3IWXA

Crystal structure of cisplatin bound to a human copper chaperone (dimer)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Crystal structures of cisplatin bound to a human copper chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iwxA00
1SI9A 1SQEA 2GGPA 3FMBA 2GV1A 3HF5A 2XMVA 1VQSA 2BBEA 3BDEA 2KKHA 1S6OA 4FNHA 3HHLC 2HIQA 2HLTA 4HH0A 2HFNA 2VH7A 5F0UA 3KG0A 1YJVA 2XMKA 5B0FA 3MCSA 1Y3KA 4Y2KA 2K1RA 2LQ9A 5F0WA 2FIUA 3IWLA 2XMUA 4Q2MA 3HHLD 1N5SA 1W2IA 2K7JA 2OKQA 1AFJA 2GA7A 1Q8LA 4OJ3A 2RILA 1Q53A 1APSA 1OPZA 2GGPB 1Q4RA 2GCFA 4ZA1A 1K0VA 2QIFA 3TNVA 4EFAC 5B08A 4OIXA 3KNGA 1TL5A 1URRA 2VV5A 3IWXA 4NL5A 1XBWA 4A47A 3I9ZA 3FGVA 4U9RA 3HDSA 2IYIA 2IFXA 2ROEA 2K1RB 5B0AA 2BYCA 1Y0HA 1N5TA 1TUVA 2OD6A 4FNIA 1VQYA 2AP6A 2N4DA 2QLXA 3BF4A 2KYZA 2JDJA 2XMTA 1P6TA 3CJKA 1IUJA 2XMMA 5T7LA 1GXTA 4HI1A 1TR0A 4HI2A 2KT3A 1SB6A 2OP5A 3TOQA 2BJEA 2XMJA 1YJTA 1FVQA 2KT2A 2ROGA 1AW0A 2Q3PA 2HQIA 4F67A 1GXUA 1S6UA 2CRLA 1JK9B 1X0PA 2FB0A 1LQ9A 2LXFA 2ROPA 3MZIA 2BJDA 1FD8A 1MWYA 2GFFA 5IXUA 1KVIA 2EW9A 2AW0A 2LQBA 3LGMA 4A46A 3FRYA 1Y3JA 3KG1A 3CJKB 1YJUA 3BM7A 3TRGA 5T7LB 3LO3A 4QOTA 1OQ3A 4HL9A 2N4CA 5B0GA 3K7RA 1TL4A 4A4JA 3GZ7A 2PGCA 3DXSX 1OSDA 1FE0A 1JWWA 2XMWA 1V3ZA 2IYGA 3BGUA 2L3MA 1YRXA 1CC8A 2W4DA 3E8OA 1N5QA 3KKFA 5A6PA 2BUNA 2ZDPA 3BR8A 4YEAA 4ZOSA 2QYCA 2RSQA 4Y2MA 4DN9A 1X8DA 4NPOA 3QMQA 5B09A 1YJRA 2G9OA 2OFGX 2LDIA 1YG0A 2HFOA 5B0BA 3HHLA 1R6YA 1KVJA 2FTRA 2QLWA 4Q2LA 1FEEA 1X7VA 3QGPA 3BN7A 3VTIA 5KAKA 4Y2IA 5B0DA 4HH1A 4OJHA 3BB5A 4DL0C 1WD6A 2ACYA 2OD4A 2RU9A 3HX9A 4YDXA 5A6WA 1TZ0A 2AJ0A 3F44A 5B0EA 3T9NA 3UDCA 4A48A 2ASYA 2ZDOA 2FHMA 5K9FA 2PD1A 4DPOA 2N7YA 3LGNA 4OJGA 1FVSA 2HLUA 2AJ1A 1CC7A 1FESA 1FE4A 1OQ6A 1Y9OA 2K2PA 1N5VA 2OAUA 5B0CA 2W4CA 3HHLB 1ULRA 3DCAA 2RMLA 2K7KA 2OFHX 3HFKA 2GO8A 4OJ1A 1Q8BA 1P8GA 1U7LA 1KQKA 1AFIA 1RJJA 2OMOA 2W4PA 3WDOA 1MWZA 1QUPA 1CPZA
chains in the Genus database with same CATH superfamily
1VQSA 2BX6A 4C0HA 2KFZA 2Z30B 3CDUA 3IAM9 4F4ZA 2DEIA 5I4MA 1J5OA 4CLYA 1ZBTA 1DLOB 1M1GA 4A8KA 4B3MF 1FTCA 3KK1B 2PEBA 4NA3A 2FVCA 2MEWA 3N6LA 1CJTB 5CCMA 2CJ9A 4OZLA 3VQSA 4KRWA 2X1AA 4A8WA 4BDPA 1AXQA 1HBNA 1U25A 1X60A 3BM7A 1VLYA 1PYSB 2HGNA 2QN6B 5H9FK 1PAEX 3PHTA 5RUBA 4NWBA 2XLKA 3D6HB 4W98A 2ZHOA 3OFGA 4CH7A 5J2MB 3HD1A 2IVFB 2VPZB 1MROB 1HWUA 2R2TA 3RJMB 2ACYA 4DV4J 2HHHF 1VC5A 1URNA 3I82A 1HI1A 2EXUA 3KK3B 1SC1B 1NKBA 1FDAA 3E3XA 2HWTA 4R5PA 3F41A 2IRXA 4ZDNA 3CW2C 1U6FA 2M70A 4ZMMA 3MM5A 2FIUA 4G1PA 2M8DB 3NGKA 1YJ7A 2B8QA 5H1SV 5CCLA 2HIYA 4RBVA 1T9UA 2LU2A 4PWUA 2CPEA 5D3GA 2IVMA 2G1DA 1K73T 1S6QB 1X0FA 4KTQA 3U1MA 3M30A 3LP2B 3OVAA 2HRYA 2VFTA 4DL2A 3DLJA 3LALA 2MDAA 5C42A 4B17A 4F8RA 1CJUA 2KG0A 2ZH5A 2RQ4A 1KONA 1UTAA 2NQPA 2Z8QA 3BSNA 3K5PA 3TQ1A 2M9KA 5ITHA 2J9EA 2DNOA 2J76E 4XPEA 1XWLA 2XZWA 2BRLA 2JHEA 4BHQA 5B0CA 3KG4A 4RW9A 4JI4J 3H7HB 3QAEA 1HNWF 4BS2A 1QUPA 3FKBA 2Z57B 1U48A 4DL4A 2J8SA 4DQIA 1QAJA 1JLBB 4DFKA 2QGFB 4DR5F 2X1GA 4WP3A 4KO0A 1R43A 1S7HA 2WAQD 2RF2A 1RGVA 1F5CA 2C3OA 1HNZJ 1QAIA 1TUVA 3N01A 2FZCB 2DRAA 1RTIB 2WVEA 3POTB 2P6TA 3DGPB 2Q43A 3MMJA 4CTAA 2V4JA 1SV5A 1JLGA 4DU8A 3LPEA 3GIIA 1JLCA 1NKEA 1NDPA 3K7RA 3ISNC 3ZNUA 4ES2A 4DHVA 3GV8B 3CO9A 2E5IA 3GSDA 1KSPA 4WXOA 1QE1B 3C15B 4UQGA 3RBDA 1NHKL 3CCUS 1OPIA 4ID8A 4DQRA 4WFXA 1YKWA 3E01A 2PSZA 4NX9A 2RVJA 1DTQA 4QU6A 2FD2A 5H9EJ 5SUHA 2AZ1A 4QR0A 4JI7J 1O8BA 3QJJA 3GIKA 4DLEA 3QPIA 4F4WA 2D3OR 2YXLA 2AV5A 4MKYA 5GAEU 2AP6A 3M4XA 3G96A 2WB4A 3N4WA 4C8NA 2IM0A 5CQGA 4EI2A 3P5BP 3MM9A 1U45A 5KFQA 2DJWA 2IBOA 1U1RA 5AE1A 3TAMB 3UI3A 1F5BA 3MM7A 3H0PA 1IR1A 1ZZFA 1GFWB 1C0UB 1U09A 4DUTA 2C2MB 1GTHA 3P96A 2ADBA 4WE1B 1L3SA 4DF8A 2LDIA 5G4DA 3BJYA 5KFTA 2JSXA 2QC3A 5DG7A 3KLFB 4QR2A 5CZXA 3UPFA 1X4FA 2ATCB 1T03A 3R7BB 2MKJA 1NJZA 3DRRA 4ATNA 5KG6A 2F40A 4M5MA 1A9NB 1NBEB 3V4MA 3P45B 4RKUC 2XG8A 3GCWP 1EB0A 4BC9A 4DX8H 2L08A 2QEXS 1ZA2B 5BYRA 3TQEA 3RR7A 2ZBQA 4ECRA 3FEXB 1UETA 1S79A 4DFPA 1U1KA 4AQYF 2AT1B 3G8SA 1FKPA 2FZKB 2R2UA 2DR5A 2WVCA 1WUUA 3FRZA 4KH0B 3KUGA 3RB3A 2J6SA 1EZZB 4K0KF 3L3CA 2C3MA 2KYZA 1NUEA 1N48A 4ZVQB 2V67A 1LWCB 5DGBA 2VC0A 3MOJB 2XTJP 3PW0A 1YVFA 2JEFA 4DCJB 1JK9B 5J2QB 1MNEA 4H4OA 4QIFA 3UNYA 3V6KA 3IRWP 1SL0A 1VBZA 4JI2F 2X1FA 1HHSA 4IFYB 5M2PA 4F02A 2NXEA 2VZ9A 4LSLA 4X62J 5DQHA 1RTDB 4UOFA 1WKJA 3IBWA 1G2EA 1T9VA 1WDDA 3CO0P 1JX4A 2UP1A 1GX5A 2DH8A 2WONA 4UT4A 2W01A 1VRUB 2C2NA 1KQKA 2BANA 1M5PC 3QGIA 4YB6A 1TL1B 4R0EA 1NKCA 1JJHA 4DDFA 3BO2A 1MU2A 4O3PA 1UVJA 3OFHA 1GH8A 1H7XA 1V3SA 1NZAA 1HW8A 4WP8A 4DX5A 2IYIA 3GMGA 3I96A 4ZLPA 2F3JA 2HNDB 3VAGA 1ZTWA 4ZVUB 3S7RA 1N6QB 2GJ2A 1YJTA 2YWGA 4C0BA 3UDEA 2G0IA 4I7FA 2EFPA 2CNOB 4WFNQ 2CQ4A 4RNFA 4BWJA 3DDKA 1FFSB 3TAPA 3DDIA 1RT7A 5HAOA 5G0RB 4F3QA 3NP5A 1CVJA 4FPIA 4ECUA 3M9OB 4JI6F 4OI4A 2LDYA 1Q16B 2B3TB 2V5HG 3GG0A 5J2NA 2ZNZA 2FUG9 2FHJA 4JI0J 4B9UA 3A1YG 4GO5X 2QA1A 2PFDA 1AFIA 1CSJA 1VRTB 4IRKA 3R5CA 1SI9A 4H4KC 1Q5YA 3D67A 3BGRA 1NSAA 3I5CA 2HIQA 2WB1D 3ILOA 1HQ2A 3IM8A 1VLOA 3HSGA 2HHSA 3MAQA 