3IX4A

Lasr-tp1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
b'GFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein lasR
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 52
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix4A00
4Y13A 3IX4A 4Y17A 4Y15A 3QP6A 3QP8A 2AVXA 3JPUA 5L07A 2Q0OA 1L3LA 3QP1A 4LGWA 5L09A 4LFUA 3IX8A 5L10A 3QP2A 3QP5A 3QP4A 1H0MA 2UV0E 3IX3A 3SZTA 4NG2A
chains in the Genus database with same CATH superfamily
4MCWA 4BQMA 4N9LA 1JNUA 1GA0A 2FZ0A 3DTEA 1BT5A 4EBNA 4K0XA 1PI5A 1S4SA 2DCFA 4X1LA 3C4OA 2H0TA 3S7OA 1YAXA 4HI4A 5F1GA 4Y7PA 4MDZA 4OPZA 3S7PA 4DF6A 5FAOA 1L0GA 4MBHA 1ZC2A 2OAQ1 3BY9A 2OSUA 1A0KA 2PBDP 4KZ8A 3BFCA 1UWNX 2VK3A 4C75A 1SKOB 3KSIA 3HLGA 4NXGA 3UN7A 3KYZA 2WKQA 3CZDA 2VV8A 5F83A 4KG6A 1YKDA 3HCYA 5AVEA 4BL3A 1FSWA 1MKIA 2GZAA 1GA9A 4MN6A 3PAEA 4WMCD 2WKIA 4R3AA 3T4LA 2O9BA 2JCHA 3GRJA 4C3QA 3UPNA 1PWGA 1PIOA 3Q7VA 2HDSA 4HH3A 4BD1A 3HLDA 5HAIA 2KOIA 3DTIA 5EECA 3WRZA 3ZG5A 3ITBA 5EPHA 2EX9A 3UE0A 4OOYA 4BENA 2O9CA 1OT9A 4JGRA 5AQAA 3LR5A 1ZHHB 4BMWA 5HPIA 1K56D 3LY3A 5AQBA 5L07A 3HJKA 2JC7A 1NRFA 1IYQA 4CLCE 3MJQA 1MKMA 2Y2QA 3BFDA 1NLYA 2PHYA 4KQQA 4D2OA 4NG2A 2HV1A 5EVLA 4I38A 4WZ4A 3AGDA 5FI6A 3EEHA 2EWWA 5CHMA 4Q0IA 3HLWA 5CEDA 2C6WB 4NXBA 2EX2A 3CI6A 3MMHA 4JGOA 2OLVA 2JKTM 1K57C 1S4RA 3NDGA 3PYPA 4S2IA 2A49A 1DRMA 3NCKA 1EROA 4MMNA 4PM9A 4EEPA 3B47A 5CERA 4B9OA 3MR0A 3PAGA 4R3JA 3V39A 5G4ZA 1YLYA 2VV6A 4CLCB 4NK3A 4LENA 4HJ4A 3SZTA 5TR7A 3V5MA 1PW1A 5HZHA 4BWIA 1ONGA 5U47A 1OTEA 3W8KA 3E4OA 4BBUA 2VA0A 4DE3A 4WUJA 3OCLA 2HJ9C 4KZ9A 3Q7ZA 3HREA 4I39A 2PAVP 3QP2A 2L1MA 3HL9A 1IOUA 1KOUA 2R9WA 4WEJA 1K4EA 2ZMAA 3VP4A 4B4ZA 5GLCA 1D7EA 4XT2B 3MQOA 4I3IA 3UB6A 3BEBA 5DKLA 1YLTA 3M6BA 1TS8A 4ID4A 3K3CA 5TBMA 4DRTA 3C5AA 4DKIA 1K0KA 3EGDC 4MBKA 1ES4A 4S2PA 2ZL1A 2XF3A 4P87A 3E2LA 4ETXA 5CHUA 3GR2A 3A3IA 2ZMVA 2PR5A 3T4TA 5F5YA 2J3TD 4GZBA 5IS1A 2UWXA 4JGPA 3WWXA 2Y2GA 4ZTKA 3ZVWA 1QMEA 1KE4A 3IF6A 5G18A 4HQAA 4N9KA 3HLEA 3ITAA 1GHMA 4EBPA 1KVMA 3MXRA 1CEFA 3UPOA 4GB7A 5IT5A 2EXAA 5A91A 3SS3A 4QWOA 5F82A 2ZC6B 1PFLA 4GN2A 2GDNA 3AGEA 4HJ3A 3LIAA 4WM9A 3UDXA 2JN7A 3KX0X 4MNRA 1BLPA 5J4EA 3SH7A 4HP4A 1RGYA 3IQAA 1CI8A 2VEAA 1WYCA 1STZA 1HVBA 3VP3A 1H3QA 4E3OA 4JF4A 1F2KA 1DP9A 2KX6A 5GHXA 1N9LA 1ZG6A 1L3LA 5KZHA 4KG2A 4LFUA 2J8YA 3D4FA 3IX8A 3OPRA 2JKRI 2B18A 4QU3A 5LBRA 3NOTC 5FQJA 