3IWXA

Crystal structure of cisplatin bound to a human copper chaperone (dimer)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of cisplatin bound to a human copper chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Copper transport protein ATOX1
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iwxA00
1X0PA 4NPOA 1QUPA 3K7RA 3T9NA 5B0CA 4YEAA 3QGPA 4FNIA 2KKHA 2QYCA 4OJHA 4F67A 1N5TA 2BYCA 2OFHX 2AJ1A 2K1RA 2LQBA 4OJGA 5B0GA 2GV1A 1K0VA 1KVIA 1S6OA 2GO8A 2EW9A 3DXSX 1Y0HA 4A48A 5A6PA 1Y9OA 4ZA1A 2RU9A 3BM7A 2BJEA 5F0UA 1MWYA 1U7LA 3KG0A 5B0EA 3TNVA 3CJKB 2HQIA 2VV5A 1CPZA 1AFIA 2K7JA 5B0AA 1CC7A 1FE4A 1TL4A 2AJ0A 2RMLA 3WDOA 1FE0A 1Y3JA 2IYGA 4Y2IA 4Y2MA 1OPZA 3LO3A 1V3ZA 3IWXA 2AW0A 1SI9A 1GXTA 2PGCA 3KNGA 2FHMA 1TZ0A 2BJDA 2K1RB 1JK9B 1YJTA 1P8GA 4DPOA 2XMJA 1Q53A 3HHLC 1TR0A 4HI1A 1OQ6A 2OD4A 3KG1A 1X7VA 3KKFA 3LGMA 4Q2MA 2HLUA 1OSDA 1JWWA 1CC8A 1FVSA 4EFAC 2OMOA 1N5QA 5B09A 3LGNA 4HI2A 2OKQA 1Y3KA 2LDIA 3IWLA 2ROPA 1N5SA 3HHLB 3MCSA 4ZOSA 4YDXA 1W2IA 3HDSA 1AW0A 2OAUA 3VTIA 2K2PA 2RILA 3FGVA 4HL9A 3HX9A 1Q8LA 3BF4A 2K7KA 4Q2LA 1VQYA 2ASYA 1APSA 5K9FA 2HLTA 2FB0A 4OIXA 3BGUA 2W4CA 3CJKA 1GXUA 1SQEA 2ACYA 2GA7A 1S6UA 1N5VA 1TL5A 4DL0C 1XBWA 3HFKA 1ULRA 2JDJA 3HHLA 1YJVA 4OJ3A 3HHLD 1FESA 2LXFA 2OD6A 1P6TA 2BBEA 2N4DA 1Q8BA 1X8DA 2RSQA 2ZDOA 1MWZA 2GGPA 3MZIA 4A46A 2IFXA 1URRA 2XMVA 2ZDPA 2AP6A 1VQSA 3E8OA 3FRYA 1R6YA 2GGPB 3HF5A 5B0DA 3BR8A 3I9ZA 5KAKA 2KYZA 1YG0A 1RJJA 2PD1A 2ROEA 3TOQA 3BN7A 4A47A 1WD6A 1OQ3A 2QLWA 1SB6A 2OP5A 2N7YA 2XMWA 5T7LA 3BDEA 2G9OA 2HIQA 1KQKA 5B08A 2FIUA 5B0FA 2GCFA 4U9RA 2HFOA 2VH7A 4QOTA 1FVQA 2XMMA 2QLXA 2XMUA 3FMBA 3GZ7A 4HH0A 1KVJA 3QMQA 2FTRA 3BB5A 4NL5A 5A6WA 2W4DA 1Q4RA 2Q3PA 1LQ9A 1TUVA 2XMTA 3F44A 2OFGX 1IUJA 1AFJA 2IYIA 4HH1A 2BUNA 2XMKA 2L3MA 2KT3A 4Y2KA 3UDCA 1YJRA 1YRXA 2LQ9A 4FNHA 5T7LB 2W4PA 3DCAA 4OJ1A 5F0WA 5B0BA 4A4JA 5IXUA 1FEEA 4DN9A 2CRLA 1FD8A 2GFFA 2HFNA 2N4CA 3TRGA 2QIFA 1YJUA 2ROGA 2KT2A
chains in the Genus database with same CATH superfamily
1WC5A 2Z4PA 1TK8A 2LQ8A 4DV6F 2YY3A 3ELHA 3OTEA 5KFTA 1RXOB 4OI1A 2QYCA 4OJHA 4RLEA 2HURA 2IJNA 1G7CB 4JB8B 1VR6A 2OPSB 3NWRA 4G1IA 3OHBA 1ZAWA 2ZOGA 1JLGB 5A6PA 2FVQA 3M8QA 1Y9OA 1BD6A 1VBZA 2V6AA 4WTYA 3G6ES 4NLWA 2FJVA 3M2VA 1RT5B 4B9UA 2FQQB 5ETVA 2PO4A 2D9OA 1S7IA 1NM2A 5A8WB 2AJ0A 3H2VE 2OEMA 2H5JB 1UJ6A 4O0IA 5GADU 4ZLPA 4FYWB 1T02A 1NMEB 3RRKA 2C28A 2RS2A 4UOFA 3CC4S 2AW0A 3V81A 1NXIA 3DM2A 4M5MA 5IM0B 3QNWB 4ES2A 5DQGA 4OHWA 1TV6B 4NZ0A 5J1EA 4F0MA 2WZ1A 1K1QA 4Y2CA 3QSYB 3DDNA 3X3UA 3MPWA 4RUBA 3LGMA 3ZO7A 2OTLS 3D5MA 1OSDA 3ZZTA 2VU5A 1HNVA 2EBEA 2YQ1A 2Y1LB 5HVFA 2AGOA 4EBCA 1VQ6S 1SIZA 2ZZMA 1Q78A 1NK0A 2G0JA 1QE1A 4ZN3A 4ZOSA 4DDFA 4MIAA 5F8HA 1NBEB 2I5JB 2HQGA 1M0SA 2BV3A 3R7BB 6FD1A 2K2PA 4ZPAA 3MR7A 4RNNA 4IOAQ 2B5JB 1D8YA 2OMLA 3M6VA 3R5GA 5D3GB 1Z1ZA 3BKFA 2J9EA 2BACA 4OYAA 3OVBA 2MLXA 3W66A 1QSSA 3HSZA 4OI6A 3SFGA 2R8KA 3FUYA 1AT1B 4K5SA 4JV0A 1SQEA 2OH2A 3GFHA 2ACYA 1QM9A 1NHKL 4JI8J 4DMZA 2RT3A 3H98A 1OYEA 3NCPA 5A0YA 3CCRS 4DL0C 4F7VA 2C2RA 3A3OB 5BYRA 1XMBA 4Y28C 4Q44A 5KFKA 4E2FB 4C3KA 4KR0B 4NYOA 1IBLF 2QSFA 1L3KA 2FY1A 1RBLA 4H4OA 2MYFA 4ECZA 4CQ1A 3Q8VA 4NXMF 3NS6A 2MMYA 1H2UX 3CJ2A 1CJVB 3CO0P 4LSZB 2KO1A 2R8IA 1BQNB 1R6YA 4RNFA 4B3SJ 1YHQS 1FRJA 2H65B 1RJJA 4O3OA 1NHVA 1Z2ZA 3NWGA 2DGSA 2XHWA 4X4UA 4FZVA 2KN4A 4H4KC 4J9KA 1P1LA 4F26A 3QGIA 1FTCA 2E1CA 2JEJA 4ED7A 5FLXY 3RB4A 4TU9A 2FIUA 1S6PB 2EFVA 3MPYA 1X5TA 3HKZD 4WE1B 5JVGQ 4CO2A 1TKZA 2H3EB 3R5AA 5F3ZA 2WONB 1R8CA 4MYTA 4ZK7M 1CULA 1SJFA 2F3JA 2J8SA 5GAEU 3CCUS 2RKIB 4DFKA 4DG1B 2W25A 5J2PB 1U6FA 1KS2A 2B56A 3OL6A 1S1XB 1X4FA 2W7AA 3V2UC 2MXYA 4ATNA 2DR8A 1RT6A 2YQ3A 4J9OA 3SV3A 3HLUA 3GIIA 1O8BA 2WW4A 2EK6A 4JI7F 3VAIA 4CLWA 4GKKJ 4J37A 5C42B 3NOCA 2ZC3A 4KT0C 4LREA 1KHWA 2DNQA 2FHJA 1BWEA 2BOAA 1CG2A 3T9NA 3MR3A 3V6DA 2J0QD 2U2FA 1PBAA 2V4JB 2AHOB 3MAQA 1ACMB 1SC6A 2WW8A 1S6OA 4ZVUB 4Z37A 1SH0A 3HM9A 4LRDA 1NB2A 2HG4A 2B9WA 2W9CA 4DR1J 4DQQA 5HROB 3D54A 3RJMB 2BJEA 4CLFA 3VVUA 1U7LA 1RTDB 3G71S 1RAOA 4C48A 3CSKA 1DTTB 2DPJA 2KZMA 3EM1A 5K5MA 3ILJA 1TL7A 2V2VA 1RGVA 5LM7E 2JEFA 4JI0J 1K0TA 3IWNC 3KK2B 1D8ZA 4TQRA 4WJBA 2YKAA 4WTOB 4P52A 1NH8A 4NEYA 5CD4A 1J2VA 1GAOA 4NA1A 4DS5A 3QAUA 3W8PA 1F2GA 4HEA9 3DLGA 1GQEA 1Q5VA 3F41A 2I1RA 2YH1A 4TYBA 2K1RB 3TUZC 1G1XA 3QQCD 3I5BA 3JTPA 1XMQF 2M8DB 2NUUG 5KFVA 3DKDA 4PG8A 4Q43A 2EKYA 2IBOA 4FN5A 5IT4A 5D4NA 4F0KA 4U7CA 2OMOA 3PHEA 3W5YA 4DF8A 1RBAA 1LK7A 2Q43A 1NDPA 2YPYA 4X4PA 2RNEA 3HDSA 1GK8A 4ZLLA 3SSQA 1VRTA 2RILA 3MM5B 3KFWX 3VQSA 1VQ5S 4A8FA 2XSJA 4JUZA 3VHQA 3PYEA 5FDLB 4ZCKA 1IKXB 3PX6A 3NS7B 3HKWA 4XAKA 1JLQA 3I87A 1QAIA 2DB1A 1TL1B 2EK1A 3H20A 3PV8A 2DNZA 1S0OA 1HYSB 2HHPA 3QT5A 2BW2A 2G4BA 1XIQA 3J7YU 2ZH3A 1OJ4A 2Q79A 5ITHA 2Z0GA 4KBIA 3CT9A 1F2HA 4H4MB 3HJVA 2ZJQQ 5IV3A 2X3DA 2YNIB 1IR0A 3DRPB 2VD3A 2LA6A 3O2IA 1VYAA 1YJVA 4ZVRB 3DN9A 4NE9C 2J5AA 3BGLA 1NEEA 3ETOA 4HHHA 2MLZA 4LQ9A 4IG3B 3NLCA 4P9SA 2MDAA 3FBFA 1X0FA 2Z2LA 4KC5A 4L75A 4QIGA 3CD6S 4OZLA 4Z7YA 