5KFZA 2KFYA 4C3LA 3ZTQA 5KFGA 5B08A 4ETXA 2IA0A 3M6UA 1HPZB 4KAIA 3PR5B 2MQNA 1DZ5A 2K3IA 2ZHAA 3AQOA 4C8LA 3THVA 3PW4A 3H25A 5A8WA 5DM7Q 3J7YU 3MHYA 2D3ZA 4KPYA 2YBVA 1VQ8S 4PWDB 4PXBA 2LEAA 1OWXA 2X7IA 3DYAA 5A8RA 3OQ2A 3KLIA 2BKNA 2VA2A 4E98A 5A8KB 2FVRA 2UUBF 2HAFA 1WJ9A 2ZJQQ 1FVSA 4ZVHA 4X4NA 2KU7A 3MECB 4MIAA 5FIIA 3NBPA 2Q1LA 3CCQS 4RW6B 1P8GA 3SSSA 2NLWA 1HWIA 1TVRB 2J9DE 2VQFJ 2EVZA 1IXKA 1VQKS 1P1TA 2VH7A 3LP0A 3C66A 4ES1A 1S4EA 4KPCA 4DV5F 2QYGA 3D3CJ 2KYXA 5T14A 4X4VA 4I56A 1MWQA 4J9PA 1IKXA 5HROB 3H5SA 4DLGA 1HD1A 4UZCA 2BE2B 5MAOA 4HLBA 1SCJB 2ZWPA 1FTRA 4I0WA 1TMJA 2JEGA 4U7UK 1YDLA 3KJQB 3K5LA 2W8KA 3LW5C 3BSCA 2XHWA 4RUCA 4D3GA 1H0HB 2CKWA 1YSJA 3JTPA 3M8PB 3PYFA 1B0PA 3G71S 3Q2SC 3W7BA 2YKOA 4USTA 2MLYA 4F0KA 4PR6A 3BN7A 4KYZA 5FLXY 5IZHA 2PMHA 1U6ZA 2RUSA 3BQ2A 2W2QP 3HHLB 3AAWB 3DM2A 2F9JA 2GO8A 3D5MA 3CXCR 1KVKA 4CO4A 1HWKA 1RAOA 3W2VA 1S9GB 1JXEA 3GJTB 4W92B 2G2OA 1YJVA 4OQJA 4DL6A 5F0WA 5K8MA 4UZBA 3OXFA 4QPTA 1IQZA 3H8YA 3EXCX 1WDTA 1M5OC 4FYDA 1TL5A 4YR0A 2Y1IA 3GPAA 2AJ4A 4E0DA 2QA2A 4ZVEA 3ETMA 4M5LA 2EKYA 2VB6A 2MQ8A 7FD1A 4FF3A 4KGXB 5GAEI 3PM9A 4EU0A 5KFNA 2CQ3A 4EWTA 3HHDA 1S1VB 4B3TJ 2SXLA 2YH1A 1OSDA 2V8GA 2OELA 2I38A 2EK1A 3I87A 4LF5F 4YEAA 4QWDA 3CJQA 3MD1A 3NS5A 3KJVA 2HBQB 1ZTTA 2XCAA 3T5KA 3TVKA 3UQSA 3M2RB 3TZZA 1WC5A 3BQ0A 2AJ1A 2ASJA 3TUIC 2BABA 3HZGA 4MK9A 1WI6A 3R2CJ 3RUBL 5KFAA 1T8EA 4GKJJ 4ZLNA 3T5JA 3SFUA 1T02A 1FA0A 2VL1A 2DH9A 4LFCF 2Q66A 4KHPF 2XLJA 4OZJA 3T6JA 4M1KA 2RIJA 3ILIA 3W61A 1XK8A 3DLEA 4ECZA 1VR6A 1SJ1A 2ZC3A 1H2TZ 4HTIA 1H74A 1OYEA 2ZZTA 4GVBB 3Q0AA 4RNHA 1SKSA 3K0JA 2EFOA 3H2UB 5HMWA 4PPZA 3DHWC 2VBYA 3MM8A 5HJYA 1UP1A 2BDPA 1CJKB 3KLGB 2HHUA 4DPUA 2KRBA 3ZXWA 2R2RA 3AOAA 2BUNA 4NYPA 1KNZA 1I3OB 1VYAA 1FERA 4AXJA 1S1UB 2W2PP 3GYNA 1EX8A 2BM0A 2WBMA 2DY1A 4FZVA 3DOLB 2WOMB 3D66A 3MGJA 4FN5A 3T9NA 3D0HE 5GAHU 5JXSA 1TL3B 2G4BA 4ZPVR 4P2MA 1HARA 1RT3A 1I5OB 1NU4A 2HKEA 3D6FB 4XDDA 2GAGC 4W4MA 1Q8LA 4LR9A 5L1IA 1JNZB 5GVQA 1X5PA 2RJZA 3DLBA 5KT5A 3M8ZA 2G2ZA 3VAHA 4U9RA 1D8ZA 1YGYA 1BC6A 2YX1A 3TZWA 3JAMU 3PJ9A 4FF2A 2YKAA 1T95A 2W9BB 4C3MA 3BGFA 3QT5A 1BGXT 3CJ0A 1YJUA 1SUQA 1H72C 2H48B 2ZBPA 1RBAA 3C19A 1N33F 1OY6A 3EX7B 2E1CA 3SZ2A 2VASA 2F65A 4DV0F 1X8DA 1FRIA 4R8UB 1RT2B 1G6BA 3DOKA 3HHNB 5L1LA 4FKYA 3IS9A 1FRHA 2UUAF 3V81B 3CCLS 1U8SA 3HSDA 2AU0A 2AQ4A 2EKNA 3W2WA 2DKOB 2V63A 3KOAA 1X9WA 4A8SA 1RBLA 1V3RA 1DTTB 3BO4A 1KLMA 2LP4A 5K8NA 1RHUB 4B9SA 1F0XA 1S7IA 1T05A 3LH2S 1R0AA 5F9NA 4RNOA 2DY9A 1AZSA 4C8MA 4F2RA 3H40A 4LF6F 4JI3J 1JMTA 1FXLA 2YWWA 3UN3A 5IQ6A 2GS8A 1G1XA 3FEYB 3DLLQ 4XDCA 4QYZJ 3TVYA 1FEHA 1Q1KA 1X31C 4RNMA 5T7LB 4TYAA 3N5FA 4YQWA 4DR2F 1FE0A 3BGUA 2WW4A 2J6TA 2V2QA 4PPDA 1RAGB 1EQMA 3MF5A 3AJDA 2Y9HA 3M8QA 1FXDA 4WIQA 3W64A 4MIBA 4WZQA 5HBMB 5LJ5Y 3UN5A 2XHCA 3AB2B 3TJ9A 1KRPA 3BBBA 2ZZMA 3CT9A 2RD5C 3CDAA 5F8GA 4LF8J 1MN7A 2LQ8A 3DCAA 3HZEA 2DGWA 2NXNA 1UPMB 5L1KA 2A1BA 3IBFB 3TR5A 1G3OA 2YKNB 1S6OA 2BQRA 1HMVA 2DHHA 2ZWOA 3PTWA 1WI8A 2IBKA 1ZAXA 3HMJG 1RT5A 2OH2A 2DGOA 2BXJA 4MYUA 3NCPA 2RUGA 3TNVA 3CTRA 3CDWA 4GC7A 1LXJA 4FNIA 4ZCMA 1SPBP 3DRSB 3MI7X 5A0YA 2DH7A 4RW4B 1N0UA 2HNZA 4O4RA 4K4SA 4ICLB 3RRKA 3D1HA 4C0OC 3ENWA 4PWWA 1FI4A 2XULA 5C7PA 2BZ2A 4USKA 2NREA 2GIFA 4QIVA 5KT2A 2LVWA 3PVXA 2VHGA 3DDNA 4ZVPB 3E8OA 4OX7A 5D6GA 4ANEA 4Y2MA 3P6YC 2BJ3A 2KDOA 2L9NA 1S9EA 4U96A 4WF9Q 2BVZA 1UVNA 4OYBA 1TU0B 5ETLA 5DS7A 1T3OA 3VGTA 3EGZA 3ULHA 5D0GA 2H65B 4FXDA 1U0HB 1CJUB 2F4VJ 3D7SB 4TLRA 4YS2A 4TU9A 2AJFE 2DNLA 2ZH1A 3ZTPA 2D9PA 3R27A 1VISA 2WHOA 4QJVA 5EDWA 2PA3A 4XAKA 4LBPA 4HACA 2I5JB 1EQ0A 4Q44A 1Q79A 3FNNA 1D8YA 4JI5J 4NOHA 1URRA 1Q78A 4OZ0A 1IJFB 2ROEA 3KWMA 2GW8A 3LQVA 2MQQA 2R3VA 4X84A 1GTEA 2VPXB 4LSNB 3Q8VA 3ISND 1NK4A 3M1VB 4LUBA 5F8MA 1VDHA 2HHTA 1FDNA 2DHAA 4LF7F 4M94A 3UWTA 4OYXA 1I1GA 4PAAA 1TV6A 2IYGA 2VPYB 3OL8A 1GK8A 2YY3A 2XO7A 1TKZA 3SFGA 1N8RT 1RHJB 5L9NA 2MZQA 2VG7A 3VTIA 1HNVA 2ZKUA 3H5UA 5E3PA 5IT9U 3NL0A 2ASYA 3ADAC 2BM1A 4CTAB 2V4JB 1JLGB 1VFJA 2J6UA 3CULA 2FJWA 4ED5A 3WC2A 3MCNA 3TJAA 2E5GA 3W5YA 5C25B 4J9MA 3EVOA 1S49A 3D9BA 4ECWA 2B6AA 1REVB 2HVEA 4OX9J 1Q81T 1VQOS 4DF4A 1XBWA 1RWMB 1BWEA 4NLTA 2EFGA 3DXBA 2QSFA 1T0TV 1WKKA 2F5GA 4WFYA 1PC4A 2XI2A 1HYSB 3FUYA 4MMOA 3DLGB 4I2PA 2RDJA 5J2PB 3Q89A 1A7GE 1N34F 3DXSX 4J9VA 4F3OA 3M8WA 1RT6A 2Y1JA 1UEUA 2ZDPA 4WXWA 4HDHA 3PX0A 1ACMB 4PQAA 4I2QB 4M5KA 2A18A 5KG4A 3UVJB 1ZYQA 2R4FA 5LT5A 4LBHA 3BSOA 2YWKA 5L46A 4QIEA 3CIMA 3PG9A 1CS4A 1VHFA 3OUYB 2E1PA 4NLDA 2R8JA 3MM7B 1RAJA 1HNZF 1GAOA 4S0MA 1WC1A 1UVIA 1B7YB 4LF9F 2R7UA 5GAHI 1DURA 2HNYA 3LWMA 4EUVA 3K2YA 4Q0BB 3M8YA 5CD4H 2JNJA 3ILJA 4N7TA 1WF0A 1KKHA 2POKA 1JJ4A 3NOCA 1WF1A 4ZHRA 4KIAA 2LQ5A 1IBKJ 2CPYA 3R6GB 3I9ZA 4G65A 3VVTA 5HQLA 1PJ6A 2HQCA 2QV6A 1JKHB 1CG2A 3P5TL 4DEZA 4X4OA 1TL7B 5GADI 1U2RA 4K4UA 3S8SA 2LXFA 5F8JA 4MAKA 2O01C 4C3KA 1RZMA 2XO6A 2BQUA 1UPPA 3FCHA 1CC8A 3DLKA 6FD1A 5E3AA 4OHZA 2VQEJ 1ZOTA 1R6YA 2JLFA 4DWIA 3NAIA 3TX8A 5KAKA 4WJBA 2OD4A 2HFUA 2OEMA 5KFYA 1MMNA 4X64F 4H4OB 