3UNWA 4ETZA 2V8CA 5DF8A 2O99A 1LL8A 3LO7A 4U0TA 2Y2LA 4DE1A 2K7SA 5M18A 2E8IA 3IXBA 4EQ1A 4A5RA 3IBJA 4EBLA 3ZDJA 1ERQA 5HW3A 2WAEA 3RJUA 1TVFA 3A3EA 3T12B 3NHQA 4EEUA 3LIBA 2RCXA 4PM6A 1PW8A 3ZNTA 3VE4A 2H28A 2Q0OA 2Z2LB 2VLGA 5L09A 1YPRA 2ZLYA 4EETB 5EVIA 1K25A 1MPLA 2ZQCA 3MBZA 1LT0A 3O3VA 3L7HA 3VFHA 3NOUC 4EESA 5L8MA 3VOLA 4UAAA 2INWA 4IUHA 5EUAA 1XFQA 4NEED 3GQZA 4KENB 5K5BA 2P04A 3UMEA 2JKGA 4RX2A 3NY4A 5HSQA 5A93A 5DKKA 4O0PA 4EW7A 5AVFA 3P01A 4GD6A 4FH2A 5KSHA 3TE8A 1SHVA 1MXOA 5A90A 1L2SA 1XA1A 1ONHA 2ZC4B 2QWSA 3IH8A 4ZRRA 5HDDA 2Y2OA 4B93A 2QPNA 2JHEA 3GV9A 4LGWA 1EW0A 3UB9A 2HDQA 4RQ9A 3WS0A 1VB6A 3T4KA 1AXBA 4KQOA 4OVDA 2VGLM 2VGLS 4NETA 4Y3IA 5HX9A 1IFQA 2C5WB 1SCWA 2Y2PA 3B42A 3O87A 3IXHA 1ZTUA 2PU4A 2P7JA 1HZOA 4GHIA 5EVID 5IU1A 1PWCA 4OPRA 5TBMB 3T4JA 2WGIA 1BLSA 1WA9A 1H8YA 3SS4A 2ZD8A 1F5MA 1OJ5A 1OJGA 2A3UA 1TDLA 1OPXA 2ZL1B 2M7VA 3DTMA 4KZ5A 4LV3A 1JWPA 2JE5A 3T4QA 5FQQA 3ZCZA 2WADA 4DDSA 3LR4A 5J3WA 5F69A 5CGXA 2GJ3A 4K08A 3NDEA 4UQIM 3CLOA 4QB8A 1VHMA 3Q07A 2V1ZA 2NUPC 2XA7M 1RP5A 3MF0A 5AQ7A 3TW8A 3CUEC 3W4PA 3IF6B 2VZWA 4HBUA 4OPQA 4WELA 4PM5A 3G2YA 3UB7A 4BL2A 1F98A 4HOIA 2VGKA 4CQHA 1T18A 3N8SA 4NKPA 3UB8A 3E98A 1MWUA 3HLBA 1K55A 4HBTA 2KDKA 2Y2JA 5FA7A 4BD0A 1YQSA 2FFFB 2JKFA 3EGXC 4X68A 1MC0A 3MXSA 1UWPX 4XXRA 3W4QA 1OT6A 4G3VA 2PD7A 4JKTA 4X1MA 4BJPA 3ULFA 1S6RA 4E3JA 2ZQAA 4HP9A 4WZ5A 3S4XA 4K0WA 3LR3A 5DFXA 5DJTA 4EUZA 3O86A 3C2WA 1P9RA 4OP5A 5E2FA 4LRXC 3WRTA 2XDMA 2W27A 2WGWA 3GECA 3Q1FA 3OPLA 1H5XA 3LI9A 2J9OA 4WMCA 1HLUP 2ACGA 4CPKA 2Y2IA 4JF5A 3UMDA 1N9OA 1H8MA 2XROA 3MKFA 3KO6A 1BLCA 3BJNA 4EERA 1YLWA 2B5RA 2R9XA 3OOVA 5DTSA 1XGIA 3IF5A 4KUOA 3N6IA 2JBFA 3WS5A 3P7NA 5FDSA 3VFFA 4X56A 1N9NA 5CTMA 1K56A 5FQ9A 1T1CA 3LICA 3MZDA 3IX3A 5FASA 3MS6A 4PM8A 3FYZA 1ERMA 3GVBA 3HUOA 5EVIB 4OQIA 1L0EA 1KDWA 1K54C 2WK0A 2EX6A 2W0NA 3HLFA 3PR6A 1S67L 1CF0A 3DW0A 4X25A 5A8BA 1ES3A 2FH5A 2AVXA 4I3JA 2B95A 1E3UD 5J8XA 3ZG8B 3O5YA 3CITA 3ZVTA 4OOMA 3I7JA 1ZG4A 2V2FF 5EOEA 1SKFA 2I9VA 4S2NA 4EQIA 3BRMA 1W7FA 3PXPA 1S66L 2O9AA 4LCLA 4EUVA 1FCNA 3BM6A 4UA9A 4XUZA 3BLSA 1XJ2A 2Y55A 2HJEA 3BWLA 3U2AA 3KSHA 4M3KA 1LSXA 4GHIB 1NJ4A 4F94A 5CEBA 4CLCC 4DN0A 5CX7A 3JVUA 4IVKA 3V3RA 1HD8A 1OTAA 5FI2A 5HFOA 2G2WA 1YM1A 3C8CA 4JF6A 4S2KA 3ICYA 1BULA 5FQIA 2CMNA 3QP1A 2W1RA 2W1TA 4Z9QA 2HPBA 3CJMA 2WZXA 4KZBA 3Q82A 4RA7A 4BLMA 