3IWXA

Crystal structure of cisplatin bound to a human copper chaperone (dimer)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
b'PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
molecule tags Metal transport
source organism Homo sapiens
publication title Crystal structures of cisplatin bound to a human copper chaperone.
pubmed doi rcsb
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iwxA00
4Y2KA 3F44A 5B0GA 2XMMA 1APSA 2GFFA 2IYGA 2AW0A 3IWLA 4A48A 2CRLA 2RMLA 4Y2MA 2KT2A 3HFKA 1S6OA 3TRGA 2N4DA 2BUNA 2XMKA 1FESA 2JDJA 5B0BA 4HI2A 1K0VA 2W4CA 4OJ1A 4ZOSA 4Y2IA 3HF5A 2FB0A 1MWYA 4A4JA 3HHLD 2QYCA 2W4DA 1SB6A 2ZDPA 4HI1A 1X8DA 3FGVA 1Y3JA 3WDOA 3BR8A 4ZA1A 2W4PA 1TL5A 2HFOA 4HL9A 2AJ0A 1MWZA 3QGPA 4OJHA 1X7VA 3KKFA 5T7LA 3CJKB 3IWXA 5T7LB 1Q8LA 4OJGA 1TZ0A 3BDEA 2XMVA 1N5TA 2QIFA 4YDXA 3VTIA 2K7JA 2ROGA 4YEAA 2HIQA 2ROEA 2G9OA 2ZDOA 2KYZA 4QOTA 5B0FA 2VH7A 1Q8BA 3KG1A 1FE4A 3HDSA 3HX9A 1OSDA 1QUPA 2OP5A 1W2IA 5A6PA 3BB5A 2KT3A 1FVSA 2GV1A 2KKHA 4FNIA 3KG0A 2PGCA 4OIXA 1Y9OA 1JK9B 1CPZA 5F0UA 4DL0C 1OPZA 2IYIA 3MCSA 4FNHA 4Q2LA 1P6TA 2K1RA 5IXUA 1N5SA 2EW9A 2RU9A 4NL5A 2GA7A 3BGUA 1Q53A 1ULRA 5B0EA 3HHLC 3FRYA 5B0AA 2RSQA 1VQSA 1N5VA 2OFHX 2QLXA 3LO3A 1WD6A 1LQ9A 1AFJA 1JWWA 3UDCA 1OQ6A 2HQIA 2HLUA 2AP6A 1U7LA 1V3ZA 2BJEA 2N7YA 3BF4A 4HH1A 5KAKA 3DXSX 1P8GA 5B09A 2XMWA 1X0PA 1VQYA 2GO8A 2RILA 1FE0A 1GXUA 3QMQA 1FVQA 1URRA 4HH0A 1YJVA 3T9NA 2BJDA 1N5QA 2BBEA 2K2PA 2LQ9A 3LGMA 2FHMA 2ASYA 2LQBA 1RJJA 2XMUA 2LDIA 2QLWA 4OJ3A 3BM7A 4DN9A 4F67A 3LGNA 2XMJA 3GZ7A 2HFNA 4DPOA 1Y0HA 1FD8A 5A6WA 1GXTA 1YRXA 3MZIA 1SQEA 3TOQA 4NPOA 2GGPB 1AW0A 1CC7A 3E8OA 2ACYA 5B0DA 1TR0A 2FIUA 2IFXA 2OFGX 1R6YA 2OMOA 2OKQA 2N4CA 2OAUA 1CC8A 2PD1A 3I9ZA 3CJKA 1S6UA 5B0CA 1OQ3A 3FMBA 1IUJA 2GCFA 4Q2MA 1Q4RA 1SI9A 5B08A 1TUVA 1FEEA 3KNGA 2AJ1A 2GGPA 3K7RA 2FTRA 2K7KA 2HLTA 1KQKA 4EFAC 2LXFA 1YJUA 1YG0A 2L3MA 2ROPA 1TL4A 3HHLA 2BYCA 3HHLB 5F0WA 3DCAA 1XBWA 2K1RB 3TNVA 1KVJA 2Q3PA 1KVIA 1Y3KA 2OD6A 2XMTA 1YJRA 3BN7A 4A46A 2OD4A 2VV5A 4A47A 5K9FA 1AFIA 4U9RA 1YJTA
chains in the Genus database with same CATH superfamily
2XMMA 4IDKA 2CPJA 3QGHA 4A8OA 4TQSA 3H4DA 3G82B 4C8YA 2O5DA 1FK9A 3DRPA 4HHUA 4ZLLA 5DO2A 2W7PA 3POTA 3BSCA 1IQZA 3GG0A 4HVZA 1VI7A 4YR0A 4KH0B 5B0BA 5F8HA 2POKA 1FDNA 4F0HA 2V68A 1EKSA 1MWYA 2ZDPA 5K14B 3BKTA 3V2UC 3NEKA 4YB7A 1FK9B 2DTJA 4HHJA 1NKBA 4G1QB 5DDRC 1AZSA 4JI7J 1VIOA 1PC4A 3GJSB 5L1JA 4DR1J 1C2PA 3MF5A 5HAOA 5M2RA 2I6WA 1GTHA 2FDNA 3I56S 3CCJS 4P52A 3HSGA 1HI0P 4J5OA 3CC7S 2CQDA 5IWAJ 1U1LA 1NSAA 2AYMA 4B3RF 1GX5A 1NH8A 3PYFA 2LEBA 1IR2A 4JI2J 1B99A 3JTNA 4P75A 5ETLA 3QT5A 3FNNA 5KOXA 3W9IA 1NJIT 4RUCA 4C98A 4RBVA 2B4UA 4CYUB 3B82A 3IGVA 4LR9A 3O5TB 3THPA 5IC4B 1TFWA 3PRBA 4PPZA 3M8PA 3ICLA 2YPZA 4ZVTB 2D3O1 5FDLA 1S57A 2JNJA 1N6QB 4K4UA 2B7BB 1R3NA 3IBFB 3M8WA 4UQGA 1LK5A 4DLEA 4JYAF 3PRVA 2R2UA 1LOUA 2CADA 3ILOA 2B51A 3TUZC 3AA9A 1FWLA 2YX7A 3PCOB 3MEDA 1ZAVA 4I6YA 4FNHA 2K1RA 2MHNA 4W98A 3C66A 1AUSL 4RPFA 1FKAF 1ZOTA 3PZPA 1U1MA 4K4SA 3LP1A 5EGYA 2X3GA 2DR5A 1GH8A 2YX1A 3A3PB 3GWCA 2K8GA 2Y8YA 5F8NA 3D5MA 3GLJA 8RUCA 3EJMA 2IVMA 3NRBA 2DEJA 4MFBB 2ALYB 4R25A 2CPHA 3NXZA 5EUHA 1F9FA 3SCLE 5KFTA 4KFBB 2RRNA 1IJFB 1S9GB 1TL7A 2V2ZA 4QR1A 3SDEB 3UDCA 4DV2F 1U1OA 2VD3A 2M5YA 2HHSA 2HMIB 1HI1A 2VL1A 2YNHB 4WCEQ 2LA6A 2DYAA 3P8BB 2UVWA 2UXCJ 4J9KA 3BS9A 4E0DA 4PQAA 1VIXA 3ZZYA 1RKJA 1FVQA 3KXDA 4OI3A 5KFFA 1T02A 4E2FB 2BQUA 2ASJA 2APOA 2VBWA 5D78A 2LQ9A 2CZ4A 3D0GE 3GV8B 2VPXB 4QR2A 4DLGA 3IM8A 3V4MA 3LPEA 2RT3A 1TL3A 3W1YC 1RAAB 4C8ZA 3D6MB 1OIAA 3PTWA 2LKZA 4F4KA 1HNVB 1U0HA 2OPQA 1KOOA 5GMEA 1FNOA 2ILZA 1ZPVA 2M52A 2MQMA 3G71S 1BHNA 4X65F 1X5SA 2VPZB 1HR0J 4XIUA 4WZQA 3NGRA 4IKAA 4U6PA 4NLDA 4BC7A 3E8OA 4X66J 1T9TA 2D9PA 2ZD1A 1D9AA 4PCQA 1CC8A 2C3MA 2LA4A 1AROP 1OQ3A 3Q8YA 3M6WA 4NXMF 2GMHA 1FKPA 2AHOB 3CGIA 2ADBA 4NLTA 1Q1KA 4DSFA 1T05A 3K7RA 3NCQA 4DV1J 1KQKA 2BANA 2DNKA 3NNAA 1N33J 2ZH9A 1RADB 4IRKA 4DL5A 3CJ3A 1JJ2R 3VAFA 2M8DB 2DNLA 2FLOA 1RLDA 4LFAJ 2UXDF 2RE1A 5KFXA 4ZKAA 3CD6S 1R8BA 3QZ7A 2PSZA 2BACA 2XHCA 3QGGA 5ETOA 2QGFB 3L7PA 3VGSA 3T1AA 3BEGB 4IH5A 3OV7A 4LSLA 1SH3A 4J9OA 2A6OA 4Y2KA 1YTYA 1UFWA 3LAMA 5C24A 2VQEJ 3ENAA 2ZH1A 4RBUA 3CCES 3Q24A 1JLEB 4OYXA 4PQUB 2HRUA 2QT7A 2VFRA 3WC2A 2XG8A 4DR6J 1U1PA 4HACA 1G6BA 1IKXA 3QQCD 3TX8A 1HNXJ 1O51A 3NCPA 1XR6A 4CLFA 1XC9A 2YTCA 2LQJA 3PFEA 4PG6A 5LSLA 5KT7A 2FVQA 4BCAA 3KLHB 4ZVGA 4IOBA 2W9CA 4BWJA 1KP6A 3AODA 1KVKA 2ZITA 3PYEA 1Q8KA 3GG1A 3TW0A 5LMNJ 1VC6A 3JAMU 5H9FK 3L9ZA 2HVIA 3JS9A 2LVWA 3IWXA 1NCLA 5IV3A 4MKVA 4WFNQ 3BDEA 2XMVA 3PFOA 2Y1RI 2ROGA 3GFXA 5I3PA 3Q86A 5HK4A 1D0EA 4B9MA 3N9UC 2CNNB 1RE1B 2HGNA 4EUVA 3V6DA 3NG8A 1Y5LB 3CT9A 3KYLA 2KHCA 3MTKA 3DGVA 4I4BA 1S9FA 1Q7YT 1WKLA 2KI2A 2FLNA 5A6PA 4V19X 3GV7B 1XR7A 5BYQA 5IT0A 2A3JA 5AE3A 4DUZF 4F8RA 1BQMA 2D41A 3C6TB 3JSYA 1F0XA 3GYXB 3MM8A 4YQWA 2GS8A 3UN5A 4ES3A 2XS7A 1DTTA 4RNHA 1JK9B 2XSFA 4NWBA 3VR1A 2FZCB 4OX6A 3MCSA 4CT8A 4C11B 4ZCMA 1K47A 1LW2A 2P5VA 2V4RA 1WNEA 1NBEB 3BBFA 1Y10A 3DRYA 