5HP1B 2E5JA 2W7PA 5JUMA 2CQ2A 1KQGB 3QT7A 4OX6A 2R8IA 4WFBQ 3R1HA 3AD8C 4U8VA 4MFBA 3SIPB 1VJWA 4CLZA 3DOMB 5E41A 4ZK7M 3GFXA 4LVOP 5U47A 2WONB 2KFNA 4ZCKA 2PDAA 2ZOMA 1NSQA 2LXUA 2D41A 5EX0A 2DTJA 2BANB 3IP0A 5LXYA 4Q7AA 4Z2XA 2FJXA 1GXUA 2GFFA 3TUJC 4ZLJA 2C2OB 5FLXU 2OO4A 3HVAA 4JI8F 4EO8A 4LFBJ 2GMLA 3R7NB 4ENOA 4ED6A 3T5HA 4A4JA 4RLEA 2V8PA 4C11B 2V34A 1WTBA 4P7TA 4DS4A 2DR7A 4IKAA 3AD9C 2F9DA 2UV8G 3DI6B 2GVDA 2K06A 4KGMA 5CYMB 1S0VA 1S5ZA 2FZGB 2HAIA 2V2KA 2WK4A 4IG0A 5BYQA 2MQLA 4U7CA 4LIRA 3PRBA 3GJRB 4NEYA 3UDVA 1IM6A 3NGDA 1EP4A 2W8LA 1RT7B 1C1BB 1I51B 4J9OA 3LAMA 1FRKA 5EWGA 1Y3KA 5HLFA 2XMUA 4RW8B 4V19X 2KVQE 3OLBA 2FLNA 1NH8A 5THWA 3EGNA 4DV3F 4F4KA 5J2NB 3W9HA 1K47A 2AHOB 2PMWA 1E6VA 4UF4A 1M5VC 1RYRA 2ROPA 2HSEB 4CZCA 1L3KA 3EZUA 4QZVB 3ET6B 2YQ0A 2W9CA 3QBCA 4NMLA 1R8PA 4H4MB 4IH7A 1NPRA 3R5AA 4TKTA 3FBFA 1NDCA 1IKWB 1BQMA 3A8IA 2KTQA 2DNNA 2RU9A 3CJSA 2OUGA 4P9SA 1HNXJ 1FFGB 1JLEA 2P9EA 3QQCD 4RUBA 3PDNA 4CLSA 3FVYA 2XYGB 2NXCA 5HATA 3WDOA 1IN0A 3DYAB 1SJRA 1F2HA 1O0PA 3KG0A 4NYOA 3KLIB 2QSWA 2H51B 4O4GA 4J90A 2ZOGA 1NSPA 4ZA1A 3TZXA 4GC6A 4CI0B 1RACB 1SJQA 1M5SA 1XERA 3TA1A 3NBPB 5LL6d 4YMEA 3IAS9 3HXMA 1NSKL 1AB8A 1YRTA 4IYQA 2HVDA 1PJ7A 2ZBCA 3KHGA 4WWSA 2AW0A 4OYAA 2H5JB 3LP0B 1RYSA 2CQHA 4JI0F 1VQMS 3PHEA 3FFIB 1JXLA 4J9NA 2CPXA 2Z0GA 5KFCA 1FWPA 2GC8A 3OTBA 1X5OA 1XMQF 5DZ6A 1T9YA 1RQ0A 3PRDA 5KT6A 4Y0FA 2PD1A 3TX0A 4YFUA 3OR1B 4ZIVA 5L8RC 4RBUA 2V6AA 4NI2A 5DO2A 3BZQA 2JWNA 1YITS 5D4OA 3CMES 1PILA 2YKQA 4DUYF 2VFUA 1X5TA 1A6LA 2G2YA 4J9KA 2R7TA 5F8HA 2D74B 2B4PA 4MKAA 1J2VA 4F4YA 1RAAB 3AODA 2VFRA 3C16B 2NR0A 1S97A 2XYHB 1KTQA 2YNHA 2BYCA 2IMOA 4CDIA 1VQYA 3BDPA 3FSXA 1QAXA 3DM2B 2DO0A 3TWZA 1RXOB 3CPWR 2HHQA 2QL7B 5D4PA 3HVRA 4PRFA 3M32B 5JVHQ 4DPWA 2ILZA 2BR0A 2CPHA 2HMIA 3HSZA 3T1HF 5F8NA 3S1TA 2VQFF 1AUSL 2UUCJ 5FJ4A 3QJLA 5GMDA 3SQGB 2YKMA 3X1LB 5BYSA 3FK4A 4DPOA 2QO3A 4Y2CA 4CP5A 1JLQA 5IT0A 4OZNA 4F0MA 2DK2A 2FVPA 2KZMA 4NCGA 2GVZB 2PE8A 5KG3A 3VV2B 4Y3CA 4OZ1A 4CH1A 3EYZA 1KQSR 4IFVA 3RB0A 4P6QA 3VCDA 5DQGA 1WORA 1CJVA 4RUHA 1HL6A 1ZM9A 3OTDA 2RHSB 4N56A 3JSRA 3MPYA 5KG1A 1VS3A 1QDUB 4CT8A 3CJKA 2ZH3A 1IKVB 3SDEB 1P27B 3DRYA 4P73A 3M2UB 3T1AA 3U7JA 2OPQA 2B0GA 1N4LA 3WX8A 2EC0A 3MZIA 4QR1A 2I6WA 4I1TA 3A8KA 2OMLA 1B7FA 3HM9A 1JLFA 2X51A 1Q86T 1S0OA 3ZZYA 3AQPA 3V2UC 3C14B 2VD3A 4QWEA 3Q8PB 1QVFR 1K0TA 3C46A 3VHQA 1KP6A 2ZDOA 2DR9A 4K5SA 1WOPA 4K8RA 3TZYA 2CJQA 4LREA 2AEJA 1DAXA 3UCZP 4B3OA 4DV7F 2GQ2A 3KLVA 1AA1B 4BWMA 2HS4A 1N52B 1SJ3P 3W66A 2XSJA 2XMKA 1RTZA 3Q8SB 2LFVA 1APSA 1PGZA 3Q8QB 3OL9A 2NSBA 4B3TF 3P4UB 3G82B 5CA5A 3F0NA 3MEGA 3QWPA 4WIIA 4M95A 1D1UA 3E2EA 3MTJA 2QLXA 2C3UA 4TQRA 3PO4A 2CA9A 1FWLA 2UXDJ 3BYPA 2OEKA 2DGQA 1RT3B 3NKYA 4J91A 1R8BA 3SXLA 3PZPA 2L41A 3KFWX 2MQOA 2NS1B 2MB0B 5DDRC 3GJSB 1N5QA 5A6PA 4GKJF 4F0HA 2GNKA 3V4IB 2MKIA 2BJ7A 3QIDA 5KFKA 5C24B 2R9LA 1XTZA 2EPIA 2QT7A 1DY3A 2RQMA 3PW7A 2KM8C 2B9WA 1FRXA 1TUGB 2DPJA 4DSEA 4ID5B 2J0SD 1Q95G 1AT1B 2MLXA 3KK2B 2UVWA 2XY5A 3NY0A 2BKPA 2VOPA 1RTJA 4G6VB 2LQJA 1FJGJ 3RB4A 1IQTA 3Q2TC 1NZ8A 4AYBD 2HVIA 5AJ3J 4M5IA 1LW2B 2CFXA 5IWAJ 4DX7A 3MAAB 4BCAA 1K0VA 3H42A 1RWOB 3RR8A 4NCAA 2IRYA 2APOA 4P2SA 1EKSA 3C6UB 3K5MA 4B08A 3UD5A 2U2FA 2MKKA 1RT4A 4RW7A 2DR6A 4HT5A 3GYGA 2F8HA 2QRRA 3CEDA 2GJFA 4KY3A 3K5OA 1OYDA 3NCRA 1GXLA 1GEHA 3DU6A 4DR6J 1REGX 3CD6S 2XY6A 3LUYA 2KXHA 3NS6A 4PXDA 4ZOSA 2PI5A 1GMVA 2WSCC 4EBCA 3C6TB 2L48A 2H4YB 3TP2A 1RA7A 3LP1B 3F56A 4ZIWA 3O5TB 1CQMA 2FHMA 2H5EA 3B4MA 1R8HA 5KT7A 3PW5A 6FDRA 2CVIA 3M8RA 2JJ4D 3K5NA 3PFEA 4TQSA 1X4GA 3BS9A 1N32F 2NUUG 3O6QA 2MSTA 5CYQA 4N77A 3QIPB 2CPIA 3SCLE 1IBCB 2GCFA 2HVZA 2YNGA 3DRPB 3SI8A 2HWHA 3OD2A 3MEDB 4KBIA 2JVOA 2B7CB 2HBRB 2V8HA 4M5HA 1D09B 2JLEA 1SKRA 1SQGA 4I4BA 1IVZA 4C8KA 4X4SA 3EICA 4G1QB 2EG2A 2AIRB 2B4UA 3HSJA 3O2IA 1DQ8A 4CNZA 2ZC4A 3JQMA 4F7VA 1S77D 1Y3JA 4Q8EA 1ZM2A 1WOOA 3GZ7A 2UU9J 1RI7A 4TLQA 4DG1A 4KB7A 3NAHA 3GONA 3RAQA 4DR1J 5DM6Q 2RQKA 3PY8A 3QT6A 1HA1A 1BE4A 2OPRA 5A0YB 4DFJA 2J5AA 1GX6A 1K9MT 3THTA 4ECSA 3A12A 2IAJA 1RP5A 3GIMA 3ETOA 3IMQJ 3RU0A 1V6HA 2BRKA 2FPHX 3FMBA 4JI3F 2HGMA 2KKHA 2V8VA 4DQQA 2O66A 4DSFA 3O8WA 3SCIE 1S9EB 2LXIA 3AA9A 2GGPB 4GRSA 4ZLLA 4EFAC 2QA4G 2KL8A 2KJVA 1VBYA 1XIQA 4ECQA 4DCPB 2CG8A 2JH3A 5BJRA 4EMDA 5AXKA 4IOCQ 5I3PA 3RZAA 3ICLA 3KDNA 1BQNB 2OPPA 3MEEA 1RTHA 4HACB 7AT1B 3D1OA 3IRXA 3I55S 2V4QA 2RRAA 4KJIA 1NK0A 3OSPA 2FJEB 2Z4PA 2E1MC 1B4SA 4KFBA 4OI3A 3GILA 3LGHA 2OSQA 2BW2A 1R8CA 2LU1A 3CJRA 3FDSA 4N5SA 3UNGC 2CQ1A 2B7BB 2HEKA 1ZM4A 2C22A 5E7OB 2ERRA 1SBRA 4A8FA 1TV6B 3I0RA 1BXNA 4DR3F 1S1WA 1NDLA 2VG5A 8RUCA 1VCTA 4FYWB 2VG7B 2XEXA 4DR7J 4A8OA 3W8PA 3N5BA 3W3SA 3C8YA 4USVA 3HJVA 1IUJA 2CZ9A 2RKIA 4C7QA 5JJBA 4O0IA 2RRBA 1NJWA 1XEZA 1LQ9A 1I94J 2WSEC 4H54A 2WVBA 3DRXA 4Z37A 1IBMF 1WG1A 2YNFB 1I6JA 3R7SB 2MZSA 3R6LB 4ZPAA 1R27B 4TY9A 3CJ3A 1RBOB 2D3UA 3R5JB 4X4QA 5ETOA 1YBUA 3IG1B 4Y2AA 2BE9B 4EYIB 2ZH9A 2E9TA 4C97A 2B5JA 2O5DA 1W25A 3SQOP 1J27A 2VG6B 1HI8A 2IC3B 2DVIA 2GMJA 1DLOA 2CJYB 