2WUQA 4O8GA 1KGGA 1SDEA 3C30A 4YOFA 2BG1A 1FSYA 3MFDA 4CJNA 2V9AA 2ZBBA 1TDGA 1LI9A 1DY6A 3QP4A 2OWJA 2EXBA 4E3MA 1EI5A 4UA6A 3M2JA 1O07A 3LFVA 3E4PA 1K38A 4GNUA 1U60A 1PNEA 2MJ6A 3FC7A 1M6KA 1ESUA 4Y0UA 3PTEA 4DE0A 3FKWA 1FR1A 2WYXA 1BLHA 3EWKA 2WGWB 4OOLA 3M2KA 4ME4A 3BYDA 3UO9A 2XGNA 4FSFA 3G30A 3CPTA 3QHYA 1Z6FA 1BTLA 4Y17A 5EE8A 3B3XA 5FQMA 4MLLA 1L0DA 4HEFA 4Z1WA 4LV0A 4KG5A 1ZKJA 5FEFA 1W8YA 1Y54A 4GOGA 4IJGA 4C6YA 3T4OA 1MWSA 3ZHHA 3T50A 2K2NA 3PBRA 4JBFA 2V20A 2Z2MB 1S1YA 4ZJ3A 2XD5A 4II7A 1N4OA 2WKEA 1G6OA 2Y79A 1YLJA 4Q0JA 3WS2A 5HD3A 5CGSA 5HAQA 4MN5A 1K6RA 5EVEA 2WZZA 3QNBA 1MBLA 4KZAA 4DE2A 1CJFA 4ZJ1A 1XXMA 5HD5A 4OKPA 4GW9A 3NBLA 3NIAA 4K91A 1W79A 4KZ7A 1VM1A 5CRFA 5DVAA 4R3BA 2PT7A 3BQ8A 3LIFA 3K3DA 3Q81A 1XJ6A 1F9IA 1YLPA 4Y15A 5FAPA 5FATA 2OV5A 1DP6A 3FG8A 3NJAA 4Q8IA 2BLSA 3P09A 3TSGA 3MXQA 3BW6A 3ZGAB 3IHAA 5IHVA 3DWZA 2WKRA 3IWOA 2V8FA 2IWCA 2K31A 1TS0A 3VP0A 4IUKA 1FQGA 3N8RA 3NOPC 3SH9A 2R78A 1NYYA 5GHZA 3W2ZA 1NLZA 2ZQDA 3B33A 4DJ2A 2KLIA 2V0WA 1NWZA 3H82A 1KVLA 3BECA 4JGQA 5JYOA 4GDBA 3E2KA 3ZG7B 3G31A 1DJAA 1TEMA 1W8QA 1DJCA 1E4DA 3RFBA 4P85A 3IWIA 4IHQA 1VEUA 4F3LA 4JPMA 3QP6A 2W3DA 1XFNA 5CECA 4P6ZM 4NXFA 2W1TB 4HH2A 1CI9A 4OQ0A 3FKVA 2HP9A 4X53A 1YSPA 4FUWA 3MFXA 1OMEA 4PMAA 5CGWA 2VGJA 2H5SA 3GSGA 5CXWA 5KMWA 2LB5A 2BASA 1OTBA 3H7WA 4EV4A 3NULA 3NI9A 5HAPA 3IHBA 4HNBA 2G2UA 1XX2A 3UDFA 3S1YA 2ZJ9A 2L0WA 4PKYA 4JXVA 5DF9A 1OTDA 4R4RA 3WS4A 1JWVA 4RVAA 5CTNA 3IF6C 1G28A 3LY4A 5HWTA 2G7UA 2J3WA 3C4PA 3V3SA 3HUMA 1FIKA 3F1NA 5GLBA 1G6AA 3A3DA 4GLQA 4WF0A 4WYYA 2JKTI 1Y28A 3BFEA 3SOIA 4LV1A 4Y5FA 4PAUA 1HTZA 4UHUA 4EU0A 1XKZA 3CPTB 3D3OA 3LR0A 1M40A 3T1XA 1W63Q 3JYIA 1GSXA 1FCMA 3IX4A 1ACFA 3NC8A 4KZ6A 4FOFA 3RXXA 1MY8A 5GHYA 1CK3A 3S7QA 3BFGA 3VE3A 2Y2NA 2W3HA 1VETA 4UQIS 2ZC3B 2DRWA 4KQRA 2XA7S 4PPRA 3W4OA 3LEQA 2Q9MA 4RX3A 2QMIA 1FR6A 5EM1A 1JTDA 3U4LP 4OH0A 4B88A 3SH8A 4BBTA 2RL3A 2GX5A 2XLNA 1IYSA 3UB5P 1WE4A 4DXCA 1H0MA 5FDHA 1H8ZA 4R1GA 3ZG0A 4QJGA 4Y13A 5F6AA 2X01A 4ARZA 4R38A 1TD5A 1XGJA 4GKUA 4IEDA 3RXWA 2WKPA 3R7WB 2P74A 2WAFA 2DMWA 3G4PA 4U3TA 4FD8A 1K57A 3EQUA 1Q2PA 3C38A 3A0SA 1ODVA 2XK1A 2A24A 3VSKA 1ALQA 4I5SA 4IVIA 4JXSA 4Y0OA 3T4SA 5FQKA 5DTKA 1NRJA 2VV7A 1WYBA 3UE3A 2HP5A 1LL9A 2W3GA 2ZC7A 5EVIC 3A0VA 2ZQ7A 4QPRA 1E3UA 1GSWA 3F1PA 4LLOB 3G2ZA 4WBGA 1VQQA 3PBNA 3IH9A 5MC7A 3N7WA 2PYRA 3MQ0A 4PKYG 