3IX4A

Lasr-tp1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
GFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein lasR
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 52
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix4A00
4Y17A 2AVXA 4Y15A 3IX8A 3IX4A 3QP1A 4LGWA 2Q0OA 3QP6A 5L10A 3IX3A 3QP4A 5L09A 3QP5A 1L3LA 4NG2A 3JPUA 3QP8A 2UV0E 3QP2A 3SZTA 1H0MA 4LFUA 5L07A 4Y13A
chains in the Genus database with same CATH superfamily
5GLBA 4F94A 3CJMA 1DJBA 1N4OA 4ESPA 4PAUA 2Q9NA 3HLCA 3MXRA 4WBGA 5F1FA 4WUJA 1V9YA 1ALQA 1GA9A 4JLFA 2J3TC 5HDDA 4Y7PA 1YAXA 2NUTC 1PIOA 2KDKA 3Q7VB 2HDQA 1PWGA 4NG2A 4L9EA 3S22A 4IUHA 1KGFA 2BLSA 2DRWA 4E3LA 1SZVA 5GLDA 4OLDA 4E3IA 1D06A 1RGZA 1D1JA 1W79A 3LUQA 2EFUA 3OCNA 3BFGA 4OPYA 1LI9A 1STZA 3Q81A 3NECA 4EQIA 5F69A 3LIDA 1BLCA 1BZAA 4UHUA 1W8YA 3UNWA 4HH3A 4Q0HA 5DF9A 4BQMA 2W1TA 5EVID 4JXVA 5L8MA 1RCJA 4YNRA 2W3GA 2JKFA 2V1ZA 3PBSA 2C6WB 4KUKA 4E6XA 4HP4A 3MQOA 3PAEA 4HEFA 4EEPA 5TGFA 2Y59A 2M7VA 3UE0A 3SZTA 1EW0A 5DVAA 4HJ3A 3IBRA 4WMCD 4WMCA 2WUQA 2VZWA 4S2KA 1V9ZA 3CMZA 4ARZB 5EVLA 4P6BA 4R3BA 3K2NA 1GSVA 4UQIS 2PR6A 5TBMB 2GZAA 1G6OA 3S1YA 5J3WA 1ESUA 3ZDJA 1M6KA 3F1PB 4I3IA 2PBDP 5DF8A 4ZRRA 1KGEA 3HLBA 3UPPA 3FG8A 4WF0A 3AGDA 2Z6CA 3T4OA 3UPOA 2Y2QA 4WZ5A 3KO6A 3NCKA 3ZG5A 3EEAA 3G32A 4O7DA 1JTGA 2O0YA 1O7EA 4KQQA 4X1MA 5DKKA 2H28A 1DP9A 4I38A 2R9WA 4P6ZS 4HESA 4XUXA 4B88A 2XEPA 5FAOA 3C7VA 5F5YA 1IYPA 4ZDXA 4S2OA 4EUZA 3WS5A 3RJUA 4S2LA 4MN5A 3S7OA 3T4SA 4PM8A 2XA7M 3KYEA 4I39A 3S7PA 3VV4A 1G6AA 1FQGA 3KYQA 4UA6A 4EBNA 5L2FA 1MWUA 1PNEA 1YLPA 3CITA 4ME4A 3E2LA 1C3BA 4JF6A 4BLMA 5F6AA 1PFLA 3LIAA 2VV6A 1CI8A 3DWKA 2YKFA 4JXGA 1FOFA 3MKFA 3W4QA 4N92A 5E43A 1SDNA 3IXBA 3WS4A 3ITBA 4R6LA 2JBFA 3GV9A 4GDBA 3IXHA 1X0OA 2MJ6A 3T1SA 2PR5A 3Q7VA 3LR5A 2HP9A 3IX3A 5J7EA 3TW8A 3V5MA 2J8YA 4H6JA 3ZVWA 5A8BA 5AQAA 4F3LB 1Y4OA 3MFXA 5EM1A 5F83A 3UMDA 4EETB 1NJ4A 1YM1A 3KYZA 4DE3A 1PZPA 3LEZA 4B4XA 2JHEA 3SH7A 4BD0A 5CECA 4CLCD 1K4EA 4PHTA 2V2FF 2QJ5A 3BYDA 4UA7A 3IBJA 2BASA 5FQJA 3N8RA 4X69A 3NBLA 3BRMA 2EX2A 2HJEA 1NY0A 2ZC3B 3M2KA 3PAGA 5CHJA 4NETA 3MZDA 3QP6A 3GDIA 2OLVA 4XXRA 2QMIA 4B93A 3GTCA 2XK1A 3UB6A 1IYQA 3AGFA 4Z1WA 2WAEA 4ZJ3A 2Y2LA 4YWZA 3CZDA 3GQZA 1FIKA 3QP1A 4ARZA 1K4FA 3K3DA 3A3IA 4IVKA 5HD5A 5EOEA 3SS3A 5U47A 2OWJA 5AVEA 5TBMA 3W8KA 3MSHA 3G35A 3KSFA 4GZBA 1L0GA 1F98A 4UEYA 3F1PA 3KSIA 4DXCA 5GLCA 1OTAA 3EQVA 1PWDA 5E2EA 3O3VA 4DE2A 3HL9A 1SCWA 3ZGAB 4WM9A 4S2NA 4WELA 3T4LA 1YT4A 1ZHHB 2W3DA 3E4QA 3P98A 4R0QA 3D4FA 3UPNA 3UB8A 2PD8A 5FA7A 2P08A 3FKWA 4I3AA 2OWHA 1PRQA 5FQMA 5EFWA 2XRNA 1GHIA 2PHYA 5HFOA 3OPRA 5HW3A 3Q07A 3TOIA 1BULA 4EV4A 2O99A 3B33A 1NYYA 1WYBA 1PI4A 3G2ZA 4HBTA 3SW1A 2ZQ9A 5FAQA 2XH9A 4X68A 5HARA 4KG2A 4KG5A 5GLAA 1K25A 3R4KA 1RP5A 4JKTA 2OV5A 4KZ4A 3UE3A 3KX0X 4ZBEA 1MBLA 2W1RA 3HCYA 2V9AA 3LFVA 4X1LA 1YLZA 4OPRA 1ZG4A 4F3LA 3LIFA 3LR4A 1LHYA 1KDWA 4BL3A 4BD1A 3S7NA 4EBLA 4R23A 3N8LA 5HPIA 5I5LA 5DTTA 3N7WA 3IX8A 3C38A 3S7QA 3ITAA 3HUMA 2K31A 5F68A 3T4JA 4MN6A 3IXDA 4FSFA 2FFFB 2V1BA 1O07A 1FR1A 2PDRA 4IEDA 4HQAA 4FTXA 3UO9A 5GL9A 3RXWA 3FV7A 4OQ0A 2WKPA 4Y0OA 2I9VA 1OTEA 4K0XA 1ESIA 2OAQ1 3UDXA 3Q82A 4LENA 3ZNTA 3N8SA 1Q2PA 1OTDA 3GVBA 4EXOA 1CQAA 1IKGA 4DXBA 3UN7A 3SS4A 3EGDC 2ZM0A 2IWBA 2HGVA 