1U25A 1ULRA 4NRUA 2CJ9A 3DOMB 1R6VA 2VB6A 5HN0A 1N4LA 3SMZA 3PR4A 2QTWA 2C22A 1VQSA 1HNIB 2VZ9A 4FVCA 3J7ZT 3T5JA 1KSPA 3SSQA 5LJ5Y 3DGPA 2V5HG 3G82A 1HYSB 1N36F 3H0PA 4HH1A 4YHHJ 2E5HA 4CT9A 2DITA 4DCPB 1QSLA 4LFBJ 1R8AA 4B02A 5ETPA 2DIVA 4CLUA 2V4QA 3I4HX 2BMBA 3D7SB 4FYXB 4QIVA 1OY9A 3C6UB 3KLEB 3FSIA 4K4YA 1T7PA 3QFHA 1VLOA 2FY8A 5HO4A 5F8LA 2QLBB 2HHXA 2ZWOA 1AZSB 1RTIB 2DB1A 2HFVA 2CG8A 2W2QP 3CMQA 5KFYA 1RWWB 2LQ5A 2RS8A 4OYWA 2HFNA 3A8IA 5DQIA 2XO7A 2OSQA 3N79A 1W26A 1WEXA 4C0OC 3SFUA 4ZVPB 3TJ8A 1VFJA 4CLSA 3U1LA 4DR5J 3OSPA 1KFSA 1VBXA 1FDAA 4FKXA 1WTBA 3K5OA 1J27A 1NXIA 2ACYA 4C8MA 4EO8A 2MZSA 3KG4A 3ZTQA 2XLJA 2FJWA 4FBUA 2HVZA 4IQXA 5KT5A 1RWKB 1NDLA 2E5GA 1TP7A 3IRXB 1TKTB 4ZPWR 4R8UA 1N32F 1S6PA 4M5DB 2ZOFA 4WFXA 4KHRA 3VVUA 4P2XA 2FTRA 4J7CA 4JBCA 1VLYA 3ONQA 4ES1A 3I5AA 2BE2A 1VQ8S 3TAMB 3OUYA 2XNRA 3AD9C 3B6BA 2GJIA 4C4WA 2BVZA 4ZVSB 3DDNA 1JLGB 5C2CA 4DPTA 2Q3PA 2WVCA 4NLXA 2B6AA 2C2KB 3DRSA 4OI6A 4ZPCA 3TWZA 5LSRA 2HWIA 4W90B 1ACMB 1XTZA 3OR1B 4JI4J 4C8KA 3MEDB 4WXWA 4LF8J 3T6BA 2RRAA 5IZHA 1C4AA 4ZHRA 4QWAA 4JYAJ 2JEFA 1CJTA 1S4EA 4FPRA 4F4AA 1SJ3P 3PX0A 3R5AA 1VCTA 4WP8A 3EPIA 2YKQA 4AYBD 2XMAA 2HHVA 2XGPA 4RW4B 3R9LA 1FRJA 2YBVA 4ZVEA 2DGOA 1IKWB 3CNQP 3MOJB 1K0VA 4L75A 2XWYA 3NCRA 1S76D 3A1YG 3IAS9 4AL5A 1K0TA 1YI2S 3H40A 1GMWA 1NK9A 3H2VE 2E1CA 3DU5A 3EXYA 2MGZB 1DZ5A 1MROA 2NCKL 3DLLQ 4ILRA 1X7VA 2UUCF 4U7UD 1EIYB 1RTZA 3ZZ0A 3HHNB 1PKUA 2QLJB 2EFGA 2QIFA 2ZBPA 1Z2LA 2P6TA 4P7VA 4TY8A 4DV4J 3PW0A 4TY8B 5LMUF 2H9ZA 1VQOS 1XMQJ 3HI9A 1Q8BA 3G4SS 2E9RX 3DLEB 3ENVA 3RAQA 2R7XA 4UY8T 2EFOA 1U2FA 3ILLA 2HVEA 3W60A 2RQCA 2W9BA 3O6QA 4OYIA 3N28A 4IG0B 2NXEA 2YWGA 4DV7F 4F2RA 2KKHA 2XWXA 3NGKA 4RX6A 2H1YA 4DFJA 3MM9B 1XNRF 4ED5A 1WC0A 3LALA 2JSXA 5K8OA 3LPYA 2VFVA 3I96A 2Q6CA 1X4DA 3RB4A 2RF2B 3M8QA 1M1HA 1S9GA 1TL7B 2CQGA 3HVTA 3SDEA 5J2QA 2F4VJ 2LYVA 4DX8H 4D3GA 4ANEA 4EBDA 1GEHA 1RAIB 4CO3A 3FBBA 4HTJA 1VBYA 1RSCA 1OJ4A 1YZ7A 2YKMB 4AL7A 1VRTA 4NYZA 3DC2A 1LQ9A 1PBAA 2W1BA 2AQ4A 1RA7A 3JQMA 2HQDA 2HQIA 1VC5A 3AB2B 4ZCIA 5KAKA 4I6AA 5KFIA 1YITS 5L39A 4X4RA 2RILA 2F40A 3NP5A 1M0SA 4M5KA 4JI6J 3PVXA 2MLXA 4IOCQ 1RBLA 3O1LA 2IJRA 5CHCB 3PR5B 2FHMA 1Y11A 3T1YF 3AXMA 1Q16B 1XWLA 2Z2LA 3CJ8A 5DGBA 3CDEA 1FXLA 2HNZB 2GMLA 3LGNA 2QYGA 1QSSA 3IWNC 2BJ1A 3OQ2A 5J2MB 1LWXA 1QLNA 2OPPA 4CLZA 2XO6A 2B7CB 3PM9A 4ECYA 3UDVA 4DR2J 1UWAA 4NPOA 2ILYA 3Q8RB 1ZS6A 1YGYA 4ZLNA 1RU1A 2OGUA 4QZVB 1H73A 4LF6J 2QSFA 4AT1B 2LXUA 4RBTA 1HARA 4J37A 2HURA 4USHA 2HQ3A 2KM8C 1Q78A 2MDAA 2KT5A 2N4CA 3B4DA 4ICLB 3TJ9A 5K8PA 2CNKB 4ECUA 1YWXA 3OXFA 1RQ0A 3GIRA 4FXWA 4G65A 3V6JA 2J6UA 4HKQA 1CPZA 3EMTA 5F8JA 4GC6A 3SCIE 2EK1A 4DPUA 4RW7B 4X62J 3DYAB 1J5EF 1B0VA 1HPZA 2L3MA 2J0XA 3KDOA 2XBPA 3O8WA 3RW7A 4HYKA 3GSIA 3AJ1A 3U27A 3CO0P 3C3LA 1UFKA 3BYPA 3MPDA 2LLZA 5HLFB 1QUVA 3IR6B 1YJRA 2IDEA 1A6LA 4NZ7A 4DEZA 4L3KA 2E1AA 3MOZA 4AUKA 2FUG9 1UVLA 1UJ6A 4M94A 4OV1A 4MK7A 5ETQA 1NUEA 3BBCA 4A48A 4QIFA 4O4GB 3NNCA 1AXQA 3TP2A 5J1EB 3HFKA 3SEOA 3HULA 1FESA 3SCJE 2VJVA 2J9DE 1QDUB 2QMXA 1TKZA 1RLCL 3MPWA 2EI5A 4K4VA 4RW8A 2FC9A 3UE2A 1FDBA 1ROFA 1T9UA 1X60A 2MPUA 5D0GA 2E29A 4DV3F 2YNFB 2HZVA 4WIIA 3JSMA 2UVUA 4MKBA 2VA2A 1F5CA 3RB6A 2QL5B 3QIPB 4TVAB 5KFDA 3QPIA 2HFZA 1KR4A 1HBUB 4KV8A 4R0EA 2W8LA 2DGQA 3DOKA 3JTPA 4ZCKA 3D67A 3EZOA 5D0RA 4FPIA 4LFBF 4JI5F 3TR5A 3J7AN 1JLQA 3MEGA 1LW0B 4O0NA 2RQMA 2VFTA 1LFWA 4KT0C 5LMNF 3W9HA 8AT1B 2KO1A 4UOGA 2HWTA 2KVIA 1RISA 3A3OB 4HEA9 5DG9A 4TKTA 5KFOA 4YFUA 1R0AA 1UA1A 3FQKA 2GO9A 2P9CA 1NJYA 3PX4A 2FHJD 4P73A 1ZTTA 4PPDA 4QPXA 4KHPF 4N5SA 2E5LF 4ED3A 2ZFHA 3CWJA 1P1TA 3L09A 4DSKA 5FIIA 3BZQA 3CJ5A 4X4PA 1BWVA 3HVRA 1GMWD 2R8IA 1HYSA 4X4UA 1RT4A 2ZC3A 4QCLA 4JI6F 1PSDA 3CCVS 2C2DA 3FRYA 2DHGA 3FRZA 4IOAQ 4QWDA 4Q5VA 5LOQA 2E5LJ 4QWCA 2VICA 4IG3B 5KFLA 2PEHA 3Q0AA 1H0HB 1WACA 2GJ2A 2WTFA 1Q5VA 4WYLA 1TK8A 2ZH5A 4O3PA 4DV4F 5KG5A 3C14B 2HGLA 7FD1A 2YNHA 1RTJB 3DXSX 3W65A 3H2LA 2DHSA 2CAJA 2FHJA 3KJVB 4DV1F 5CABA 1VQNS 3MPUB 2FHKA 2BJDA 2ZZTA 3B54A 4LR8A 1EETB 2CQIA 2KL8A 4KE5A 4DI6A 1Y00A 3LANA 2KG1A 3EVWA 4C2MA 4ID8A 3NOCA 4F67A 3R3TA 4ZJQA 3A3NB 2G0CA 1FRXA 4KJIA 3HFZB 4Q7AA 2MY7A 2J6SA 4B3MJ 5A6WA 1IR0A 1SCJB 2JFKA 3DOLB 4OQJA 4X66F 4DL3A 3ZZPA 3OL6A 1S6PB 4M5DA 2CQCA 2HVDA 2YH1A 1CJVA 3IGNA 2JJ4D 2GGPB 3M9OB 4O4RA 4ZP9A 2RB7A 5L9NA 1K1SA 5HQLA 3SYZA 2AJFE 1FKOA 2FQQB 1IM6A 1RP5A 2FIUA 2N82B 1Y5IB 2KG0A 2DRBA 4EYIB 3FKBA 1NK7A 3FMBA 1W7WA 2LMIA 2Y1IA 1MU2A 1NJXA 3IN5A 4UF4A 3LOUA 5GAGU 3BN4A 2AJ1A 1F9EB 1FNMA 3G8QA 4B9SA 3QSIA 4F2SA 2YNGA 1T3OA 1LFPA 2XEXA 3NWRA 1AUDA 3OR2B 1RCXB 3C15B 3HKWA 3P45B 2CQPA 4IG3A 1DQ8A 2ZE2A 4BBYA 3BQ2A 3KDNA 3GIJA 4A8XA 2L9NA 4DQRA 2OD6A 2E1MC 2QFJA 2HMIA 2BZ2A 2L08A 3KLGA 4ID5A 3FQLA 2VG6A 2FVPA 3MM5A 4LSLB 2KJVA 4MFBA 3CMES 4CO5A 3F56A 1M1GA 4CO0A 1V5IB 4WYWA 2AW0A 3RUBL 5A2QU 4OZ0A 2KHDA 3EX7B 3MMCA 4DV7J 1FRIA 2A6MA 1YSJA 3FJ2A 2OIHA 5LL6d 1S48A 5IQ6A 4B9VA 1X4GA 1YIJS 4BC9A 2JDJA 5FJ4A 1JNZB 3MM6A 4EGLA 5K8MA 1NK5A 1X9SA 1BWEA 2FB0A 2KXFA 1S0NA 4JV1A 4ELUA 2IBOA 