1TS6A 4CLCD 3LI8A 5HL6A 1LI0A 2JKRM 4YWZA 2DNSA 4R4SA 3FPVA 3G34A 2ZM8A 1GHIA 3PBTA 4N92A 3H82B 2P08A 3CWFA 4HHDA 1G68A 3RH8B 1VEUB 3T1SA 4GDNA 4F3LB 3FPWA 4FCFA 4E6XA 3TOIA 4ZDXA 2XH9A 3IS2A 3QP8A 2ZC5B 2VJWA 4ESPA 4S2LA 2ZQ9A 3PBOA 3A3JA 1XPBA 5L10A 3F1OA 2H10A 4GCZA 3H7WB 3E4QA 1Q2QA 1DP8A 1PRQA 5DTTA 3IXDA 4H8RA 5KSCA 3PBSA 1LSWA 5JYPA 4L9GA 2W3EA 4QD4A 3BQAA 1IEMA 2HDUA 2QJ5A 4GD8A 3RTYA 2OOLA 4E04A 2QKPA 4N1HA 4EXOA 1G5UA 1YT4A 5BOHA 5FL3A 2OWHA 3GTCA 4S2OA 1T19A 3A3FA 4GJ4A 3BFFA 1NZOA 4M4XA 2BTFP 4KQDA 3F1NB 4FTXA 1YSQA 3UDIA 1K55C 1PYYA 4GS9A 2I72A 2V1AA 3K2NA 2E8JA 3CMZA 3CHWP 4Y2FA 2Q9NA 5HWVA 3T1RA 3O88A 2J9PA 2XSSA 5F1FA 2EFXA 2Z6DA 2XFTA 2J7VA 1JWZA 1VETB 3JPUA 3OLOA 3ISGA 4LV2A 1ES2A 4WZ5C 1V9YA 1X0OA 1T1BA 1YLZA 3V67A 2Y8HA 3P98A 4OP8A 1PWDA 3DTKA 4LCMA 3L9KA 3TRCA 4UA7A 5KIZA 2L4RA 1UGUA 3LIDA 2HF6A 2ZQ8A 3BY8A 2IWDA 1W5DA 4X69A 3H9WA 3LGOA 1T1AA 1NYMA 1SZVA 5TGFA 4H6JA 4AFIA 4X6TA 3QP5A 2GNXA 3TJZC 2M7UA 1P9WA 5FSRA 4ARZB 5EV0A 5HDSA 3KSFA 1J3WA 2IA2A 3UE1A 1GCEA 3WS1A 5HWWA 2P9VA 4QHCA 5TJJA 4I3AA 4S2JA 4S2MA 3C7UA 2A24B 2H0YA 3MSHA 3EQVA 4KZ4A 4MBFA 1GSVA 3IXGA 1TS7A 3LYXA 5EOOA 3GDIA 1MWTA 3FV7A 1LLBA 3IWQA 1FILA 2XQZA 3HBRA 4U0XA 3HJIA 3ZNYA 4JXGA 4OQHA 3V50A 2PR6A 5FAQA 2D01A 5AJGA 3T1QB 3EEAA 1DJBA 3SW1A 4WN5A 1KE3A 2X02A 1YMXA 3F1PB 2D02A 4NXEA 2Z6CA 3GMWA 1NZUA 5FEGA 4BBVA 1BUEA 3HVFA 4DJ3A 4ZAMA 2EX8A 1E25A 4XUXA 1TF1A 4OONA 5AQ9A 1NY0A 2XR0A 5HARA 5DJUA 1XJ3A 3DWKA 4R6LA 5DFYA 1W63M 4S2NC 1FOFA 1BZAA 2PDRA 4D60A 1J9MA 3MZEA 4YFMA 3S7NA 1S1ZA 1KGFA 5F68A 5HDCA 4R23A 5GL9A 2Y4AA 1Z09A 4IBXA 1S0WA 3HLCA 2WGVA 2Y2KA 5HPFA 3R7WA 2Y91A 4OPYA 4DMZA 3IS2B 3KYQA 2XFSA 1JVJA 3D72A 4MEZA 3G6OA 2V0UA 4R0QA 1GHPA 5TFQA 5J7EA 4O7DA 2O0YA 5EFWA 3F1OB 5EM0A 4G3KA 2HZ5A 4LRZE 5E2HA 3CUEA 3LEZA 2VX8A 2Y2HA 3NECA 1PZOA 4WEKA 3VP2A 3MZFA 3UE6A 5C5KA 3Q7VB 3S22A 1O7EA 4MN7A 4QY6A 1IYOA 1MWRA 2ZM2A 3FZCA 3BLMA 5GLAA 2PU2A 4R70A 4WLAA 1LHYA 1I2WA 4FH4A 4O01A 4LRYC 1IKGA 2J3TC 3FWLA 1OTIA 3VSLA 3UPPA 5DF7A 3AGFA 4GS9B 4OQGA 3ZYTA 5E2EA 3N8LA 1CEGA 1I5QA 1XP4A 2PBYA 3OCNA 1SKOA 3OPPA 1N9BA 4PHTA 3HUNA 3UY6A 4E3LA 3C7VA 1RCJA 1BYWA 4P6ZS 3PHYA 1XJ4A 1NXYA 1V9ZA 4OLDA 5M19A 1MZUA 4JXWA 3JVVA 4HJ6A 3EOIA 4E6WA 4PM7A 3KSGA 1IELA 3VP1A 5G4YA 3ZFZA 2XD1A 1ESIA 1Y4OA 3MKEA 1CQAA 2CC1A 4YINA 1LSVA 3OC2A 4H6JB 3DAVA 4UEYA 3ZQ5A 2Y59A 2LB9A 3TG9A 