3HREA 4N9LA 1K57C 4GD8A 1TD5A 1L0FA 5CX7A 4DDYA 1FCOA 3UE6A 2PT7A 1OT6A 5CGXA 1IEMA 1FCNA 4ID4A 2EX6A 4PPRA 2ZMFA 3I7JA 4L9FA 5AJGA 2C5WB 4JXSA 3BFDA 4HIAA 3QNCA 4DKIA 4E6WA 4UA9A 2EWVA 4UQIM 3E2KA 2VX8A 3DAVA 4BL2A 3VSLA 4CQHA 2Y2JA 1GHPA 1P97A 5M19A 1CI9A 3E98A 1DP8A 5A90A 2Z2MB 3HJIA 2PU4A 4DE0A 1AXBA 5IHVA 5KIZA 3ULFA 1VETB 4RVAA 5FATA 2INWA 4KZAA 4QB8A 4GJ4A 3VE4A 4E3KA 3CPTB 4OP8A 1XFQA 2B95A 1NRJA 1S1YA 5GHYA 2L1MA 3NC8A 4YFMA 1LLBA 1QMFA 3L7HA 4FH2A 4OQIA 2WK0A 4JBFA 3BEBA 1CEGA 1W7FA 1N9NA 4I3JA 3B3XA 4LRYC 2Y55A 2I72A 4JPMA 4PM5A 4PMAA 3G4PA 5KMWA 1BLPA 1KVMA 1PWCA 2ZC5B 3Q7ZA 1JNUA 3NDEA 4ZJ1A 1XGJA 3WS0A 4BBTA 2UWXA 2VGLM 5EM0A 4DF6A 1KDSA 4CJNA 3ICYA 4CLCE 3PR6A 4BWIA 4QWOA 3O88A 4RX2A 5CHUA 1ES2A 4Y0UA 3C7UA 3CHWP 4FUWA 2XD1A 1DY6A 4NXBA 4S2PA 1PZOA 2WADA 3UMEA 2EA9A 3WRZA 5FQQA 2G2UA 3UE1A 3JVVA 5HPFA 1TS8A 5CXWA 4X56A 4LPZA 3BQ8A 1JWZA 4R70A 4CLCB 4R4SA 1E4DA 5FQKA 4ZAMA 1NZUA 5EVIA 2A2LA 1VB6A 2Z6DA 5EVIC 3IF5A 2O9AA 1M40A 1MC0A 3OLOA 4G3KA 2P7JA 3VFHA 3BJNA 1TS7A 1LSVA 4GNUA 1K55A 5L10A 1OTBA 2YKHA 2EXBA 1FILA 4Y3IA 1DJAA 2LB9A 3GSGA 1XGIA 3JYIA 1XX2A 3W4PA 2H5SA 5L07A 2V0UA 4KQRA 2ZL1B 5JYPA 2ZMVA 2VGKA 1S4RA 2OAP1 2E8IA 2QWSA 3ISGA 1K6SA 3VSKA 4FOFA 1L3LA 3OOVA 2G2WA 2Q9MA 1XJ2A 3DBAA 4JXWA 1N9OA 1VETA 4WZ5C 1IELA 2WKEA 5IS1A 1QMEA 5FEFA 1G68A 3V67A 4EW7A 3G6OA 4IBRA 3N6IA 2W0NA 4MLLA 3CPTA 4YOFA 1TF1A 4G3WA 1YSPA 3CUEA 3QP5A 1OJGA 3HVFA 1GHMA 5GHZA 2VV8A 3QP8A 3HJKA 3A3FA 2DCFA 2IWCA 1YMSA 3WS1A 3ZYTA 5E2HA 1MWSA 4JF4A 4C3QA 1ONGA 1SHVA 5IT5A 3C4PA 1S66L 1VHMA 4Q8IA 2A24B 4ETXA 3WS2A 4Y13A 3PBRA 5KZHA 1IOUA 3DWZA 1ODVA 4O01A 1XPBA 3MMHA 1FSWA 2Y8HA 5HWVA 4KZ9A 2ZC7A 3MQQA 1S4SA 2X01A 3IF6B 2HV1A 2B02A 3HLWA 2XR0A 1F2KA 3MXSA 2PYRA 3BWLA 4QY6A 3QNBA 4DN0A 4FD8A 2Q0OA 2GJ3A 3FPWA 3M6HA 2X71A 1NYMA 3T1XA 4CLCA 3WRTA 4MBFA 3T4KA 3FWLA 4CLCC 1H8ZA 3MZEA 2V1AA 1F9IA 2BG1A 1HZOA 2H0TA 2EXAA 4HJ6A 4WYYA 3U2AA 3Q1FA 1L2SA 3A3EA 2Z2LB 1IFQA 2OLUA 3F1OB 1NXYA 2IWDA 1S1ZA 4S2MA 4OPZA 4Y15A 1L0DA 2Y2NA 5G18A 3LYXA 1I5QA 4D60A 2J3WA 4N1HA 1XFNA 2QKPA 3D72A 3CLOA 3O86A 3S4XA 2ZL1A 4QJGA 2DNSA 2ZC6B 3IS2B 2PD7A 3PHYA 4GHIB 3BM6A 4P87A 3BECA 1IYSA 4AFIA 1W63Q 3TG9A 1TDLA 3NDGA 1H3QA 4GOGA 1H5XA 3V3SA 2H10A 1GSXA 1MPLA 2Y2GA 3A3DA 2A49A 2FFYA 4EUVA 5HL1A 4S2NC 4MBKA 1NZOA 2HJ9C 2WGWB 2Y2KA 2ZD8A 4IVIA 3MF0A 5TJJA 3HLFA 4LRZE 4JGQA 4FCFA 4MCWA 4KZ6A 5HZHA 4XUZA 2D02A 4OP5A 4GCZA 3NOPC 2HP6A 3OZHA 2W3EA 1ZC2A 4QPRA 3EOIA 1OT9A 1DRMA 3MS6A 3FYZA 5HAPA 2A24A 4QHCA 1PW1A 5FDHA 3HBRA 4LLOB 1ZG6A 3TJZC 1MXOA 1MWRA 3H7WB 1WE4A 5HDCA 2RCXA 3TE8A 2KLIA 4K08A 3C8CA 1H0MA 5A91A 2XD5A 1FSYA 3PBTA 3P09A 2XQZA 1SKOB 3LEQA 1K0KA 1T1BA 2J9PA 2OOLA 3LICA 1RGYA 3HLGA 2W3FA 3IX4A 3IF6A 5DFYA 4O0PA 2DMWA 5EE8A 3JPUA 2JCHA 5HAIA 3MXQA 2Y2IA 1G5UA 1T19A 4G3VA 3UDIA 5TR7A 2EWWA 4BJPA 1BLSA 3G31A 1E3UD 1PW8A 4BBVA 1E3UA 5IU1A 4LGWA 1J9MA 5HDSA 5G4YA 4H8RA 3NOTC 5FSRA 4Y0TA 2WKIA 1GA0A 3HUOA 4OQHA 2K7SA 1I2WA 3LIEA 1MKIA 4OKPA 3VP1A 2V0WA 1ZKJA 4HH2A 5FQIA 4KZ5A 1BSGA 1KE0A 4GW9A 1JTDA 3F1OA 5DF7A 1IKIA 1MZUA 3ZG8B 5JYOA 3P7NA 3ZHHA 4OVDA 3TRCA 2PYPA 3QP2A 2R78A 3V39A 4HJ4A 1LL8A 3F1NB 1OPXA 2ZQ8A 1K54A 5KSHA 2JC7A 3SH8A 1K54C 4KQOA 2VGJA 5FI7A 4IJGA 4DRTA 3DW0A 3SH9A 3IS2A 3BLSA 4GHIA 1UGUA 4OOLA 