4HH0A 2B4OA 3BH6B 3KK1A 3DLHA 4I69A 4OJ3A 2CQGA 2W1BA 1R89A 3EM1A 2XS5A 4RU2A 1JLAB 1U49A 1CJTA 1E6YA 2P6SA 3IR7B 4M5NA 3T1YF 5EN1A 3TI0A 2WSFC 3GP9A 5E3RA 2JRSA 2DIUA 3W63A 2EBEA 4NYZA 1PC5A 1FRJA 8ATCB 2HW3A 1OY9A 1YWXA 5J2MA 3OVSA 3TUPA 1MROA 1RDRA 1Q7LB 4M8LA 1V3ZA 3U02A 5KFMA 1HQUA 2QG9B 4J9SA 3CD7A 2RNEA 4F50A 3KK3A 4ILLA 1FKAF 3PFOA 2E44A 4P52A 3HX9A 3D1QA 2V69A 4A48A 5HMXA 4JV5F 4OX9F 1OIAA 3QYYA 1TK8A 3VGVA 2Y0SD 3WIUA 3V6DB 4OV6A 1VIXA 2VDIA 4ZN3A 2CZVC 2R7VA 3MDFA 1CPZA 2GV1A 2CNKB 2CNNB 2DGUA 2AYGA 2FDNA 3GV7B 4LRCA 3EWGA 1S6QA 3TUZC 2KO1A 1OPZA 1FRLA 3LP2A 4CLWA 3Q8RB 1A0OB 2LLZA 2KI2A 1Q7YT 3JS9A 5D0EA 3OV7A 4P71A 1O6XA 3KLEB 2KB2A 3I5BA 2HS3A 2BQ3A 2A10A 1XC9A 4P2FA 4DS5A 1WHWA 2DNZA 3PNIA 2PIIA 4N8OA 1TAQA 1SC4B 1TKDA 2W2MP 3EPIA 4YDDB 1MMLA 1Q8KA 3CF5Q 5CYJA 4K2JA 4F2SA 1RB0A 3DU5A 4HH1A 3M6WA 4MKBA 3H5YA 1TFYA 2FLOA 4AFFA 1IBKF 1NK8A 2A6OA 5DRKA 2BACA 1GMWA 4TYBA 2FGCA 2UXCF 4USMA 4CYUB 3QFHA 1S76D 4LF2A 1VI7A 4L3NA 5KT4A 3DMJA 4GKKF 3HF5A 4X4TA 3HVTB 3H4BA 1D9DA 2H9ZA 2HFZA 2KH9A 2OKQA 3CE8A 3IA0A 1RTIA 3FC9A 3POTA 3DGPA 4CO1A 4LVNP 2HQ3A 3PIPQ 2OTJS 4J7CA 1C4CA 3BEGB 4IQMA 4IG0B 2KHCA 2JEJA 5SZTA 2ZVSA 2HK3A 2VQEF 3CCJS 3JAMY 3G2XA 1LNQA 2G0JA 2Q6BA 3PXGa 4IDKB 2HG4A 3L7PA 1TKTB 1PBUA 1SL2A 2ZE2B 1QE1A 3J7ZT 2R7WA 1H7WA 3WC0A 3D6TB 2W2NP 2DGXA 3HULA 1TTHB 1RA6A 3KHHA 1DFDA 2MHEA 1NK6A 3W9IA 1U02A 4HR2A 4PG6A 2EWHA 2U1AA 2ILYA 4QIGA 4K0KJ 5IM0B 4UUXA 2LMIA 2GQQA 3CVKA 3ENQA 7FDRA 2RS2A 3UD4P 3K59A 4NLUA 2WVDA 4B3RF 4XO0A 2IPOB 3M9MB 3EZOA 4NA2A 1HNIB 1S1TB 4ED7A 1AFJA 4RUAA 4UOHA 3E51A 2CXEA 4JI2J 4OV1A 5K8OA 4WTYA 2YKPA 1OY8A 3TAMA 1UZDA 4LFAF 2IRUA 1C0UA 3M2VA 2HGLA 1HBMB 2MKHA 3HD2A 2VBXA 2BKOA 1PAUB 4WE1A 5CABA 2OLWA 4B02A 2F7VA 4DU7A 3KLFA 1NJIT 2HHVA 4DMZA 2D9OA 5IV4A 4J5OA 5HI7A 3AT1B 1RWWB 3T41A 2ZH2A 4ZPTR 1SQFA 4OHWA 4NASA 5FDLB 2RMLA 3J7Z5 1WHVA 4I67A 4ER8A 3I5AA 3SEOA 2DBBA 3BPSP 2DPIA 4F26A 1D9FA 4DPTA 3G86A 2DNGA 4N47A 5D15A 1LWCA 3JYTA 3JTOA 4P10A 3HHEA 4OIXA 3KNGA 1Y5NB 4J9RA 2HK2A 6AT1B 2DD8S 5J2QA 3RBXA 1SH2A 4JI6J 3CCVS 2XS2A 1ROFA 3ISZA 3A8EA 4I64A 2I2YA 4RX6A 2IM1A 1SJ4P 5I3QA 2QFJA 1VC0A 1LWFA 5LOQA 5I42B 5E2QA 1RTDA 3N9UC 4X4RA 4USWA 2YQ1A 2NZ4A 2QYCA 5KFWA 1YJRA 4NLQA 4L3KA 5B0BA 3KLHB 4KKOA 5AE2A 1VRUA 2C3PA 3MMAB 2Z2YB 4TN2A 2KRRA 1TL1A 2FY1A 5D77A 3JSMB 4N76A 2AYMA 2DHSA 3D0GE 1B64A 4NLGA 1S10A 2UVRA 3BKUA 1XMOJ 2NYIA 1HFEL 4KV8A 3MMBA 1C1CB 2YVSA 2D7SA 2GZOA 1WG4A 2HNDA 5KTQA 1N6QA 2VA3A 3Q23A 4AT1B 2K1RB 3GFYA 1KS2A 1HR0J 2O67A 1O51A 2HBZB 1F3VA 1XR5A 4OHYA 1N5YB 5M2UA 4DUZF 1KVIA 3KG1A 3LWLA 1S1XB 2N3OA 2F1FA 5LMUF 2PGCA 5DDOC 2J0XA 2BJ1A 2R7OA 3NWRA 1F2GA 2VIHA 1WC3A 2CJBA 3CCRS 4DV5J 4V19J 4HDGA 1VRTA 1WHXA 5IT9Y 5KOWA 3UDCA 2RH3A 4LF1A 2AF6A 4I68A 2VF3A 2K7KA 2OFHX 1KOHA 4DXLA 3RB6A 1MWZA 4TU7A 4NXNJ 1H6KX 4LJMA 4AUKA 2GMHA 5F0UA 1J5EJ 4ZPWR 3FQLA 2LQ9A 3DKDA 4OZ5A 1RWUA 4DBQA 4WU2A 3D0IE 5EUHA 4RWWA 3UD3P 1Y5LB 2R7RA 4IG3A 3IR6B 1WELA 4PQUA 1Y0HA 2O3DA 4PWDA 3CC2S 4WZMA 2NSCA 1EKRA 1WOSA 3V6JA 1U0SA 4NLWA 1F9FA 2FQQB 2HFVA 5A8KA 2XS7A 3OXLA 3GYXB 1KLNA 3QMQA 2OFGX 2B9XA 1C0TB 3LAKA 4RW6A 3QLHB 4WKRA 5IQQA 5EGYA 1HHTP 1TVRA 1IM4A 2O1PA 2YWHA 3UCGA 3UN2A 2IM3A 4G1IA 4OJ1A 2JFDA 5EHHA 3NMRA 3ENAA 5HROA 3S6EA 3OTCA 2BE2A 1VQ5S 3I4PA 2BW7A 2CVEA 3FBCA 1ZH5A 2UXBF 4OYOA 2J7UA 1VQ6S 4LF5J 2XZTB 1YJWS 2FC9A 4URSA 5HQ8A 3CMAS 4U8YA 5H9FJ 3M8PA 1NHUA 1GNKA 4EO6A 5HANA 2J0WA 4M5GA 2EI5A 1S6UA 1RTJB 4Z7YA 1MWYA 2EW9A 2DGSA 5LSLA 1HBOA 3UO0A 5KFBA 1YJNS 2MGZB 2VKRA 4LF4F 1VGYA 4JB8B 4LFCJ 3HHLA 3AOBA 1FEEA 4C9DA 2H1YA 5KFHA 4JYAJ 4WYLA 1S9GA 2JZ5A 3H59A 2MKCA 3MPUB 3NWGA 1IBLF 1YTYA 4HEA9 3V6HA 2P8IA 1RLCL 1UZHA 4YHHF 1PYTA 4UY8T 3GTYX 3HKZD 1MMDA 4BBYA 3CGIA 3ILLA 1SVDA 3IO1A 1RCXB 2UXDF 2QL9B 3CCSS 1KHVA 1LW0B 4LBIA 1WHYA 4YOEA 3SMZA 4B9VA 3KUHA 5H9EK 3P3DA 3M9NB 3IWXA 3OHBA 3EMTA 1XNRJ 3B4DA 1UWAA 3ZTOA 3QGHA 2E9RX 1RT1B 1S1VA 2R42A 3BN4A 3OL7A 1FKOB 1XR6A 2XMJA 2HQIA 2V9KA 4A46A 4K4TA 3VALA 2AMCB 4NLRA 1S6PB 4DV2F 1VQLS 3M2RA 5LM7E 1FJGF 5ETQA 4A8MP 2VICA 1N36J 4K4XA 4KT0C 4ZN1A 5AJ3F 2D1CA 5IWAF 2N7YA 3FSYA 4OJGA 4GMKA 2ZVIA 5ETMA 2IDEA 3CNQP 2MMYA 3MMCB 3CIZA 3J81j 2CADA 4ECYA 5C2CA 2OIHA 5BR8F 3VGUA 4OYIA 2E7VA 4FNHA 5KFIA 3ZZUA 2PFFB 2EG1A 3DC2A 2E7XA 3MCSA 4Y2KA 3OLAA 4GVBA 1TKXB 4QW8A 2ADCA 2IY5B 5HMZA 4DR6F 1LOUA 4ZCLA 3J81Y 4Q8FA 1PKUA 4FYYB 4UY85 1U1NA 2IAJB 5E0OA 1CJKA 5E33A 3KLGA 2UUAJ 4IO1A 2BMBA 2RQCA 4OFZA 3I32A 3TARA 5IXUA 2EC2A 1Q8IA 1S1UA 1MSWD 1FNOA 1UL3A 4HL9A 5D78A 4U95A 5F3ZA 3T19A 2WOMA 3OBIA 1H2VZ 4ZP9A 3B78A 1H2UX 2OI2A 3W5ZA 1TL3A 5GAGU 2A2CA 4DSLA 2QJ3A 1IKYB 3N28A 4CO0A 2ZM6J 1S72S 4PUOB 1KTVA 1XN9A 3TO8A 3Q83A 2B8PA 2M8HA 3HI9A 1BLUA 2K3KA 4IR1A 3D68A 2CDQA 1RTHB 3BPDA 3PJWA 4LRAA 9ATCB 1RE1B 4FVMA 4NLXA 4NEZA 3DN9A 3MOZA 2FYXA 3QNWB 2DGTA 3HK2A 4DR2J 4XTTA 2DT9A 3R3TA 1ZAVA 3HDSA 4PCQA 4AE5A 2DYAA 2N3LA 2I0XA 2KN4A 2ZD1A 1KC8T 2OGUA 4DR1F 2P9CA 2YWFA 4HTJA 2HS0A 2CYYA 5DG8A 1FK9B 1NPPA 1RU1A 1ZZNA 4MK8A 4R8UA 1UFWA 4DN0A 3OJSA 