4R25A 2FJWA 1OMSA 4JI1J 2AP6A 1A6LA 4OX7A 4AL7A 2Q1LA 4PWUA 5T41A 1C1CA 3OUYB 1R0CB 2LECA 2HMIA 2QA2A 3MM6A 4PWDB 4DN0A 4AE5A 4YY3F 4AFFA 2YNGA 1NUEA 2XMWA 2JLGA 4X62F 3GV5B 4H4MA 4K0KJ 1FHTA 3SQOP 1OY9A 3F0NA 1CJKA 1LXJA 3MPVA 1T05B 1YJ9S 1P27B 2GCFA 2KXHA 3UWTA 1O51A 2MZTA 4K8RA 5HMYA 2XWYA 5CYMA 4UF4A 4HACB 2VC0A 5HQMA 2R8HA 2QLXA 4G6VB 3TAMB 3H40A 2FZCB 2CJKA 1SKSA 4DI6A 3DM2B 1NJZA 4KGXB 2ZBQA 1B64A 3F73A 4NL5A 1NPKA 3I0SB 2W4DA 1XNRJ 1NPRA 4ICLB 1LQ9A 1HWKA 1IJEB 3BSAA 3J7Z5 4QWAA 2V50A 4DSKA 2M70A 1REVA 4HH1A 3TUPA 3GILA 4NLRA 2NZ4A 1ZZNA 3KK1A 4LIRA 3ZTQA 1M1GA 3JAMY 5IXUA 2VB6A 1B0VA 2B4VA 2OSQA 1CEZA 5C42A 4OL8A 3N6MA 3TRGA 1TKTA 1YJNS 2HFSA 1U0HB 3T9ZA 3V4IB 2CPXA 5D3GA 3MOJB 5LXRA 3QGPA 1WC1A 4IDKA 1UFKA 5KG4A 1T9WA 4F67A 2GMHA 4QIVA 4DCOB 4MKAA 3CPWR 3UW1A 3IN5A 2QZ8A 4I6WA 3JSMB 4UQGA 1VLYA 4KGKA 4GVLA 3OV7A 1Y0HA 2AX1A 1H98A 1B3TA 4NLDA 5THWA 3UDLA 1D3WA 1FRMA 2YWFA 4ILLA 2B0GA 3TUJC 4CO1A 1U2CA 1RT7A 3MGJA 4DWIA 4PEOA 4XPEA 1RTDA 3HFVA 2EKNA 1FE4A 1NHUA 2LCWA 3LA0A 1PC5A 3L95X 3GCWP 2V67A 1FE0A 4NMXA 5LSOA 3T1YF 2HVIA 3RBDA 1N32J 4I4BA 1GFWB 2MKYA 4WP3A 3VAGA 3SZ2A 4RW6B 4KPYA 4L72B 4RNMA 1TUGB 4RWWA 4IQMA 1RT4A 1HWJA 3DLGB 3HULA 1WHWA 3PR4A 1PJ6A 1SKUB 2BJ8A 3KG1A 1M1KT 4K4WA 2NCKL 3OFFA 2V2QA 1VQKS 5KOWA 4MFBB 1U1MA 2FGOA 2IMOA 1CC8A 2F4FA 4QR2A 4EFAC 3PJ9A 3IM9A 4USWA 2HFZA 3E3XA 1NJWA 4FS2A 4HI2A 1DQ9A 1NAQA 1RYRA 3CC7S 2BVZA 2YPZA 2QTWA 4IYQA 5M2UA 4IDKB 3K57A 3IR5B 2QFJA 2LEAA 1HQ2A 3MEKA 2XZWA 3FSXA 4U6PA 2DGOA 2DH7A 3N01A 1T05A 1B7YB 2CWXA 1NJIT 2YQ0A 1F5CA 2RKIA 4LF4F 4QCLA 1CBKA 1XERA 1PYTA 2I6WA 4YDDB 1VQYA 4Y0FA 1VDHA 2FGCA 3TQ1A 4JV5F 1GH8A 5KT4A 3EDRB 4KY3A 5KFCA 3PXGa 2HEKA 2K06A 2E5IA 2CG4A 1H3DA 1WC4A 1YBTA 4DU8A 1UW9A 3KK3A 1NK9A 1RCXB 2O1PA 2J8AA 2HFVA 3AD8C 1VI7A 2LP4A 4NCGB 4CYUA 2FY8A 3P4UB 1HI8A 5KFDA 2VA2A 3EGNA 1YRTA 2CVEA 5I3UB 5HLFB 5IT9Y 3I56S 1FX2A 2HZAA 2LXUA 3BR9A 2ZH2A 2DR5A 1I1GA 4LF4J 2RSQA 3H59A 4LIWA 2R7RA 3NMRA 1BC6A 3IG1A 2IFXA 4EYIB 3A1YG 4U7UK 4I69A 1X4HA 3CDAA 3HF5A 3DU6A 3ETMA 1HHSA 2KXNB 2EFGA 2D3O1 1SJRA 4C98A 2Q6BA 2GQQA 1N34J 2YH0A 3DRYA 4KRWA 4A47A 4ETXA 1N33J 2QLWA 2R7XA 2AKWB 3EZOA 1WSVA 2RUSA 3G86A 3MM6B 1KKHA 4ZVTB 4KJIA 3EJMA 3H42A 4HLBA 2XC9A 2HIQA 1CJUA 1WG1A 3GTYX 4RJVA 4WK1A 4U8YA 4YB7A 3M4XA 3M2VB 1DTQB 3OFEA 4FYXB 4PR6A 2HVEA 1FF2A 3KLEA 3SDEA 3R1HA 4PYDA 4ZPTR 5E3CA 4C8KA 1SC1B 4OYMA 2GHWA 2M52A 2DGVA 3MOZA 4TU8A 3IGVA 4WYWA 1N32F 2V69A 2KU7A 1Q4RA 5F8GA 4OYXA 1WG4A 2MKCA 5KFIA 5A2QY 1QAYA 1SKWA 2PC6A 2OHDA 4USTA 4W90B 4KYZA 2R8JA 3TUIC 1ZAXA 1WF2A 1HQEA 4FNHA 4USMA 3HHDA 2HS0A 2E7VA 2CJAA 1NK7A 3EPIA 2HVDA 1SJ4P 3HK2A 3PCOB 3G96A 3WHIA 4ZVPB 3D1OA 1HNXF 3E01A 3CXCR 1PILA 2IMWP 4DPWA 2C3OA 5G0RA 1LV5A 5I3QA 4DR6J 1X4EA 3DLKB 2OPRB 4LSNA 3D67A 4GO7X 5CZXA 4GMKA 4OZ0A 3QATA 4DPTA 4DUZJ 1FCAA 2LA4A 3NEKA 2VPZB 3N5BA 3ONQA 3TEHB 5GMKa 2W9BB 2W1BA 1K44A 4D3HA 2ZH5A 1ZS6A 2AX0A 4LR8A 4DOZA 3J7ZT 4NMLA 4ED5A 4KFBA 2JZ5A 2KM8C 2ATLA 2DNNA 2YXLA 4FKYA 1LOUA 5BJRA 1TMJA 1JLFA 1ZTWA 2D69A 5JMNA 1MWYA 4WFYA 3RAMA 3PYGA 2J6SA 2UXCJ 4U7UD 3V6JA 1KN6A 1KHVA 4OLOA 5D4OA 4F4KA 3RG6A 4RPFA 2C3PA 4ECYA 2ZITA 2M88A 2HK3A 4OZ2A 4CZCA 1B4SA 3KHGA 2OO4A 3W9JA 1XNRF 1NO8A 3KDNA 5EDWA 4J9PA 4DV5F 2EEYA 3DRRA 4RW7A 4Y34A 2Y9HA 2L9WA 4RW6A 3Q22A 3IGNA 5IC6B 3V4MA 2EFOA 3J7YI 1P8GA 2CJYB 5HL7Q 1TR0A 3O1LA 3O5TB 3PW2A 3D9BA 4LFBF 2W2NP 2FJAB 1WELA 1YTYA 5A8RB 1Y00A 5HQ8A 3OTOJ 2JLFA 4I64A 5DZ7A 1N5QA 4J9UE 1W26A 1IVZA 3R7SB 3N28A 3QIPB 4YDXA 1EETB 1T0TV 5HK4A 1FDBA 2KJWA 3D68A 3K2YA 3CGIA 5KFRA 5CABA 3B8HA 4OYZA 2C2EA 2B4UA 5GAHU 1HWIA 3EGVA 1KRPA 1F0XA 1NNDA 3QSIA 2ZBRA 5IQ6A 4B3SF 3PIOQ 4MAKA 3KLIA 1XR7A 3MECB 4C6AA 3H4DA 2ATCB 4IR1A 3BZQA 3QT7A 2UXBJ 1FNMA 1B0TA 1NRKA 1RHUB 1NK4A 3DXBA 3GFXA 4CLLA 1Y5NB 1HI0P 1RCOB 4NXNJ 3MMBB 5C5JA 3UNYA 2R2TA 5KT7A 2HVHA 1YZ7A 5D4LA 5A76A 1D9DA 3HHLD 2MPUA 4DV7F 3MMCB 4DSEA 2X1BA 2QL7B 3FK4A 4EZ9A 3CULA 4A46A 2OUGA 3FBEA 3IBWA 4ZJOA 3OVAA 1YIJS 3FRYA 4FXWA 1WF0A 4UQTA 1U45A 1N36F 2FLPA 2BABA 3BR8A 3CIZA 3AOBA 3W64A 2D3UA 5HBMB 1U8WA 4JI2J 3GFYA 1HIYA 1RAAB 2DO0A 4F4AA 2VICA 2DK2A 1Q7YT 4B3MJ 4LQ3A 4TYAA 1T9TA 1CS4A 3AA9A 3SQGB 2IM0A 2AYEA 4NWBA 5AE3A 4K4YA 4GKKF 3CWJA 3BH6B 4W98A 5L8RC 1HHTP 5B08A 3AQOA 4YR3A 2O01C 4ID5A 3KHRA 2ASJA 1UWBA 1OWXA 4J9SA 1UL3A 2XMMA 5KG3A 4DV4F 4N8OA 1T3OA 3FMBA 4P10A 4DL2A 4EMDA 4AUKA 2FTRA 4B02A 1K8AT 1S9GA 3QWUA 1JNRB 5RUBA 1O5JA 2O67A 3PEHA 5DO2A 2J0WA 1UW4A 2XMTA 3L09A 3N79A 4LFCJ 2XULA 4XO0A 1TL3A 1SJQA 4JI6F 1S1XA 2BUNA 2YNIA 1WACA 1BWVA 3V5RA 5DDRC 4L3KA 4MH8A 5LOQA 3ILIA 1W7WA 4LBIA 2VDHA 4CI0B 1N5YB 4L3NA 2D41A 3PO4A 5HMXA 4KHPF 2XCAA 4MK7A 1ZH5A 1RTJB 4UTGA 4WE1A 4BC9A 2ROGA 4IH6A 3IRXA 1IBKJ 3MEDB 3UO0A 1VQ4S 1W2BR 4ALZA 2OPQA 2MQMA 3JSRA 1JJCB 3ZXWA 3SSRA 3OTDA 4E8UA 3MM5A 3G6VA 3OR1A 1JJ2R 1DBDA 2RF2B 2R7OA 3R3TA 4LFAF 2XI2A 5E7OB 3EGWB 2M5YA 2GJ2A 2YKPA 3ICLA 2I2YA 1RE1B 1TU0B 1JLGA 1KQGB 1KC8T 4JI7J 2B3TB 2LEPA 2NLWA 1PSDA 4ANDA 1HBNA 4EU0A 2VV5A 1I5OB 2N7CA 5B0AA 4QWBA 2WVEA 1S0MA 