2Y2OA 2WKQA 4P85A 1CF0A 3DTEA 3BFCA 1Q2QA 5CGWA 3VMAA 3T50A 5EOOA 4R38A 3ZG9B 4GS9B 1MWTA 2V8FA 3LY4A 2ZQCA 3MQ0A 4R4RA 2WGWA 3T12B 2EX9A 5J4EA 1NLYA 3FKVA 4K91A 2R9XA 5DTKA 2EX8A 4WN5A 3FPVA 3VOYA 4KZBA 1L0EA 3LGOA 3ZVTA 1ACFA 2W3HA 2HDRA 4P6ZM 1VQQA 3NOUC 3EQUA 4ZJ2A 5DKLA 2Y2MA 1LL9A 3EGXC 5HWWA 1A0KA 4L0LA 3H7WA 4NKPA 2QPNA 4M3KA 4IHQA 1PI5A 1W63M 4JGOA 4PKYA 1BLHA 3ZFZA 3GECA 4HY8A 4HP9A 4IUKA 5GHXA 4IBXA 2WZXA 3L9KA 4Z9QA 4MNRA 3LI9A 1KGGA 3MKEA 2QYBA 3B47A 3QP4A 3W4OA 4OQGA 2JKRI 2X02A 2FZ0A 1LT0A 4QY5A 4ETZA 2J9OA 4E3NA 2J3TD 3VP2A 5AQ9A 2JE5A 2NUPC 2ZBBA 1W5DA 1BT5A 3VP3A 1W8QA 4E04A 2O9BA 3ZG0A 3HUNA 4H6JB 2WAFA 1MY8A 2GDNA 3IWIA 3NIAA 5HSQA 1EROA 1TDGA 3A3JA 4N9KA 1HLUP 3AGEA 3OPPA 4MDZA 3G2YA 1Y54A 1H8MA 2RL3A 1YLWA 3F1NA 5DJTA 4KZ3A 1ES5A 2ZQDA 3IWOA 5CRFA 2IA2A 3PTEA 3M2JA 1KOUA 5EPHA 2QJ7A 1SDEA 3BFEA 1XJ4A 1DJCA 3VP4A 4RQ9A 3PXPA 4HI4A 2CC1A 4PM9A 2VJWA 4Y5FA 1ONHA 3VOLA 4DJ3A 2H0YA 1K55C 5FL3A 2XFSA 4GD6A 4B4ZA 1BTLA 3LY3A 3M6BA 1Z6FA 3MZFA 2Y2PA 4N1XA 4PM6A 1XKZA 4GS9A 1ERMA 4R3AA 3NY4A 2O9CA 3H9WA 3IHBA 2ZOIA 3GMWA 2W27A 2B18A 1ERQA 2PAVP 5E2GA 2JKTI 3CWFA 1DP6A 1AWIA 4B9OA 4E3JA 4MEZA 4NXFA 5M1AA 5D3OA 4M4XA 3CUEC 1SKFA 2K2NA 5FAPA 1K38A 4P0MA 3C30A 3FC7A 1XJ3A 3W2ZA 5F82A 4RA7A 5CEDA 2ZQ7A 2Y79A 2HF6A 1K56D 1OJ5A 4QU3A 5EVEA 1K56A 5I94A 3U4LP 2P04A 1D7EA 1YMXA 3BY8A 1KE4A 2JKRM 3BQAA 4CPKA 1EI5A 3DTIA 4NEED 4KQDA 2ZC4B 1OTIA 2GNXA 1LSWA 1MKMA 1ZTUA 5EUAA 3A0SA 1Y28A 3OBFA 5HX9A 3JVUA 1PYYA 1XP4A 2XDMA 3B42A 1I2SA 4OPQA 4HNBA 5CEBA 2WKRA 3MR0A 2QHKA 4NXEA 2VGLS 4GN2A 5DTSA 2ACGA 3KSGA 5FI2A 2J7VA 2ZOHA 3IH8A 5F1GA 4C6YA 1TEMA 5G4ZA 4EQ1A 3OPLA 3RXXA 1TVFA 4MMNA 3G34A 3C4OA 4ZTKA 1P9WA 5BOHA 1BYWA 2VKSA 4C75A 4DE1A 4EEUA 4L9GA 3LCEA 2WYXA 4XT2B 3VOZA 5A92A 4X53A 4Q0IA 5CTNA 4PKYG 1T18A 3QHYA 3IH9A 2XSSA 3UY6A 1NWZA 2D01A 1HVBA 2JKGA 5EECA 4KG6A 2P74A 3OC2A 1NRFA 4OONA 1NLZA 1XA1A 4E3MA 3R7WB 4OOMA 5L09A 2WZZA 1FR6A 2PBYA 2L0WA 5E2FA 4HHDA 4BBUA 3LR0A 4OOYA 4X6TA 3MFDA 5A93A 3IQAA 2ZM8A 5CERA 3N4IA 3ZG7B 1WYCA 2VK3A 5CTMA 3FZCA 3EWKA 3IT9A 3D9YA 2ZJ9A 1LI0A 3BFFA 1LL5A 4MBHA 4S2JA 4PM7A 1P0ZA 3BW6A 3KSHA 2JKTM 1YKDA 2A3UA 5HWTA 2P9VB 3E0YA 4EBPA 4R1GA 4LFUA 3UB5P 1ES4A 4WLAA 1J3WA 4E3OA 4GKUA 3D3OA 5FASA 4LCMA 1ES3A 5EV0A 3PBNA 3E4PA 4EWFA 1VEUB 4KENB 5TFQA 4LV1A 5HD3A 2PRFA 2ZM2A 2V8CA 5FEGA 1HD8A 4Q0JA 3WWXA 4WEJA 2GX5A 5M18A 1JWPA 2AVXA 1S0WA 3RH8B 2LB5A 3ZCZA 3O5YA 2XA7S 3PBQA 4DDSA 4BMWA 3K3CA 2HDUA 1F5MA 5AVFA 3PBOA 2JN7A 2WGVA 1XA7A 4GDNA 4LV3A 4X55A 3CAXA 4R3JA 4Y17A 3NHQA 4LRXC 1U60A 2V20A 1YQSA 3A0RA 4GB7A 1E25A 1G28A 3PYPA 1EWZA 4KZ8A 1IYOA 3IF6C 1CK3A 4FH4A 2WGIA 4DJ2A 3HLEA 4NK3A 3C2WA 1K6RA 1N9LA 2XLNA 1S6RA 3V3RA 3LR3A 3H82B 3G30A 3LI8A 3RFBA 4D2OA 2Y2HA 2HDSA 3E4OA 3BLMA 3MJQA 3NI9A 4EESA 2KX6A 2VEAA 1OMEA 3O87A 4OLGA 2PU2A 1YLJA 2ZMAA 5FI6A 2B5RA 3P01A 5K5BA 3IHAA 3UDFA 2XROA 5MC7A 4XT2A 2QZ6A 3OPHA 5C5KA 2M7UA 3VE3A 1H8YA 1LSXA 2E8JA 4A5RA 4WZ4A 2FH5A 4X25A 1CJFA 3LO7A 3IXGA 2BTFP 1T1AA 2XGNA 4GLQA 3A0VA 1YSQA 3CG5A 3V50A 1GSWA 1UWPX 2OSUA 3SOIA 1T1CA 1P9RA 3GRJA 2HPBA 2M1CA 5HAQA 3R7WA 2HZ5A 3C5AA 4UAAA 1CEFA 2J80A 3UB7A 4S2IA 2Y91A 1N9BA 2VV7A 2ZLYA 2W1TB 4U0XA 5HL6A 5EVIB 2G7UA 4Y2FA 4KUOA 4II7A 3OCLA 1YLYA 4K0WA 4O8GA 3GR2A 2CMNA 4JGPA 3DTMA 