA 1HMVB 4UUXA 3DRRB 4X4OA 3G6XA 2W9BB 4ED5A 4C8NA 4MYUA 2FLNA 3EGZA 4PCQA 4Q7AA 4DV7F 5KOXA 2J9CA 2BRKA 5KFMA 2DR8A 2UXDF 3C6UA 2DNGA 2DGWA 4ZVEA 2JJ4D 4CH0S 2YWGA 5J1PA 2I8EA 1SIWB 1S6QA 4DOZA 3Q8PB 3V6DB 1YBAA 3DRPA 1RT3A 3D0HE 3MR5A 1U1MA 2D7SA 2V2KA 1RQ0A 5F0WA 2E5IA 1FDAA 4F26A 1GXUA 2X51A 2U1AA 4QYZJ 1D9FA 1HR0F 5B0BA 4CT8A 1B0VA 4TXSA 2QMXA 3OPKA 4O3PA 4EWTA 5C42B 2MY8A 4FYDA 1VQMS 4DL3A 2F4VF 4DS5A 4TQSA 2DHXA 4MK7A 4Y34A 5KFZA 3ULHA 3CD5A 4PG5A 2ZM6F 4LF4F 3CE8A 1KOHA 3KJVA 4DL6A 3PFEA 1RT7A 3POTA 4JI5F 3JSBA 3LUYA 2MQPA 3PEJA 4C3KA 2KXHA 1DQ8A 3D5MA 1V9OA 3B4DA 2ZKUA 5LJ3Y 3I4PA 3RB6A 3QLHB 4NA3A 3RBDA 2OKQA 1JX4A 3AB2B 2CPIA 4PPZA 1TV6B 4DEZA 4F4XA 4IOCQ 3R1LA 3MMAA 2F1FA 5L1JA 3FSYA 5E0OA 4HH0A 5I42A 1FRJA 1KFDA 3I0RA 4OQJA 2DRBA 1ZYQA 3KLGA 2K2PA 2X1FA 3DLLQ 5T7LB 5EWGA 5CZXA 2DGVA 5KFJA 4IUFA 1SI9A 2D9OA 5CA5A 2A10A 3KMSA 3FMWA 1VK3A 4BWMA 3O5TB 4XPCA 2F8HA 1Y4ZB 3MUTP 3MM9B 5HLFA 4MKAA 4B3OB 1F5AA 1XR6A 3MTKA 5J1EA 4Q8FA 1KNZA 4J9RA 2L9WA 3LAMA 1BQXA 4KB7A 4HH1A 3UCZP 1S0VA 1YJWS 1X4FA 1XEZA 2FC9A 2JC1A 3JTOA 3PR4A 5A6PA 1HNXF 3CCLS 2BM0A 2FHJD 5FJ4A 2HHXA 4HI1A 1X4CA 5CD4H 1M1KT 1QM9A 5EDWA 1C0TA 3NBPB 4MIWA 2MZTA 3WC0A 4RW9A 1UEUA 1VHFA 4HI2A 4XAKA 3U1NA 5H9EJ 4PG6A 3FEZA 3QIPA 1KD1T 2WK4A 1IQZA 4LQ9A 1BC6A 1LQ9A 2HWTA 2YNHB 3QWPA 1YRTA 4RBUA 2KG0A 2VC0A 5LSRA 1C4AA 4LFBF 2APOA 1IBKF 1K1QA 1SIZA 1UAWA 2LDYA 1FK9B 1Y00A 2R9LA 1C1BB 1RT1A 4HTIA 3PX0A 2QV6A 2VFVA 2GMJA 1U7LA 2UP1A 3UR3C 3N28A 4WU3A 4F3MA 4RUAA 4P6QA 4J9PA 2MY7A 3ITHB 5D4PA 4Y0FA 2N4CA 1ZETA 1FJEB 2HLUA 1KRPA 4B02A 1N0VC 3QGHA 3H5UA 7FDRA 2O5DA 2ASLA 3OUYA 2XY6A 1VRUA 1RT5B 4DR5F 1HYSA 2VONA 1DURA 1FDNA 2VH7A 1RAJA 3MM8B 5FDLA 3PIOQ 4DL2A 3KG4A 3DOKA 1P27B 1FESA 5LXRA 4C0BA 3NGDA 2OD4A 2ASJA 2J5AA 4ES1A 5KFQA 4I67A 4C3MA 3UPFA 1AFJA 1RT4B 1NJWA 1G3OA 3DLGA 4ZCKA 2JLGA 2NXUA 1LV5A 3JB9k 3EXCX 3AB4B 5A2QY 1S72S 5GAGU 2ZDPA 2B56A 4LVNP 4I56A 1HWIA 