3UD5A 3Q8SB 2GHPA 3I4PA 1S9GB 3MPUB 3HVRA 1SVDA 2QRRA 3CJSA 2VBWA 1Q7LB 3TVYA 2PI4A 3OL7A 3W60A 3C46A 3D1HA 5DGBA 2BRLA 4PUOB 4DL4A 2E9ZA 2X1FA 3MUMP 4ECRA 9ATCB 1IKXA 4PWWA 2ZNZA 2BE2A 4NA2A 2GNKA 2G0IA 2E29A 2W7OA 2RQ4A 1MMLA 2BZ2A 4C11B 1WEYA 2G0CA 4USVA 4B9TA 4ELUA 3IBFB 1X9WA 3PR5B 4IRKA 1N5YA 3KKFA 2IC3B 5DG8A 2ADCA 1UA0A 4K2XA 4Q0BB 2Z56B 4ANEA 1JWWA 1VC5A 1U49A 4ECSA 4ZMMA 1RLDA 4N41A 5IV4A 4M94A 3P49B 3MPDA 3IM8A 5KT6A 3DMJB 4OYIA 1EJ7L 4URQU 4LRBA 2CPIA 4DFPA 3PRDA 4I56A 4JI4F 2VOOA 3PJWA 3AH6A 3CVKA 3GFZA 2DYAA 4EUVA 4ZIVA 2F7VA 2G1DA 1FDAA 2IHR1 2B43A 3D4JA 2COLA 3CEDA 1UFLA 2PDAA 3EE3A 4USHA 5L39A 4DV5J 3LF0A 1HHQA 5E0OA 4CM2A 5K9FA 4K0KF 2HLTA 5DZ6A 2QEXS 4OIXA 4ERDA 4A8XA 3OJSA 4USUA 4X4SA 3MM8A 4YY3J 2BM1A 1RSCA 3FQKA 2KHDA 3DOMA 3KNAA 1SQGA 3R5BA 1RU1A 5KFJA 1HKAA 2VZ9A 3HFKA 2ZH7A 1FRLA 5I3UA 5HLFA 3JXOA 2J7KA 3GIMA 2UUAJ 4KAIA 4OZ5A 2EC2A 3M6XA 3NXZA 5L38A 2BOPA 3ISNC 4X4NA 1VRUB 2BBEA 2Z58B 3CCVS 4P2SA 1IKVB 1Q8BA 3M9MB 2R2UA 3RB0A 1MWZA 3MZIA 4TN2A 5KFYA 2Z2MA 2DNPA 2ZDPA 4A8QA 4ED8A 1VQSA 2XEXA 3E8OA 3I5AA 2CPDA 3JSYA 4DQRA 4ED0A 4YOEA 1UZDA 4QW9A 5ETOA 1YG0A 3AXKA 4K4ZA 3CJ5A 4CO5A 3DHXA 4DX8H 2V94A 2MJNA 3KJVA 2N82B 1LWFA 1VQOS 4ED3A 1R8PA 2VFVA 4FDFA 1X4CA 2ZBPA 2AV5A 5HSPA 3WX8A 4AQYJ 3EPGA 2AU0A 1N6QA 1BQMA 3LP1A 4NASA 1HNWJ 4QYZJ 1QAXA 2JVOA 4L74A 1KQKA 3M2UB 2HAIA 3UR3C 3NRBA 4M8LA 5B0FA 1WOOA 2HFOA 2VH7A 1NU4A 2WAQD 4CTAA 3MTJA 1EETA 4FS1A 1U2FA 1WC3A 4O4GA 3OTCA 4QJVA 3OSPA 2R7VA 2B6AA 2C42A 2HRYA 2P9EA 4KQZA 3BB5A 3WC0A 3DLJA 4V19J 4FXVA 3VALA 1RT3B 1TUWA 2HWIA 1Q0NA 2QLFB 2VBYA 4PPDA 1M5OC 2QFIA 5FLXU 1WDTA 3GU0A 2XMKA 3KMQA 3UDCA 5F8LA 1JIHA 1YRXA 3FBCA 3OR2B 1YWXA 4TY8B 4QWDA 5F0WA 4RUCA 3S7RA 4DV2J 1WC6A 5B0BA 1E6YB 3THVA 2BDPA 4FP9A 1KONA 3MTKA 2B4OA 3CCMS 4B3TJ 2MZ1A 1YJUA 2OD6A 3CUNA 3ZTOA 2HHWA 3NCRA 3VF0B 4QYRA 2DR6A 2KL8A 2JEIA 2PA8D 1J27A 1XWLA 3TJ8A 4TVAB 4IRCA 1RADB 4ICLA 3BYPA 5KFZA 2ZH4A 4X66F 2LQBA 3CCZA 2VHGA 2ADBA 3R7NB 1RAGB 5KFFA 1HMVB 3BKTA 5MLCV 1RHJB 2RAQA 3QZ7A 3ZZZA 1VK8A 4LUBA 2CNOB 3Q83A 4ZITA 5HQLA 4LF5J 4DZDA 4PZVA 4DR3J 1KVKA 1CC7A 1AROP 3DOMB 4HYKA 2RMLA 3UDVA 3HMJG 1NZ8A 2ZHOA 1Y3JA 3R27A 2HQDA 5E41A 3RUBL 5F8MA 4IO9Q 2IRUA 2QLJB 4Z2XA 5LMUJ 2ZOFA 3PX0A 4Y2MA 3AT1B 3EXCX 1YI2S 2WONA 1C1CB 2XYPB 4ZHRA 2BJDA 2XSFA 3OT9A 2J9CA 4RNHA 4RX6A 2RU3A 2AEFA 4JOUA 1ELOA 1SIWB 2AJ2A 2R2SA 3L4BC 4QWEA 1Q82T 1UVIA 1N0VC 2ZWOA 1S1TA 2R7UA 2HPUA 4K7QA 4CWBA 2J0SD 1UEKA 4Q0BA 2ROPA 1LWEB 3MCSA 1FKOB 2Y3YA 3TAPA 2HNDA 4OHZA 4AXIA 4CCHA 1IR2A 4OFZA 5KFPA 5SZTA 2OPSA 3R2DJ 1XEZA 3QIDA 4O23A 3DDIA 4LF8J 2E9TA 1JKHA 2DNKA 3KG4A 2W7PA 2V63A 3MFIA 2HHSA 4C3LA 1U1NA 5FDLA 3UQSA 4NLPA 3M9NB 2ACMA 3R5JB 2JHEA 3DOKA 1JXLA 3MM9A 3EX7B 2C2DA 4KGVB 3D1QA 4Y6IA 4LRAA 4X65F 3QO9B 1OO0B 1R31A 2MHEA 2MQNA 3TZXA 3T5HA 2Y1IA 1MMDA 1X4DA 4FXDA 3IAM9 3ZFVA 7FDRA 4R5PA 1OYDA 3MMAA 1U1OA 2XQCA 1TL7B 4ITSA 1WC0A 4WBFA 2H4YB 2PI5A 2HRTA 2V8PA 1HL6A 5ETQA 4W92B 3A8KA 1RTZA 3ET6A 3PG9A 1AUSL 3CTRA 3US5A 3FEYB 3MR2A 5G0RB 1ZBTA 1WORA 2YVSA 2GVDB 2BJ1A 3LP0A 3THPA 1M5PC 4DSFA 1FWPA 2R4FA 4ZVOB 4CP5A 3K5LA 1NSPA 3OXLA 1HBMB 3P3DA 5GMDA 2FJDB 5KTQA 3BN7A 5AJ3J 2EPIA 3D6HB 2MZQA 2XZDB 1SUQB 4BHQA 3PZPA 2HBYB 2ILZA 2HHHJ 3QIPA 3RR7A 2OJ3A 1HA1A 1U1QA 1FD2A 2G9OA 4KE5A 2CPFA 3S01A 1NKBA 5J2MA 1QAJA 3G6YA 2CIMA 2VPYB 4H4KA 2P9CA 5DDQC 4ZVSB 2H1YA 4QR0A 3SCJE 4C9DA 3FZ2A 4HDHA 2E5LF 3IMQJ 3OXFA 3I82A 2MGZA 3F56A 2FHKA 5M2PA 2YX7A 1HR0J 2AT1B 3AJ1A 3ILOA 1HQUA 1NDKA 1Y5IB 2DXEA 3FMWA 4WP8A 1S10A 3KK1B 1AFJA 3S1TA 3KDOA 2X7IA 5K14B 2KT3A 5CCMA 1YJRA 2WOMA 3TYTA 4GKJJ 4M5DA 2XB2D 1RWWB 4J90A 3BBCA 3MMCA 2Z2ZA 2AQ4A 2J9DA 4TLRA 1V3SA 2CYYA 1N34F 2N4CA 3W2WB 3C2PA 5ETTA 4YB6A 1X0PA 4NPOA 4BBYA 1XR6A 4PYAA 4LFBJ 4HHJA 1U0HA 4LJMA 1LXNA 1IM6A 3AFGA 3M30B 3GMGA 8AT1B 4U8VA 1HBOB 1RT6B 5GAGU 1RBOB 4ZA1A 4IG0B 2D9PA 4B3RF 1RT7B 3JQMA 3D2WA 3QO9A 2LYVA 3RBEA 5G4DA 2DVIA 4Y3CA 2AZ1A 3KUHA 3TWZA 2IY5B 1K9MT 3MM9B 1CPZA 2AD9A 4KH1B 2CWKA 2VA3A 4IUFA 3NBPB 3HHEA 1FERA 3UR0A 3ET6B 2NPFA 2IYGA 2XO7A 3QJPA 2M8HA 1KLMA 2ZBIA 3G82A 5H9EJ 4QU6A 4OX6A 2GVDA 2HBRB 4ED6A 2XM3A 2C22A 4IFVA 1FRHA 1EQMA 2ASLA 3I4HX 4YUDA 3I55S 4O3NA 1MLAA 1GX6A 1T03B 4ZLNA 3DRSA 2MKHA 4QWCA 2QMUB 2RQCA 1U0SA 4A8WA 1GTHA 3MCMA 3K5PA 1U09A 3RAXA 5E3PA 1UP1A 3C19A 4ZCMA 1X9MA 1QD1A 2JVRA 2YBVA 3C6UB 2G2OA 4PABA 3K5MA 4X4TA 1X4BA 3IP0A 1WG5A 1UJ5A 3HHLB 1XJWB 2GJIA 2FC9A 1HBUA 3GP9A 3PYDA 2D3OR 1S77D 2Q6CA 4WU2A 3KHHA 2HNDB 5AXNA 5I42A 2BQUA 2YNFA 5AXKA 2NXEA 2A6OA 3A4TA 3I31A 3K58A 3CJ0A 1CQNA 1APSA 2KVIA 1DFDA 1BE4A 4OX9J 1D09B 1S1WB 4WFXA 2PT0A 2W4CA 3BS9A 3C14B 2MLYA 1NDCA 4RW8B 4PWDA 2LQ5A 2V34A 3JTNA 4B3MF 2DGWA 3A3NB 4CO4A 4CYUB 2P8IA 2QSWA 3DOKB 1S57A 3OTBA 1L3TA 1DY3A 3LWLA 3E01B 1YDLA 2V2ZA 4CLYA 4RUHA 3HHLA 5CH7B 3ZTPA 2XY6A 1NK6A 2MQLA 3FKBA 2DGUA 1BMQB 1S9EB 1UWBB 1P6TA 4OZNA 2OGUA 3DLEA 3GYGA 4ILRA 3V6HA 2E1PA 2PMHA 2VPXB 4L6V3 3AD7C 2ZVIA 3UD3P 1URRA 1GT8A 2XMVA 3T3FA 5KT5A 1EZZB 1H2TZ 2KB2A 3WIUA 2J0XA 1TK5A 2IC3A 4PRFA 1FEHA 