3ZQ5A 1XJ6A 1UWNX 4JF5A 1Z09A 4RYEA 5DFXA 1YLTA 3T4QA 2WKHA 1K57A 2Y4AA 4EU0A 1BUEA 3NJAA 2P9VA 3EEHA 3BY9A 4I5SA 5DJUA 4LCLA 3DTKA 5AQ7A 4NXGA 1XXMA 3NULA 1FCMA 2VA0A 2XFTA 3UB9A 3T1QB 2XF3A 3RTYA 1VM1A 1JWVA 1VEUA 1GCEA 5FDSA 2HP5A 5CHMA 2ZQAA 3HLDA 2L4RA 1TS6A 4DMZA 3SS5A 4OH0A 3MBZA 5KSCA 4KZ7A 4HOIA 4MN7A 3LIBA 2KOIA 4WL9A 5AQBA 1TS0A 5J8XA 3IWQA 1WA9A 2EFXA 4YINA 4LV0A 4HBUA 3VP0A 1SKOA 2UV0E 3TSGA 4WEKA 2VLGA 3T4TA 5CGSA 1JVJA 1KVLA 3T1RA 4U3TA 1YPRA 4LV2A 3ZNYA 3CI6A 5FQ9A 4EERA 3VFFA 4QD4A 1S67L 3H82A 4U0TA 5LBRA 1KE3A 4RX3A 4JGRA 4BENA 1HTZA
chains in the Genus database with same CATH topology
4Y17A 2AVXA 4Y15A 3IX8A 3IX4A 3QP1A 4LGWA 2Q0OA 3QP6A 5L10A 3IX3A 3QP4A 5L09A 3QP5A 1L3LA 4NG2A 3JPUA 3QP8A 2UV0E 3QP2A 3SZTA 1H0MA 4LFUA 5L07A 4Y13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  2AVX A;  4Y15 A;  3IX8 A;  3IX4 A;  3QP1 A;  4LGW A;  2Q0O A;  3QP6 A;  5L10 A;  3IX3 A;  3QP4 A;  5L09 A;  3QP5 A;  1L3L A;  4NG2 A;  3JPU A;  3QP8 A;  2UV0 E;  3QP2 A;  3SZT A;  1H0M A;  4LFU A;  5L07 A;  4Y13 A; 
#chains in the Genus database with same CATH topology
 5GLB A;  4F94 A;  3CJM A;  1DJB A;  1N4O A;  4ESP A;  4PAU A;  2Q9N A;  3HLC A;  3MXR A;  4WBG A;  5F1F A;  4WUJ A;  1V9Y A;  1ALQ A;  1GA9 A;  4JLF A;  2J3T C;  5HDD A;  4Y7P A;  1YAX A;  2NUT C;  1PIO A;  2KDK A;  3Q7V B;  2HDQ A;  1PWG A;  4NG2 A;  4L9E A;  3S22 A;  4IUH A;  1KGF A;  2BLS A;  2DRW A;  4E3L A;  1SZV A;  5GLD A;  4OLD A;  4E3I A;  1D06 A;  1RGZ A;  1D1J A;  1W79 A;  3LUQ A;  2EFU A;  3OCN A;  3BFG A;  4OPY A;  1LI9 A;  1STZ A;  3Q81 A;  3NEC A;  4EQI A;  5F69 A;  3LID A;  1BLC A;  1BZA A;  4UHU A;  1W8Y A;  3UNW A;  4HH3 A;  4Q0H A;  5DF9 A;  4BQM A;  2W1T A;  5EVI D;  4JXV A;  5L8M A;  1RCJ A;  4YNR A;  2W3G A;  2JKF A;  2V1Z A;  3PBS A;  2C6W B;  4KUK A;  4E6X A;  4HP4 A;  3MQO A;  3PAE A;  4HEF A;  4EEP A;  5TGF A;  2Y59 A;  2M7V A;  3UE0 A;  3SZT A;  1EW0 A;  5DVA A;  4HJ3 A;  3IBR A;  4WMC D;  4WMC A;  2WUQ A;  2VZW A;  4S2K A;  1V9Z A;  3CMZ A;  4ARZ B;  5EVL A;  4P6B A;  4R3B A;  3K2N A;  1GSV A;  4UQI S;  2PR6 A;  5TBM B;  2GZA A;  1G6O A;  3S1Y A;  5J3W A;  1ESU A;  3ZDJ A;  1M6K A;  3F1P B;  4I3I A;  2PBD P;  5DF8 A;  4ZRR A;  1KGE A;  3HLB A;  3UPP A;  3FG8 A;  4WF0 A;  3AGD A;  2Z6C A;  3T4O A;  3UPO A;  2Y2Q A;  4WZ5 A;  3KO6 A;  3NCK A;  3ZG5 A;  3EEA A;  3G32 A;  4O7D A;  1JTG A;  2O0Y A;  1O7E A;  4KQQ A;  4X1M A;  5DKK A;  2H28 A;  1DP9 A;  4I38 A;  2R9W A;  4P6Z S;  4HES A;  4XUX A;  4B88 A;  2XEP A;  5FAO A;  3C7V A;  5F5Y A;  1IYP A;  4ZDX A;  4S2O A;  4EUZ A;  3WS5 A;  3RJU A;  4S2L A;  4MN5 A;  3S7O A;  3T4S A;  4PM8 A;  2XA7 M;  3KYE A;  4I39 A;  3S7P A;  3VV4 A;  1G6A A;  1FQG A;  3KYQ A;  4UA6 A;  4EBN A;  5L2F A;  1MWU A;  1PNE A;  1YLP A;  3CIT A;  4ME4 A;  3E2L A;  1C3B A;  4JF6 A;  4BLM A;  5F6A A;  1PFL A;  3LIA A;  2VV6 A;  1CI8 A;  3DWK A;  2YKF A;  4JXG A;  1FOF A;  3MKF A;  3W4Q A;  4N92 A;  5E43 A;  1SDN A;  3IXB A;  3WS4 A;  3ITB A;  4R6L A;  2JBF A;  3GV9 A;  4GDB A;  3IXH A;  1X0O A;  2MJ6 A;  3T1S A;  2PR5 A;  3Q7V A;  3LR5 A;  2HP9 A;  3IX3 A;  5J7E A;  3TW8 A;  3V5M A;  2J8Y A;  4H6J A;  3ZVW A;  5A8B A;  5AQA A;  4F3L B;  1Y4O A;  3MFX A;  5EM1 A;  5F83 A;  