5B0GA 4B9NA 4OX8A 1U1LA 2MJNA 3KJNB 2HYIB 4EGLA 4NZ7A 4DN9A 1T9XA 1X4AA 5KOXA 1UWBB 2IVYA 2XGPA 4CM0A 2MSSA 1PIEA 3MPVA 1VIOA 2RKIB 3OXGA 2DB1A 1OQ6A 1OO0B 3RAMA 1N5VA 1AUDA 2XMAA 1Q8BA 5GADU 5DQIA 2ZJPQ 4ZVGA 2I1RA 3LA0A 1EETB 5KG2A 3EUNA 3MURP 2J7WA 4B3SJ 1ZA1B 1BD6A 3OHAA 4ZKAA 3US5A 3K58A 5A2QY 2J9CA 2V0NA 2RU3A 3FBBA 1FNXH 3SYZA 3CC4S 1RSCA 2E1AA 5T7LA 4P2XA 2DRDA 4WK1A 1QD1A 2E7WA 2Q3PA 3ZZTA 4C4WA 3OTOJ 2AGQA 2Y8WA 4I6YA 5F41A 2CPDA 1L3UA 4FF4A 2IJFA 5HBMA 1E6YB 2ASDA 1RWPB 2Y1LB 1CULA 1X4HA 2HQGA 4JI1J 3BQ1A 2HZVA 4J9LA 2YKNA 2MY7A 1Z1ZA 3KMSA 2R8HA 4ZVRB 1UFKA 1UVMA 4DR7F 2LA4A 4ILRA 1F9HA 2YNIB 2E9ZA 2G1HA 3ZZRA 1QLNA 5DDQC 2W7OA 2FHJD 4IUFA 2B9EA 3L9ZA 1DARA 1HQUB 2LEBA 1HQEB 4F25A 3R5GA 1I94F 3DRSA 4LF7J 3W62A 4RW4A 2PN6A 4USUA 2LECA 1SKUB 2R8GA 1AYEA 2VV5A 1UA1A 4ICLA 3H20A 4C8YA 5AXLA 3AHPA 2C42A 3WQPA 3OVBA 1JJ2R 2GJIA 2E5LF 2OSRA 2QMXA 1J5OB 1MLAA 1IWGA 4LQ9A 4C8ZA 1FD8A 1VQ4S 2VOOA 3VR1A 4X65J 3PCOB 1TK5A 2Z58B 1FHTA 2FVQA 3BGOP 3R9LA 3SBMA 4XPCA 1DQ9A 4UOCA 4EZ6A 2KM8B 1T94A 2DNQA 3L7UA 2G9OA 1HBNB 3NGUA 4F4AA 1RU2A 1B0TA 3QGPA 1U0HA 3LPYA 1VK3A 3F44A 1NEEA 4CLTA 1F6TA 3CCWA 3QSIA 2HZCA 1SJFA 2I9SA 2HBYB 2GX8A 3PKYA 4HYKA 4EEYA 3G8QA 3ZTSA 1VRQC 2I5JA 4NA1A 2YTCA 3Q22A 4OI2A 3LOUA 1S57A 3HVWA 2EEYA 2VDHA 5JMNA 1Q82T 3HHLD 1F1BB 1QJHA 1N34J 4R5PB 3UFCX 4LSNA 3M1VA 3KHRA 2E5HA 2MY8A 4DV6F 5B7WA 2XB2D 3MM5B 4C6AA 1KN6A 4M5DA 3I56S 1L5UA 1U1MA 5HJXA 5HVHA 5D3GB 3MR7A 2NPFA 3DMJB 1KEKA 1R6VA 2V94A 3M30B 5E5NA 4UTGA 4PKDB 5KFUA 4Y34A 4LF9J 4C8OA 4OYWA 3M7VA 4Z7CA 4B9TA 2V68A 5C42B 2FLLA 4DV1J 2QMWA 4NCBA 2B43A 1TFWA 1NPKA 1UCNA 1NLKL 1TZ0A 1Y4ZB 2ZH6A 1UW9A 4KHMA 1FE4A 5C25A 3ONQA 3NNHA 5I3UA 2MQPA 1TMMA 1REVA 1B0VA 2DO4A 1ZS6A 3RBEA 1KFSA 3OSNA 4RW9B 1N54B 1P1LA 1RISA 3HJFA 2DNHA 3DHXA 1NK7A 4DV4F 1GQEA 4J9UE 2V8DA 3G6YA 2QIFA 2CPJA 3BKFA 1HYSA 2MZTA 3DLGA 4KO0B 4P72A 5J2PA 4JV2A 2AZ3A 4WP9A 3C3LA 1SB6A 2M7SA 2RF2B 4UUWA 1QSLA 2EFQA 3K8WA 3BSAA 4NLVA 1ITPA 2OEJA 1NXIA 4I2QA 4X64J 3UVJA 3L09A 4EZ9A 1RWNB 4NXMJ 2AGOA 3AH6A 1SV5B 2NXJA 3OUYA 2F4FA 4CWBA 1JLCB 3I9V9 1QVGR 2VUGA 1VQ7S 4CCHA 3J80Y 3M2VB 2YX7A 5GAGI 2L9DA 4Q0BA 3FZ2A 2K2PA 4CNYA 2XGQA 4DR4J 2GAHC 2BE7D 3QT8A 3GU0A 1UJ6A 3M6VA 3MR6A 3E01B 2Y0BB 4KGZB 2RDDA 1JKHA 1DTQB 4LRFA 5MLCV 4JI8J 3EVMA 3KTQA 1DHMA 1TL7A 1T3NA 3GIJA 4ELVA 2Q6CA 4A47A 4ZVFA 3CDBA 4ZJQA 2ZITA 4JI4F 4AD6A 4K4YA 4V1Ak 4HT7A 3FMWA 1TR0A 3HP6A 4CLPA 9RUBA 2A2DA 3L95X 4IQXA 3PX4A 2JX2A 4QWBA 3K8VA 5DETA 3MM9B 1RABB 4D3HA 1X4EA 3JYTB 4RL1A 4O3RA 5HMYA 1P9QC 2PEHA 1NM2A 4IOBA 5HP1A 2MJUA 3I6PA 4Y2IA 2Z2ZA 3UW1A 4OZ2A 4DV3J 4HHJA 3BR9A 2OMOA 1LWFB 1LXNA 1NK5A 1T03B 2YWEA 3DRRB 2WVFA 1FO1A 2JC1A 2CQIA 3DOMA 5B0FA 1VQ9S 3T6BA 2OHDA 4KKOB 2KXNB 3GR0A 3AFGA 4K50A 1YQHA 4CRJA 2ZFHA 1M1HA 1L3TA 1FKPB 4PXEA 1NJXA 4C11A 2MKYA 2KT2A 3OFFA 2ZHBA 1S12A 4RPFA 4P7VA 4JI7F 2P9GA 4KV8B 2ZZNA 2COLA 3MMBB 3DI6A 2J0QD 5CYMA 3NCQA 4MJKA 3D54A 2F8EX 2ATLA 3HO1A 3BR8A 3TVZA 4QYRA 1NK9A 5J1NA 4K7QA 3W8GA 4O3NA 3TW0A 2JOQA 2B51A 4QYZK 2B9YA 4QU7A 4IRCA 2FY8A 3BB5A 4IOAQ 1RWVB 2BA9A 5L39A 2AYBA 2GHPA 5IV3A 4LSLB 4M5JA 1CC7A 1C1BA 3TJ8A 4PABA 4LRDA 4NRTA 4RW8A 2L9WA 4O3SA 2CPFA 2C2EA 3BDEA 2DNYA 3NGSA 1V9OA 3MR2A 2MTLA 2OJ3A 1B70B 2LKZA 1LFWA 3MFIA 5LSOA 3OT9A 2YH0A 1MU2B 1PYOB 3FGVA 2C28A 4JP8A 1N5TA 4KQZA 2HURA 1C2PA 1QTMA 1XMQJ 3ET6A 4RJVA 3ELHA 2OP5A 3QRRA 2AEMA 4H4MA 3O1LA 2YQ3A 5HVFA 3D4JA 3AXKA 1LWEA 1IKWA 2JVRA 4DUYJ 4O44A 3W60A 3A3OB 2N82B 4IG3B 4I7FB 1XMOF 2FVSA 4PQUB 5HN0A 4J37A 2HPUA 1LEOA 2QZ8A 5ETTA 4ECVA 4X4PA 3GB0A 1DBDA 5DZ7A 4ALZA 4KGVB 2DXFA 1M5KC 4E8UA 1PO6A 4ZJOA 1VBKA 3I31A 1HR0F 1SQEA 3VAJA 3EE3A 4K2XA 1FD2A 3J81U 3KYLA 2OPSA 3BBCA 4X62F 1LWXA 4QCLA 3EGVA 3ENVA 4NLPA 3RRGA 3GFHA 3QZ8A 4WFAQ 3BGRB 3T1HJ 2GQCA 4ITSA 2H5IB 2XMMA 3TYTA 1ZAWA 3FFIA 3J7AN 2DITA 2M0GB 1EAYC 4L76A 4UQTA 3LGMA 3NNAA 4FKXA 2FJBB 1RWXB 1TL4A 2A6MA 5A8WB 2GO9A 3L4BC 5L38A 2M3DA 4O3OA 2KHDA 4GVLA 5DG9A 3MCOA 3OR1A 4NXNF 5E3CA 2HFOA 1UVLA 1SC6A 1J5EF 5A8RB 4ZPDA 4DL0C 4EBDA 2HHPA 2XLIA 1R0BG 2KXFA 4CO2A 2V50A 1SC3B 3NLCA 3JSBA 4RU9A 1R0CB 2MKSA 3P8BB 1KWMA 3C16A 1WC0A 1YHQS 1HBOB 2HWIA 3ZZZA 4QWCA 1T9WA 1FT8A 5AXNA 4NRUA 3W1YC 2MPUA 1N88A 4U67Q 4L74A 2EFVA 1SH0A 5CXTA 1TP7A 5L9XA 3M32A 4TY8A 3OW2R 2JDJA 3SCKE 3B54A 1WNEA 2CNLB 4ECTA 2CQ0A 4DFMA 2CJKA 1IKXB 1PBAA 2BOPA 3AXMA 2XWXA 1IR2A 1OS5A 2VODA 3SQGA 2QA4S 2ASLA 4DL3A 4DV7J 4RWXA 4Y6IA 2M52A 3PYGA 1QAYA 1JJCB 3CDEA 2GVZA 4CLUA 1FCAA 2FGOA 2DXDA 1Y5IB 4ECXA 2BJ9A 2GIRA 4USJC 1R7IA 3NGRA 1LFPA 1N0VC 3JXOA 5A2QU 2BBEA 1T7PA 2QE5A 2PI4A 3PKMA 1VMBA 1EHWA 2RS8A 1IKVA 3SDEA 3JQJA 3W2VB 5LMNJ 3JSYA 3M2UA 1H3DA 3QO9A 1BQXA 1P6TA 3N0VA 2MZRA 3KNAA 4OL8A 1YRUA 4WFZA 2CQCA 4ZP8A 2AX1A 4JYAF 1XQIA 1X9SA 4F36A 3C14A 2ZBRA 2CWXA 3RW7A 4CT9A 3WX4A 3MUVP 2KT5A 2B56A 2HZAA 1WTFA 4OZ3A 1FRMA 1B99A 3C2PA 5J1EA 4CO5A 5K9FA 3B8HA 3VAMA 4MK7A 3JB9k 3KJVB 2HQFA 1XNRF 3B82A 2C2DA 3CJ8A 1FF2A 2VBZA 1CEZA 1MN9A 3G82A 1FNMA 2IHR1 2C2ZB 2JL9A 1Y10A 2A0FB 5C5JA 5CHCB 5ETRA 