3L7UA 1VK3A 3QYYA 1S48A 4B3TF 1FKPA 1BQNA 2WSFC 4F4ZA 2DBBA 2DNGA 4BWJA 2QYGA 1FJCA 3HZEA 1XNQJ 3M32A 1EAYC 5C24A 1FXRA 1U24A 4RR5A 4MKYA 3G6XA 3PW7A 2HHUA 2FVSA 2CQIA 1I3OB 1S49A 1S6QA 3BQ2A 2LQJA 2H51B 3NY0A 4U9RA 2VG6B 2GJFA 3SCIE 3JAMU 4OI0A 1TMMA 3CE8A 5M2RA 5A8KA 1TKDA 4NLSA 1PIEA 1VQLS 1S1WA 2KI2A 1HNIA 4OQJA 4P75A 5J1EB 3CD0A 3D6TB 1S5ZA 1RTHB 2DT9A 2VKRA 4TQSA 2Y1JA 2CPHA 1J5EF 2FLNA 2XS2A 1HNZF 2YNGB 2ZH1A 1G3OA 4MKBA 1NKEA 1U47A 1C0UA 1S9EA 3KK3B 2FZGB 3ENQA 2DD8S 2B51A 2KT5A 3LGHA 3UPFA 1RT1A 3HSDA 2UXDJ 4ID5B 2YKMB 1ITPA 3BGFA 1YBUA 4LVNP 2JRSA 4N5SA 3ZZ0A 4E0DA 5J1PA 3RW6A 3T6BA 1TKZB 1UVLA 1B0PA 1FXDA 3Q89A 1RHKB 2DCLA 1YITS 4J9QA 2YWGA 1VC0A 2B4PA 4P73A 5D77A 1AXQA 2OFHX 3W61A 1F9FA 3GV8B 3EGZA 3UVJA 4DR4J 1K0VA 1KVIA 3PX4A 2GO8A 2EW9A 4RNOA 1IBMJ 4PQUB 4F4WA 5LMUF 4O44B 3JYTA 2WBRA 4OX9F 5AE1A 5DG7A 3EICA 3MAHA 2VONA 4Q45A 2HRUA 2RQKA 1FXLA 2YWHA 3MM8B 4OX8A 4RW9A 4KHPJ 3KMSA 4EK2A 1YVFA 4BDPA 2ZWPA 2O66A 2C2ZB 2QGFB 3NAIA 2BJ3A 3JTOA 3RBZA 4A8KA 1RT4B 1NB7A 1MN7A 1FX4A 2BM0A 4JV5J 3FFIA 3LTOA 5FD1A 1S1UA 2JC0A 4IFYA 5D8HB 2ZE2A 2VASA 3A8EA 1UKUA 4XPCA 1JK9B 2RVJA 3D66A 4WCEQ 1QSLA 2CQDA 3A3PB 1X4GA 4FYVB 3KTQA 1X7VA 4B3OA 1YBAA 4XDCA 2VFRA 4S0MA 2P9GA 5HANA 5E3RA 1HWUA 2RQMA 4B17A 4DCPB 1HD1A 3LPYA 1BGXT 4UW2A 1K73T 2IRYA 4JBCA 2FZKB 3CB4A 1MNEA 4WFNQ 4DLGA 1AYEA 4WYLA 4QBUA 2XLIA 2EI5A 4DV3F 1OS5A 5E2QA 2MZRA 3C66A 2ZH6A 4OHYA 4EBDA 2IJRA 1WI6A 4WIQA 3KUEA 1T95A 2VG5A 1N54B 4UZCA 3B4MA 3TEGA 4U67Q 2FJEB 2AGPA 1CJTB 3PYFA 4AD6A 4B9SA 4J9LA 4AL6A 4RW4B 3KJQB 5CA5A 3MR5A 3OSNA 2GA7A 4HVZA 1S6UA 1N5VA 1UEUA 5LSRA 5KG5A 2W9CB 1D9FA 1RKIA 1S1VB 3MEGB 3GB0A 3Q8RB 2VQEF 2DRDA 5HP1B 2V8DA 3NCQA 5CYQA 3FVYA 3BREA 5KOXA 1S7HA 5D0HA 3J80U 1HARA 2HIYA 3CCES 4KTQA 1WNEA 5K8NA 3JSBA 1CJVA 3I0RA 2CPEA 2EVZA 4KSEB 1DAXA 2YKMA 5C25A 2GGPA 5KFHA 2W8KA 5ETKA 3DU5A 2AYBA 4WFAQ 3K0JA 1QVGR 1GEHA 2ZUAA 1R8HA 2AZ3A 2GQCA 2BJ7A 3ZNUA 4MMOA 1GTEA 4LR7A 2POKA 2P5VA 5E33A 3MEEA 4CDIA 1U1PA 4TY9A 1NDLA 2N7YA 5HVGA 2DY1A 2CQ1A 4CM0A 1IKWA 1U6BA 1ZZFA 3EZ5A 1HW9A 2RJZA 2W2MP 2ZFHA 4FVCA 1CQMA 1UWAA 4OV1A 1KEKA 2BKOA 3TX0A 2DHXA 5CQGA 2CG8A 2KG1A 1RAFB 2XMUA 4XDDA 2I9SA 3MFHA 2HS4A 1LWCA 1GMWD 1VFJA 2AWZA 2E5HA 3NG8A 1LW0A 3AY0A 1ZTTA 2QO3A 4LSLA 3C15A 2M7SA 4OZ1A 3F44A 4DR3F 2L08A 3NKYA 1R43A 2IYIA 2IPOB 1RUSA 2CJ9A 4OZJA 2HQ3A 1EHWA 1LEOA 3PW5A 4DR6F 1F1BB 3N6LA 5K20B 1VQMS 2R42A 4WKRA 2L9DA 3TZWA 1DTQA 3DRPA 1HBUB 3WC2A 2HGLA 4P74A 2E1AA 1S59A 3WBZA 3GJTB 2A18A 4DUYJ 3HVTB 1DURA 1JJ4A 4DR7F 3GR1A 3IRXB 3G9CA 1N5TA 2ABYA 3B6BA 1OPIA 1HFEL 1D9AA 3M6WA 4WFZA 1RKJA 4ZHRB 4LF5F 1G2EA 1RT3A 5B0GA 2HS3A 4NEZA 3PFEA 5C2CA 1NSAA 5L1LA 3R6LB 4QW8A 3SYZA 4NOHA 1J5OB 4F2RA 1N36J 3H2LA 3C6TB 4A8MP 2PA3A 4DV6J 2RS8A 1E6YA 1RWOB 2DJWA 1PKUA 4RL1A 3Q23A 3SFUA 1VCTA 2RRNA 3TP2A 1DLOB 4K2JA 1S12A 1FO1A 1X9SA 3QRRA 1OPZA 3QAEA 1QUVA 4DX7A 3IWXA 1U25A 2XY5A 1FJGJ 3I96A 4DV4J 4B9MA 4NRTA 3TJAA 5C25B 4DPYA 1C4AA 2AMCB 1UTAA 1XC9A 1PJ7A 3BO3A 2WSEC 1GX5A 3RAQA 1KD1T 1X5PA 1Q86T 1PYSB 3I9V9 2C2KB 2KDOA 3TA0A 1L5UA 1RABB 4B3OB 3U7JA 2ZZNA 5CD4H 2CZ4A 3LGNA 1KOHA 2V2KA 3IWLA 4CLPA 1C1BA 2DNYA 4HL9A 1Q79A 2FHOB 3Q8UA 2WHOA 4P2XA 5EX3A 4C8NA 4PG7A 4BS2A 2CQ2A 2DO4A 1BY9A 1Q8LA 5CXTA 2IVMA 2K7KA 3GONA 3UD4P 1NK8A 1IBLJ 2HNYB 2KZZA 1CULB 2CXEA 1RT5A 1ZPVA 2ZKUA 4MTPA 4ES3A 4U96A 1FRIA 1MROB 4DUTA 2A10A 4WZQA 1CS4B 1TL5A 3SQGA 1XBWA 1NLKL 4O3PA 3CDBA 2MKSA 3D3BJ 3D0GE 5F9LA 2CVIA 1VRUA 2NS1B 2W24A 3ADAC 2A2DA 3M05A 1SV5A 2VKZG 3PM9A 1PCAA 4E98A 1FESA 1K47A 1YRUA 3DRRB 5IT0A 1KFDA 1Q16B 2E7WA 2PSZA 5GMEA 2VQFJ 1CVJA 2K3KA 2ZBCA 4HR2A 3O44A 3IR6B 3DGPB 3UNGC 4DV3J 3SIPB 1U4BA 4FBTA 2C3MA 5D0RA 4DV0J 2DNHA 3AB4B 3DLKA 1SJ3P 2DR7A 1NH7A 2VDIA 3LANA 3R6GB 5D15A 4CO3A 3RB3A 2BE2B 3OLAA 2ROEA 4CLZA 3HVAA 3CCWA 4LF7J 5CAAA 3IA0A 2MB0B 1QE1B 2OP5A 4OHVA 1TKXA 4M95A 1OSCA 1TFWA 1C1BB 2B8QA 2AJFE 2G13A 1NPPA 2O3DA 1LFPA 5EGYA 1U48A 2M2BA 5FJ4A 2RRAA 2BQRA 4MKVA 9RUBA 1JLCB 2JH3A 3NGKA 3SEOA 4N56A 3TA1A 2HQCA 2FYXA 3AHPA 3HSJA 3KJNB 5DETA 4UZBA 3KHLA 3Q2SC 1WI8A 2HK2A 3SCLE 1M5HA 3BH7B 3OR1B 4LF7F 1JLBB 5AE2A 1JLEB 1F3FA 3PVXA 1YJWS 1N52B 1NCLA 1HYSA 2E9RX 3VAJA 1F5AA 2VG7A 3C15B 3LUYA 4KKOB 5KFWA 1T7PA 5HJYA 1KP6A 4F50A 1U1RA 1IR1A 1RWVB 3DCAA 3BQ0A 3R97A 4PKDB 1RTJA 5H9EK 4DR2F 3DLLQ 2CRLA 1FD8A 2GFFA 3ITHB 3TR5A 2ZM6F 2FPHX 4M5KA 7FD1A 2D1CA 2OELA 2QMWA 2NXCA 4FNIA 3M9OB 1AUDA 3W5ZA 1JMTA 3VZIA 1P1TA 1SBRA 1I51B 3DYAB 4MIWA 3K59A 5L1IA 2AJ1A 2G1HA 1DRZA 4A8OA 4RW4A 5I42B 1EP4B 4CH0S 4DFJA 3DLHA 3OUYA 3CDWA 4YFUA 5K8PA 2C1EB 2CA9A 3H7HB 3BN4A 3NGTA 3VAHA 3CMAS 3LALA 1BQXA 1YSJA 4X2BA 2YTCA 4ID8A 3J81j 2YKNA 4TKTA 3CJKB 2NXJA 2ASDA 4ZPBA 1AFIA 5DRKA 3H8YA 3TAMA 2UXCF 4UOHA 2X1AA 1ZETA 2V8GA 1F5BA 4DPUA 1L3UA 1WHYA 3CW2C 3T1AA 3BSCA 3DGPA 3DLBA 3QFWA 4F3OA 1X31C 3D7SB 3OVSA 1R8AA 1AZSA 1SI9A 3Q86A 1GXTA 3T19A 1EARA 2HHTA 4C11A 3IR7B 5KT3A 4J5OA 1N48A 2Y8YA 2DNLA 3QJJA 2XMJA 4ZP9A 3M8PB 4ZCLA 1JLQB 3PW0A 2CFXA 1X60A 1RHMB 4LSLB 1S9FA 4BCAA 1TFYA 1GMUA 3CDUA 