4JLFA 4E3IA 3G35A 4B4XA 3VOZA 4WL9A 1ES5A 5M1AA 2XRNA 4QY5A 4EWFA 4L0LA 3VOYA 1KDSA 2Y2MA 2ZM0A 2P9VB 4L9EA 4Q0HA 1P0ZA 1I2SA 3A0RA 2ZOHA 1KGEA 4X55A 2EFUA 1K54A 4G3WA 1D1JA 1K6SA 4E3KA 4OLGA 1YMSA 3LIEA 1IKIA 4KZ3A 4HESA 5E43A 3SS5A 5CHJA 1QMFA 2YKHA 3IBRA 3D9YA 1PZPA 2OLUA 4DDYA 2NUTC 2A2LA 5FI7A 3ZG9B 1PI4A 4KUKA 2W3FA 2V1BA 2EA9A 1LL5A 2HDRA 1JTGA 2IWBA 1D06A 1FCOA 3CG5A 5I5LA 2J80A 5A92A 2OAP1 3IT9A 4HIAA 1L0FA 2PYPA 2WKHA 3KYEA 1SDNA 4P0MA 5E2GA 3VV4A 3E0YA 2ZOIA 5HL1A 1K4FA 2UV0E 4E3NA 3DBAA 4P6BA 2EWVA 3OZHA 1EWZA 3OBFA 4CLCA 3VMAA 5L2FA 3R4KA 1P97A 1AWIA 2HGVA 1IYPA 1C3BA 4ZBEA 2QHKA 2XEPA 2HP6A 4IBRA 4HY8A 2QJ7A 2FFYA 2ZMFA 2B02A 2PRFA 3LCEA 4YNRA 3N4IA 2PD8A 4N1XA 2QZ6A 1RGZA 5D3OA 4ZJ2A 2M1CA 5GLDA 2X71A 3QNCA 3MQQA 2YKFA 3G32A 4XT2A 2QYBA 3OPHA 5I94A 3LUQA 1BSGA 3CAXA 4RYEA 4Y0TA 1KE0A 4L9FA 3M6HA 4LPZA 1XA7A 2VKSA 4DXBA 3PBQA
chains in the Genus database with same CATH topology
4Y13A 3IX4A 4Y17A 4Y15A 3QP6A 3QP8A 2AVXA 3JPUA 5L07A 2Q0OA 1L3LA 3QP1A 4LGWA 5L09A 4LFUA 3IX8A 5L10A 3QP2A 3QP5A 3QP4A 1H0MA 2UV0E 3IX3A 3SZTA 4NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y13 A;  3IX4 A;  4Y17 A;  4Y15 A;  3QP6 A;  3QP8 A;  2AVX A;  3JPU A;  5L07 A;  2Q0O A;  1L3L A;  3QP1 A;  4LGW A;  5L09 A;  4LFU A;  3IX8 A;  5L10 A;  3QP2 A;  3QP5 A;  3QP4 A;  1H0M A;  2UV0 E;  3IX3 A;  3SZT A;  4NG2 A; 
#chains in the Genus database with same CATH topology
 4MCW A;  4BQM A;  4N9L A;  1JNU A;  1GA0 A;  2FZ0 A;  3DTE A;  1BT5 A;  4EBN A;  4K0X A;  1PI5 A;  1S4S A;  2DCF A;  4X1L A;  3C4O A;  2H0T A;  3S7O A;  1YAX A;  4HI4 A;  5F1G A;  4Y7P A;  4MDZ A;  4OPZ A;  3S7P A;  4DF6 A;  5FAO A;  1L0G A;  4MBH A;  1ZC2 A;  2OAQ 1;  3BY9 A;  2OSU A;  1A0K A;  2PBD P;  4KZ8 A;  3BFC A;  1UWN X;  2VK3 A;  4C75 A;  1SKO B;  3KSI A;  3HLG A;  4NXG A;  3UN7 A;  3KYZ A;  2WKQ A;  3CZD A;  2VV8 A;  5F83 A;  4KG6 A;  1YKD A;  3HCY A;  5AVE A;  4BL3 A;  1FSW A;  1MKI A;  2GZA A;  1GA9 A;  4MN6 A;  3PAE A;  4WMC D;  2WKI A;  4R3A A;  3T4L A;  2O9B A;  2JCH A;  3GRJ A;  4C3Q A;  3UPN A;  1PWG A;  1PIO A;  3Q7V A;  2HDS A;  4HH3 A;  4BD1 A;  3HLD A;  5HAI A;  2KOI A;  3DTI A;  5EEC A;  3WRZ A;  3ZG5 A;  3ITB A;  5EPH A;  2EX9 A;  3UE0 A;  4OOY A;  4BEN A;  2O9C A;  1OT9 A;  4JGR A;  5AQA A;  3LR5 A;  1ZHH B;  4BMW A;  5HPI A;  1K56 D;  3LY3 A;  5AQB A;  5L07 A;  