4TYAA 2VA3A 1WELA 2QG9B 2D3UA 2QA4G 3GR1A 2AEFA 1T9WA 2HFOA 4RUBA 3FK4A 2PMZD 3M4XA 4EWTA 2ZD1B 3VWSA 2CJYB 3PW5A 2MKYA 5T7LB 2CPZA 3BYRA 1H3DA 4RKUC 3CCUS 3K0JA 1N5TA 4UZCA 1YBTA 4IQMA 3UN2A 3CF5Q 4ZP7A 1HNZF 2WHOA 1B3TA 1FRLA 1VRUB 2RDDA 1CVJA 2RRBA 1RT5A 4MAKA 5KFWA 4ED7A 2ZUGA 2HNZA 1D8YA 3UW1A 2JHEA 3DLEA 1O5JA 2XY5A 2RKIA 1BLUA 4CLKA 3QJPA 2PA8D 1H72C 2V63A 2CPYA 4F4YA 2FVCA 2FJVA 1DHMA 2VU5A 3OHAA 3NBPB 1RHQB 2WOMA 4KGZB 5KG1A 9ATCB 1KTQA 4FF1A 4F26A 2M4MA 5E7OB 1X4BA 3MR5A 1D9FA 1RBOB 5C42A 3M2RB 4DZDA 1ZBTA 4LQ9A 3DHWC 3KK3B 3KHRA 3TAPA 2HGMA 2XZDB 4IUFA 5ETKA 2BX6A 3BO3A 4PYDA 2NYIA 4NI2B 5HROA 4NL5A 1IQTA 1YLXA 3KK1A 1JLBB 3DMJB 1QTMA 2XSJA 4ZJOA 3LA0A 1S1VA 1QTNB 3V5RA 2VUGA 2OFHX 1MN9A 1VQ5S 3VCDA 1KKHA 1SC4B 1DTQA 2CJBA 3POTB 4FXVA 1V3ZA 2G1HA 2MKCA 3HSZA 4MK8A 2ERRA 1S1UA 1G7CB 2NLWA 2XMWA 3QFWA 1UZDA 2J7KA 1SC3B 2DHHA 2WW4A 3K5PA 2W8KA 1HD1A 1T9XA 1BQXA 1URRA 2OO4A 2J8SA 3W8GA 1QVGR 4ZVUB 1P1LA 2BBEA 1SBRA 3GILA 1Q82T 2XHWA 3KUEA 5GAEU 5D3GA 2L9WA 2NXUA 1DTQB 2DEIA 1RJJA 2LQBA 3FSYA 1N56A 4WIQA 3SI8A 4RNFA 3RW6A 5HJYA 1Q95G 3KWMA 1HW9A 4XO0A 1FD8A 2Y1JA 4W92B 3CJRA 1YRXA 1N52B 3BBBA 3O44A 3CVKA 1CS4A 1PBUA 3U02A 4DCOB 3EGZA 4I7FA 1RHMB 1CG2A 2DRDA 4PAAA 1YRTA 2OEKA 2WB1D 1IJEB 3RU0A 4C97A 5KT4A 1TR0A 4DR1F 4B9LA 4F02A 2IFXA 1R6YA 3CJ4A 3IXQA 1SPBP 3M2RA 5CZVA 3UNGC 4ES2A 1FHTA 1S6UA 2ZEJA 4ZCLA 4ELTA 1T03A 4DQPA 5KG2A 1K1QA 2V8HA 3IM9A 3GIKA 1SUQA 1N5YB 3KJFB 1RA6A 5FDLB 2GGPA 1C4CA 4X4VA 1ITPA 1EKRA 3DOKB 3CTRA 3J81j 1S5ZA 4GMKA 2DNGA 3DN9A 2LXFA 4LSNA 1TL1A 4KGXB 3OL9A 5LT5A 4A8QA 3LP0B 3HHLB 1R27B 2ADCA 1WEZA 3BH6B 2DGTA 3FEXB 1FCAA 5A0YB 3QLHB 1UVKA 2JLGA 1UMJA 1KVIA 3IBCB 4FYVB 4I2QA 4ZS6A 3C16A 4U9RA 2E9ZA 3FSXA 4I2QB 1I94F 1F2HA 2BEFA 3F0NA 5DG7A 5FLXY 3MFHA 1NNDA 1APSA 1S12A 2KT2A 3QLHA 4B17A 1TAUA 4ECZA 1HR0F 1NZ8A 2AZ3A 2CYYA 2HPUA 3TVYA 2G0JA 4QU6A 5J2PB 3BH7B 1N32J 2UUCJ 1WC4A 4KHPJ 2A10A 5EHHA 2G0IA 5HL7Q 1X8DA 1K8AT 3H5UA 5DS7A 1SXLA 1TL5A 1DBDA 3QO9A 1F3VA 5CCLA 1HNWJ 3TEGA 3A8JA 2V8GA 5GVQA 5HBMA 1N33F 2K3IA 4LF4F 1RAJA 1G1XA 1P27B 1TUWA 3QJJA 4FYYB 3PDNA 1T9YA 3Q8QB 1UA0A 1X5OA 2NUHA 4E98A 3QJLA 4OHZA 1WHVA 2MKJA 1E6YB 2Z56B 4NLVA 4YB1P 3GQCA 4JI7F 1U0SA 1D09B 3TVKA 3NMRA 4LF8F 2O3DA 4DR7J 3MTJA 3MEGB 1U0HB 4X4NA 1B70B 2MQQA 2V2KA 3DFEA 2FJEB 3R27A 4ZITA 4B9UA 1JKHB 2BV3A 3THTA 3MM7B 1NSQA 4M5GA 4DV0J 4EZ9A 2LCWA 2M70A 3IS9B 2WONA 4M5MA 5D6GA 1FXDA 1R0CB 2WONB 3UVJB 4DL0C 4OFZA 1HW8A 2H4WB 5CAAA 2PMHA 3W2VB 2EW9A 2ZVSA 2AJ4A 2HSEB 3B4MA 5J1PA 4DQSA 1HHTP 4KGMA 2GVDB 1U6FA 4J9VA 2BOAA 4JI8F 1X31C 3M7VA 5FD1A 2XLIA 3P4UB 1IBLF 4G1PA 1L3VA 3R5BA 1X9MA 2PN6A 4B9TA 2FZKB 1KD1T 4ZHRB 4EBCA 1W25A 1FJGF 2F8MA 3JYTA 4ILMA 4C9DA 1QJHA 4USIA 1M5PC 1YJ7A 1DARA 4RW4A 1QY7A 2MSTA 1ZA1B 1U26A 2GO8A 1C1CA 2GQQA 3D6FB 3EDRB 4IO1A 4Z37A 4QW9A 2L41A 1H98A 1FJ7A 1RWXB 2R7OA 3EVMA 3Q8UA 1VRTB 1FD2A 2B3TB 4Y34A 5G4DA 5BJRA 5K8NA 4TU8A 2KM8B 3LWMA 5HP1A 2VQFJ 1XQIA 1UJ5A 4OX7A 3MCMA 1HBMA 2FGCA 4TNOA 3UWTA 3MEEB 4LBPA 3HT0A 3GZ7A 2XYPB 2HS0A 4CWBA 2XY7A 4DWIA 3HJFA 4LF7F 4LF6F 2IBKA 3VGUA 1V9OA 2D7SA 3TOQA 3CCZA 1B7YB 1M90T 1G3OA 1T11A 2P2CB 3AY0A 5KTQA 3BSOA 1TK0A 4ED4A 4WKYA 2I5JB 4J9MA 3I9ZA 1HL6A 5C2GA 5F9NA 3CCMS 4OI4A 2GCFA 2E7VA 1I5OB 1HQEB 5KFUA 1CS4B 4CM0A 4F50A 3AQOA 1S0OA 2VPYB 1U1NA 3C2PA 4QPTA 4DFPA 1WEYA 1RT2B 2AV5A 3AOAA 4CH7A 4DCJB 4EFAC 2DGWA 3OPKA 3KHLA 1I6JA 1IBMJ 1QAJA 2LXIA 1YBAA 2VQEF 2UUAF 1M5OC 4MJKA 4RWWA 4B3TF 4I2PA 1WF0A 1WC3A 4Y6IA 2R7QA 3VQTA 4ZK7M 4A8YA 2NS1B 2GAGC 1AT1B 1SUQB 1N5YA 2XMTA 1CJUB 3MAAB 2DRAA 3DOMA 5DJBA 3DLGA 3FDSA 3KLIA 8ATCB 2GQ2A 2X3DA 4I0WA 3UCGA 1VQ7S 2EXUA 1UW4A 2IJFA 3BKUA 4QYRA 1VBZA 4PUOA 3CJ2A 3NMAA 1LXNA 3EGNA 2U1AA 3T1HF 5C24B 3Q2SC 4L3NA 3M8ZA 2CQBA 5KFBA 3WZ0A 5A8KA 2MHEA 2QSWA 4HACB 4F04B 3GFYA 3K5NA 1WKJA 3UFCX 3HZGA 2YWKA 3A8KA 2Y8WA 3FBCA 2DR6A 5ITHA 4CH0S 2MKHA 4ZPDA 1YZ6A 4JI2F 4CO2A 2X1AA 2R3VA 3AB4B 1R31A 2YKNB 5H9FJ 4KTQA 1MWZA 2JVRA 1FRKA 3HKZD 1HWIA 3KKFA 1ZA2B 5KFGA 4YUDA 3VV2B 3UCZP 2B8QA 2ZVIA 2B5JA 4IFVB 2FPHX 1FI4A 2F3JA 2RAQA 4DV0F 3NY0A 2V9WA 4JV5F 1XK8A 2CPIA 1TELA 1V3SA 2WOMB 1F5BA 3CW2C 2HIQA 3EGVA 3NLCA 1NDKA 1UFLA 1F5AA 3C6TA 3MM8B 4MMOA 3OTBA 2XCAA 4QR0A 2RKIB 2IIHA 5GAGI 2EEYA 5H9EJ 4N47A 3M1VA 1XEZA 3IRXA 4R8UB 1JLQB 2OTLS 3MEKA 1WI8A 2O01C 2DNMA 2M7SA 1XN9A 4BHQA 1R0AB 5BR8F 4RNNA 4DQQA 1E6YA 4QBUA 2KFZA 2G13A 5E3PA 3KG0A 2PGCA 1TK5A 5KT6A 5D8HB 2B8PA 1HBOB 3JXOA 2EG2A 1UVMA 2BKOA 2E1RA 4ZP8A 5G0RB 4KBIA 1J5OB 3K17A 4A8WA 5KT2A 3PW2A 3RR7A 3BGUA 4NA2A 3VZHA 3BO4A 2V8PA 3NGUA 2VC0A 1U1KA 2E66A 4ZLPA 5GAHI 1EJ7L 4NCAA 4L6V3 2VKZG 3J7YI 2FY1A 4JI4F 4O3SA 3ZXWA 7FDRA 4LRCA 1HWUA 1OWXA 2OUGA 3EDQB 1AB8A 1DURA 2NREA 3W62A 2I9SA 2VIHA 4UY85 2CWKA 3T9NA 4LF1A 1UJ4A 2HNDA 5AXLA 3ETOA 5BXIA 2HNDB 5DM7Q 2HAIA 5B7WA 1DQ9A 4I68A 2FVSA 2R8GA 2ASYA 2UUWA 3HSJA 2Z2YB 4ILLA 2CPXA 2V6AA 1GFWB 1LWFA 3BM7A 1TKXA 3MHYA 3MMAA 5L8RC 3VGTA 2VONA 3GFZA 3R6LB 5AXKA 2RS2A 5F3TA 1R8PA 1HMVA 1UL3A 3DXBA 3G87A 4ECWA 2B43A 1T8EA 4CM2A 4JI3F 2B4VA 1L3UA 