2PMWA 5I3PA 3ZZUA 3VAMA 1NZAA 1WHXA 4LMZA 1P9QC 1JLAB 1NJYA 2HWHA 2XS5A 4ED2A 3TW0A 1FA0A 2OKQA 3V6DB 2ERRA 4LF6J 3AOAA 1AW0A 2E1RA 2DXDA 5GVQA 5IQQA 3C16B 2ZNYA 4EZ6A 1BXNA 4LR9A 1KR4A 1EB0A 2Z8QA 4QYZK 4N7TA 2J7WA 3KLFB 2L9NA 3U1LA 5B7WA 1R8BA 3CIMA 4DLEA 1LKZA 5HI7A 3BGUA 2VJUA 4JI5F 4JYAF 1RAHB 1SC4B 3ENAA 2CQ3A 4KO0B 4NLUA 4NXNF 5J2PA 1LWFB 5EWFA 3LP2A 1VHIA 3QFHA 4WKYA 4K4XA 1T3NA 1V5VA 2DGTA 2UZAA 4P2MA 4WK3A 4R8UA 2F4VF 4OJ3A 1HI1A 1UCNA 4LF9F 3OHAA 1Y5LB 4XIUA 1F6TA 3E51A 5BYQA 3EYZA 2NREA 4X4VA 1ZM9A 5F3TA 1FFWB 2YKOA 3OQ2A 4WXOA 2CKWA 1NSQA 2DCUB 3BEGB 3UDEA 1Z2LA 2EG2A 2CZ9A 2DNOA 2MHNA 4HDGA 1JB0C 4KFBB 3GIKA 4DFMA 2BQ3A 3K8WA 3MECA 1UPMB 2OEKA 1TP7A 2ZD1B 1KQFB 3TOQA 2CQBA 4G3IA 3L3CA 3UVJB 1TELA 3TA2A 3U02A 2X3GA 2KYXA 4ANCA 3MM7A 4YR2A 3A12A 1VGYA 2DPIA 2V4QA 2YWEA 4UOCA 4K4VA 1S6QB 4X64F 3V4IA 2UU9F 2Y8WA 1WEXA 1LWXA 3HVTA 4ZIWA 2R3VA 4XK8C 4EO6A 2GAGC 1H0HB 4G1PA 2NSBA 2NXNA 1HNIB 1FKPB 2V9KA 4KV8A 2DXFA 2GIQA 1BLUA 3RR8A 4DG1A 2HVZA 3KJVB 4M5HA 5E3AA 4UT4A 5BR8F 2XLJA 2JNJA 2W2PP 1F9HA 4I0WA 2NR0A 1MROA 3GJSB 3K89A 3N9UC 4OJ1A 3G8QA 5GAGI 3TZYA 1U8SA 2WOMB 3M2RA 3VGTA 3GV7B 4X64J 1NJXA 1RA6A 3LQVA 4LF1A 2I5JA 2RB7A 2VFUA 4MT1A 4F3MA 3G87A 3G8SA 5F8NA 3CC2S 3MWBA 2AJ4A 2LLZA 4UY8T 1VQNS 1KWMA 1HPZB 3L9ZA 3CCJS 2YX4A 3BDPA 1JXEA 3DOLB 3KLIB 2C2NA 2AF6A 3DXSX 2FUG9 2KH9A 2IIHA 3WX4A 1MU2B 2W2QP 4J9VA 2HQFA 2J76E 2VFSA 3BSOA 4ECUA 5J2NB 3TARA 2N3OA 2E7XA 2GS8A 3IFEA 5F0UA 2V9WA 1YLXA 1XN9A 2HNZA 4WFBQ 3VAKA 5CCLA 3MURP 2RRBA 2FHJD 4I68A 5D78A 3VCDA 1TL4A 1CJUB 3W9IA 1N4LA 4CLUA 1S6PA 4IR9A 1Q8IA 2M9KA 4F4XA 1LW0B 4NZ6A 2PEBA 1RACB 4NLOA 1H2VZ 5FIIA 3KNGA 4ZLJA 2XGPA 3VR1A 5DG9A 2SXLA 2GMJA 2F9DA 1AZSB 2F8MA 5IC4B 4Y00A 1DJ0A 1VOMA 2WVCA 4CNZA 3GE9A 2AYMA 2E5LJ 4LVOP 4C7QA 1ZM4A 2HLUA 4M63A 2LU2A 4Q8EA 1R27B 1WTFA 1VIOA 3QLHB 2BKPA 2DH8A 1RA7A 1H72C 2VG6A 1N5SA 5T14A 1HPZA 4GKJF 2FDNA 4ZVQB 1M90T 3FGVA 1S4FA 1U02A 4K4UA 1IQTA 1XTZA 1KOOA 4PG5A 3KLVA 1YK9A 2DKOB 2Q66A 2HZCA 2XSJB 4OYPA 3NGSA 3RGIA 5MAOA 2R9LA 5J2NA 2CDQA 3TAQA 1TL3B 4YN3B 3K8VA 4QIWD 4ZN1A 5C7PA 4GC6A 4ILMA 3BGRB 1XMOJ 3ENVA 3OPKA 4KIAA 4N77A 4KV8B 2HW3A 3VVTA 3OL8A 2FVCA 5JXSA 2OTJS 1P9YA 2CJQA 4KH0B 1Y4ZB 4Z7CA 4TY8A 3J7A1 2PFDA 3ZZRA 2G2ZA 2RDDA 3B78A 4RBTA 4N47A 4DL6A 4NCAA 1XNQF 2XLKA 3M2RB 4X66J 3CJ8A 1WJ9A 1JQGA 3BYRA 2MKKA 1RWPB 2V0NA 3UCZP 4JP8A 3OD2A 1FNOA 3M8RA 1F60B 2ZJPQ 3O3LA 3QGHA 5D0EA 4I7FA 3UI3A 2KYZA 2ZM6J 4LFAJ 2BX6A 3CJ4A 3RB6A 1T9VA 5ETRA 4GO5X 4F8RA 3M8YA 3PHTA 4G1QA 1TAUA 2QLBB 1OY8A 4C0OC 4DUYF 3TVKA 2WVDA 4F04B 1D0EA 1DZ5A 2BJ9A 3EUNA 4B9VA 1YKWA 4DSIA 3IC1A 4U95A 1UVNA 1UJ4A 1WUUA 3ULHA 3CCSS 1E6VB 2DY9A 2HBQB 3M8SA 4OZ3A 4I6AA 4DQSA 4F02A 4JI5J 3OXGA 1N88A 3QGGA 5A6WA 1MW7A 2KRRA 1H7XA 1HQUB 2MJUA 3PFOA 4MJKA 4O4GB 4WU3A 5KFXA 4BLGA 4CLKA 4NRUA 2FD2A 2GZOA 5K14A 3I0SA 3HHNB 4R0JA 5HAOA 4DBQA 5DDOC 4J9RA 1V5IB 3BGOP 3QZ8A 1C0UB 2OSRA 2JC1A 2KG0A 4KO0A 4Y2KA 3Q8PB 1R6VA 5HROA 2LQ9A 1SV5B 3KLHB 1N6QB 2W4PA 2HKEA 2ALZA 3T5KA 3OR2A 2UVRA 1SXLA 3N4WA 1CLFA 2VODA 4RWXA 3NBPA 1UVJA 4DL5A 3P8BB 1H7WA 3NAHA 1T9UA 2JWNA 3HT3A 4DV7J 1FKAF 3BSNA 4YEAA 2MZJA 2JX2A 4I7FB 3HT0A 3GYNA 4Y2AA 4JI1F 1UVMA 1HBMA 1JXVA 2XTJP 4PXBA 4I2PB 2PN6A 4F2SA 1BHNA 5IT9U 3HO1A 1FDNA 4Q7AA 2VQFF 4L76A 1EQ0A 3T5LA 1YQHA 2XO6A 1L3SA 2HQIA 3Q24A 1WF1A 2F1FA 3H5SA 5F8JA 3NL0A 2QA1A 2BA9A 3W2WA 1Y11A 2B9EA 2E5JA 4JYAJ 2VBZA 3FFIB 3FSYA 4RZRA 2I38A 4ZP7A 1VJWA 1WSRA 3M1VB 2GW8A 1RWXB 3MDFA 4URGA 4KPCA 5HMZA 5LMNJ 2J6UA 2UXDF 3P96A 2MQOA 3RYLA 4HI1A 2L41A 1C0TA 4DHVA 3PO5A 3LP0B 2OD4A 2DNMA 2XG8A 2QC3A 3GG0A 2YNHA 2U1AA 3KXDA 3IBCB 4Q2MA 4EGLA 4DX6A 8RUCA 3HJFA 3ILLA 2HHVA 5LXYA 3KLGB 3KYLA 2QA4S 2EFQA 2G2YA 2K3IA 4FF2A 2P6SA 2XCPA 1RZMA 1PAUB 3QT8A 1IKYA 3VGUA 1T9YA 4YQWA 2F8EX 2OAUA 4M5JA 4QQBA 3VTIA 2FC8A 3W5XA 3WQPA 2W9BA 1TVRB 3QRQA 4KHMA 2RF2A 4WWSA 4IOBA 2BW7A 4F25A 3HD2A 3PW4A 4KGMA 3ZTRA 1RU2A 3PACA 1SH3A 4QIEA 1FNXH 1I94F 1HW8A 1CSJA 2FB0A 3BBFA 4N8NA 3PKMA 2YKNB 3CJKA 3POTB 5LSLA 3CMQA 1KTVA 2XNQA 3T1HF 1VC6A 2XYHB 3N5FA 1JX4A 1FJGF 2MSTA 2FVPA 1TQLA 3GPAA 3H4BA 1HNVB 3AA8A 4MIBA 5F8IA 1X5OA 3KK2A 2MY7A 3BO2A 2RH3A 5ETSA 4DR1F 4LBPA 3LWMA 1LWEA 1ZM2A 3OFGA 5JJBA 5CZVA 5EN1A 2OPRA 4LSNB 2VQEJ 2QL9B 4R5PB 4GC7A 5E3QA 3HCXA 2FJXA 3DI6B 2C3UA 2B5JA 4RUAA 3T5JA 2IBKA 5A8KB 4PXCA 3DOLA 1VBYA 2DTJA 3OW2R 4PUOA 5ETNA 1LFWA 3CCQS 1S99A 2GGPB 1S1UB 5KAKA 4ECVA 2NZCA 2V8VA 1UVKA 3W9HA 4P7VA 2HYIB 4W4MA 2PD1A 1DARA 1JLBA 1RDRA 2GVZA 2DH9A 2O5DA 2V4JA 2XHCA 3LAMA 3M32B 4GVBA 1WD6A 2KRBA 2D7SA 2X51A 2YKQA 3C6UA 4QR1A 1AB8A 3ZZOA 4J9MA 2MKIA 4FPIA 3HVWA 5K8OA 4K4SA 3AQPA 4IH7A 2CQGA 4IG0A 1XMQJ 3P6YC 2OPPB 1R0BG 1KDNA 1X4AA 2XYGB 4NLYA 4CT8A 2HBZB 5GADI 4IRDA 5HN0A 2YNFB 1JNZB 1TAQA 2R7QA 3CJRA 4YB5A 5L9XA 4OYWA 4JI3F 2ALYB 2W2OP 4YS2A 5HMWA 1KVJA 2A2CA 3QMQA 1H74A 1RQ0A 1TL1A 2J7UA 4ZPCA 2ZC4A 2OPQB 2LFVA 3UE2A 2IDLA 4TXSA 5AXMA 2BXJA 1EIYB 4IH5A 1IJFB 1M5SA 2NPIA 1CJTA 1ZA1B 1T11A 2EFNA 5A2QU 3EMTA 1WKJA 3GSDA 4JI4J 4FPRA 3MR6A 2JLEA 3B54A 4A8YA 