3HJK A;  2JC7 A;  1NRF A;  1IYQ A;  4CLC E;  3MJQ A;  1MKM A;  2Y2Q A;  3BFD A;  1NLY A;  2PHY A;  4KQQ A;  4D2O A;  4NG2 A;  2HV1 A;  5EVL A;  4I38 A;  4WZ4 A;  3AGD A;  5FI6 A;  3EEH A;  2EWW A;  5CHM A;  4Q0I A;  3HLW A;  5CED A;  2C6W B;  4NXB A;  2EX2 A;  3CI6 A;  3MMH A;  4JGO A;  2OLV A;  2JKT M;  1K57 C;  1S4R A;  3NDG A;  3PYP A;  4S2I A;  2A49 A;  1DRM A;  3NCK A;  1ERO A;  4MMN A;  4PM9 A;  4EEP A;  3B47 A;  5CER A;  4B9O A;  3MR0 A;  3PAG A;  4R3J A;  3V39 A;  5G4Z A;  1YLY A;  2VV6 A;  4CLC B;  4NK3 A;  4LEN A;  4HJ4 A;  3SZT A;  5TR7 A;  3V5M A;  1PW1 A;  5HZH A;  4BWI A;  1ONG A;  5U47 A;  1OTE A;  3W8K A;  3E4O A;  4BBU A;  2VA0 A;  4DE3 A;  4WUJ A;  3OCL A;  2HJ9 C;  4KZ9 A;  3Q7Z A;  3HRE A;  4I39 A;  2PAV P;  3QP2 A;  2L1M A;  3HL9 A;  1IOU A;  1KOU A;  2R9W A;  4WEJ A;  1K4E A;  2ZMA A;  3VP4 A;  4B4Z A;  5GLC A;  1D7E A;  4XT2 B;  3MQO A;  4I3I A;  3UB6 A;  3BEB A;  5DKL A;  1YLT A;  3M6B A;  1TS8 A;  4ID4 A;  3K3C A;  5TBM A;  4DRT A;  3C5A A;  4DKI A;  1K0K A;  3EGD C;  4MBK A;  1ES4 A;  4S2P A;  2ZL1 A;  2XF3 A;  4P87 A;  3E2L A;  4ETX A;  5CHU A;  3GR2 A;  3A3I A;  2ZMV A;  2PR5 A;  3T4T A;  5F5Y A;  2J3T D;  4GZB A;  5IS1 A;  2UWX A;  4JGP A;  3WWX A;  2Y2G A;  4ZTK A;  3ZVW A;  1QME A;  1KE4 A;  3IF6 A;  5G18 A;  4HQA A;  4N9K A;  3HLE A;  3ITA A;  1GHM A;  4EBP A;  1KVM A;  3MXR A;  1CEF A;  3UPO A;  4GB7 A;  5IT5 A;  2EXA A;  5A91 A;  3SS3 A;  4QWO A;  5F82 A;  2ZC6 B;  1PFL A;  4GN2 A;  2GDN A;  3AGE A;  4HJ3 A;  3LIA A;  4WM9 A;  3UDX A;  2JN7 A;  3KX0 X;  4MNR A;  1BLP A;  5J4E A;  3SH7 A;  4HP4 A;  1RGY A;  3IQA A;  1CI8 A;  2VEA A;  1WYC A;  1STZ A;  1HVB A;  3VP3 A;  1H3Q A;  4E3O A;  4JF4 A;  1F2K A;  1DP9 A;  2KX6 A;  5GHX A;  1N9L A;  1ZG6 A;  1L3L A;  5KZH A;  4KG2 A;  4LFU A;  2J8Y A;  3D4F A;  3IX8 A;  3OPR A;  2JKR I;  2B18 A;  4QU3 A;  5LBR A;  3NOT C;  5FQJ A;  3UNW A;  4ETZ A;  2V8C A;  5DF8 A;  2O99 A;  1LL8 A;  3LO7 A;  4U0T A;  2Y2L A;  4DE1 A;  2K7S A;  5M18 A;  2E8I A;  3IXB A;  4EQ1 A;  4A5R A;  3IBJ A;  4EBL A;  3ZDJ A;  1ERQ A;  5HW3 A;  2WAE A;  3RJU A;  1TVF A;  3A3E A;  3T12 B;  3NHQ A;  4EEU A;  3LIB A;  2RCX A;  4PM6 A;  1PW8 A;  3ZNT A;  3VE4 A;  2H28 A;  2Q0O A;  2Z2L B;  2VLG A;  5L09 A;  1YPR A;  2ZLY A;  4EET B;  5EVI A;  1K25 A;  1MPL A;  2ZQC A;  3MBZ A;  1LT0 A;  3O3V A;  