2AJ2A 2Z2MA 3X3UA 5CYMA 2VG5A 5BYSA 6FDRA 1M5KC 2UXBF 3ULHA 1HQUB 4Y00A 1TU0B 5E0OA 3R8YA 4DV5J 1H7XA 1O6XA 2OAUA 4P7TA 4DDFA 4AFFA 3CJKA 1F1BB 1G2EA 2F8EX 4WU2A 4NEYA 2F4FA 4J91A 4F3QA 2BJ7A 1RT4B 3GR0A 3IMQJ 3S01A 4GRSA 4QYZJ 1QSYA 1FFGB 2DNYA 2JZ5A 1IR1A 2MQOA 3I55S 3W5ZA 1R0BG 3UO0A 1LKZA 2JL9A 4DF8A 1F2GA 2BYCA 1MMNA 4ECSA 2ACMA 1J5EJ 2U2FA 2N3LA 4WPAA 2V4JA 3H4BA 2DPIA 4FXDA 4ECVA 4YMEA 1WF2A 5GMKa 4GKKJ 1RHKB 5D77A 4DUYF 4P10A 3ET6B 4A47A 1WC5A 1IM4A 4LF9J 2F9DA 1KWMA 4KFBA 2IYGA 4D3HA 3MMCB 2R8HA 3TA2A 4X64J 1YX2A 1Q86T 4GKKF 2R7VA 1Q5YA 3MMAB 1SH2A 2N4DA 2Q43A 1U24A 4J9SA 3BV8A 3H8YA 3CDAA 3LQVA 3QYYA 4H4MA 3DRRA 3RBZA 2AX0A 4ZPAA 2XULA 1S7IA 3HF5A 1NHKL 4BLGA 2DIUA 3HHLD 1U47A 2DT9A 2RDJA 1NAQA 4KIAA 1Y3JA 3WDOA 3BR8A 2IM3A 3AJ2A 3B8HA 1NSKL 3LF0A 3T1YJ 2H5IB 4OLPA 4RWXA 1CJKA 4PEOA 3S6EA 2CJKA 4G1IA 2AJ0A 1PCAA 1C1CB 2LEPA 2GHWA 2V67A 5DZ6A 4WZMA 4ZN3A 3L7UA 4Y65A 3TX0A 5JVGQ 2HK3A 3M8PB 4OJGA 1MU2B 4ED0A 2QL7B 5A2QY 3CD5A 2JOQA 2IA6A 2KN4A 4YR3A 3GIMA 2K06A 2M8HA 3OVBA 1PYSB 3TZWA 2GIFA 2CJAA 4R0JA 5F8IA 4ZVFA 1U4BA 1ZAXA 5B0FA 3H5XA 3HO1A 4EO6A 2VH7A 3K59A 1L5UA 3T6JA 3M32A 3ISNC 4NA3A 1RXOB 5IC6B 2WBMA 3HD2A 3JSBA 5DM6Q 1UVIA 2FHOB 3MWBA 4MKAA 2ZOGA 4XDDA 1X5PA 3BB5A 1KLMB 4PG8A 4H4OB 4JV0A 4RNMA 4MTPA 1F9HA 2XI2A 3MUTP 1CBKA 3KLFA 3GJQB 1RT5B 1IWGA 4K5RA 1M5SA 4KH1B 5JVHQ 4DSEA 4ICLA 1H2VZ 1OPZA 5KFMA 1HD0A 1RWPB 2B4PA 1NHVA 2V50A 4LVNP 3MURP 4DR3J 5J2NA 4I2PB 3MD3A 1DLOA 3E01B 1NPPA 3FZ2A 4K4TA 1K9MT 4H4OA 3VF0B 1Q53A 3RRHA 4C8LA 1OY6A 4NE9C 1H74A 2CQ4A 5I3UA 3V4IA 3C8YA 5EWFA 2YKMA 2I1RA 3DKDA 1FA0A 4LF2A 4DG1A 4B9NA 1HBNB 2F63A 4Y28C 3MCOA 1WDDA 3GPAA 3HZEA 5KG6A 2DBBA 3M6UA 5IXUA 5J1EA 2BJEA 3BF4A 2EVZA 3ZC4A 2C2NA 2RDIA 4X62F 5KFSA 3GV5B 4KR0B 1D3WA 1BQNA 3EXCX 4IFVA 2QMWA 3RZAA 5DLGA 1FNXH 1V3RA 3K57A 4JI5J 4QWEA 3GMGA 3TUPA 1WF1A 2IA0A 5BR8J 1U6BA 1UP1A 3MGJA 2AYBA 4JI0J 2XMJA 3OFEA 2P6SA 5C25A 5HMWA 3P5TL 3BGRA 1Y0HA 2IM0A 3H7HB 4LF5F 1HI8A 1S7HA 2PT0A 5A8RA 2B5JB 3LGHA 5IWAF 1NB7A 3PXGa 6AT1B 4LMZA 1B0TA 3FEYB 4KO0B 4CH1A 3IG1B 1K73T 2UZAA 2DH9A 3CE8A 2GX8A 3LAKA 2OFGX 1UCNA 1RT6A 4MK9A 2VQFF 1DTTB 4A8SA 2HWHA 3V81A 1L3SA 2YKAA 3J81Y 1NB2A 2IJNA 5ETTA 1N8RT 2CQ0A 1SKWA 4LFCJ 2FJDB 2I2YA 4F0KA 1S6QA 3TQEA 4JOUA 1BXNA 1P9QC 1RWMB 3GU0A 2DH7A 3EZUA 3NBPA 5HVHA 3D4JA 5HLFA 1VISA 2ZUAA 2HZAA 4NCBA 2JLFA 2K7KA 3PJWA 3CXCR 1GTEA 1PG5B 1YJUA 3OTOF 3HK2A 2Q6BA 4ECQA 3W8PA 4PKDB 4PWUA 4LT6A 1KRPA 2NSBA 3FFIA 5A76A 1QD1A 2MY8A 2HW3A 4RUHA 3EVOA 4M1KA 2YKOA 3T5LA 2BR0A 2HEKA 2HRYA 2OD4A 2MLYA 3KLIB 2W7AA 4NLYA 4AQYF 4KC5A 4YB5A 3T5HA 1FX4A 2RH3A 4OZ5A 1TV6B 5DQHA 1NJWA 4IDKB 2W25A 3CCTA 4OMFG 4P9SA 1KNZA 2VOOA 4M5JA 1S4FA 4J9UE 4OZ2A 4RW8B 2CRLA 4NCGB 4Y2MA 5GADU 2B6AB 4WBFA 1HHQA 3CDUA 3EWGA 4JB8B 4O3NA 3WC0A 2XQCA 3OL7A 3PX6A 3BR9A 2WVBA 1RWVB 3I31A 3MFIA 1HMVB 1IN0A 4ZOSA 1SIZA 2WAQD 3I4PA 4X84A 2EFVA 3W63A 3K58A 1EX8A 3R2CJ 5D3GB 3MPYA 3GCXP 2QEXS 2OELA 2Z30B 2BE7D 4NCGA 3Q2TC 2UV8G 2IRXA 1SV5A 3C19A 2NXNA 2ZHAA 1XMBA 2KRBA 3IAM9 3PHTA 3BQ0A 2WZ1A 1RT7B 2WRMA 3ZNJ1 4RW6A 1E6VA 3FMWA 3QWPA 3DI6A 1KHWA 1YK9A 4K59A 1FX2A 4RW9B 2MZQA 2ROEA 2VBYA 3OL8A 2J0WA 2C2EA 2BRKA 1YHQS 3THVA 3OUYB 1RT7A 4LF9F 2IPOB 3OFHA 4ZJLA 1OSDA 1D8ZA 2PE8A 2ZBQA 2DXDA 2D1CA 3HVAA 1LW0A 3ZTOA 4C11A 3JB9k 5HQ8A 3R5JB 1R7IA 4K2XA 5F3ZA 5D4PA 2ZJRQ 5L1KA 4WTYA 5M2UA 3G8SA 4YY3F 3UD4P 3TVZA 4CO1A 4NLGA 3G6ES 2W9AA 1TV6A 5KFHA 4O3OA 4PG7A 3LH2S 3BGFA 3W2VA 5LJ3Y 4Q0BA 4S0MA 1ZM3A 3TUJC 2LFVA 1MWQA 2RU9A 1REGX 3IC1A 2DPJA 3MUMP 3AHPA 2XCPA 2V94A 5DETA 3M8SA 2DR8A 4ELVA 5CYQA 2HG4A 1S0MA 3J7Z5 2R7UA 5B0AA 2CUYA 2GC8A 1PC5A 3CJ0A 4Q45A 1JWWA 3N6NA 3B78A 3M30B 2ZH7A 2BM0A 3AFGA 4IFYA 1UEUA 1CJTB 4TY9A 4DL6A 2AYGA 2IM2A 1FFWB 2XZTB 3RYLA 1JB0C 2F9JA 3KUHA 3QT7A 1U49A 1GAOA 3RJMB 1D1UA 1Z1ZA 3R7NB 4CLWA 3L3CA 2QE5A 3VAGA 2DY1A 2R2RA 1ZYQA 1HWLA 2KZZA 1NEEA 1R43A 3QO9B 5KFVA 1D9DA 3G86A 4M63A 1H38A 4DPXA 2MZTA 1IKWA 2ZKTA 4QJVA 4DPOA 4ZVRB 1PO6A 2OPSB 4WFYA 3NOGA 1IXKA 2W9BB 2AU0A 1HWJA 1SQEA 3MMBB 3HHDA 3SFGA 1NKEA 5ETRA 4UTGA 3KUGA 1H7WA 2XLKA 3W9JA 1OYDA 2CPDA 4WP3A 2IRUA 3ELHA 4OHXA 3I9V9 2H4YB 4B08A 1U8SA 3BGRB 1VQLS 1K44A 1REVA 3I0RB 4V1Ak 1SC1B 4EBEA 4Q0BB 3Q83A 4IYQA 5L9XA 1Q4RA 2J5AA 3DRSB 2ATLA 3MM7A 5HMXA 1TUGB 3VAMA 2RUSA 1U1RA 4CNZA 2YNIB 1T94A 4JI3J 4I67A 2EPIA 4NLPA 2HHTA 4RW7A 3J7A1 3KNAA 4PG5A 6FD1A 3L95X 3D68A 5E41A 3UVJA 2H5EA 2HRTA 4X64F 3DCAA 3TNVA 1S6QB 4BWMA 3D0IE 4KY3A 2XZWA 2BDPA 2VDIA 2EG1A 5D4OA 4USJC 1CLFA 4RUAA 3Q22A 2YNIA 5DLFA 4USKA 1GMUA 3MM9A 1SJ4P 4ZVQB 3CCQS 1IWAA 3F44A 2OSRA 1LV5A 2UUBF 2UUTA 4RO0A 3PEHA 4OX8A 1X4FA 1FF2A 2DNHA 1R8HA 3CCSS 2AGQA 2BXJA 2BE9B 1CQMA 3TARA 3DRRB 4NX9A 2AD9A 1YJWS 1T3NA 4OJ1A 3KMQA 3QRRA 4Y2IA 4OZ3A 4Z7YA 4Z7CA 2RUGA 1SL2A 1MMDA 2HHPA 1KOHA 2QX0A 3DRPB 1ZZFA 1FWPA 1N48A 2ZZMA 3HVWA 2OMLA 5AE1A 2W7OA 3G6XA 4NLWA 4MYUA 3MR3A 3PW7A 1GK8A 4CLLA 1M1KT 5C25B 3QGPA 1PYOB 2H54B 1UWBA 3HLUA 4LRBA 2KFYA 3A12A 1UVJA 2G1DA 1T95A 2PEBA 4GKJF 1W2BR 2UXCF 4YDXA 1VGYA 2MYFA 3Q8VA 1VQ9S 2PDAA 