3GQCA 1T03A 4FF3A 5HJXA 1VISA 2OEJA 4A4JA 2FLLA 1UFWA 2GC8A 1FEEA 2D3ZA 1IKVA 1S1VA 1IKYB 3MEGA 3QPIA 2HFNA 3MCOA 4CNYA 5HP1A 4YMEA 1K1SA 4NYZA 3GZ7A 2V68A 5F9NA 4KGZB 5D6GA 2KT2A 3RZAA 3W1YC 5B0CA 3BJYA 2I8EA 2QT7A 2ZKTA 3TVZA 3ZZYA 2WVFA 3DHWC 2V4RA 3H5YA 2HAFA 4ECXA 2F4VJ 3QRPA 4C8MA 2K1RA 4DX5A 3S8SA 4X4OA 4I2PA 4ZP6A 3VGVA 3AJDA 1WEZA 3GWCA 4A48A 4Q5VA 4C4WA 4L73A 3CJ3A 2CDRB 3SV4A 1PYOB 1H6KX 2WK4A 1IWAA 4RW9B 1SQFA 1SUQA 3DDKA 2E5GA 3KWMA 3FNNA 2H4WB 3LP2B 2F8HA 1DTTA 2V8HA 3W65A 2M3DA 1SL0A 3DMJA 3NP5A 4PQAA 2MY8A 4QPXA 2A0FB 2WB4A 3D3CJ 4M5LA 4ZPDA 4Y2IA 1WKLA 1DLOA 1M5KC 4DCJB 2DEJA 3CNQP 2F40A 2PGCA 2RE1A 2LMIA 3HPOA 1A0OB 2N3LA 3CJQA 4RW7B 4DPOA 3HHLC 1Q95G 1RLCL 1OQ6A 1FJEB 2Z57B 1OIAA 3GYXB 2AIRB 5ADZA 3PY8A 1XQIA 4TU7A 1RT1B 4D3GA 3FJ2A 1WOPA 2E66A 4HTJA 4WF9Q 5A8RA 1Y3KA 2LDIA 2MZSA 4EYHB 1FI4A 2R7TA 1Q5YA 1FRKA 5C24B 3W2VB 3RTVA 3Q0AA 1JKHB 1UEVA 4ENOA 1R0AB 1UAWA 2ZZTA 5I4MA 1UA1A 2XZTB 1SH2A 2YX1A 2CUYA 4QPTA 3C16A 4DQPA 3BF4A 3IS9A 1TK0A 1ZOTA 3H2UB 3Q8YA 3TI0A 4CLSA 1MN9A 4A8SA 2HWTA 4M5DB 1VHFA 1VBKA 3D28A 3P45B 1JLAA 2NXUA 1VQ7S 3LPEA 4C8YA 2JL9A 1WDDA 1RK8A 6FDRA 3CF5Q 2FVRA 3J80Y 1G4CA 2EG1A 2QG9B 1U6ZA 1ZM3A 2CZVC 4H4OB 2ZJRQ 4ECWA 2Z30B 3I0RB 3JQKA 4ZKAA 2LXFA 3B4DA 4IQXA 1VRTB 5KG2A 4J7CA 3OBIA 2EXUA 1VS3A 3U27A 3Q2TC 4FYDA 1N8RT 2KTQA 2BRKA 4IG3A 2ZUGA 3KJFB 3CCTA 4NZ7A 1XMOF 3DI6A 3IS9B 4KB7A 3TX8A 2A6MA 4IFVB 4QIFA 1LW2B 4LT6A 1RT2B 1V6HA 4I2QA 2CNKB 1IBKF 5DQHA 2QMXA 1REVB 1PGZA 3BKUA 2DHSA 1SB6A 3OTOF 3BBBA 2GVZB 3FZBA 3OFHA 1OY6A 2IRXA 2YNHB 1HQEB 1UMJA 4GVBB 5HVHA 5KFNA 4EBEA 3RRHA 4CH7A 3NNAA 1Q1KA 3X1LB 2NUHA 3CDEA 3DNCA 2HNZB 1LK5A 2F9JA 1O6XA 4PCQA 2BEFA 5KFLA 1B99A 1HBNB 2IM2A 2XBPA 4UOGA 3SXLA 4K4TA 4LFCF 3T41A 3NNCA 1VRQC 2WBMA 5ETMA 4ETZA 3K5OA 4G65A 3FSIA 1IQZA 3WIVA 1NKCA 3KOAA 2HHQA 3A8JA 3BGRA 1HNWF 4NX9A 1HNZJ 1Q8KA 1TUVA 3TO8A 2A1BA 4ZVGA 2AEMA 3H5UA 3K17A 2CQ4A 5CHCB 3UN5A 1HMVA 4OYBA 4ZJQA 3MEEB 4QZVB 2L3MA 1PAEX 3A13A 3POTA 3R9LA 3NNHA 3V6KA 3Q8QB 4K5RA 1L3VA 2VG7B 4KKOA 5LJ5Y 3JS9A 4I67A 5KG7A 4MFBA 1KSPA 4J9NA 5AT1B 2NYHA 3AB2B 2W8LA 1T8EA 1B7FA 1U26A 1BUXA 2QIFA 1TVRA 1T9XA 2CPYA 3D0IE 8ATCB 2ILYA 5J2QA 4I6YA 2OIHA 2FJBB 5EWGA 1URNA 2QJ3A 2B6AB 1LW2A 3M8WA 4OLPA 2R2RA 3PEJA 3BQ1A 2BYCA 4IOCQ 2HHHF 2XY7A 4NLGA 1R0AA 5IM0A 3VQTA 1ZYQA 1RTIB 3U1MA 1LNQA 2DITA 1VJQA 4DR5F 4G1QB 2DRBA 3UCGA 3GJQB 4PPZA 4AL5A 4IKAA 1O0PA 3LP1B 2RU9A 1U1KA 1S97A 4QU7A 4PQUA 1FJ7A 2HHXA 5B0EA 2JOQA 3TNVA 1F3VA 1SL2A 1PBUA 2W9AA 1D1UA 2CQHA 2CPJA 2ZVSA 3DGVA 1HD0A 2PIIA 2KM8B 3DC2A 3M7VA 2UUBF 3WDOA 1A9NB 3NGRA 3QT6A 5AXLA 2VJVA 5F41A 5CYQB 4UY85 2DHAA 2CQ0A 3MI7X 3P5TL 4USIA 1C2PA 4NLQA 2FHMA 1WHVA 4WXWA 4DR2J 2R7SA 1YJTA 2GIRA 4K59A 2MGZB 1XR5A 2ZD1A 3OJUA 3ISND 4J91A 1VMBA 4C3MA 3SI8A 3GLJA 2KJVA 3PIPQ 3KLGA 2B9XA 1SL1A 1RTHA 2LXIA 4M5IA 4Y65A 1RWMB 2JJ4D 2PMZD 4DS4A 2MQ8A 3FBBA 4GRSA 1Y7PA 2RIJA 1IM4A 2OPPA 1S0VA 1YZ6A 5B09A 5DM7Q 1G6BA 2H5IB 5IS2A 4CIOA 2UUCF 3J7AN 2CNLB 2MQPA 2ZH8A 3SMZA 4B9LA 4MK9A 1FWKA 2VPWB 3BO4A 1QLNA 2NSCA 2IA6A 1HBOA 3AD9C 1KBRA 2CADA 2DIUA 1ZAVA 3PRBA 4P7TA 4B08A 1E6VA 1RWKB 1TTHB 2R7WA 1GMVA 1JLFB 2HGMA 1QDUB 3PKYA 4N76A 3R5DA 2DR9A 1IXKA 1EX8A 1KTQA 3FEXB 5HBMA 2OI2A 3RW7A 5A0YB 1M5VC 3PRVA 4JI3J 4JV1A 1RHQB 4WZMA 3JYTB 3FDSA 2F63A 4NI2B 1UPPA 5DS7A 1SCJB 2XI3A 4HTIA 1ULRA 3MD3A 4X84A 4YP3A 5IFMA 4LF9J 1ROFA 4DR7J 3MAAB 1H38A 3FCHA 3I32A 2MTLA 3LH2S 2YWKA 5K8MA 2UVUA 4LRCA 1EKSA 4P2FA 6AT1B 5KT2A 1I94J 5KFBA 3DFEA 2GHVC 2PE8A 3SCKE 5D0GA 4FKXA 3EXYA 1R89A 4JI2F 3W62A 4F3QA 3O8WA 4OYOA 5KG6A 3VGSA 3I9ZA 1FTRA 1T94A 2EFPA 3D6MB 4O44A 2AGQA 2QA4G 3M8PA 3MUVP 5HO4A 2GAHC 4Q8FA 1RT2A 3I5CA 1OQ3A 2Y1RI 4I2QB 4JI8F 4DZ6A 4O3SA 2VOPA 4YR0A 3MXHP 5T7LA 1CJKB 2DHGA 3BDEA 4PG4A 4R0EA 3GG1A 3R8YA 3TJ9A 4EWTA 2VL1A 5BR8J 1S76D 3UN2A 2VUGA 3BPSP 2JEGA 2D74B 2KFYA 3N0VA 3TQEA 4QOTA 1FVQA 3IXQA 4OHXA 1PG5B 2Y0BB 4ZP8A 5KFQA 5KFEA 1S4EA 3GR0A 5A8WA 5LT5A 1V3RA 3ISZA 3OLBA 2DIVA 2DHHA 3ZZPA 2RD5C 3DYAA 1WKKA 2KVQE 2CJBA 3M1VA 4O4RA 4WP9A 4AYBD 1S79A 4YHHJ 5GAHI 3TANA 4C0BA 2RUGA 1IUJA 3LOUA 4WPAA 2VF3A 3BV8A 3IO1A 2C2MB 1AA1B 5T7LB 4C97A 4USKA 2UV8G 1IKWB 5IWAF 4OMFG 1WTBA 4ZVFA 4DN9A 2LDYA 3DLEB 1Q81T 1QVFR 2QX0A 4JI0F 3G4SS 3GIRA 1XK8A 2QV6A 3MEDA 4ZJLA 3SDEB 1S1TB 2HGNA 1QUPA 2JSXA 1KLNA 1LWCB 2VG5B 2KKHA 1MMNA 1FFSB 2E44A 4HT7A 4NLXA 1ZA2B 4V1Ak 1JJHA 5ETPA 4EEYA 4NLTA 4TLQA 3U1NA 5KG0A 3W8GA 1VQ8S 4OJGA 2GMLA 2GV1A 2LKZA 2QN6B 4PAAA 1N56A 4V19X 2CJXB 4DPXA 2I0XA 5IWAJ 1FT8A 3N6NA 4M1KA 3BM7A 3W3SA 4NI2A 2HFUA 2B7BB 3T1YJ 2R8GA 1YX2A 2GQ2A 4X4QA 3AODA 4NXMJ 2MSSA 1FWLA 5KG1A 5DLFA 4DR4F 3PDNA 1C4CA 3ITHA 1BQMB 2VC1A 4CO0A 2IVFB 2AYGA 2EBGA 2CPZA 2KFNA 2EWHA 2K8GA 3CD7A 3C8YA 2A3JA 3FRZA 4M5GA 2BE7D 3THTA 2ZHBA 3SBMA 1SJ1A 4UUXA 2ZE2B 3MUTP 3LO3A 3TZZA 1I6JA 4RKUC 2F5GA 4EO8A 2H5EA 1H73A 3HP6A 2BKNA 4FYYB 1NSKL 1EP4A 2IJFA 1VIXA 3J81Y 1IBCB 3M8QB 2GO9A 1GNKA 5EUHA 3C14A 4RW8A 3VV2B 4DEZA 4C8OA 4FBUA 1MG7A 5DM6Q 4ZDNA 3V81B 3QJLA 1X5SA 3EVMA 3AAWB 5DLGA 4P72A 