3L7H A;  3VFH A;  3NOU C;  4EES A;  5L8M A;  3VOL A;  4UAA A;  2INW A;  4IUH A;  5EUA A;  1XFQ A;  4NEE D;  3GQZ A;  4KEN B;  5K5B A;  2P04 A;  3UME A;  2JKG A;  4RX2 A;  3NY4 A;  5HSQ A;  5A93 A;  5DKK A;  4O0P A;  4EW7 A;  5AVF A;  3P01 A;  4GD6 A;  4FH2 A;  5KSH A;  3TE8 A;  1SHV A;  1MXO A;  5A90 A;  1L2S A;  1XA1 A;  1ONH A;  2ZC4 B;  2QWS A;  3IH8 A;  4ZRR A;  5HDD A;  2Y2O A;  4B93 A;  2QPN A;  2JHE A;  3GV9 A;  4LGW A;  1EW0 A;  3UB9 A;  2HDQ A;  4RQ9 A;  3WS0 A;  1VB6 A;  3T4K A;  1AXB A;  4KQO A;  4OVD A;  2VGL M;  2VGL S;  4NET A;  4Y3I A;  5HX9 A;  1IFQ A;  2C5W B;  1SCW A;  2Y2P A;  3B42 A;  3O87 A;  3IXH A;  1ZTU A;  2PU4 A;  2P7J A;  1HZO A;  4GHI A;  5EVI D;  5IU1 A;  1PWC A;  4OPR A;  5TBM B;  3T4J A;  2WGI A;  1BLS A;  1WA9 A;  1H8Y A;  3SS4 A;  2ZD8 A;  1F5M A;  1OJ5 A;  1OJG A;  2A3U A;  1TDL A;  1OPX A;  2ZL1 B;  2M7V A;  3DTM A;  4KZ5 A;  4LV3 A;  1JWP A;  2JE5 A;  3T4Q A;  5FQQ A;  3ZCZ A;  2WAD A;  4DDS A;  3LR4 A;  5J3W A;  5F69 A;  5CGX A;  2GJ3 A;  4K08 A;  3NDE A;  4UQI M;  3CLO A;  4QB8 A;  1VHM A;  3Q07 A;  2V1Z A;  2NUP C;  2XA7 M;  1RP5 A;  3MF0 A;  5AQ7 A;  3TW8 A;  3CUE C;  3W4P A;  3IF6 B;  2VZW A;  4HBU A;  4OPQ A;  4WEL A;  4PM5 A;  3G2Y A;  3UB7 A;  4BL2 A;  1F98 A;  4HOI A;  2VGK A;  4CQH A;  1T18 A;  3N8S A;  4NKP A;  3UB8 A;  3E98 A;  1MWU A;  3HLB A;  1K55 A;  4HBT A;  2KDK A;  2Y2J A;  5FA7 A;  4BD0 A;  1YQS A;  2FFF B;  2JKF A;  3EGX C;  4X68 A;  1MC0 A;  3MXS A;  1UWP X;  4XXR A;  3W4Q A;  1OT6 A;  4G3V A;  2PD7 A;  4JKT A;  4X1M A;  4BJP A;  3ULF A;  1S6R A;  4E3J A;  2ZQA A;  4HP9 A;  4WZ5 A;  3S4X A;  4K0W A;  3LR3 A;  5DFX A;  5DJT A;  4EUZ A;  3O86 A;  3C2W A;  1P9R A;  4OP5 A;  5E2F A;  4LRX C;  3WRT A;  2XDM A;  2W27 A;  2WGW A;  3GEC A;  3Q1F A;  3OPL A;  1H5X A;  3LI9 A;  2J9O A;  4WMC A;  1HLU P;  2ACG A;  4CPK A;  2Y2I A;  4JF5 A;  3UMD A;  1N9O A;  1H8M A;  2XRO A;  3MKF A;  3KO6 A;  1BLC A;  3BJN A;  4EER A;  1YLW A;  2B5R A;  2R9X A;  3OOV A;  5DTS A;  1XGI A;  3IF5 A;  4KUO A;  3N6I A;  2JBF A;  3WS5 A;  3P7N A;  5FDS A;  3VFF A;  4X56 A;  1N9N A;  5CTM A;  1K56 A;  5FQ9 A;  1T1C A;  3LIC A;  3MZD A;  3IX3 A;  5FAS A;  3MS6 A;  4PM8 A;  3FYZ A;  1ERM A;  3GVB A;  3HUO A;  5EVI B;  4OQI A;  1L0E A;  1KDW A;  1K54 C;  2WK0 A;  2EX6 A;  2W0N A;  3HLF A;  3PR6 A;  1S67 L;  1CF0 A;  3DW0 