3M6XA 4YEAA 2F7VA 1X4HA 1QAIA 4EI2A 4TLRA 2AKWB 2R2SA 4QOTA 2B9XA 2OLWA 2DNZA 2KH9A 1PYTA 1RZMA 4CP5A 1HFEL 4P74A 3EM1A 1WG5A 3TANA 1XMQF 1C1BA 5DRKA 4M95A 2RHQB 1HQ2A 3HVTB 3CC2S 1DLOB 3E01A 2X51A 5CCMA 5J2QB 3CO9A 1F6TA 1S1WA 3VGVA 3IO1A 1FVSA 1UPMB 4PR6A 1RDRA 4PXCA 2FJXA 2VBZA 2AWZA 2YWFA 3D3CJ 2YKPA 3V4IB 4Q8EA 1B0PA 3MPVA 1HBOA 3QBCA 1FJGJ 5AT1B 3ZFVA 3IR5B 3OJUA 2C2OB 2MZJA 1U1QA 3CEDA 2FYXA 1N36J 1IBKJ 2GA7A 3TZYA 1KBRA 3PKYA 1RHUB 2DGSA 2J8AA 4OV6A 4LR7A 2G4BA 3R7BB 2JLEA 2V0NA 3FEZA 2ASLA 1H2TZ 3G8TA 2V69A 4Y0FA 2R7RA 3SSRA 5GADI 5H9EK 2GVZA 2ALZA 1KN6A 2QLXA 2HQCA 2J7UA 4XK8C 2FC8A 4ZPTR 1RWOB 1IBKF 3HM9A 2ABYA 1JX4A 4CIOA 3J81U 3ZTSA 4CLPA 4X4QA 4A8FA 1P8GA 2NZCA 1ZM9A 2C42A 1NDPA 2MEWA 3W5XA 3PIPQ 4PWDA 4FYDA 3TQ1A 2BA9A 2VPWB 4DR5F 1I1GA 2RJZA 2BQRA 4K7QA 3D28A 3M2UB 3DGPB 1XNQF 2J0SD 2ZKUA 4URSA 2LU2A 2QLWA 4C3LA 4F7VA 1RT3B 3AD7C 5LXYA 3GJRB 1RTJA 2V34A 1XIQA 2QLFB 3S7RA 3ZZRA 5J2PA 2OHDA 3GFHA 4RL1A 3H59A 2VC1A 1HA1A 3R97A 4Q43A 2F8HA 3ZZZA 4KHMA 1H6KX 2B9YA 4DXLA 4LF4J 2M9KA 2MKIA 3OVAA 4LUBA 2XM3A 1RT3A 2X1BA 1RT6B 3PEJA 4O44A 5ETVA 2QMUB 1L3KA 2RD5C 3K8WA 1IKVB 1YRUA 4DR4F 5I4MA 1Q79A 1TKTA 1IBLJ 1LNQA 1JLGA 1SI9A 1KQGB 1N6QA 3CD0A 2H3EB 4FVMA 3PIOQ 1QM9A 2HLTA 1X4EA 3T5KA 3QGIA 2B9WA 2M2BA 3AA8A 3DLKA 1TL1B 3SBMA 3TUIC 4UUXA 3DLKB 3OLBA 1VMBA 2ZH4A 3LTOA 2M3DA 4UZBA 2V4JB 4PZVA 1KVJA 2HKEA 3CJSA 4DS5A 4A46A 2IVYA 1X0FA 1Q8IA 3H98A 3UQSA 4M5HA 2AX1A 3JQKA 3NAHA 4WXOA 1CULB 2WVDA 2YWEA 2XNQA 1M5HA 4Q44A 4JV2A 1BGXT 4FBTA 3IWLA 4YHHF 1WI6A 3NKYA 3R1HA 3VAHA 3M6VA 4G1QA 2I8EA 1WTFA 4DV5F 1S6OA 2LP4A 3CD7A 3VQSA 3I0SA 3TO8A 5M2PA 1HWKA 2EC0A 3DRXA 1BD6A 4PABA 2IMWP 2OPQB 2Q79A 2W4CA 1RTHA 4X4TA 3PYGA 3M8YA 2J0QD 2AT1B 1UW9A 4I1TA 3G6VA 2Z57B 4HI1A 3ETMA 3FGVA 4U8YA 5CYMB 4ENOA 3M8RA 1NDCA 1LWCA 1HBMB 1OS5A 2DJWA 2Y0BB 2EK6A 4KGKA 5EX3A 3BJYA 1VC0A 3C14A 3O3LA 4F3OA 4ZLJA 3QNWB 2KTQA 3MECB 1CJKB 3G96A 1FERA 2DKOB 4NMXA 4OJHA 2Z4PA 1C0UB 2BJ9A 3AOCA 3ILIA 3MR7A 2P9EA 5HBMB 2HHHF 1SKSA 3I82A 1SL0A 1AFIA 1LEOA 1F3FA 1FKPB 3DOLA 4MT1A 2XYGB 5JJBA 3BO2A 4BS2A 2K7JA 2HNYA 4NRTA 4UOFA 4UUWA 3W2WA 2AJQA 2GW8A 3W2WB 5H1SV 5J1NA 2IC3A 2XS2A 1RUSA 5KFQA 2BANB 4JV5J 1N34F 4MH8A 4J9RA 4GVBA 2ZOMA 1S1XA 2W2PP 1C0UA 1WSRA 2GHPA 3NGSA 3HX9A 3R5GA 4NLQA 3UR0A 1JXVA 3IFEA 2J9DA 2CVIA 1FWKA 1T05B 4N76A 4DMZA 1HQEA 4FF2A 2YPYA 1AYEA 3U1NA 2CPFA 1SC6A 2O66A 4JUZA 3V6DB 1RACB 1TVRA 4U7UK 2NSCA 2H48B 4KPCA 5J2NB 2CNOB 4ALZA 2IDLA 4UW2A 4ZPBA 2C3OA 5LXRA 4OI1A 4B3TJ 2CWXA 2MMYA 3NWGA 1ZM2A 3NAIA 3ZZUA 3GIIA 2UVVA 4EYHB 3KLFB 5B0EA 4ATNA 2HFSA 1NJZA 2DR9A 3DYAA 2CJXB 3D6TB 1TVRB 3H90A 3OJSA 2KFNA 2B56A 3N4WA 1N5VA 3OR2A 2C1EB 4ZP6A 2CDQA 3AD8C 2IM1A 3TJAA 2AP6A 3AQPA 1N34J 4N7TA 2FJBB 4WU3A 3UN3A 1OPIA 4KQZA 4QU7A 3SV4A 1NSPA 1UWBB 4K50A 1QE1B 3J80Y 4F3MA 4FF3A 3LGMA 3BPDA 2FZGB 2UXDJ 1ZPWX 4I56A 1PJ6A 1EP4B 5KFRA 4CI0B 4A8MP 2MQNA 2ZBRA 4DN9A 2ZWPA 1G4CA 1HNVA 5KFCA 1J2VA 3QT8A 4W4MA 2Z8QA 3MM6B 3DLBA 3BPSP 2DHXA 2MLZA 1X4AA 3PO5A 4TQRA 2DNQA 3HHEA 5IT4A 3Q23A 1UAWA 4XAKA 4B3RJ 2R8JA 3TZXA 4OI0A 2DXFA 2JX2A 4OHWA 5B0DA 2RHSB 2MTLA 2ZHOA 2DCUB 3GJTB 3M2VB 4GO5X 5CZXA 3L4BC 4O3QA 5KG3A 3IRWP 2PFFB 2EWHA 2R2TA 1FRMA 2XYHB 1SQGA 4FDFA 1NPRA 5THWA 5FLXU 2VF3A 4QYZK 4J90A 2BOPA 1ZTWA 5LM7E 3R2DJ 5KOWA 3BGOP 3R7SB 4CTAB 2J9CA 3DLHA 3I5BA 2ROPA 4FKYA 3GTYX 2GQCA 2QO3A 2O67A 3UI3A 1WHYA 5F0WA 3EYZA 4OL8A 2J76E 4NI2A 2DY9A 4CQ1A 1V5VA 2NR0A 3RBEA 1FRHA 3MAQA 1VHFA 2GNKA 2BKNA 2MQ8A 2PMWA 2ZH3A 2NPIA 2GVZB 4QQBA 3VALA 4PUOB 2M88A 4LRFA 4IH7A 5D0EA 5B0GA 2KRRA 2GFFA 1S9EB 4WK3A 5L1LA 3FCHA 2JC1A 2V8DA 4AXJA 3KLHA 5GAHU 2UXBJ 5E33A 1QAYA 2QL9B 4OLOA 1U2CA 4WFBQ 4Y2AA 4URQU 4HI2A 4ZPVR 1TKZB 4L74A 2R7TA 3WX4A 1RTDA 1SB6A 4DUTA 4CO4A 2PI5A 4ANDA 2A18A 2E7WA 2RU3A 4QIEA 2UU9F 3GYGA 4B3OB 5LMUJ 4WKRA 3UCUP 1UVNA 4LF7J 3KJVA 3D66A 3UR3C 3QIPA 4IRCA 1WHXA 4B3MF 3GCWP 2W24A 3PJXA 3M2UA 1RB0A 2E7XA 5D4LA 4YP3A 2UU9J 1S1WB 1JJHA 3H5SA 1NZAA 4XPCA 2F1FA 3MI7X 1SV5B 2G9OA 1TKXB 2H65B 2ZDOA 5AXNA 4DV3J 4N8OA 1SJQA 3KOAA 3ADAC 1ZZNA 1SJFA 4DU8A 2HQGA 4DSJA 1E6VB 2HBRB 2W2OP 2HVHA 4YDDB 3F73A 4ZIWA 3Q8SB 4FS1A 1RABB 1Z2ZA 2QA1A 2R7SA 4XTTA 2E5JA 4OHYA 2MSSA 1RK8A 3IS9A 4DPWA 1JLCB 3HP6A 3MMJA 1JQGA 4CNYA 4L76A 4JI1F 1U48A 3PYDA 4KKOB 2XB2D 3TEHB 2ZBCA 4NLSA 4OZNA 1YDLA 4IG0A 3US5A 4N41A 1PIEA 3E3XA 5AXMA 1OSCA 4LREA 3RBXA 4PXBA 2DNOA 2L9DA 4NMLA 3MR6A 1L3TA 4Q8FA 3G9CA 3TYTA 3C16B 3LO3A 1AA1B 1WD6A 2HBZB 2RF2A 3M8QB 3N0VA 1NKCA 1C0TA 2MJNA 2YWWA 1JLFB 4URGA 4NZ0A 1XR5A 4DR7F 3ZO7A 4DFMA 1X0PA 2C3YA 2WSCC 3D2WA 2CQ3A 3CJTA 3OT9A 4CDIA 4RW6B 2MZ1A 5IT9U 3GE9A 4LVOP 1YJVA 1RHRB 4USUA 5KFPA 5K14A 4WF9Q 1KONA 3UNYA 5HP1B 4ETXA 1CJVB 1S0VA 4I7FB 1IKYB 1LXJA 4HDGA 2ZH2A 2BABA 1HQUA 4AE5A 1DJ0A 3KHHA 2FLLA 1U2RA 2AMCB 4DQIA 1VQKS 1NRKA 1S79A 1S1XB 1NMEB 3W5YA 4KGVB 1A9NB 1RT1A 2O1PA 3A8EA 2NUUG 1KC8T 2HNYB 1FEHA 1ICEB 4DV6F 4DSIA 2CJQA 1MW7A 4LBHA 3QSYB 1O0PA 4U8VA 2GIQA 2MKKA 3WX8A 2LEAA 4OI2A 5B0CA 5ETMA 1RT1B 4Q2MA 1FXRA 2DNPA 5A0YA 4DHVA 3KMSA 5K20B 3HXMA 5DG8A 