4YR2A 5L1JA 2QX0A 1JB0C 1DQAA 1KR4A 4BC7A 2IFXA 5B0AA 1HBUA 2FC8A 2VJUA 3DLEB 1WSRA 1BUXA 1IJEB 2WRMA 3MCMA 1N36F 4PG8A 4LRBA 3VQTA 2YX4A 4KE5A 3V4IA 3TEGA 4ZVOB 5C24A 3J7A1 4O3QA 4EK2A 4RO0A 1N32J 1YBTA 3GE9A 2XY7A 1PSDA 1S4FA 4L72B 3MM8B 2C3YA 1WKLA 2R8KA 5DLGA 4ID5A 2ZD1B 4C2MA 1NB7A 3OR2A 3KK2A 3A8JA 3G9CA 3Q8YA 2DR8A 2VPWB 3LGNA 5K14A 3I0SA 3G4SS 3BO3A 4FPRA 1EJ7L 1LW2A 3MAAA 3MR3A 4YY3J 4FVCA 2MZ1A 1UJ4A 4YR3A 4Q2MA 4OI6A 2DXEA 1QSSA 5K8PA 3C6UA 4FS2A 3GLJA 4DX6A 4HHHA 1WACA 3M6XA 1WWHA 3PEJA 2CZ4A 1YIJS 2A3JA 2FJAB 4IR9A 3R1LA 3AJ2A 4OI0A 1FVQA 2ZM6F 4K4WA 1H38A 3R5BA 2BJDA 1YBAA 8AT1B 4QQBA 3C6TA 3LP1A 2IJNA 3MWBA 5FD1A 3KKFA 3TAQA 3QJPA 1QUVA 1VHIA 4H4KA 1WSVA 3IFEA 4NPOA 4ZPCA 2IDLA 1YG0A 1MW7A 2CG4A 3IGNA 3PO5A 1SUQB 4OI1A 2QLWA 4AL5A 1UW4A 4IRDA 3GQCA 2VFSA 2CQDA 1PG5B 3N79A 4L73A 3J7YI 4B9LA 1M90T 2CJAA 4DQSA 4O0NA 3MTKA 1RCOB 3DOKB 3IS9B 5LSRA 3QIPA 1W26A 2JFKA 3JQKA 3DRPA 1BHNA 4X2BA 1M0SA 3MEDA 3IWLA 3H5XA 1X9MA 5CH7B 3W2WB 1CULB 5CZVA 2DNMA 2NXUA 4G1QA 1W2BR 1RADB 3IN5A 3U27A 1KLMB 4DL5A 3CCTA 4FYXB 4BLGA 1T05B 2R7SA 2CPZA 2KT3A 5KG0A 2ROGA 3FSIA 1VOMA 1JQGA 4X66J 1R0AB 3VVUA 2QLJB 3D3BJ 4QPXA 1EARA 1AZSB 2ZEJA 3J80U 2H54B 4ES3A 3TRGA 3Q24A 3HT3A 2N4CA 1JWWA 1XNQJ 2CJXB 2L3MA 3HFZB 2LYVA 4M63A 4TU8A 5J1PA 4DR3J 1H98A 3T3FA 2FTRA 1U2FA 1EIYB 4Q2LA 4FP9A 1V5IB 2AJQA 1WD6A 5B0EA 4B3SF 3ZNJ1 1KD1T 3CD5A 5JVGQ 1S0MA 3M8QB 1U7LA 3NRBA 2Y1RI 2GGPA 2XMVA 3KUEA 2QLFB 4DSIA 3H2LA 3OTOF 4AXIA 5DJBA 4DSKA 4NLSA 4QBUA 2E66A 1IBMJ 4MTPA 4USHA 4Y28C 1HMVB 3GSIA 1WF2A 2W2OP 5KFDA 4ZPBA 1RT5B 3FJ2A 4TXSA 1YZ6A 4LIWA 1BQNA 4OYMA 4JI1F 3TOQA 2QMUB 2VKZG 2LQBA 2ZUAA 4O23A 4QOTA 2CQPA 2HNZB 3R97A 1SXLA 4K5RA 1RAIB 1Y00A 5DGAA 1SIWB 1N56A 3PYDA 1FDBA 1GMUA 4WYWA 3MM6A 1UFLA 2QTWA 4M5DB 1RHRB 1WC4A 4CO3A 4WPAA 3PEHA 3SSRA 2HLUA 3T1YJ 1YK9A 2BJ8A 1KQFB 5ETSA 5KT3A 1D3WA 3HFKA 3KHLA 3CJ5A 3BYRA 2W4PA 4ZITA 1K8AT 2BOAA 4FYVB 1FX2A 4RNNA 1UVKA 1CBKA 2PT0A 3N6NA 3PR4A 2GHVC 2RAQA 4R25A 3LTOA 5C2GA 1W2IA 1H73A 4X65F 4MH8A 2VU5A 1NNDA 4LF8F 2XNRA 2M5YA 2PO4A 2N4DA 3IBCB 2LA6A 3ZZ0A 2IMWP 4URGA 5I3UB 4HI1A 2YNFA 1HLWA 3B6BA 4JV5J 4KC5A 2KZZA 3PIOQ 2BEFA 3IG1A 4A8XA 4ILMA 3SSQA 3PYEA 4B3MJ 2VJVA 1PCAA 3U1LA 4CLKA 3QGGA 2QLBB 3CCMS 4AL6A 2VG6A 2IC3A 1UAWA 4A8YA 4I6WA 1TKZB 2IM2A 1QM9A 4PYAA 4ZP7A 5D0RA 3IR5B 4B9MA 4R0JA 2DNKA 3AOCA 1FDDA 3ZZOA 1HNVB 2P2CB 2XCPA 1SIZA 3CJ2A 1JLAA 4WBFA 2HLTA 1YLXA 2HFNA 5KFSA 2KG1A 3NGTA 1FJCA 2HHHJ 1DJ0A 2MXYA 3Q86A 5HVGA 5HO4A 1QTNB 4MYTA 4NL5A 1U2CA 3G6XA 1RLDA 3LF0A 2NZCA 1IWAA 2OD6A 2B6AB 3HT0A 1DRZA 1KBRA 2F4VF 4C48A 2NPIA 3EZ5A 4DV1F 4CQ1A 3HPOA 4HI2A 3A4TA 3RAXA 2AKWB 5DDPC 4DSJA 2V2VA 5IC4B 3HFVA 3BGLA 5D4NA 5F3TA 5F9LA 4X4UA 5KFOA 1UKUA 2UXCJ 3LO3A 3ITHA 2J9DA 4JI5F 3UCUP 2MLZA 4GKKJ 3PX6A 2MYFA 4FDFA 2MQMA 2HQDA 4I2PB 2AYEA 1Z2ZA 3FCVA 4NLOA 3V6DA 1ZM3A 3GWCA 4A8QA 3OFEA 1RT6B 2FJDB 1U4BA 2B4VA 1VK8A 2W24A 5KFFA 1NDKA 4URQU 1RJJA 1W7WA 3NXZA 1CS4B 2G13A 2ZUGA 3K57A 2M88A 3CCES 2XZDB 3IM9A 2AX0A 4K4VA 3VWSA 2RHQB 1S99A 1YZ7A 3A3NB 1FXRA 2WTFA 4FXVA 4IH6A 5ETKA 1Q53A 3KLEA 2HNYB 4FS1A 3AY0A 3PRVA 2V2ZA 4NXMF 3HHKA 1HWJA 4YB5A 4PG4A 3QWUA 1HNWJ 4ZHRB 2XQCA 5DLFA 1JXVA 4DR5J 2ZOFA 2K8GA 1P9YA 1YI2S 4DR4F 3QATA 3G6VA 4FF1A 4LR8A 4OYZA 1Y7PA 1AROP 4B3RJ 4GO7X 3W65A 1F3FA 4YUDA 4LR7A 5A76A 4CYUA 3VZIA 2W25A 1U6BA 1M5HA 2CUYA 3DLKB 3QRPA 3HVTA 1Q0NA 1PJ5A 3WZ0A 2Y8YA 1JIHA 4LFAJ 2Y3YA 1C4AA 4PEOA 4ERDA 4OHVA 2AWZA 3NMAA 1WC6A 5HSPA 1V5VA 2ZBIA 4OHXA 1RHMB 2C1EB 4UW2A 1Q4RA 4L6V3 4HVZA 1CQNA 4CIOA 4EBEA 4IDKA 2XSFA 3IWNC 4KHRA 1HW9A 5HK4A 1TKTA 5AXMA 3CWJA 4MFBB 2ZE2A 1WG5A 2M2BA 3AD7C 1ELOA 2CAJA 2X3DA 3TEHB 2AGPA 4F67A 5IT4A 1R31A 1LK7A 4Q45A 4YB7A 1ZETA 4ED2A 2ZNYA 1Q5VA 3MFHA 4DI6A 2RSQA 3NG8A 4ETZA 1JLBA 5AE3A 4FBTA 5IM0A 2XC9A 4CLLA 3EJMA 2EFNA 5D4LA 3OPKA 5KFEA 4PXCA 1Y9OA 3R5DA 2W4CA 1SL1A 4DPYA 2GVDB 2VC1A 5KFLA 3BREA 1HNIA 1S1TA 4DCOB 5HL7Q 4OLOA 4XK8C 3EDRB 1LWEB 3GV5B 3OL6A 3SV4A 5KG7A 3VF0B 3HHLC 2F8MA 4O44B 2WBRA 2PC6A 2YPZA 1K1QA 2Z2LA 3RRHA 2RILA 3K89A 5IS2A 1EP4B 1HBMA 3T9ZA 2DRBA 3OJUA 3PACA 2PMZD 3QSYB 5HLFB 1RKJA 3FCWA 3C15A 1U1PA 4LT6A 2YPYA 4C98A 1TK0A 1QY7A 3DGVA 1UJ5A 4AQYJ 2OPSB 2IA6A 4JUZA 1E6VB 1OJ4A 3VAIA 3T5LA 4DZDA 2IIHA 2CIMA 3DNCA 5FDLA 1T11A 1WEZA 1S0NA 1NHVA 1FJEB 2UUTA 3V5RA 1NMEB 2W9CB 4QWAA 5F8IA 3D28A 3H4DA 1ICEB 1ULRA 4LFBF 1BQMB 1GT8A 5KFRA 1YX2A 2ACMA 4OLPA 4DQPA 3HCXA 4ANDA 1JLEB 1HHQA 4Y65A 2H3EB 3GJQB 4DUZJ 2J8AA 3O3LA 2ALZA 1L3VA 5LMUJ 4OYPA 3FZBA 4Q43A 4LSZB 3KDOA 3ZTRA 1VJQA 2AD9A 2HVHA 4ZP6A 1RAHB 4E2FB 3BF4A 4O4GB 4WU3A 5I42A 1UEKA 1GXTA 3RG6A 5GMEA 1LV5A 4KR0B 1X0PA 4DPXA 4ELTA 3GG1A 3KLHA 3W9JA 1XR7A 2HFSA 3MMAA 2X3GA 2RT3A 1BY9A 4ED1A 2DNPA 2HHXA 3H2VE 4JBCA 2DGVA 1OMSA 4HHUA 3JSMA 3NOGA 3Q8UA 1QSYA 2LCWA 1X7VA 4TY8B 4NMXA 2F63A 3RTVA 1G7CB 4MIWA 4Y00A 4QIWD 1X4DA 3SV3A 3WHIA 1C1CA 4YP3A 3KMQA 3IGVA 1FJ7A 3VAKA 3H90A 5LXRA 2XBPA 2QL5B 4NI2B 2K1RA 2V4RA 1RUSA 3TANA 1KFDA 4PZVA 3QFWA 4WTOB 4IFYA 3R8YA 4DZ6A 3GIRA 2VONA 1HNXF 1NCLA 