3UMD A;  4EET B;  1NJ4 A;  1YM1 A;  3KYZ A;  4DE3 A;  1PZP A;  3LEZ A;  4B4X A;  2JHE A;  3SH7 A;  4BD0 A;  5CEC A;  4CLC D;  1K4E A;  4PHT A;  2V2F F;  2QJ5 A;  3BYD A;  4UA7 A;  3IBJ A;  2BAS A;  5FQJ A;  3N8R A;  4X69 A;  3NBL A;  3BRM A;  2EX2 A;  2HJE A;  1NY0 A;  2ZC3 B;  3M2K A;  3PAG A;  5CHJ A;  4NET A;  3MZD A;  3QP6 A;  3GDI A;  2OLV A;  4XXR A;  2QMI A;  4B93 A;  3GTC A;  2XK1 A;  3UB6 A;  1IYQ A;  3AGF A;  4Z1W A;  2WAE A;  4ZJ3 A;  2Y2L A;  4YWZ A;  3CZD A;  3GQZ A;  1FIK A;  3QP1 A;  4ARZ A;  1K4F A;  3K3D A;  3A3I A;  4IVK A;  5HD5 A;  5EOE A;  3SS3 A;  5U47 A;  2OWJ A;  5AVE A;  5TBM A;  3W8K A;  3MSH A;  3G35 A;  3KSF A;  4GZB A;  1L0G A;  1F98 A;  4UEY A;  3F1P A;  3KSI A;  4DXC A;  5GLC A;  1OTA A;  3EQV A;  1PWD A;  5E2E A;  3O3V A;  4DE2 A;  3HL9 A;  1SCW A;  3ZGA B;  4WM9 A;  4S2N A;  4WEL A;  3T4L A;  1YT4 A;  1ZHH B;  2W3D A;  3E4Q A;  3P98 A;  4R0Q A;  3D4F A;  3UPN A;  3UB8 A;  2PD8 A;  5FA7 A;  2P08 A;  3FKW A;  4I3A A;  2OWH A;  1PRQ A;  5FQM A;  5EFW A;  2XRN A;  1GHI A;  2PHY A;  5HFO A;  3OPR A;  5HW3 A;  3Q07 A;  3TOI A;  1BUL A;  4EV4 A;  2O99 A;  3B33 A;  1NYY A;  1WYB A;  1PI4 A;  3G2Z A;  4HBT A;  3SW1 A;  2ZQ9 A;  5FAQ A;  2XH9 A;  4X68 A;  5HAR A;  4KG2 A;  4KG5 A;  5GLA A;  1K25 A;  3R4K A;  1RP5 A;  4JKT A;  2OV5 A;  4KZ4 A;  3UE3 A;  3KX0 X;  4ZBE A;  1MBL A;  2W1R A;  3HCY A;  2V9A A;  3LFV A;  4X1L A;  1YLZ A;  4OPR A;  1ZG4 A;  4F3L A;  3LIF A;  3LR4 A;  1LHY A;  1KDW A;  4BL3 A;  4BD1 A;  3S7N A;  4EBL A;  4R23 A;  3N8L A;  5HPI A;  5I5L A;  5DTT A;  3N7W A;  3IX8 A;  3C38 A;  3S7Q A;  3ITA A;  3HUM A;  2K31 A;  5F68 A;  3T4J A;  4MN6 A;  3IXD A;  4FSF A;  2FFF B;  2V1B A;  1O07 A;  1FR1 A;  2PDR A;  4IED A;  4HQA A;  4FTX A;  3UO9 A;  5GL9 A;  3RXW A;  3FV7 A;  4OQ0 A;  2WKP A;  4Y0O A;  2I9V A;  1OTE A;  4K0X A;  1ESI A;  2OAQ 1;  3UDX A;  3Q82 A;  4LEN A;  3ZNT A;  3N8S A;  1Q2P A;  1OTD A;  3GVB A;  4EXO A;  1CQA A;  1IKG A;  4DXB A;  3UN7 A;  3SS4 A;  3EGD C;  2ZM0 A;  2IWB A;  2HGV A;  3HRE A;  4N9L A;  1K57 C;  4GD8 A;  1TD5 A;  1L0F A;  5CX7 A;  4DDY A;  1FCO A;  3UE6 A;  2PT7 A;  1OT6 A;  5CGX A;  1IEM A;  1FCN A;  4ID4 A;  2EX6 A;  4PPR A;  2ZMF A;  3I7J A;  4L9F A;  5AJG A;  2C5W B;  4JXS A;  3BFD A;  4HIA A;  3QNC A;  4DKI A;  4E6W A;  4UA9 A;  2EWV A;  4UQI M;  3E2K A;  2VX8 A;  3DAV A;  4BL2 A;  3VSL A;  4CQH A;  2Y2J A;  1GHP A;  1P97 A;  5M19 A;  1CI9 A;  3E98 A;  1DP8 A;  5A90 A;  2Z2M B;  3HJI A;  2PU4 A;  4DE0 A;  1AXB A;  5IHV A;  5KIZ A;  3ULF A;  1VET B;  4RVA A;  5FAT A;  2INW A;  4KZA A;  4QB8 A;  4GJ4 A;  3VE4 A;  4E3K A;  3CPT B;  4OP8 A;  1XFQ A;  2B95 A;  1NRJ A;  1S1Y A;  5GHY A;  2L1M A;  3NC8 A;  4YFM A;  1LLB A;  1QMF A;  3L7H A;  4FH2 A;  4OQI A;  2WK0 A;  4JBF A;  3BEB A;  1CEG A;  1W7F A;  1N9N A;  4I3J A;  3B3X A;  4LRY C;  2Y55 A;  2I72 A;  4JPM A;  4PM5 A;  4PMA A;  3G4P A;  5KMW A;  1BLP A;  1KVM A;  1PWC A;  2ZC5 B;  3Q7Z A;  1JNU A;  3NDE A;  4ZJ1 A;  1XGJ A;  3WS0 A;  4BBT A;  2UWX A;  2VGL M;  5EM0 A;  4DF6 A;  1KDS A;  4CJN A;  3ICY A;  4CLC E;  3PR6 A;  4BWI A;  4QWO A;  3O88 A;  4RX2 A;  5CHU A;  1ES2 A;  4Y0U A;  3C7U A;  3CHW P;  4FUW A;  2XD1 A;  1DY6 A;  4NXB A;  4S2P A;  1PZO A;  2WAD