2E9TA 5CH7B 2W2MP 4H4KC 5AE2A 4TU9A 1PAEX 3LWLA 1XMOJ 2YXLA 1YG0A 3FUYA 3C15A 3OLAA 4NLRA 1EQMA 3GONA 2EFQA 2I0XA 5KFEA 3FVYA 2DISA 1GQEA 5HSPA 4UOHA 2DGUA 3DDKA 1FTCA 1S49A 2D3ZA 2J7WA 4DX6A 4UOCA 1KHVA 4FP9A 3W61A 2QZ8A 4J9PA 3CDWA 3BSAA 3NNHA 4WE1A 5A8WB 5I3QA 4WE1B 5A8WA 3K89A 3EUNA 4DG1B 3RB0A 4V19J 4OX9F 5IM0B 2ZHBA 5F41A 1RHJB 1RAOA 1YKWA 4ER8A 1VK3A 4M5NA 2HYIB 2KDOA 1HLWA 2W4DA 4LFCF 3G2XA 1ZAWA 4TN2A 1Y5NB 3KTQA 2OEJA 2SXLA 2Z0GA 5T41A 3CCWA 1S99A 2NXJA 3KJQB 4N77A 1BUXA 4FYWB 1BQNB 2X7IA 2CG4A 1QVFR 1TZ0A 2G2ZA 4EU0A 3MCNA 3PV8A 3MMBA 1VRUA 4K2JA 4P2SA 2H5JB 3IG1A 3ITHB 3R5CA 4KO0A 5KFKA 3IBWA 2QRRA 3M2VA 5E3RA 3ZZOA 4B3OA 4GVBB 3SSSA 3N5BA 4DZ6A 2X1FA 1FE4A 3W3SA 1QUPA 2HBQB 3RB3A 1W2IA 4GC7A 3SQOP 5KG4A 3EICA 3RRGA 4JI8J 4GVLA 2P8IA 3RTVA 1OMSA 1WUUA 2HHUA 2D3OR 3P6YC 2F65A 2GV1A 2GAHC 4DOZA 2OI2A 5C42B 1O8BA 5CA5A 3OBIA 2YX4A 1NK4A 2H51B 2GJFA 4WK1A 4HTIA 1LW2B 2DGXA 2A0FB 3SZ2A 3V6KA 1N5SA 4N8NA 3TZZA 3UD3P 4U95A 4O23A 2ZZNA 2ZC4A 3MAAA 1HHSA 3HHKA 1RAHB 1VR6A 1S1VB 1HPZB 2NYHA 1WG4A 2J9EA 2PI4A 1A0OB 1VJWA 4FF4A 5DDPC 2Y9HA 4DR3F 4OZJA 1I3OB 1DAXA 1GXLA 1OQ6A 5HROB 1JJCB 2N7YA 1N0UA 3IR7B 2IRYA 3A4TA 3OXLA 1X5TA 5DDQC 5B09A 5I42A 4JP8A 3OXGA 2VHGA 3QRPA 3JTOA 4ED1A 2I38A 4HH0A 1PJ5A 2G2OA 1RGVA 1S9EA 4MIWA 4P6QA 1RKIA 1UEVA 4EK2A 3NL0A 2WSEC 3UDEA 3BKFA 1M5VC 2DGVA 3D54A 4OJ3A 4DUZJ 4A8KA 1WHWA 2AIRB 1WDTA 2ATCB 3JSRA 3QAUA 1OYEA 4C48A 2W9CB 2Q1LA 2YH0A 4DPYA 2KJWA 4I69A 3PJ9A 4PWDB 3W64A 3AT1B 1VS3A 4RW9A 2EBGA 1S97A 1VQ6S 3UDLA 4OZ1A 3WIVA 2IVFB 4USWA 4OZLA 1CC7A 1LWFB 1KEKA 2MQPA 1DRZA 2IMOA 3UD5A 2YKNA 3SIPB 4YS2A 1IKVA 1N88A 4ANCA 4JI0F 4B3SF 2OKQA 3X1LB 3K5MA 3CDBA 1SKRA 2QA4S 1B64A 4LF5J 2ZJPQ 1HIYA 1TUVA 3NS6A 3KNGA 4L73A 1FO1A 4NXNJ 3FZBA 4CTAA 2G2YA 2RQ4A 2DK2A 3AOBA 3D1QA 3KK2A 4F4ZA 3TAMA 5L38A 4ITSA 3EPGA 4PYAA 5AJ3F 1URNA 1HNIA 2VDHA 3HHLA 5MAOA 3O2IA 4CCHA 4F25A 9RUBA 5KT3A 3ISZA 2DR7A 2K1RB 4U67Q 2C2RA 1RWNB 4G3IA 2DO0A 3CB4A 4NXNF 3RR8A 3BN7A 2HIYA 1VHIA 4PXDA 1CULA 1QAXA 3OTEA 4WFZA 4KSEB 4USVA 2V2QA 3MD1A 3D3BJ 1UTAA 1TTHB 3GYNA 4LBIA 1GT8A 2JRSA 4LIWA 2ZM6F 4IFYB 2QFIA 2BKPA 4UQTA 5L1IA 2DXEA 1YJ9S 4E8UA 4YY3J 2VBXA 2Z58B 3MR2A 3CC4S 3FBEA 4OYAA 5CYQB 3RRKA 1SL1A 2HBYB 1S1TB 1S1TA 4KYZA 2XC9A 3DU6A 4TXSA 3QRQA 4HLBA 1NK6A 5ETNA 1Q0NA 2PA3A 4UT4A 3Q8PB 3CJQA 5IM0A 5U47A 4F4WA 4GO7X 3M05A 3D0HE 1SJRA 2AEJA 4O44B 3PRDA 1FFSB 1MROB 3I32A 2BJ8A 4CZCA 5KFJA 1RYRA 3CJKB 3T41A 3S8SA 2OH2A 1Q8LA 2D9OA 4DSLA 2UVRA 3OSNA 2C2ZB 1PGZA 5MLCV 4DV2J 2HS3A 2IC3B 3P3DA 5F8GA 1VQMS 3I5CA 1HNWF 4DJBA 1DFDA 1P9YA 4X4SA 1XJWB 2GHVC 4TLQA 1Q81T 1WOPA 4Y3CA 4K4XA 3DM2A 4DS4A 2JEJA 1S77D 3HMJG 2B9EA 1EARA 3U1MA 1VDHA 2VODA 1T9VA 3H5YA 3ITHA 4FN5A 1N54B 2YNGB 3GP9A 5E2QA 3VZIA 4FNIA 3K5LA 1MMLA 1TAQA 3P96A 4DFKA 3JQJA 4R5PB 2XS5A 1B7FA 1Y9OA 5F0UA 4ERDA 2IYIA 1VQ4S 2Y1LB 5EWGA 1IBMF 3PY8A 2XGQA 2QC3A 2X1GA 1BC6A 1HKAA 2UUAJ 1EZZB 3RGIA 1V6HA 3I0SB 4CLTA 2WCXA 4PWWA 2WW8A 4FS2A 2KXHA 2LQ8A 1U6ZA 3I87A 4C3MA 4ED6A 2R4FA 2HHQA 3QZ8A 3H20A 5F9LA 4OYPA 4J9LA 3T19A 1XERA 3E51A 3RBDA 1IKYA 1XMOF 1TL3B 1U7LA 4K4ZA 3PNIA 4ZIVA 2FLPA 1X9WA 4NASA 3DLGB 3MECA 4DX5A 2VFUA 1UKUA 3MM5B 1GXUA 2C3UA 4EMDA 1BMQB 4DL4A 2E5IA 2V9KA 3K8VA 1EETA 2PC6A 3ZTRA 3HFVA 1NLKL 1BE4A 5BYRA 4C6AA 5HATA 1N0VC 2E1PA 3SQGB 3CUNA 5LSOA 4K4WA 3D9BA 4LRDA 4MIBA 2XMUA 2LDIA 2BM1A 5IS2A 2EC2A 4I6WA 4YN3B 4WFAQ 2R9LA 3OFFA 3KHGA 3BREA 3M32B 2GZOA 3WHIA 1H2UX 1KFDA 4KB7A 2RIJA 5HMYA 1ZETA 4XDCA 1GXTA 2CDRB 2Y0SD 3QIDA 4RZRA 2M0GB 1MG7A 3SQGA 3OW2R 3EE3A 3NS5A 3A13A 4WP9A 3LW5C 4N56A 4HHHA 1SH0A 3OTCA 4ZDNA 1RBAA 4ETZA 4NLUA 2CQ2A 5J2MA 2YQ3A 1CQNA 2QA2A 2E44A 3MXHP 5B08A 3CIZA 1KLMA 1CJUA 2RQKA 3QATA 3KLGB 1KQFB 1OY8A 4F36A 3HJVA 4LJMA 3ET6A 5DZ7A 5HQMA 1WORA 2MKSA 4C8NA 2ZE2B 3T1HJ 2VASA 3EZ5A 1RWUA 3HCXA 4MYTA 5IQQA 1XBWA 3QT6A 4NYPA 1XNQJ 2EKNA 3NGTA 4M5LA 4DF4A 1R8CA 2XSJB 2D74B 1Y7PA 4FZVA 1JLBA 2VG6B 2VG7A 2VV5A 2IAJA 1RI7A 3IP0A 3FCWA 5K9FA 3KFWX 5SUHA 4F0MA 2AYEA 3J80U 1BY9A 1SQFA 1NM2A 1NHUA 3KK3A 3VAKA 4X2BA 1WWHA 2CVEA 2NPFA 1MLAA 1UPPA 3TAQA 4G6VB 2RMLA 3AJDA 3AXKA 3EGWB 2BJ3A 3N6MA 5C5JA 4QWBA 1I51B 2COLA 2OPRA 3J7YU 5A8KB 2BUNA 5E3AA 3SXLA 1SJ1A 2XMKA 3G6YA 5I3UB 2DNNA 3AH6A 3N5FA 4NXMJ 4IH6A 4WWSA 1RU2A 4QIGA 4A4JA 2QYCA 2BW7A 5KG0A 5CXTA 2N3OA 2R8KA 4B3SJ 2CPEA 1UZHA 4TYBA 4HDHA 2EFNA 1VJQA 2L48A 4NA1A 5HI7A 4I64A 2AZ1A 4RU9A 4YOEA 2VKRA 1U02A 4IR1A 5F8MA 3CMAS 5T7LA 4P71A 2EBEA 3D1HA 3DLJA 3IA0A 2C28A 2CFXA 4KAIA 4LRAA 5E5NA 2WK4A 3CIMA 2ZH8A 2DVIA 2KZMA 5IOLA 2AGOA 2R7WA 3H25A 2HHHJ 3DNCA 2ZNZA 1WKKA 4NOHA 2HAFA 2W2NP 3ZTPA 5IFMA 3CSKA 3M1VB 3W66A 1S10A 2VOPA 2YWHA 2B0GA 2OP5A 4CRJA 1FJCA 2ZM6J 1C1BB 2CA9A 2MZRA 3F41A 5K5MA 4P72A 4GKJJ 2KT3A 2OTJS 4KRWA 2D69A 2XI3A 1VOMA 4H54A 4DN0A 5CD4A 2J6TA 3VHQA 1IVZA 4ECXA 2FD2A 3TI0A 1LK7A 4OIXA 5HANA 3PW4A 3I6PA 2JEGA 4K8RA 2LECA 4QIWD 1P6TA 1WOOA 3DM2B 4CLYA 3HSDA 5KFAA 3CPWR 5G0RA 5HMZA 5DQGA 1FT8A 4DL2A 4HT5A 1JKHA 1WJ9A 3ILJA 2WVFA 1JXLA 4AD6A 4YB6A 5I42B 3U7JA 3DDIA 3T3FA 5CD4H 4YR2A 