3GCXP 1F9EB 3UCUP 1ICEB 1Y10A 3KUGA 5H1SV 2E1MC 4I1TA 1TKXB 4PXDA 4ECQA 1PO6A 5BXIA 4OI2A 2AEJA 3I6PA 4NLVA 2OLWA 2APOA 2JFKA 3M8ZA 5J2MB 1J5EJ 4ED4A 3K5NA 5HATA 1VQ9S 2C2OB 3FCWA 5LMNF 1U2RA 1YJ7A 1PC4A 4Q2LA 1HR0F 2B7CB 2DRAA 2QL5B 1QJHA 4OI3A 4NCBA 2YWWA 3O6QA 3EWGA 4ZCIA 3DRSB 4DV0F 1RWNB 1GXUA 3SSSA 2CQPA 4RU9A 5EHHA 4DF4A 3D6FB 2B8PA 1KLMB 4DUZF 1EKRA 3MMJA 1QTMA 4B3RJ 2UUBJ 4DL3A 1KNZA 2P2CB 1SPBP 4NCGA 4MYUA 4IFYB 4WIIA 3ZTSA 1UETA 5L9NA 5DQIA 5AJ3F 2ZDOA 5IOLA 3J81U 4ECTA 2RDJA 5J1NA 5B0DA 4YB1P 1PJ5A 2HNYA 2GIFA 1J5OA 1RISA 3H25A 4USJC 3T1HJ 3EDQB 2UXBF 3OL9A 3GJRB 2IDEA 4NA3A 3M2UA 3W7BA 4URSA 2UUWA 3HI9A 4LF6F 4FF4A 3P5BP 1RWUA 2M4MA 4HACA 5L46A 2DNRA 7AT1B 1FK9B 2BANB 2DEIA 2MKJA 3PTWA 4LBHA 2WRMA 2IA0A 4MK8A 5DDPC 4AXJA 5J2QB 5DGAA 4O3RA 3NMAA 2VIHA 1S0NA 1GMWA 4DL7A 1B70B 3EZUA 2Q3PA 1FFGB 5KFUA 4ELVA 2W01A 3JSMA 1R3NA 2KFZA 2OFGX 3NOGA 3B82A 3IAS9 3UN3A 3NGDA 2XMAA 3HXMA 2H48B 3R1LA 2RHQB 3HHKA 2XNRA 4X62J 4FF1A 4ED1A 2XGQA 3GSIA 1TKTB 4ZS6A 4DU7A 4DR5J 2X1GA 4DSJA 2NQPA 3WZ0A 3UFCX 2XS7A 5CYMB 3MMAB 3VZHA 5CYJA 4LF2A 3FEZA 1JLCA 3K7RA 3CD5A 2WB1D 3LAKA 5LL6d 4X4RA 5JVHQ 4PXEA 2DISA 3T6JA 3GIJA 4DV1J 1SC3B 2HMIB 3HSGA 3FCVA 3NGUA 2ZH9A 1R7IA 3H5XA 1RAJA 4ZVEA 3AOCA 1QTNB 3EVOA 3KLEB 2UUTA 3MF5A 4JV2A 3A8IA 2UVVA 4ZPWR 2WTFA 3CJTA 1U1LA 2IAJB 3KG0A 5LJ3Y 4FVMA 4UUWA 3QLHA 3MAAA 1KFSA 3R2CJ 2UV8A 2K7JA 3MCNA 4ES1A 2UVWA 2HZVA 2VFTA 3L7OA 1FKOA 1RI7A 4PG6A 4OI4A 4XTTA 4F36A 4DV1F 2UUAF 3RRGA 1UZHA 5KFSA 3FC9A 5C2GA 1V3ZA 1TV6A 1HNXJ 3AJ2A 3G82B 2WSCC 1TZ0A 1S72S 1NK5A 1A7GE 1REGX 2UU9J 1Z4UA 1Q53A 4TNOA 2PFFB 2L48A 1RB0A 4HT5A 4O3QA 3E2EA 3MHYA 1KQSR 4F4YA 1JLEA 2MEWA 4CH1A 1VBXA 1C0TB 3CO9A 1FVSA 2GX8A 1MSWD 2Y0SD 4C8LA 4M5NA 3ZNJ1 4DXLA 3H90A 2IM3A 2B9YA 1IN0A 3PNIA 5KFOA 1W2IA 4RBUA 5H9FJ 2ZHAA 4P6QA 5ETLA 4DV2F 2LEBA 3DRXA 4C0HA 5U47A 1FRXA 4H54A 3JQJA 3W2VA 1SKRA 2BANA 3HX9A 3IG1B 2J9DE 1MU2A 2KXFA 1VQPS 2ASYA 5D4PA 4BWMA 2IAJA 2HSEB 1M1HA 3ZC4A 2QE5A 2F65A 4K50A 4OV6A 4X65J 4B9NA 2IM1A 4CRJA 2H54B 3EVWA 3L7PA 3NS5A 3MD1A 2MQQA 3H0PA 4KHRA 1GXLA 4BC7A 4CT9A 2CQCA 2JDJA 1WWHA 1RP5A 3RBXA 2UP1A 1MWQA 4ELTA 1QY7A 3MMBA 1WOSA 2FLOA 2V5HG 2N4DA 3CCLS 2VBXA 3PJXA 2DGXA 1X8DA 1HLWA 3CMES 1RHRB 2RHSB 3KLHA 3M30A 1IWGA 3VWSA 3HZGA 3KLFA 4EI2A 1V9OA 4LRFA 2Z2YB 2H9ZA 1DQAA 1VLOA 3BPDA 3FQLA 3HFZB 4ZVHA 1IBMF 2BMBA 3RU0A 3W63A 2RDIA 2CNNB 4O0NA 4CLTA 3AXMA 1DHMA 2XWXA 5EWEA 2LU1A 3G2XA 4HHUA 5SUHA 2WVBA 2AJQA 3QBCA 1QSYA 4P71A 5IZHA 2KHCA 2LVWA 3S6EA 5KFMA 5DJBA 1RAEB 1YGYA 4RU2A 4HKQA 4DSLA 3IRWP 5E5NA 4ER8A 3QWPA 5GAEI 4C2MA 2BR0A 4DQIA 3HD1A 3G8TA 3C3LA 5H9FK 4F0HA 5EX0A 4HH0A 1HWLA 1DQ8A 2C3YA 1FK9A 2JFDA 2ZEJA 4IO1A 4RO0A 5L1JA 4DJBA 5L1KA 4CTAB 1ZPWX 2UUCJ 3VAFA 2DGQA 1FDDA 4JI6J 3LW5C 2WCXA 1RTIA 4RBVA 2J6TA 4LF8F 2EC0A 2NYIA 2CAJA 2P6TA 3R5CA 1N33F 5BYSA 4NYPA 1N0UA 3JB9k 2IVYA 3M6UA 4YHHF 3C6TA 1RYSA 2PEHA 3D0HE 5JUMA 2BE9B 3MM7B 4C8ZA 4AT1B 4AQYF 5KFGA 2ZOMA 1RAIB 2M0GB 1W25A 5KFAA 4R8UB 4ZPVR 3ENWA
chains in the Genus database with same CATH topology
2Z4PA 1TK8A 4DV6F 2YY3A 3OTEA 5KFTA 4OI1A 2QYCA 4OJHA 4RLEA 2IJNA 1G7CB 4G1IA 2OPSB 3OHBA 1ZAWA 2ZOGA 1JLGB 5A6PA 2FVQA 3M8QA 1Y9OA 1BD6A 1VBZA 4WTYA 3G6ES 4NLWA 2FJVA 3M2VA 1RT5B 4B9UA 2PO4A 2D9OA 5A8WB 2AJ0A 3H2VE 1UJ6A 4O0IA 5GADU 4ZLPA 1T02A 3RRKA 2C28A 2RS2A 3CC4S 2AW0A 3V81A 3DM2A 5IM0B 5DQGA 4ES2A 4OHWA 1TV6B 4NZ0A 5J1EA 1K1QA 4Y2CA 3DDNA 3X3UA 3MPWA 3LGMA 2OTLS 3D5MA 1OSDA 3ZZTA 1HNVA 2EBEA 2ZZMA 2AGOA 4EBCA 1VQ6S 1SIZA 1Q78A 1NK0A 1QE1A 4ZOSA 4DDFA 4MIAA 5F8HA 2I5JB 1M0SA 2BV3A 6FD1A 4RNNA 2K2PA 4ZPAA 4IOAQ 2B5JB 1D8YA 2OMLA 3M6VA 5D3GB 1Z1ZA 2J9EA 2BACA 3OVBA 1QSSA 3SFGA 4OI6A 2R8KA 4K5SA 4JV0A 1SQEA 2OH2A 3GFHA 2ACYA 1QM9A 4DMZA 2RT3A 3H98A 3NCPA 5A0YA 3CCRS 4DL0C 2C2RA 5BYRA 1XMBA 4Y28C 4Q44A 5KFKA 4C3KA 4KR0B 4NYOA 1IBLF 2QSFA 1L3KA 2FY1A 4H4OA 2MYFA 4ECZA 4CQ1A 4NXMF 3NS6A 2MMYA 1H2UX 3CJ2A 2KO1A 2R8IA 1R6YA 1BQNB 4RNFA 1YHQS 1FRJA 1RJJA 4O3OA 1NHVA 1Z2ZA 3NWGA 2DGSA 2XHWA 4X4UA 4FZVA 2KN4A 4H4KC 4J9KA 1P1LA 4F26A 3QGIA 1FTCA 2E1CA 2JEJA 4ED7A 5FLXY 3RB4A 4TU9A 2FIUA 1S6PB 2EFVA 3MPYA 1X5TA 3HKZD 4WE1B 5JVGQ 4CO2A 1TKZA 3R5AA 5F3ZA 2WONB 1R8CA 4MYTA 4ZK7M 1SJFA 2F3JA 5GAEU 3CCUS 2RKIB 4DFKA 4DG1B 2W25A 5J2PB 1U6FA 1KS2A 2B56A 3OL6A 1S1XB 1X4FA 2W7AA 3V2UC 2MXYA 4ATNA 2DR8A 1RT6A 2YQ3A 4J9OA 3SV3A 3HLUA 3GIIA 1O8BA 2EK6A 4JI7F 3VAIA 4J37A 5C42B 2ZC3A 4KT0C 1KHWA 2DNQA 2FHJA 1BWEA 1CG2A 3T9NA 3MR3A 3V6DA 2J0QD 2U2FA 2V4JB 3MAQA 1SC6A 2WW8A 1S6OA 4Z37A 1SH0A 3HM9A 2HG4A 2B9WA 2W9CA 4DQQA 5HROB 3D54A 2BJEA 1U7LA 1RTDB 3G71S 3CSKA 1DTTB 2DPJA 2KZMA 5K5MA 2JEFA 1RGVA 1K0TA 3IWNC 3KK2B 1D8ZA 4TQRA 4WJBA 2YKAA 1NH8A 1J2VA 1GAOA 4NA1A 4DS5A 3QAUA 1F2GA 4HEA9 3DLGA 1GQEA 3F41A 2I1RA 2YH1A 4TYBA 2K1RB 3TUZC 1G1XA 3I5BA 3JTPA 1XMQF 2NUUG 5KFVA 4Q43A 4PG8A 2EKYA 2IBOA 4FN5A 5IT4A 5D4NA 4U7CA 2OMOA 3PHEA 4DF8A 1LK7A 2Q43A 4X4PA 2RNEA 3HDSA 3SSQA 1VRTA 2RILA 3MM5B 3KFWX 3VQSA 1VQ5S 4A8FA 2XSJA 5FDLB 4ZCKA 1IKXB 3PX6A 3HKWA 4XAKA 1JLQA 3I87A 1QAIA 