A;  3UME A;  2EA9 A;  3WRZ A;  5FQQ A;  2G2U A;  3UE1 A;  3JVV A;  5HPF A;  1TS8 A;  5CXW A;  4X56 A;  4LPZ A;  3BQ8 A;  1JWZ A;  4R70 A;  4CLC B;  4R4S A;  1E4D A;  5FQK A;  4ZAM A;  1NZU A;  5EVI A;  2A2L A;  1VB6 A;  2Z6D A;  5EVI C;  3IF5 A;  2O9A A;  1M40 A;  1MC0 A;  3OLO A;  4G3K A;  2P7J A;  3VFH A;  3BJN A;  1TS7 A;  1LSV A;  4GNU A;  1K55 A;  5L10 A;  1OTB A;  2YKH A;  2EXB A;  1FIL A;  4Y3I A;  1DJA A;  2LB9 A;  3GSG A;  1XGI A;  3JYI A;  1XX2 A;  3W4P A;  2H5S A;  5L07 A;  2V0U A;  4KQR A;  2ZL1 B;  5JYP A;  2ZMV A;  2VGK A;  1S4R A;  2OAP 1;  2E8I A;  2QWS A;  3ISG A;  1K6S A;  3VSK A;  4FOF A;  1L3L A;  3OOV A;  2G2W A;  2Q9M A;  1XJ2 A;  3DBA A;  4JXW A;  1N9O A;  1VET A;  4WZ5 C;  1IEL A;  2WKE A;  5IS1 A;  1QME A;  5FEF A;  1G68 A;  3V67 A;  4EW7 A;  3G6O A;  4IBR A;  3N6I A;  2W0N A;  4MLL A;  3CPT A;  4YOF A;  1TF1 A;  4G3W A;  1YSP A;  3CUE A;  3QP5 A;  1OJG A;  3HVF A;  1GHM A;  5GHZ A;  2VV8 A;  3QP8 A;  3HJK A;  3A3F A;  2DCF A;  2IWC A;  1YMS A;  3WS1 A;  3ZYT A;  5E2H A;  1MWS A;  4JF4 A;  4C3Q A;  1ONG A;  1SHV A;  5IT5 A;  3C4P A;  1S66 L;  1VHM A;  4Q8I A;  2A24 B;  4ETX A;  3WS2 A;  4Y13 A;  3PBR A;  5KZH A;  1IOU A;  3DWZ A;  1ODV A;  4O01 A;  1XPB A;  3MMH A;  1FSW A;  2Y8H A;  5HWV A;  4KZ9 A;  2ZC7 A;  3MQQ A;  1S4S A;  2X01 A;  3IF6 B;  2HV1 A;  2B02 A;  3HLW A;  2XR0 A;  1F2K A;  3MXS A;  2PYR A;  3BWL A;  4QY6 A;  3QNB A;  4DN0 A;  4FD8 A;  2Q0O A;  2GJ3 A;  3FPW A;  3M6H A;  2X71 A;  1NYM A;  3T1X A;  4CLC A;  3WRT A;  4MBF A;  3T4K A;  3FWL A;  4CLC C;  1H8Z A;  3MZE A;  2V1A A;  1F9I A;  2BG1 A;  1HZO A;  2H0T A;  2EXA A;  4HJ6 A;  4WYY A;  3U2A A;  3Q1F A;  1L2S A;  3A3E A;  2Z2L B;  1IFQ A;  2OLU A;  3F1O B;  1NXY A;  2IWD A;  1S1Z A;  4S2M A;  4OPZ A;  4Y15 A;  1L0D A;  2Y2N A;  5G18 A;  3LYX A;  1I5Q A;  4D60 A;  2J3W A;  4N1H A;  1XFN A;  2QKP A;  3D72 A;  3CLO A;  3O86 A;  3S4X A;  2ZL1 A;  4QJG A;  2DNS A;  2ZC6 B;  3IS2 B;  2PD7 A;  3PHY A;  4GHI B;  3BM6 A;  4P87 A;  3BEC A;  1IYS A;  4AFI A;  1W63 Q;  3TG9 A;  1TDL A;  3NDG A;  1H3Q A;  4GOG A;  1H5X A;  3V3S A;  2H10 A;  1GSX A;  1MPL A;  2Y2G A;  3A3D A;  2A49 A;  2FFY A;  4EUV A;  5HL1 A;  4S2N C;  4MBK A;  1NZO A;  2HJ9 C;  2WGW B;  2Y2K A;  2ZD8 A;  4IVI A;  3MF0 A;  5TJJ A;  3HLF A;  4LRZ E;  4JGQ A;  4FCF A;  4MCW A;  4KZ6 A;  5HZH A;  4XUZ A;  2D02 A;  4OP5 A;  4GCZ A;  3NOP C;  2HP6 A;  3OZH A;  2W3E A;  1ZC2 A;  4QPR A;  3EOI A;  1OT9 A;  1DRM A;  3MS6 A;  3FYZ A;  5HAP A;  2A24 A;  4QHC A;  1PW1 A;  5FDH A;  3HBR A;  4LLO B;  1ZG6 A;  3TJZ C;  1MXO A;  1MWR A;  3H7W B;  1WE4 A;  5HDC A;  2RCX A;  3TE8 A;  2KLI A;  4K08 A;  3C8C A;  1H0M A;  5A91 A;  2XD5 A;  1FSY A;  3PBT A;  3P09 A;  2XQZ A;  1SKO B;  3LEQ A;  1K0K A;  1T1B A;  2J9P A;  2OOL A;  3LIC A;  1RGY A;  3HLG A;  2W3F A;  3IX4 A;  3IF6 A;  5DFY A;  4O0P A;  2DMW A;  5EE8 A;  3JPU A;  2JCH A;  5HAI A;  3MXQ A;  2Y2I A;  1G5U A;  1T19 A;  4G3V A;  3UDI A;  5TR7 A;  2EWW A;  4BJP A;  1BLS A;  3G31 A;  1E3U D;  1PW8 A;  4BBV A;  1E3U A;  5IU1 A;  4LGW A;  1J9M A;  5HDS A;  5G4Y A;  4H8R A;  3NOT C;  5FSR A;  4Y0T A;  2WKI A;  1GA0 A;  3HUO A;  4OQH A;  2K7S A;  1I2W A;  3LIE A;  1MKI A;  4OKP A;  3VP1 A;  2V0W A;  