1CEZA 2ZBIA 2BE2B 1JNRB 2EKYA 2GMJA 1FTRA 2LU1A 2RSQA 3OR1A 3T9ZA 1WC1A 2R42A 1VBKA 3LP0A 1XNRJ 1AFJA 4O4GA 1A7GE 4C0BA 1PAUB 1SVDA 2JWNA 3RG6A 2RVJA 4M5IA 3NGDA 1TQLA 3FCVA 1J5OA 3C46A 2UV8A 2GVDA 1S72S 1X4CA 3R6GB 2QN6B 2IY5B 1VQYA 4X65J 1EHWA 3VVTA 3W7BA 2PO4A 5E3QA 2FVRA 2EFPA 2JVOA 2JFDA 3VAIA 3AAWB 2CZVC 1HBUA 3KJNB 1LWEB 1RTDB 2OJ3A 4IR9A 1LWEA 2ZNYA 3M30A 2CZ9A 3OFGA 4TU7A 4J9QA 2KU7A 2YNFA 1VRQC 4IO9Q 3JAMY 2DNRA 1Q7LB 4DR4J 2P9GA 4HT7A 4OYOA 2MGZA 4DR2F 1FDDA 5SZTA 4HR2A 5EN1A 2ZH6A 4WTOB 3MZIA 4KV8B 1T03B 3OTDA 3DI6B 3FC9A 2WBRA 4AL6A 1NO8A 4U96A 5GMDA 1U45A 2ASDA 3M9MB 2HK2A 3GB0A 3RAMA 5D4NA 4XPEA 2HFUA 2Y3YA 1PJ7A 3HT3A 1Y4ZB 4K0KF 1AW0A 3TA1A 3E2EA 1PILA 1VK8A 2B4OA 2YQ1A 2MXYA 2MB0B 4ZN1A 5JMNA 5CQGA 2OPSA 4ZMMA 4H4KA 2KB2A 3SCKE 4EZ6A 4DX7A 5HVGA 1VYAA 4EEYA 2ZJQQ 3N6LA 4P2FA 4ECTA 3KK2B 2F5GA 2K3KA 1TMJA 1WC6A 2CKWA 1VQPS 2FJAB 1JLCA 1TMMA 2DH8A 4O0IA 3VAJA 1WG1A 2BQ3A 5JXSA 1NK0A 2HS4A 4AXIA 2UUBJ 5JUMA 1GX6A 2BW2A 3ENWA 4NEZA 4LQ3A 2LDYA 3PHEA 3LP2B 3LP2A 1Z4UA 1RT2A 1YJTA 1WSVA 4P2MA 4AQYJ 4LSZB 4DBQA 3BGLA 5KFNA 4LIRA 1JLFA 2N7CA 2A1BA 1LWCB 1C0TB 3WIUA 3BDPA 2WVEA 1JIHA 3TRGA 2GIRA 2RNEA 5EDWA 1CSJA 1RAGB 2YQ0A 4ED2A 2C2MB 3D6HB 1RTHB 3S1TA 5T14A 1IKXB 3Q89A 4DUYJ 3CULA 3GSDA 1QE1A 1UETA 5HVFA 4RJVA 2DO4A 4DL7A 4Y2CA 2JC0A 2DD8S 1U8WA 2W4PA 4ZA1A 1JLAA 5DDOC 1GNKA 3KLVA 3BQ1A 1FKOB 4HL9A 4ZVOB 2I5JA 3MEEA 5ADZA 3R1LA 4PXEA 3ZNUA 3ZZTA 3P49B 1REVB 3I0RA 4ECRA 1B4SA 2WSFC 1NH7A 1IBCB 2OPPB 3VTIA 1YBUA 1MSWD 4ZVHA 3FBFA 1ELOA 1SKUB 1JLAB 2PIIA 2OEMA 2A2CA 3M9NB 2KYZA 4RNOA 4RU2A 3PKMA 5ETSA 4DU7A 2IHR1 3WQPA 3UPFA 3KG1A 3HDSA 2KVQE 3CCLS 2Z2ZA 4C0HA 1GMVA 2VFSA 4NZ6A 4X4OA 1DY3A 3K2YA 3LP1B 1DQAA 2IAJB 3L7OA 4R5PA 1F60B 4NYOA 4K5SA 4C7QA 4C3KA 3V81B 3NS7B 2AGPA 2UP1A 2C3PA 4C8OA 4DR6F 2AF6A 3MDFA 2MJUA 3PACA 4Q2LA 1NPKA 1HBNA 3OTOJ 1HNXF 5L46A 3JYTB 2WB4A 2YVSA 4MIAA 1JXEA 1JLEA 1KTVA 3RAXA 4PQUA 4USTA 3HPOA 4ID5B 2JEIA 2NXCA 2CQ1A 1MN7A 1U09A 3HD1A 3HHLC 2W01A 2V2VA 4PG4A 5GAEI 4H4MB 4JI1J 4OHVA 3MUVP 4NLOA 3FFIB 1YJNS 5EWEA 4ED8A 2HZCA 3TA0A 1RYSA 2CXEA 2HLUA 1EP4A 2DHAA 2HQFA 1S1UB 3DMJA 3PO4A 1T0TV 3H2UB 3DHXA 1ZH5A 3H42A 1FE0A 4LFAF 2QV6A 3QMQA 2CIMA 4M8LA 2VJUA 3BSNA 1N5QA 2K2PA 5AJ3J 3C6UA 3KLEA 4OYMA 4KPYA 1EAYC 4K0KJ 2DCLA 4J9NA 3V6HA 1NU4A 3ISND 5IT9Y 2CNLB 3LUYA 4OYBA 2OPRB 5D0HA 1JMTA 3N01A 2KXNB 2PFDA 1RTIA 1EQ0A 4RLEA 5E3CA 5RUBA 3OHBA 1YQHA 3WBZA 5D15A 1S59A 1HNZJ 5KFZA 5A8RB 5HJXA 2MQLA 1EB0A 7AT1B 1KS2A 4Z2XA 5C7PA 1YVFA 4O3RA 4L72B 1NK8A 4F4XA 1RAEB 1RCOB 2QJ3A 3D1OA 4WJBA 4QW8A 2YY3A 4IRDA 2NQPA 3OD2A 3JSMB 3PG9A 4OYZA 5CYJA 3MAHA 2OMOA 1KQSR 5IV4A 2PD1A 2HHWA 2V8VA 4DV6J 4PRFA 1IUJA 4RR5A 5DGAA 2KYXA 2AEMA 1FEEA 1MNEA 2VG5B 3P5BP 3QAEA 2XY6A 2Q66A 3CCRS 1KLNA 2BRLA 2VG7B 3OVSA 5EX0A 2A2DA 1BQMB 1ZM4A 4MKYA 1TFYA 5KG7A 2XTJP 4CYUA 1UEKA 2JH3A 4USMA 1RAFB 1I94J 4OX9J 1TL4A 4BDPA 1WOSA 4KKOA 3ENQA 1FJEB 3KK1B 2FGOA 1Y3KA 1R89A 3R5DA 3SV3A 1JJ4A 2F4VF 2CQHA 3QWUA 4U7CA 4LSNB 1SIWB 1KDNA 1OO0B 1TKDA 2NZ4A
chains in the Genus database with same CATH topology
2XMMA 4IDKA 2CPJA 3QGHA 4A8OA 4TQSA 3H4DA 1CPZA 4C8YA 2O5DA 1FK9A 3DRPA 5DO2A 2W7PA 3POTA 3BSCA 1IQZA 3GG0A 4HVZA 1VI7A 4YR0A 5B0BA 5F8HA 2POKA 1FDNA 1MWYA 2ZDPA 5K14B 3V2UC 4YB7A 1FK9B 2DTJA 4HHJA 1NKBA 4G1QB 5DDRC 1VIOA 1PC4A 5L1JA 1S9FA 1C2PA 3MF5A 5M2RA 1GTHA 2FDNA 3I56S 3CCJS 1HI0P 3CC7S 4J5OA 2CQDA 1U1LA 2AYMA 4B3RF 1GX5A 1NH8A 2LEBA 3JTNA 3FNNA 5KOXA 1NJIT 4RUCA 4C98A 4RBVA 2B4UA 3B82A 3IGVA 3THPA 3O5TB 1TFWA 3PRBA 4PPZA 3M8PA 3ICLA 5FDLA 1N6QB 2B7BB 1R3NA 4DLEA 4UQGA 1LK5A 4JYAF 1LOUA 3TUZC 2B51A 3AA9A 2YX7A 4I6YA 3MEDA 1ZAVA 4FNHA 2K1RA 2MHNA 3C66A 1FKAF 1ZOTA 3PZPA 1U1MA 4K4SA 3LP1A 5EGYA 2X3GA 2DR5A 1GH8A 2YX1A 3GWCA 2K8GA 5F8NA 3D5MA 2IVMA 3NRBA 4MFBB 4R25A 2CPHA 5EUHA 3SCLE 1F9FA 5KFTA 4KFBB 2RRNA 1IJFB 1S9GB 4QR1A 3SDEB 3UDCA 4DV2F 1U1OA 2HHSA 2VD3A 2M5YA 2HMIB 1HI1A 2VL1A 2YNHB 4WCEQ 2LA6A 2UVWA 4J9KA 3BS9A 4E0DA 4PQAA 1VIXA 3ZZYA 1RKJA 1FVQA 4OI3A 5KFFA 1T02A 2BQUA 2ASJA 2APOA 2VBWA 5D78A 2LQ9A 2CZ4A 3D0GE 3GV8B 2VPXB 4QR2A 4DLGA 2QEXS 3V4MA 2RT3A 1TL3A 4C8ZA 1OIAA 2LKZA 4F4KA 1HNVB 2OPQA 1KOOA 1NK5A 1FNOA 2ILZA 1ZPVA 2M52A 2MQMA 3G71S 4X65F 1X5SA 2VPZB 4XIUA 4WZQA 4IKAA 4U6PA 4NLDA 4BC7A 3E8OA 2D9PA 2ZD1A 1D9AA 4PCQA 1CC8A 2C3MA 2LA4A 1AROP 1OQ3A 3M6WA 4NXMF 2GMHA 1FKPA 3CGIA 2ADBA 1T05A 4NLTA 1Q1KA 4DSFA 3K7RA 3NCQA 1KQKA 2BANA 2DNKA 3NNAA 2ZH9A 4IRKA 4DL5A 3CJ3A 1JJ2R 3VAFA 2M8DB 2DNLA 2FLOA 2UXDF 2RE1A 5KFXA 4ZKAA 3CD6S 1R8BA 3QZ7A 2PSZA 2BACA 3QGGA 3L7PA 3T1AA 3BEGB 4IH5A 3OV7A 4LSLA 1SH3A 4J9OA 4Y2KA 1YTYA 1UFWA 3LAMA 5C24A 4RBUA 3CCES 3Q24A 1JLEB 4PQUB 2HRUA 2QT7A 2VFRA 3WC2A 2XG8A 1U1PA 1G6BA 1IKXA 3TX8A 1O51A 3NCPA 1XR6A 1XC9A 2YTCA 2LQJA 3PFEA 4PG6A 5LSLA 5KT7A 2FVQA 4BCAA 3KLHB 4ZVGA 4IOBA 2W9CA 4BWJA 2ZITA 3GG1A 3TW0A 1VC6A 2HVIA 2LVWA 3IWXA 4WFNQ 3BDEA 2XMVA 3PFOA 2Y1RI 2ROGA 3GFXA 5I3PA 1D0EA 4B9MA 3N9UC 2HGNA 4EUVA 3V6DA 3NG8A 1Y5LB 3CT9A 3KYLA 2KHCA 3MTKA 4I4BA 1Q7YT 2KI2A 2FLNA 5A6PA 4V19X 3GV7B 1XR7A 