2DB1A 1TL1B 2EK1A 3H20A 3PV8A 2DNZA 1S0OA 1HYSB 2HHPA 2G4BA 2BW2A 3J7YU 2ZH3A 2Q79A 5ITHA 2Z0GA 4KBIA 3CT9A 4H4MB 2ZJQQ 3DRPB 2YNIB 1IR0A 2VD3A 2LA6A 3O2IA 2FLNA 1YJVA 4JUZA 3DN9A 2J5AA 3BGLA 1NEEA 3ETOA 4LQ9A 4IG3B 3NLCA 2MDAA 2Z2LA 4KC5A 4QIGA 3CD6S 4OZLA 4R25A 2FJWA 2AP6A 1A6LA 4OX7A 4AL7A 2Q1LA 4PWUA 5T41A 1C1CA 3OUYB 2LECA 2HMIA 2QA2A 3MM6A 4PWDB 4DN0A 4AE5A 4YY3F 4AFFA 2YNGA 2XMWA 2JLGA 4X62F 3GV5B 4H4MA 1FHTA 1LXJA 3MPVA 1T05B 1YJ9S 1P27B 2GCFA 2KXHA 3UWTA 1O51A 2MZTA 5HMYA 2XWYA 5CYMA 2VC0A 2R8HA 2CJKA 2QLXA 4G6VB 3TAMB 3H40A 1SKSA 3DM2B 1NJZA 1B64A 3F73A 4NL5A 3I0SB 2W4DA 4ICLB 1LQ9A 1HWKA 3BSAA 1IJEB 3J7Z5 4QWAA 4DSKA 2M70A 1REVA 4HH1A 3GILA 4NLRA 2NZ4A 1ZZNA 3KK1A 4LIRA 3JAMY 5IXUA 2VB6A 1B0VA 2B4VA 2OSQA 1CEZA 5C42A 4OL8A 3N6MA 3TRGA 1TKTA 1YJNS 3T9ZA 3V4IB 2CPXA 5D3GA 3MOJB 5LXRA 3QGPA 4IDKA 5KG4A 4F67A 2GMHA 4QIVA 3CPWR 4MKAA 3UW1A 3IN5A 2QZ8A 4I6WA 3JSMB 4UQGA 1VLYA 4KGKA 3OV7A 1Y0HA 2AX1A 1H98A 4NLDA 5THWA 3UDLA 1D3WA 1FRMA 2YWFA 4ILLA 2B0GA 3TUJC 4CO1A 1RT7A 3MGJA 4DWIA 4XPEA 1RTDA 1FE4A 1NHUA 2LCWA 3L95X 1PC5A 5LSOA 4YHHF 3T1YF 1FE0A 2HVIA 3RBDA 4I4BA 3SZ2A 3VAGA 4RW6B 4KPYA 4L72B 4RNMA 4RWWA 4IQMA 1RT4A 1HWJA 3DLGB 1WHWA 3PR4A 1M1KT 3KG1A 4K4WA 3OFFA 1VQKS 5KOWA 4MFBB 1U1MA 2FGOA 2IMOA 1CC8A 4QR2A 4EFAC 1NJWA 2HFZA 3E3XA 1RYRA 4FS2A 4HI2A 1DQ9A 1NAQA 3CC7S 2BVZA 4IYQA 5M2UA 4IDKB 3K57A 3IR5B 2QFJA 2LEAA 3MEKA 2XZWA 3FSXA 4U6PA 2DGOA 2DH7A 3N01A 1T05A 1NJIT 1F5CA 2RKIA 4LF4F 4QCLA 1XERA 4Y0FA 3TQ1A 4YDDB 1VQYA 4JV5F 2FGCA 1GH8A 5KT4A 5KFCA 2E5IA 2CG4A 1H3DA 3KK3A 1NK9A 2O1PA 2J8AA 1VI7A 4NCGB 2VA2A 5KFDA 1HI8A 3EGNA 1YRTA 2CVEA 5I3UB 5HLFB 5IT9Y 3I56S 2ZH2A 2LXUA 3BR9A 2DR5A 1I1GA 2RSQA 3H59A 4LIWA 2R7RA 3NMRA 1BC6A 3IG1A 2IFXA 4EYIB 3A1YG 4U7UK 4I69A 1X4HA 3CDAA 3HF5A 3DU6A 1HHSA 2KXNB 2EFGA 1SJRA 4C98A 2Q6BA 2GQQA 2YH0A 3DRYA 4KRWA 4A47A 4ETXA 2R7XA 2QLWA 3MM6B 3G86A 4KJIA 4HLBA 2XC9A 2HIQA 1WG1A 4WK1A 4YB7A 3M4XA 3M2VB 1DTQB 3OFEA 4PR6A 1FF2A 3SDEA 3R1HA 4ZPTR 5E3CA 4C8KA 2GHWA 2M52A 2DGVA 3MOZA 4TU8A 3IGVA 4WYWA 1N32F 2KU7A 1Q4RA 5F8GA 1WG4A 2MKCA 5KFIA 5A2QY 1QAYA 1SKWA 2PC6A 4W90B 2R8JA 3TUIC 1ZAXA 1WF2A 1HQEA 4FNHA 1NK7A 3HHDA 2HS0A 2CJAA 3EPIA 1SJ4P 3HK2A 3G96A 3D1OA 1HNXF 3E01A 3CXCR 1PILA 2IMWP 2C3OA 5G0RA 1LV5A 5I3QA 1X4EA 3DLKB 2OPRB 4LSNA 4GO7X 5CZXA 4GMKA 4OZ0A 1FCAA 2LA4A 5GMKa 2VPZB 3N5BA 3ONQA 1HHTP 2W9BB 2ZH5A 3V81B 4D3HA 4ED5A 2AX0A 4DOZA 3J7ZT 4NMLA 4KFBA 2JZ5A 2KM8C 2ATLA 2DNNA 5BJRA 1LOUA 1JLFA 1ZTWA 1MWYA 4WFYA 3RAMA 2J6SA 3V6JA 1KN6A 1KHVA 4OLOA 5D4OA 4F4KA 2C3PA 4ECYA 2ZITA 2M88A 4CZCA 1XNRF 3KHGA 2OO4A 1NO8A 5EDWA 4J9PA 4DV5F 3DRRA 4RW7A 4Y34A 2L9WA 4RW6A 3Q22A 3IGNA 3V4MA 3J7YI 2EFOA 1P8GA 5HL7Q 1TR0A 3O1LA 3O5TB 3PW2A 4LFBF 2FJAB 1WELA 1YTYA 5A8RB 1Y00A 5HQ8A 2JLFA 4I64A 1N5QA 3N28A 3QIPB 4YDXA 1EETB 1FDBA 2KJWA 3K2YA 5KFRA 3CGIA 3B8HA 2C2EA 2B4UA 5GAHU 1HWIA 1KRPA 1F0XA 1NNDA 5IQ6A 4B3SF 3PIOQ 4MAKA 3KLIA 1XR7A 3MECB 3H4DA 4IR1A 3BZQA 1FNMA 1B0TA 1NRKA 1NK4A 3DXBA 3GFXA 1HI0P 1Y5NB 3MMBB 5C5JA 2R2TA 5KT7A 2HVHA 5D4LA 1D9DA 3HHLD 2MPUA 4DV7F 3MMCB 4DSEA 2X1BA 4EZ9A 3CULA 4A46A 3IBWA 3OVAA 1YIJS 3FRYA 4FXWA 1WF0A 4UQTA 1U45A 1N36F 2FLPA 2BABA 3CIZA 3BR8A 2D3UA 5HBMB 3GFYA 2DO0A 2DK2A 1Q7YT 4LQ3A 4TYAA 3SQGB 3AA9A 5AE3A 2IM0A 2AYEA 4NWBA 4K4YA 4GKKF 3CWJA 5L8RC 5B08A 3AQOA 4YR3A 2O01C 4ID5A 3KHRA 2ASJA 1UWBA 1OWXA 4J9SA 1UL3A 2XMMA 5KG3A 4DV4F 4N8OA 1T3OA 3FMBA 4DL2A 4AUKA 2FTRA 4B02A 1K8AT 1S9GA 3QWUA 1JNRB 1O5JA 2O67A 3PEHA 5DO2A 2J0WA 1UW4A 2XMTA 3L09A 3N79A 2XULA 4XO0A 1TL3A 1SJQA 4JI6F 1S1XA 2BUNA 2YNIA 1WACA 3V5RA 5DDRC 4MH8A 4CI0B 1N5YB 4L3NA 2D41A 3PO4A 5HMXA 4KHPF 2XCAA 4MK7A 1ZH5A 1RTJB 4WE1A 4BC9A 2ROGA 4IH6A 3IRXA 3MEDB 1VQ4S 1W2BR 4ALZA 2OPQA 2MQMA 3JSRA 3SSRA 3OTDA 4E8UA 3MM5A 3G6VA 3OR1A 1JJ2R 1DBDA 2RF2B 2R7OA 3R3TA 4LFAF 2XI2A 5E7OB 3EGWB 2M5YA 2GJ2A 2YKPA 3ICLA 2I2YA 1JLGA 1KQGB 1KC8T 2B3TB 2LEPA 2NLWA 1PSDA 1HBNA 4EU0A 2VV5A 2N7CA 5B0AA 4QWBA 1S0MA 3Q8SB 2GHPA 3I4PA 1S9GB 3HVRA 1X0FA 3TVYA 2QRRA 2VBWA 1Q7LB 2PI4A 3OL7A 3C46A 3D1HA 5DGBA 2BRLA 4PUOB 4DL4A 2E9ZA 2X1FA 3MUMP 4ECRA 1IKXA 2ZNZA 2BE2A 4NA2A 2GNKA 2W7OA 2E29A 2RQ4A 1MMLA 2BZ2A 4C11B 1WEYA 2G0CA 4B9TA 4ELUA 1X9WA 3PR5B 4IRKA 1N5YA 3KKFA 2IC3B 5DG8A 2ADCA 1UA0A 4K2XA 4Q0BB 1JWWA 1VC5A 1U49A 4ECSA 4ZMMA 4N41A 4M94A 3P49B 5KT6A 3DMJB 4URQU 4JI4F 2CPIA 4DFPA 3PRDA 4I56A 2VOOA 3PJWA 3CVKA 3AH6A 3GFZA 4EUVA 2F7VA 2G1DA 1FDAA 2IHR1 2B43A 5L39A 2COLA 3CEDA 1UFLA 2PDAA 4USHA 3KLEA 3LF0A 5E0OA 5K9FA 4K0KF 2HLTA 2QEXS 4OIXA 4ERDA 4A8XA 3OJSA 4X4SA 3MM8A 2BM1A 3FQKA 2KHDA 3DOMA 3KNAA 3R5BA 5KFJA 2ZH7A 2VZ9A 3HFKA 5I3UA 1FRLA 5HLFA 2J7KA 3GIMA 4KAIA 4OZ5A 3M6XA 5L38A 2BOPA 3ISNC 4X4NA 1VRUB 2BBEA 3RB0A 4P2SA 1IKVB 1Q8BA 3M9MB 2R2UA 1MWZA 3MZIA 4TN2A 5KFYA 2Z2MA 2DNPA 2ZDPA 4A8QA 4ED8A 1VQSA 2XEXA 3E8OA 3I5AA 2CPDA 3JSYA 4DQRA 4ED0A 4YOEA 4QW9A 1YG0A 4K4ZA 3CJ5A 4CO5A 3DHXA 4DX8H 2V94A 2MJNA 3KJVA 2N82B 1LWFA 1VQOS 4ED3A 1R8PA 2VFVA 1D0EA 1X4CA 2AU0A 2AV5A 1N6QA 3EPGA 1BQMA 3LP1A 4QYZJ 1QAXA 2JVOA