1ZKJ A;  4HH2 A;  5FQI A;  4KZ5 A;  1BSG A;  1KE0 A;  4GW9 A;  1JTD A;  3F1O A;  5DF7 A;  1IKI A;  1MZU A;  3ZG8 B;  5JYO A;  3P7N A;  3ZHH A;  4OVD A;  3TRC A;  2PYP A;  3QP2 A;  2R78 A;  3V39 A;  4HJ4 A;  1LL8 A;  3F1N B;  1OPX A;  2ZQ8 A;  1K54 A;  5KSH A;  2JC7 A;  3SH8 A;  1K54 C;  4KQO A;  2VGJ A;  5FI7 A;  4IJG A;  4DRT A;  3DW0 A;  3SH9 A;  3IS2 A;  3BLS A;  4GHI A;  1UGU A;  4OOL A;  2Y2O A;  2WKQ A;  4P85 A;  1CF0 A;  3DTE A;  3BFC A;  1Q2Q A;  5CGW A;  3VMA A;  3T50 A;  5EOO A;  4R38 A;  3ZG9 B;  4GS9 B;  1MWT A;  2V8F A;  3LY4 A;  2ZQC A;  3MQ0 A;  4R4R A;  2WGW A;  3T12 B;  2EX9 A;  5J4E A;  1NLY A;  3FKV A;  4K91 A;  2R9X A;  5DTK A;  2EX8 A;  4WN5 A;  3FPV A;  3VOY A;  4KZB A;  1L0E A;  3LGO A;  3ZVT A;  1ACF A;  2W3H A;  2HDR A;  4P6Z M;  1VQQ A;  3NOU C;  3EQU A;  4ZJ2 A;  5DKL A;  2Y2M A;  1LL9 A;  3EGX C;  5HWW A;  1A0K A;  4L0L A;  3H7W A;  4NKP A;  2QPN A;  4M3K A;  4IHQ A;  1PI5 A;  1W63 M;  4JGO A;  4PKY A;  1BLH A;  3ZFZ A;  3GEC A;  4HY8 A;  4HP9 A;  4IUK A;  5GHX A;  4IBX A;  2WZX A;  3L9K A;  4Z9Q A;  4MNR A;  3LI9 A;  1KGG A;  3MKE A;  2QYB A;  3B47 A;  3QP4 A;  3W4O A;  4OQG A;  2JKR I;  2X02 A;  2FZ0 A;  1LT0 A;  4QY5 A;  4ETZ A;  2J9O A;  4E3N A;  2J3T D;  3VP2 A;  5AQ9 A;  2JE5 A;  2NUP C;  2ZBB A;  1W5D A;  1BT5 A;  3VP3 A;  1W8Q A;  4E04 A;  2O9B A;  3ZG0 A;  3HUN A;  4H6J B;  2WAF A;  1MY8 A;  2GDN A;  3IWI A;  3NIA A;  5HSQ A;  1ERO A;  1TDG A;  3A3J A;  4N9K A;  1HLU P;  3AGE A;  3OPP A;  4MDZ A;  3G2Y A;  1Y54 A;  1H8M A;  2RL3 A;  1YLW A;  3F1N A;  5DJT A;  4KZ3 A;  1ES5 A;  2ZQD A;  3IWO A;  5CRF A;  2IA2 A;  3PTE A;  3M2J A;  1KOU A;  5EPH A;  2QJ7 A;  1SDE A;  3BFE A;  1XJ4 A;  1DJC A;  3VP4 A;  4RQ9 A;  3PXP A;  4HI4 A;  2CC1 A;  4PM9 A;  2VJW A;  4Y5F A;  1ONH A;  3VOL A;  4DJ3 A;  2H0Y A;  1K55 C;  5FL3 A;  2XFS A;  4GD6 A;  4B4Z A;  1BTL A;  3LY3 A;  3M6B A;  1Z6F A;  3MZF A;  2Y2P A;  4N1X A;  4PM6 A;  1XKZ A;  4GS9 A;  1ERM A;  4R3A A;  3NY4 A;  2O9C A;  3H9W A;  3IHB A;  2ZOI A;  3GMW A;  2W27 A;  2B18 A;  1ERQ A;  2PAV P;  5E2G A;  2JKT I;  3CWF A;  1DP6 A;  1AWI A;  4B9O A;  4E3J A;  4MEZ A;  4NXF A;  5M1A A;  5D3O A;  4M4X A;  3CUE C;  1SKF A;  2K2N A;  5FAP A;  1K38 A;  4P0M A;  3C30 A;  3FC7 A;  1XJ3 A;  3W2Z A;  5F82 A;  4RA7 A;  5CED A;  2ZQ7 A;  2Y79 A;  2HF6 A;  1K56 D;  1OJ5 A;  4QU3 A;  5EVE A;  1K56 A;  5I94 A;  3U4L P;  2P04 A;  1D7E A;  1YMX A;  3BY8 A;  1KE4 A;  2JKR M;  3BQA A;  4CPK A;  1EI5 A;  3DTI A;  4NEE D;  4KQD A;  2ZC4 B;  1OTI A;  2GNX A;  1LSW A;  1MKM A;  1ZTU A;  5EUA A;  3A0S A;  1Y28 A;  3OBF A;  5HX9 A;  3JVU A;  1PYY A;  1XP4 A;  2XDM A;  3B42 A;  1I2S A;  4OPQ A;  4HNB A;  5CEB A;  2WKR A;  3MR0 A;  2QHK A;  4NXE A;  2VGL S;  4GN2 A;  5DTS A;  2ACG A;  3KSG A;  5FI2 A;  2J7V A;  2ZOH A;  3IH8 A;  5F1G A;  4C6Y A;  1TEM A;  5G4Z A;  4EQ1 A;  3OPL A;  3RXX A;  1TVF A;  4MMN A;  3G34 A;  3C4O A;  4ZTK A;  1P9W A;  5BOH A;  1BYW A;  2VKS A;  4C75 A;  4DE1 A;  4EEU A;  4L9G A;  3LCE A;  2WYX A;  4XT2 B;  3VOZ A;  5A92 A;  4X53 A;  4Q0I A;  5CTN A;  4PKY G;  1T18 A;  3QHY A;  3IH9 A;  2XSS A;  3UY6 A;  1NWZ A;  2D01 A;  1HVB A;  2JKG A;  5EEC A;  4KG6 A;  2P74 A;  3OC2 A;  1NRF A;  4OON A;  1NLZ A;  1XA1 