5BYQA 5IT0A 2A3JA 5AE3A 4DUZF 4F8RA 1BQMA 2D41A 3C6TB 3JSYA 1F0XA 3GYXB 3MM8A 4YQWA 4ES3A 2XS7A 1DTTA 4RNHA 1JK9B 2XSFA 4NWBA 3VR1A 4CT8A 4OX6A 3MCSA 4ZCMA 4C11B 2V4RA 1LW2A 1WNEA 2P5VA 3DRYA 1U25A 1ULRA 4NRUA 2CJ9A 2VB6A 5HN0A 1N4LA 3SMZA 3PR4A 2C22A 1VQSA 1HNIB 2VZ9A 4FVCA 3J7ZT 3T5JA 1KSPA 3SSQA 5LJ5Y 3DGPA 2V5HG 1HYSB 1N36F 4HH1A 2E5HA 4CT9A 2DITA 1R8AA 4B02A 2DIVA 2V4QA 3I4HX 4QIVA 3C6UB 3KLEB 4K4YA 3FSIA 1T7PA 5F8LA 5HO4A 2HHXA 1RTIB 2DB1A 5KFYA 2LQ5A 2RS8A 2HFNA 5DQIA 2XO7A 2OSQA 3N79A 1WEXA 4C0OC 3SFUA 3OSPA 1KFSA 1VFJA 3U1LA 1VBXA 1FDAA 1WTBA 3K5OA 4EO8A 2ACYA 4C8MA 2MZSA 3KG4A 2XLJA 2FJWA 4FBUA 2HVZA 4IQXA 5KT5A 1TP7A 3IRXB 2E5GA 4ZPWR 4R8UA 1TKTB 1N32F 1S6PA 4M5DB 2ZOFA 4WFXA 4KHRA 2FTRA 4JBCA 1VLYA 3ONQA 4ES1A 3I5AA 2BE2A 1VQ8S 3TAMB 3OUYA 2XNRA 2GJIA 4C4WA 2BVZA 3DDNA 1JLGB 2Q3PA 4ZPCA 4NLXA 2B6AA 3DRSA 4OI6A 5LSRA 2HWIA 4W90B 1XTZA 3OR1B 4C8KA 3MEDB 4WXWA 3T6BA 2RRAA 5IZHA 1C4AA 4ZHRA 4QWAA 2JEFA 4FPRA 1SJ3P 3PX0A 3R5AA 3EPIA 2YKQA 4AYBD 2HHVA 2XGPA 4RW4B 1FRJA 4ZVEA 3MOJB 2DGOA 1IKWB 1K0VA 2XWYA 3NCRA 1S76D 3A1YG 3IAS9 4AL5A 1K0TA 1YI2S 3H40A 1NK9A 3H2VE 2E1CA 3DU5A 3EXYA 2MGZB 1DZ5A 1MROA 3DLLQ 4ILRA 1X7VA 2UUCF 3ZZ0A 2EFGA 2QIFA 1Z2LA 2P6TA 4P7VA 4TY8A 3PW0A 1VQOS 4TY8B 5LMUF 2H9ZA 3HI9A 1Q8BA 3G4SS 2E9RX 3DLEB 3ENVA 3RAQA 2R7XA 4UY8T 2EFOA 1U2FA 2RQCA 2W9BA 3O6QA 3N28A 4IG0B 2YWGA 4DV7F 4F2RA 2KKHA 2XWXA 3NGKA 4RX6A 4DFJA 1XNRF 3MM9B 4ED5A 3LALA 2JSXA 5K8OA 3LPYA 2VFVA 3I96A 2Q6CA 1X4DA 3RB4A 2RF2B 3M8QA 1S9GA 3HVTA 2CQGA 3SDEA 5J2QA 2LYVA 4DX8H 4D3GA 4EBDA 4CO3A 4HTJA 1VBYA 2YKMB 1VRTA 4NYZA 3DC2A 1LQ9A 2AQ4A 1RA7A 2HQIA 1VC5A 3AB2B 4ZCIA 5KAKA 4I6AA 5KFIA 1YITS 5L39A 4X4RA 2RILA 2F40A 3NP5A 1M0SA 3PVXA 4IOCQ 3O1LA 3PR5B 5CHCB 2FHMA 3T1YF 1Q16B 1XWLA 2Z2LA 5DGBA 3CDEA 1FXLA 2HNZB 2GMLA 3LGNA 1QSSA 3IWNC 3OQ2A 5J2MB 1QLNA 2OPPA 2B7CB 3PM9A 4ECYA 4NPOA 2ILYA 3Q8RB 1YGYA 4QZVB 2QSFA 2LXUA 4RBTA 1HARA 4J37A 4USHA 2HQ3A 2KM8C 1Q78A 2MDAA 2KT5A 2N4CA 3B4DA 4ICLB 5K8PA 4ECUA 1YWXA 3OXFA 1RQ0A 4FXWA 3V6JA 2J6UA 4HKQA 5F8JA 4GC6A 3SCIE 2EK1A 4RW7B 3DYAB 1J5EF 1B0VA 1HPZA 2L3MA 2J0XA 2XBPA 3O8WA 3RW7A 4HYKA 3AJ1A 3U27A 3C3LA 2LLZA 5HLFB 1QUVA 3IR6B 1YJRA 1A6LA 4NZ7A 4DEZA 2E1AA 3MOZA 4AUKA 2FUG9 1UVLA 1UJ6A 4M94A 4OV1A 4MK7A 4A48A 4QIFA 4O4GB 3NNCA 1AXQA 3TP2A 5J1EB 3HFKA 3SEOA 1FESA 3SCJE 2J9DE 2QMXA 1TKZA 3MPWA 2EI5A 4K4VA 4RW8A 2FC9A 3UE2A 1FDBA 1ROFA 2MPUA 2E29A 4DV3F 2YNFB 4WIIA 3JSMA 2UVUA 4MKBA 2VA2A 1F5CA 3RB6A 3QIPB 5KFDA 3QPIA 2HFZA 1KR4A 1HBUB 4KV8A 4R0EA 2W8LA 2DGQA 3DOKA 3JTPA 4ZCKA 4LFBF 4JI5F 3TR5A 1JLQA 3MEGA 1LW0B 2RQMA 2VFTA 1LFWA 4KT0C 5LMNF 2KO1A 2HWTA 2KVIA 1RISA 4HEA9 5DG9A 1UA1A 4TKTA 5KFOA 4YFUA 1R0AA 3FQKA 2GO9A 2P9CA 1NJYA 3PX4A 2FHJD 1ZTTA 4PPDA 4QPXA 4KHPF 4N5SA 2E5LF 4ED3A 2ZFHA 3CWJA 1P1TA 3L09A 4DSKA 5FIIA 3BZQA 3CJ5A 4X4PA 3HVRA 1HYSA 2R8IA 4X4UA 1RT4A 2ZC3A 4QCLA 4JI6F 1PSDA 3CCVS 2C2DA 3FRYA 2DHGA 3FRZA 4IOAQ 4QWDA 4Q5VA 4QWCA 4IG3B 5KFLA 2PEHA 3Q0AA 1H0HB 1WACA 2GJ2A 2WTFA 4WYLA 1TK8A 2ZH5A 4O3PA 4DV4F 5KG5A 2HGLA 7FD1A 2YNHA 1RTJB 3DXSX 3H2LA 2DHSA 3KJVB 2FHJA 4DV1F 1VQNS 2FHKA 2BJDA 1EETB 2CQIA 4KE5A 1Y00A 3LANA 2KG1A 4C2MA 4ID8A 4F67A 3R3TA 2G0CA 1FRXA 4KJIA 4Q7AA 2MY7A 2J6SA 5A6WA 1IR0A 2JFKA 3DOLB 4OQJA 4X66F 4DL3A 3ZZPA 3OL6A 1S6PB 4M5DA 2CQCA 2YH1A 3IGNA 2JJ4D 2GGPB 3M9OB 4O4RA 4ZP9A 2RB7A 5L9NA 1K1SA 3SYZA 2AJFE 1FKOA 2FIUA 2N82B 1RP5A 1Y5IB 2KG0A 2DRBA 4EYIB 1NK7A 3FMBA 2Y1IA 2LMIA 1MU2A 1NJXA 3IN5A 3LOUA 5GAGU 3BN4A 2AJ1A 4B9SA 1FNMA 3G8QA 4F2SA 2YNGA 1T3OA 1LFPA 2XEXA 1AUDA 3OR2B 3HKWA 4IG3A 2CQPA 3BQ2A 1DQ8A 2ZE2A 4BBYA 3GIJA 4A8XA 2L9NA 4DQRA 2OD6A 2E1MC 2QFJA 2HMIA 2BZ2A 2L08A 3KLGA 4ID5A 3FQLA 2VG6A 2FVPA 3MM5A 4LSLB 2KJVA 4MFBA 3CMES 4CO5A 3F56A 4CO0A 4WYWA 2AW0A 4OZ0A 2KHDA 3EX7B 3MMCA 1FRIA 2OIHA 1YSJA 3FJ2A 5LL6d 1S48A 5IQ6A 4B9VA 1X4GA 1YIJS 4BC9A 2JDJA 5FJ4A 1JNZB 3MM6A 4EGLA 5K8MA 1X9SA 1BWEA 2FB0A 2KXFA 1S0NA 4JV1A 4ELUA 2IBOA 4TYAA 1WELA 2D3UA 2QA4G 3GR1A 2HFOA 2PMZD 3M4XA 4EWTA 2ZD1B 3VWSA 3PW5A 5T7LB 2CPZA 1H3DA 4RKUC 3CCUS 3K0JA 1N5TA 1HNZF 4IQMA 3CF5Q 4ZP7A 2WHOA 1FRLA 1VRUB 1CVJA 2RRBA 1RT5A 4MAKA 5KFWA 4ED7A 2ZUGA 2HNZA 1D8YA 3UW1A 2JHEA 3DLEA 1O5JA 2XY5A 2RKIA 1BLUA 3QJPA 2PA8D 2CPYA 4F4YA 2FVCA 2FJVA 1DHMA 3OHAA 3NBPB 5KG1A 2WOMA 1KTQA 4FF1A 4F26A 2M4MA 5E7OB 1X4BA 3MR5A 1D9FA 5C42A 3M2RB 3TAPA 1ZBTA 4LQ9A 3DHWC 3KK3B 3KHRA 2HGMA 4IUFA 3BO3A 2NYIA 5HROA 4NL5A 1IQTA 3KK1A 1JLBB 3DMJB 1QTMA 2XSJA 1S1VA 3V5RA 2VUGA 2OFHX 1VQ5S 3VCDA 2CJBA 1DTQA 3POTB 4FXVA 1V3ZA 2MKCA 4MK8A 2ERRA 1S1UA 1G7CB 2NLWA 2XMWA 2J7KA 2W8KA 3K5PA 1HD1A 1BQXA 1URRA 2OO4A 1QVGR 1P1LA 2BBEA 1SBRA 3GILA 1Q82T 2XHWA 5GAEU 5D3GA 2L9WA 2NXUA 1DTQB 2LQBA 1RJJA 3FSYA 1N56A 3SI8A 4RNFA 3RW6A 3KWMA 1HW9A 4XO0A 1FD8A 2Y1JA 4W92B 1YRXA 1N52B 3O44A 3CVKA 3EGZA 3U02A 4I7FA 1CG2A 1YRTA 3RU0A 2WB1D 1IJEB 4C97A 5KT4A 4B9LA 1TR0A 1CLFA 4F02A 2IFXA 1R6YA 3CJ4A 3IXQA 3M2RA 5CZVA 3UNGC 4ES2A 1FHTA 1S6UA 4ZCLA 4ELTA 1T03A 4DQPA 5KG2A 1K1QA 2V8HA 3GIKA 1SUQA 1N5YB 4X4VA 1RA6A 5FDLB 2GGPA 1C4CA