3H98A 2E1RA 1N5YA 3UDLA 2N7CA 1B3TA 1S1XA 2VBWA 4FXWA 2WW8A 4F3MA 3MEKA 3MAHA 2YNHB 5E3QA 3R2DJ 1U24A 2I8EA 3VZHA 1F5AA 4QW9A 2HRUA 1D9AA 3EGWB 5B09A 2DCUB 3CD0A 3QO9B 1IR0A 4Q5VA 2UXBJ 2HMIB 2J7KA 4ED4A 5IC6B 4P74A 4RZRA 2D3O1 2KVIA 4G3IA 2CWKA 1K44A 3MD3A 2YKMB 3EDQB 1KVJA 1TAUA 2RDIA 3PJXA 1JLQB 3UE2A 2UUBJ 1U8WA 4EYHB 4NCGB 5IFMA 5G0RA 2DCLA 4L75A 3SCJE 4DOZA 3RBZA 5J1EB 3GCXP 4K4ZA 2UV8A 4PYDA 4LF4J 4IFVB 2Z56B 4ELUA 3NS7B 1CJVB 2UVVA 5CD4A 3A13A 4AL7A 1S9FA 4DL7A 1IBLJ 2VFVA 3CJKB 1RHKB 3A3PB 2XYPB 1MG7A 1OQ3A 3M05A 2Z2MA 1C0TA 2E29A 2XMWA 4YHHJ 3QLHA 2OPQB 1RAFB 5D8HB 3AA8A 3O44A 1F60B 1HBUB 2W7AA 4OJHA 1HD0A 2C2RA 1HPZA 1S59A 1JLFB 2M4MA 3UR0A 5LMNF 1RKIA 2HHWA 3D2WA 4NE9C 1X4BA 1FWKA 1U1OA 2DHXA 2LEPA 1NJYA 2UUCF 3L7OA 4W90B 3KXDA 1UMJA 1G4CA 1KHWA 5LJ3Y 4B3OB 4DV2J 4WK3A 3OR2B 2R7XA 2XSJB 1TUWA 3OTEA 1RAEB 3ZC4A 4J9QA 5K14B 3I0SB 3MEGB 3CB4A 4ED3A 2XI3A 3MECA 4ANCA 2MGZA 2W9AA 2R2SA 4I6AA 3MUMP 1LK5A 1HKAA 2FJVA 4ZS6A 1U1QA 3M8SA 1YRXA 3D6MB 2W4DA 5BR8J 1HIYA 1VBXA 1RHQB 2UVUA 1UEVA 3CSKA 2XWYA 3BV8A 3NEKA 2ZH4A 5B0DA 3G6ES 3RW6A 1XJWB 2KJWA 4YDXA 3CJTA 3BBFA 1Z4UA 2XNQA 2DHGA 5D0HA 4JV0A 3RGIA 1CLFA 4TNOA 1LW0A 3MPWA 5K5MA 3WBZA 1S48A 1UA0A 2FHKA 1GMWD 3ZZPA 4NZ6A 4F04B 4LMZA 4N8NA 1RT1A 3K17A 1FKOA 4NLYA 4U6PA 3RYLA 3GFZA 4JV1A 5KFJA 4CLFA 3N6MA 1BWVA 1NH7A 3QZ7A 2XM3A 1R8AA 5GMKa 3BH7B 1S6PA 2BJEA 1T9TA 1Y11A 4KHPJ 3CMQA 3IXQA 4K59A 4P75A 2OTLS 1O5JA 3FQKA 1RT4B 2ZH8A 4RW7B 3CC7S 2FHOB 3MR5A 4NZ0A 2RRNA 4YY3F 1KOOA 1M1KT 3MMCA 1X5SA 2FLPA 2WCXA 3EPGA 3PV8A 2C2KB 1JNRB 5KFXA 4CM2A 4ED8A 4TVAB 1TKXA 2MZJA 1SH3A 1NO8A 2V9WA 3QRQA 1F9EB 2ZH7A 1Z2LA 2IJRA 4KGKA 2AEFA 2R7QA 2K7JA 4IH5A 3TA0A 3P49B 3FEZA 3ZO7A 3F73A 5KFVA 4U7UD 2MHNA 1OSCA 4ZCIA 1TQLA 5CYQB 2RB7A 2CDRB 2YNGB 4YN3B 5KG5A 4XIUA 2ZKTA 4USIA 4DJBA 3MXHP 3G87A 4RBTA 2BV3A 2FB0A 3U1NA 2DISA 3FRYA 1WEYA 1VQPS 3ZFVA 1IKYA 3UR3C 3THPA 5HQMA 1NB2A 4F4XA 4PUOA 4KSEB 4DG1B 5A6WA 2AJ0A 4KH1B 3GR1A 5ETNA 4LQ3A 2DIVA 2CQBA 3MUTP 1NRKA 3WIVA 4ED0A 1N33J 3CUNA 2OPRB 4CH0S 4WKYA 2NYHA 4DV0J 2DNRA 5ADZA 3HLUA 2QFIA 5ETVA 4X66F 2H4WB 1N5SA 4ZVSB 1SKWA 2GHWA 1YJ9S 4WCEQ 3MM6B 1RK8A 3AJ1A 1FK9A 5EWEA 1XNQF 1ZPWX 5AT1B 5K20B 4HKQA 3W5XA 2XMTA 3DOLA 3AB4B 1FX4A 5M2RA 1AW0A 3VGSA 2EBGA 1X4CA 3QAUA 1BMQB 2AJ2A 1UWBA 2JC0A 3CJ4A 3PW2A 3G8TA 3VAFA 2UUWA 2NUHA 3KJFB 1KDNA 4UOGA 4ZJLA 1LKZA 1FFWB 3LANA 1K1SA 2ZJRQ 4LF6J 1RWKB 1ZPVA 4PG5A 2OPPB 3MEEB 3CCZA 1HWLA 2X1BA 5F8LA 3IRXB 2ALYB 2G0CA 5EX3A 4YB1P 1D0EA 3IC1A 1FESA 2OAUA 2ABYA 1R3NA 3TA2A 3S01A 1EETA 4ZVTB 3I4HX 5CAAA 2RE1A 2E5LJ 4KFBB 2UU9F 2W9BA 4MKVA 2P5VA 1VC6A 2Q79A 1HI0P 3HKWA 2DEJA 2GA7A 5T41A 1WEXA 4JOUA 3I0RB 1U47A 1RT2A 4OMFG 4FBUA 3JTNA 1S1WB 1U26A 3FBEA 2D69A 2VG5B 3V81A 3MPDA 3DFEA 4IO9Q 2UZAA 3BKTA 2CRLA 3X3UA 4RR5A 5KFPA 2PA8D 2JLGA 3EVWA 2WZ1A 2JEIA 1DTTA 4PG7A 4MT1A 5BXIA 1TELA 2YNIA 2HRTA 4N41A 1NAQA 2GIQA 1XMBA 5IOLA 1VQNS 4DV6J 5ETPA 5EWFA 3EXYA 2NCKL 2EK6A 3NNCA 1HQEA 2B5JB 3ITHB
chains in the Genus database with same CATH topology
1LW2A 2CQ2A 4TU7A 1VQSA 1H6KX 4LJMA 4C0HA 4AUKA 3MR3A 2GMHA 2KFZA 1KQGB 5F0UA 4FVCA 2MZ1A 4OX6A 4ZPWR 3FQLA 2LQ9A 1UJ4A 4YR3A 2R8IA 4WFBQ 3R1HA 4Q2MA 4OZ5A 4OI6A 1QSSA 1RWUA 4DBQA 3CDUA 3IAM9 4MFBA 5K8PA 4WU2A 4F4ZA 3C6UA 3D0IE 5EUHA 5I4MA 4RWWA 1VJWA 1J5OA 4FS2A 1ZBTA 3UD3P 1Y5LB 2R7RA 1DLOB 4A8KA 4B3MF 4IG3A 1FTCA 1WACA 3M6XA 3IR6B 1WELA 1WWHA 5E41A 3PEJA 4PQUA 4ZK7M 2CZ4A 1Y0HA 3GFXA 3KK1B 2O3DA 1YIJS 2A3JA 2FJAB 4LVOP 2WONB 5U47A 4NA3A 4PWDA 2FVCA 2KFNA 4ZCKA 4IR9A 2PDAA 2ZOMA 3R1LA 3CC2S 3N6LA 4WZMA 2LXUA 2D41A 3AJ2A 2DTJA 5EX0A 2BANB 4OI0A 5LXYA 2NSCA 4Q7AA 4Z2XA 5CCMA 2FJXA 1FVQA 2ZM6F 1GXUA 4K4WA 2CJ9A 3V6JA 1H38A 3R5BA 2BJDA 4OZLA 3VQSA 2GFFA 1YBAA 4KRWA 3TUJC 2X1AA 4A8WA 2OO4A 4BDPA 1AXQA 4QQBA 3HVAA 4JI8F 4EO8A 3C6TA 1HBNA 4NLWA 2GMLA 1U25A 3BM7A 1VLYA 1F9FA 4ED6A 2HGNA 3T5HA 4A4JA 3LP1A 2IJNA 5A8KA 3MWBA 4RLEA 5FD1A 4NWBA 4C11B 2XLKA 2XS7A 3OXLA 3KKFA 3TAQA 4P7TA 3GYXB 1WTBA 4DS4A 3QJPA 2DR7A 1QUVA 2ZHOA 1KLNA 4IKAA 4H4KA 3IFEA 4NPOA 4ZPCA 3QMQA 3OFGA 4CH7A 5J2MB 2F9DA 2OFGX 1YG0A 1MW7A 2CG4A 3IGNA 3PO5A 1SUQB 2UV8G 2IVFB 2VPZB 4OI1A 2QLWA 1MROB 2B9XA 3DI6B 1HWUA 4AL5A 4KGMA 5CYMB 2R2TA 1C0TB 1UW4A 4IRDA 3GQCA 3LAKA 4RW6A 1S0VA 3QLHB 2VFSA 4WKRA 2ACYA 2HHHF 5IQQA 2CQDA 5EGYA 1VC5A 1TVRA 1IM4A 3N79A 1HHTP 3I82A 2O1PA 3J7YI 1M90T 4B9LA 1URNA 2V2KA 2HAIA 2CJAA 2WK4A 2YWHA 4IG0A 5BYQA 2MQLA 3UCGA 4DQSA 1HI1A 2IM3A 4U7CA 4G1IA 4LIRA 3MTKA 3PRBA 3KK3B 3DOKB 3IS9B 4OJ1A 1NKBA 5LSRA 3QIPA 2JFDA 3NGDA 2JFKA 1FDAA 3E3XA 2HWTA 1EP4A 3F41A 5EHHA 4R5PA 2W8LA 3NMRA 3DRPA 2IRXA 4ZDNA 4X2BA 1RT7B 1C1BB 4J9OA 1M0SA 1U6FA 3LAMA 3MEDA 3S6EA 2M70A 4ZMMA 5HROA 1FRKA 5EWGA 3OTCA 1Y3KA 5HLFA 3MM5A 2FIUA 2BE2A 3IWLA 2XMUA 3I4PA 4G1PA 1VQ5S 2M8DB 3H5XA 2CVEA 4RW8B 1X9MA 3NGKA 4V19X 1ZH5A 2UXBF 5CH7B 5H1SV 5CCLA 4RBVA 3W2WB 3OLBA 2FLNA 5CZVA 1NH8A 2LU2A 2DNMA 4PWUA 2J7UA 2NXUA 4G1QA 5THWA 1VQ6S 2CPEA 3EGNA 4DV3F 1W2BR 4F4KA 5D3GA 2IVMA 3IN5A 3U27A 2G1DA 1YJWS 1K73T 