3JSRA 4OHWA 4CNZA 5IQQA 3BSNA 4IG0A 1P9QC 2WOMA 3MMBB 1S1VA 2GC8A 2YY3A 4N5SA 4DR3F 3WDOA 4MKYA 2ZC4A 4KKOA 1FJ7A 2XNQA 3MOZA 1KLMA 2DK2A 4GMKA 3DI6B 3DNCA 1NK6A 1X4GA 3NCPA 1SJFA 2VQFF 5KG6A 1IJEB 4URGA 3M6VA 4NWBA 4WFXA 2K3IA 3IRXB 4IRDA 4JI6F 1KONA 5D4LA 3D28A 3RU0A 1VI7A 1SV5B 4G1QA 1Q16B 3E3XA 2L3MA 4J9MA 5G4DA 2J0WA 3N6MA 5C25A 4ID8A 3KLFB 2MHNA 3M2VA 3CSKA 1IKVA 1ZAXA 3FSXA 4WE1B 4B3SF 4Y2KA 2P5VA 2VBYA 4JV2A 2DHGA 1YJUA 4FPRA 2QYCA 4ZOSA 5A0YA 2MKIA 1D8YA 1N5VA 2XI3A 2GGPB 1REVA 1WG5A 1UFLA 1X9SA 4Q2LA 1C2PA 4DSKA 3LW5C 3LAKA 2E5HA 3FEYB 2HGNA 3KLHB 2Q6CA 4NA1A 5AJ3F 1FD2A 4ILMA 3V2UC 2DNKA 4K4ZA 4J9QA 1QUVA 2BW2A 4CCHA 3DYAB 5FD1A 2W7OA 2J8AA 2CQPA 3CDAA 1Q7YT 4G1IA 3W2WA 2ZH9A 2COLA 3QJPA 3L7OA 3J7YU 4Q2MA 1SB6A 5IM0B 3D1OA 3MMJA 1ZM3A 4DSEA 2M3DA 4NLXA 2HS3A 4NLUA 3FEXB 2K7JA 2RS2A 4PG8A 4JOUA 1VIOA 4DSLA 1RA7A 3O6QA 2DIVA 2ZH8A 4FBUA 5B0DA 2QE5A 2RH3A 5LJ5Y 3HT3A 3PRBA 2OIHA 1HPZA 1ULRA 3A8EA 2KYXA 2B5JA 1IUJA 5EWFA 4DV2F 1NJYA 2BE2B 1IN0A 4H4OA 3TAMA 2E66A 3MEDA 1CG2A 2O3DA 3M1VA 5DDQC 2KFNA 3PHEA 1TVRA 2WCXA 3G6ES 3RW6A 2UVVA 2DH8A 3UR0A 3L09A 1WF1A 1SKSA 3NP5A 3QGPA 3CJKA 2PA8D 3DLHA 1DAXA 5IT4A 3T1AA 5M2UA 2ROGA 3J7Z5 1S0OA 3DHXA 2P6SA 1YRUA 2RKIA 3VAKA 4JV5F 4ZK7M 5T14A 1HQEA 2F9JA 5IFMA 5IS2A 2EVZA 2FHOB 3MECB 2ILZA 1XR7A 2HMIA 3E51A 1F5CA 2AJ0A 2DNMA 4KFBA 4C3LA 4HLBA 4JYAF 3IC1A 1I94F 2UU9F 5L1IA 4ZCMA 1AW0A 4ID5B 5BYQA 3HVAA 2NPFA 1J5OB 3KLIB 3KMQA 3CT9A 1K9MT 1JLEA 3CDWA 4YMEA 5L9NA 3NGKA 2ZH2A 1IXKA 1KS2A 3K0JA 4DSFA 5DQHA 1RWUA 1LW2B 3FZBA 2FC8A 1S97A 2OTLS 3SXLA 2MGZA 4ITSA 4DF8A 3DDNA 4GO5X 2JLFA 2D1CA 2G0CA 5MLCV 3R5BA 4Y65A 3OHAA 2UUCF 2CQ1A 1HHSA 3GG1A 2D3UA 5LMUF 3I9ZA 4TN2A 3JSMA 1Q4RA 3M8PA 5SUHA 1DBDA 3O2IA 2K1RA 2LQBA 3I9V9 1UFWA 2VPWB 3CB4A 1I6JA 2NQPA 2V8HA 1DRZA 5L39A 1ZPVA 4K5RA 2YX7A 4QJVA 3X1LB 2OPPB 4FNHA 4ILRA 5HP1A 1M5KC 3MD1A 2YNFA 2C3UA 1VQ7S 4WCEQ 4PXCA 4IDKB 2OH2A 2HHQA 2V4JA 1XMBA 