A;  4E3M A;  3R7W B;  4OOM A;  5L09 A;  2WZZ A;  1FR6 A;  2PBY A;  2L0W A;  5E2F A;  4HHD A;  4BBU A;  3LR0 A;  4OOY A;  4X6T A;  3MFD A;  5A93 A;  3IQA A;  2ZM8 A;  5CER A;  3N4I A;  3ZG7 B;  1WYC A;  2VK3 A;  5CTM A;  3FZC A;  3EWK A;  3IT9 A;  3D9Y A;  2ZJ9 A;  1LI0 A;  3BFF A;  1LL5 A;  4MBH A;  4S2J A;  4PM7 A;  1P0Z A;  3BW6 A;  3KSH A;  2JKT M;  1YKD A;  2A3U A;  5HWT A;  2P9V B;  3E0Y A;  4EBP A;  4R1G A;  4LFU A;  3UB5 P;  1ES4 A;  4WLA A;  1J3W A;  4E3O A;  4GKU A;  3D3O A;  5FAS A;  4LCM A;  1ES3 A;  5EV0 A;  3PBN A;  3E4P A;  4EWF A;  1VEU B;  4KEN B;  5TFQ A;  4LV1 A;  5HD3 A;  2PRF A;  2ZM2 A;  2V8C A;  5FEG A;  1HD8 A;  4Q0J A;  3WWX A;  4WEJ A;  2GX5 A;  5M18 A;  1JWP A;  2AVX A;  1S0W A;  3RH8 B;  2LB5 A;  3ZCZ A;  3O5Y A;  2XA7 S;  3PBQ A;  4DDS A;  4BMW A;  3K3C A;  2HDU A;  1F5M A;  5AVF A;  3PBO A;  2JN7 A;  2WGV A;  1XA7 A;  4GDN A;  4LV3 A;  4X55 A;  3CAX A;  4R3J A;  4Y17 A;  3NHQ A;  4LRX C;  1U60 A;  2V20 A;  1YQS A;  3A0R A;  4GB7 A;  1E25 A;  1G28 A;  3PYP A;  1EWZ A;  4KZ8 A;  1IYO A;  3IF6 C;  1CK3 A;  4FH4 A;  2WGI A;  4DJ2 A;  3HLE A;  4NK3 A;  3C2W A;  1K6R A;  1N9L A;  2XLN A;  1S6R A;  3V3R A;  3LR3 A;  3H82 B;  3G30 A;  3LI8 A;  3RFB A;  4D2O A;  2Y2H A;  2HDS A;  3E4O A;  3BLM A;  3MJQ A;  3NI9 A;  4EES A;  2KX6 A;  2VEA A;  1OME A;  3O87 A;  4OLG A;  2PU2 A;  1YLJ A;  2ZMA A;  5FI6 A;  2B5R A;  3P01 A;  5K5B A;  3IHA A;  3UDF A;  2XRO A;  5MC7 A;  4XT2 A;  2QZ6 A;  3OPH A;  5C5K A;  2M7U A;  3VE3 A;  1H8Y A;  1LSX A;  2E8J A;  4A5R A;  4WZ4 A;  2FH5 A;  4X25 A;  1CJF A;  3LO7 A;  3IXG A;  2BTF P;  1T1A A;  2XGN A;  4GLQ A;  3A0V A;  1YSQ A;  3CG5 A;  3V50 A;  1GSW A;  1UWP X;  2OSU A;  3SOI A;  1T1C A;  1P9R A;  3GRJ A;  2HPB A;  2M1C A;  5HAQ A;  3R7W A;  2HZ5 A;  3C5A A;  4UAA A;  1CEF A;  2J80 A;  3UB7 A;  4S2I A;  2Y91 A;  1N9B A;  2VV7 A;  2ZLY A;  2W1T B;  4U0X A;  5HL6 A;  5EVI B;  2G7U A;  4Y2F A;  4KUO A;  4II7 A;  3OCL A;  1YLY A;  4K0W A;  4O8G A;  3GR2 A;  2CMN A;  4JGP A;  3DTM A;  3ZQ5 A;  1XJ6 A;  1UWN X;  4JF5 A;  1Z09 A;  4RYE A;  5DFX A;  1YLT A;  3T4Q A;  2WKH A;  1K57 A;  2Y4A A;  4EU0 A;  1BUE A;  3NJA A;  2P9V A;  3EEH A;  3BY9 A;  4I5S A;  5DJU A;  4LCL A;  3DTK A;  5AQ7 A;  4NXG A;  1XXM A;  3NUL A;  1FCM A;  2VA0 A;  2XFT A;  3UB9 A;  3T1Q B;  2XF3 A;  3RTY A;  1VM1 A;  1JWV A;  1VEU A;  1GCE A;  5FDS A;  2HP5 A;  5CHM A;  2ZQA A;  3HLD A;  2L4R A;  1TS6 A;  4DMZ A;  3SS5 A;  4OH0 A;  3MBZ A;  5KSC A;  4KZ7 A;  4HOI A;  4MN7 A;  3LIB A;  2KOI A;  4WL9 A;  5AQB A;  1TS0 A;  5J8X A;  3IWQ A;  1WA9 A;  2EFX A;  4YIN A;  4LV0 A;  4HBU A;  3VP0 A;  1SKO A;  2UV0 E;  3TSG A;  4WEK A;  2VLG A;  3T4T A;  5CGS A;  1JVJ A;  1KVL A;  3T1R A;  4U3T A;  1YPR A;  4LV2 A;  3ZNY A;  3CI6 A;  5FQ9 A;  4EER A;  3VFF A;  4QD4 A;  1S67 L;  3H82 A;  4U0T A;  5LBR A;  1KE3 A;  4RX3 A;  4JGR A;  4BEN A;  1HTZ A; 
#chains in the Genus database with same CATH homology
 4Y17 A;  2AVX A;  4Y15 A;  3IX8 A;  3IX4 A;  3QP1 A;  4LGW A;  2Q0O A;  3QP6 A;  5L10 A;  3IX3 A;  3QP4 A;  5L09 A;  3QP5 A;  1L3L A;  4NG2 A;  3JPU A;  3QP8 A;  2UV0 E;  3QP2 A;  3SZT A;  1H0M A;  4LFU A;  5L07 A;  4Y13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...