2FC9A 5J2NB 1KLMB 4URSA 5HQ8A 3CMAS 1S6QB 4DL5A 3CCTA 1X0FA 5H9FJ 4KTQA 3U1MA 3M30A 3M8PA 1NHUA 3LP2B 1GNKA 4EO6A 3OVAA 1T05B 2R7SA 2CPZA 2HRYA 1E6VA 2KT3A 2J0WA 5KG0A 2VFTA 4DL2A 2ROGA 2EI5A 1M5VC 3DLJA 3FSIA 1RYRA 1VOMA 1S6UA 3LALA 2MDAA 2ROPA 1R0AB 1RTJB 5C42A 4B17A 1MWYA 4CZCA 4F8RA 2EW9A 4QPXA 1L3KA 2KG0A 4ES3A 3EZUA 4QZVB 3TRGA 3Q24A 3HT3A 2DGSA 2N4CA 5LSLA 2RQ4A 2ZH5A 1KONA 1HBOA 1JWWA 2W9CA 5KFBA 2NQPA 2L3MA 1YJNS 2Z8QA 3BSNA 3K5PA 4NMLA 2MGZB 2VKRA 3TQ1A 1R8PA 4LF4F 1VGYA 2LYVA 2M9KA 5ITHA 4M63A 4H4MB 4IH7A 4TU8A 5J1PA 1H98A 2J9EA 3HHLA 3R5AA 3T3FA 2FTRA 1U2FA 4TKTA 4Q2LA 1FEEA 4FP9A 1IKWB 2DNOA 4C9DA 2J76E 1BQMA 2AJQA 4XPEA 1XWLA 1WD6A 2KTQA 2DNNA 2RU9A 5KFHA 2XZWA 5B0EA 4WYLA 4B3SF 1S9GA 2JZ5A 3H59A 2BRLA 1KD1T 2JHEA 3CD5A 1JLEA 2P9EA 4BHQA 5B0CA 2MKCA 5JVGQ 3KG4A 4RW9A 1S0MA 3NWGA 3PDNA 1IBLF 3M8QB 1YTYA 3FVYA 4HEA9 3V6HA 3QAEA 1U7LA 1HNWF 4BS2A 3NRBA 3WDOA 4YHHF 1IN0A 1QUPA 2Y1RI 4UY8T 3DYAB 3HKZD 1MMDA 2GGPA 4BBYA 1SJRA 3CGIA 2XMVA 1O0PA 1U48A 4DL4A 4DQIA 3IO1A 3KG0A 4NYOA 3KLIB 2QSWA 1QAJA 4DSIA 2UXDF 3H2LA 3OTOF 4AXIA 1JLBB 5DJBA 4DFKA 3CCSS 4DSKA 4NLSA 1KHVA 1LW0B 4O4GA 1WHYA 4DR5F 2X1GA 4QBUA 2E66A 4MTPA 2ZOGA 4KO0A 3SMZA 4YOEA 1R43A 4B9VA 4USHA 1S7HA 4ZA1A 4Y28C 4GC6A 3P3DA 4CI0B 5KT3A 3M9NB 2WAQD 3IWXA 2RF2A 1HMVB 1RGVA 3OHBA 1F5CA 1SJQA 1WF2A 3B4DA 5KFDA 2C3OA 4ZPBA 1QAIA 1TUVA 1RT5B 3N01A 3FJ2A 1M5SA 1XERA 4TXSA 3QGHA 3TA1A 2DRAA 4LIWA 3NBPB 5LL6d 4YMEA 2E9RX 1RT1B 1RTIB 1S1VA 3BN4A 1BQNA 3OL7A 1FKOB 3POTB 2P6TA 3IAS9 1XR6A 3HXMA 2Q43A 3MMJA 4JI1F 3TOQA 4CTAA 2XMJA 1YRTA 4IYQA 2VKZG 2HQIA 2V4JA 2V9KA 1SV5A 1JLGA 3GIIA 2ZBCA 3KHGA 2AW0A 2LQBA 4A46A 4K4TA 3VALA 3LP0B 1RYSA 1JLCA 2CQHA 4JI0F 1NKEA 1VQMS 4O23A 4QOTA 2CQPA 2HNZB 3K7RA 3PHEA 3FFIB 1JXLA 4J9NA 3ISNC 1S6PB 4NLRA 2CPXA 4DV2F 4ES2A 2Z0GA 1VQLS 1SXLA 5KFCA 3M2RA 4DHVA 4K5RA 3GV8B 1Y00A 5DGAA 1SIWB 1FJGF 1N56A 2GC8A 3OTBA 3CO9A 1X5OA 1XMQF 2E5IA 4A8MP 3GSDA 1FDBA 1KSPA 4WYWA 4WXOA 1QE1B 4UQGA 3RBDA 4K4XA 3CCUS 3MM6A 4KT0C 1UFLA 1RQ0A 3PRDA 4M5DB 5KT6A 1OPIA 5AJ3F 4CO3A 4Y0FA 4ID8A 2D1CA 4DQRA 2PD1A 3PEHA 2N7YA 5IWAF 3SSRA 4WFXA 3FSYA 4OJGA 4GMKA 4YFUA 2HLUA 3OR1B 5L8RC 3E01A 4RBUA 2PSZA 1KQFB 2MMYA 3BZQA 4NX9A 3MMCB 5DO2A 2RVJA 1D3WA 1DTQA 2JWNA 3CIZA 3HFKA 5D4OA 1YITS 3KHLA 3CJ5A 3CMES 4QU6A 1PILA 2FD2A 2YKQA 5H9EJ 4DUYF 2VFUA 2W4PA 4ECYA 1K8AT 1X5TA 4RNNA 2OIHA 1UVKA 1A6LA 5BR8F 4FNHA 2PT0A 5KFIA 4J9KA 2R7TA 3N6NA 3ZZUA 5F8HA 3PR4A 2EG1A 2PFFB 5SUHA 3DC2A 2D74B 2GHVC 2B4PA 2E7XA 3MCSA 4Y2KA 3OLAA 4MKAA 4QR0A 4R25A 1TKXB 1J2VA 4F4YA 1W2IA 2VFRA 1O8BA 4QW8A 2ADCA 3QJJA 2NR0A 4X65F 4MH8A 5HMZA 3GIKA 4DLEA 4DR6F 1LOUA 3QPIA 1S97A 1NNDA 1KTQA 4F4WA 4LF8F 2YNHA 2D3OR 2XNRA 2M5YA 2BYCA 2IMOA 2PO4A 2AV5A 4ZCLA 3J81Y 4Q8FA 4MKYA 5GAEU 1VQYA 2AP6A 3M4XA 2N4DA 3FSXA 2LA6A 3BDPA 3ZZ0A 4UY85 1U1NA 3G96A 1QAXA 3DM2B 2WB4A 2DO0A 3N4WA 2IAJB 5E0OA 4URGA 2IMWP 3KLGA 5E33A 4C8NA 4HI1A 5I3UB 2IM0A 5CQGA 3MM9A 1U45A 5KFQA 2YNFA 2DJWA 2IBOA 3CPWR 2HHQA 1U1RA 5AE1A 4IO1A 3TAMB 5D4PA 3UI3A 3BO3A 2RQCA 3HVRA 1F5BA 3MM7A 4KC5A 4OFZA 3I32A 3TARA 5IXUA 2KZZA 4PRFA 3M32B 1ZZFA 5JVHQ 2ILZA 1Q8IA 1C0UB 1S1UA 1MSWD 3PIOQ 1U09A 1FNOA 1UL3A 3IG1A 4HL9A 4A8XA 4ILMA 3SSQA 5D78A 2BR0A 2CPHA 2HMIA 5F3ZA 1GTHA 3T1HF 3T19A 2WOMA 3OBIA 1H2VZ 4ZP9A 3P96A 5F8NA 3S1TA 2ADBA 2VQFF 3B78A 3U1LA 4WE1B 1L3SA 1H2UX 4DF8A 2LDIA 5G4DA 3BJYA 3QGGA 1TL3A 5GAGU 2A2CA 5KFTA 4DSLA 2JSXA 3CCMS 5FJ4A 5DG7A 3QJLA 3KLFB 1IKYB 4QR2A 4AL6A 5CZXA 3N28A 1X4FA 2VG6A 3SQGB 4CO0A 3UPFA 2IC3A 2YKMA 1T03A 1UAWA 4A8YA 3X1LB 2MKJA 4I6WA 1TKZB 2IM2A 5BYSA 1NJZA 4DPOA 2QO3A 3DRRA 1S72S 1QM9A 5KG6A 4ATNA 4Y2CA 2F40A 4PUOB 1JLQA 5IT0A 1KTVA 1XN9A 4ZP7A 3TO8A 1A9NB 4OZNA 3IR5B 4B9MA 2M8HA 4R0JA 3HI9A 3V4MA 2DNKA 1BLUA 2DK2A 2K3KA 1FDDA 4RKUC 3ZZOA 2XG8A 1HNVB 2FVPA 4IR1A 2KZMA 4NCGA 4BC9A 4DX8H 2XCPA 5KG3A 2PE8A 2CDQA 2L08A 1SIZA 3CJ2A 2QEXS 1JLAA 5BYRA 1RTHB 4Y3CA 4OZ1A 3RR7A 2HLTA 3PJWA 2HFNA 4ECRA 3FEXB 4CH1A 1UETA 4FVMA 1S79A 5KFSA 2KG1A 3EYZA 1KQSR 4IFVA 3RB0A 4DFPA 4NLXA 3DN9A 1U1KA 3MOZA 4P6QA 4AQYF 1FJCA 3VCDA 1DJ0A 2MXYA 5DQGA 2DGTA 3G8SA 5HO4A 3HK2A 1FKPA 2R2UA 2DR5A 2DT9A 4MYTA 4NL5A 4RUHA 3G6XA 3FRZA 3R3TA 1ZAVA 3HDSA 4PCQA 1HL6A 4AE5A 3RB3A 3LF0A 1ZM9A 2J6SA 2N3LA 3OTDA 4K0KF 3L3CA 2I0XA 2KN4A 2C3MA 4N56A 2ZD1A 2OD6A 2B6AB 3JSRA 1KC8T 3MPYA 1DRZA 5KG1A 2KYZA 2F4VF 1VS3A 4CT8A 3CJKA 2ZH3A 4DR1F 1N48A 2NPIA 3EZ5A 1IKVB 2P9CA 1LWCB 3SDEB 2YWFA 5DGBA 4DV1F 2VC0A 4CQ1A 3HPOA 1P27B 4HTJA 3DRYA 3MOJB 4HI2A 2HS0A 2CYYA 3M2UB 5DG8A 3PW0A 3T1AA 1FK9B 2OPQA 3U7JA 1YVFA 2JEFA 3RAXA 2B0GA 1JK9B 1N4LA 2EC0A 3MZIA 5DDPC 5J2QB 1MNEA 4DSJA 4QR1A 1ZZNA 4H4OA 4MK8A 4QIFA 4R8UA 3V6KA 1UFWA 3BGLA 5D4NA 4DN0A 5F3TA 5F9LA 3OJSA 3IRWP 4X4UA 5KFOA 1UKUA 3LO3A 3ITHA 4I1TA 5B0GA 4B9NA 1SL0A 1VBZA 4JI2F 2X1FA 2J9DA 4OX8A 4JI5F 3UCUP 1HHSA 1U1LA 2MJNA 2OMLA 3PX6A 2HYIB 4IFYB 4EGLA 1B7FA 4NZ7A 5M2PA 2MYFA 4F02A 2MQMA 1JLFA 2X51A 3HM9A 1S0OA 1Q86T 3ZZYA 3AQPA 4DN9A 1X4AA 2VZ9A 5KOXA 4LSLA 4I2PB 2AYEA 5DQHA 1Z2ZA