3GR0A 1VBZA 1R8CA 2JVOA 1HD1A 2IVFB 4KQZA 1FEHA 3DDKA 2DGXA 5DG7A 1UVKA 1IKYB 3HF5A 3WZ0A 2AYGA 3TQ1A 1VQOS 5THWA 2F3JA 2PA3A 3UNGC 1OPIA 1Q78A 2DGQA 2HNYA 2HNZA 2F7VA 2C22A 3RR8A 3Q2TC 2DGOA 2OPQA 4I2QB 3G8TA 4I2PA 2KFZA 1SBRA 3ZFVA 3ENWA 5KFNA 5C5JA 3CF5Q 2J7WA 4UQTA 2LU2A 4YOEA 3E8OA 3HHNB 3TARA 2KVIA 2ZHAA 3FQKA 3DN9A 4N76A 1B7FA 3D54A 3AA8A 2Y1IA 1RKJA 2ZBIA 1FT8A 2GFFA 3MPWA 2BYCA 4F3QA 1ZOTA 4KV8A 1RJJA 2Z0GA 1BQNA 3TA1A 2MQNA 2OMLA 5KFXA 3BREA 3SCKE 4ED2A 2LCWA 2O66A 4CH1A 1NZAA 4RW4B 5F3ZA 4DWIA 4QU6A 3DOLA 1L3VA 1JLGB 2AX0A 3LF0A 3I5BA 4CTAA 4TQRA 2YX4A 1R0AA 4AYBD 1S0MA 4F2SA 5K9FA 4WJBA 1ZM2A 3BN7A 2WSCC 3OFHA 4PUOB 2HHWA 4LSLA 2FPHX 4IQMA 2DISA 2RE1A 4MFBB 1N6QA 2AYBA 1KSPA 2WBMA 2CQCA 3MPVA 3C6TB 2I5JA 3BGUA 1JMTA 5D6GA 3FGVA 1HBUB 4R0JA 5DLGA 2EG1A 2RIJA 2HNDA 4ZDNA 5AE1A 3JYTB 3M32A 4ZHRA 2KI2A 4DR7F 1HARA 2QO3A 4A8WA 4ED1A 3MUMP 2JEGA 1E6VB 2MJNA 3QO9B 2I38A 2Y1RI 2U2FA 2FHMA 1QUPA 3LQVA 1SKWA 3GR1A 2KT5A 3EYZA 4LT6A 4PWUA 4M5DA 5G0RA 5EUHA 4I7FB 3DFEA 5KFSA 1RYRA 4B9TA 1O5JA 1RI7A 1TP7A 3CMAS 4C11A 1X4BA 4USJC 2VG7B 2YWFA 1U1RA 2RJZA 4O4GB 5F8NA 1J2VA 4DDFA 3MEGA 1D1UA 2A3JA 1OIAA 2EFNA 3MPYA 3ZZUA 4QR0A 2XWXA 4FF2A 1QVFR 1R31A 1X4HA 2CQ2A 3DLJA 1TL1B 1JK9B 2AJ4A 4HEA9 3V81B 4OX8A 4WYLA 3M2UA 3MM7B 5ITHA 1CQNA 4FF3A 1LWEB 1L5UA 2UXCF 3KG1A 2AV5A 4ECRA 4NCGA 2LQJA 3PW2A 5B09A 1JLQB 1XBWA 2LEPA 5A8RA 5DLFA 1Y3KA 3AQPA 4K4WA 1Q53A 1QE1A 3H8YA 2V8DA 5KFIA 2EC0A 2CPHA 5HMWA 2XS7A 4X84A 3BO2A 5DDPC 2W7PA 5CYQA 5K14B 4DLEA 1TK0A 3DLEA 3VQSA 4WKRA 1U49A 3FJ2A 1HNIB 4QOTA 2L08A 2OO4A 2Q6BA 4KHRA 4OZLA 2IHR1 4CNYA 1N32F 1R8BA 4Q0BA 2WONA 3PO5A 4DPOA 4PQUB 3HK2A 3T5HA 4ED8A 3SV4A 4BHQA 1DZ5A 2ZJQQ 5DM7Q 2UVRA 3HVRA 1L3KA 4R8UA 1JXEA 1T94A 1TKTB 5B7WA 1B0PA 6FDRA 3PDNA 3LWMA 4NLYA 4OZNA 5KFEA 4AQYF 1LFPA 3KLEA 4WZQA 2JVRA 5CYMB 4PKDB 4QWAA 3CCZA 5E5NA 1YQHA 1WELA 1GXTA 5KFGA 5H9FJ 1HNZF 4X4QA 1VQ6S 2R4FA 1CSJA 2V4QA 3HZEA