A;  4X25 A;  5A8B A;  1ES3 A;  2FH5 A;  2AVX A;  4I3J A;  2B95 A;  1E3U D;  5J8X A;  3ZG8 B;  3O5Y A;  3CIT A;  3ZVT A;  4OOM A;  3I7J A;  1ZG4 A;  2V2F F;  5EOE A;  1SKF A;  2I9V A;  4S2N A;  4EQI A;  3BRM A;  1W7F A;  3PXP A;  1S66 L;  2O9A A;  4LCL A;  4EUV A;  1FCN A;  3BM6 A;  4UA9 A;  4XUZ A;  3BLS A;  1XJ2 A;  2Y55 A;  2HJE A;  3BWL A;  3U2A A;  3KSH A;  4M3K A;  1LSX A;  4GHI B;  1NJ4 A;  4F94 A;  5CEB A;  4CLC C;  4DN0 A;  5CX7 A;  3JVU A;  4IVK A;  3V3R A;  1HD8 A;  1OTA A;  5FI2 A;  5HFO A;  2G2W A;  1YM1 A;  3C8C A;  4JF6 A;  4S2K A;  3ICY A;  1BUL A;  5FQI A;  2CMN A;  3QP1 A;  2W1R A;  2W1T A;  4Z9Q A;  2HPB A;  3CJM A;  2WZX A;  4KZB A;  3Q82 A;  4RA7 A;  4BLM A;  2WUQ A;  4O8G A;  1KGG A;  1SDE A;  3C30 A;  4YOF A;  2BG1 A;  1FSY A;  3MFD A;  4CJN A;  2V9A A;  2ZBB A;  1TDG A;  1LI9 A;  1DY6 A;  3QP4 A;  2OWJ A;  2EXB A;  4E3M A;  1EI5 A;  4UA6 A;  3M2J A;  1O07 A;  3LFV A;  3E4P A;  1K38 A;  4GNU A;  1U60 A;  1PNE A;  2MJ6 A;  3FC7 A;  1M6K A;  1ESU A;  4Y0U A;  3PTE A;  4DE0 A;  3FKW A;  1FR1 A;  2WYX A;  1BLH A;  3EWK A;  2WGW B;  4OOL A;  3M2K A;  4ME4 A;  3BYD A;  3UO9 A;  2XGN A;  4FSF A;  3G30 A;  3CPT A;  3QHY A;  1Z6F A;  1BTL A;  4Y17 A;  5EE8 A;  3B3X A;  5FQM A;  4MLL A;  1L0D A;  4HEF A;  4Z1W A;  4LV0 A;  4KG5 A;  1ZKJ A;  5FEF A;  1W8Y A;  1Y54 A;  4GOG A;  4IJG A;  4C6Y A;  3T4O A;  1MWS A;  3ZHH A;  3T50 A;  2K2N A;  3PBR A;  4JBF A;  2V20 A;  2Z2M B;  1S1Y A;  4ZJ3 A;  2XD5 A;  4II7 A;  1N4O A;  2WKE A;  1G6O A;  2Y79 A;  1YLJ A;  4Q0J A;  3WS2 A;  5HD3 A;  5CGS A;  5HAQ A;  4MN5 A;  1K6R A;  5EVE A;  2WZZ A;  3QNB A;  1MBL A;  4KZA A;  4DE2 A;  1CJF A;  4ZJ1 A;  1XXM A;  5HD5 A;  4OKP A;  4GW9 A;  3NBL A;  3NIA A;  4K91 A;  1W79 A;  4KZ7 A;  1VM1 A;  5CRF A;  5DVA A;  4R3B A;  2PT7 A;  3BQ8 A;  3LIF A;  3K3D A;  3Q81 A;  1XJ6 A;  1F9I A;  1YLP A;  4Y15 A;  5FAP A;  5FAT A;  2OV5 A;  1DP6 A;  3FG8 A;  3NJA A;  4Q8I A;  2BLS A;  3P09 A;  3TSG A;  3MXQ A;  3BW6 A;  3ZGA B;  3IHA A;  5IHV A;  3DWZ A;  2WKR A;  3IWO A;  2V8F A;  2IWC A;  2K31 A;  1TS0 A;  3VP0 A;  4IUK A;  1FQG A;  3N8R A;  3NOP C;  3SH9 A;  2R78 A;  1NYY A;  5GHZ A;  3W2Z A;  1NLZ A;  2ZQD A;  3B33 A;  4DJ2 A;  2KLI A;  2V0W A;  1NWZ A;  3H82 A;  1KVL A;  3BEC A;  4JGQ A;  5JYO A;  4GDB A;  3E2K A;  3ZG7 B;  3G31 A;  1DJA A;  1TEM A;  1W8Q A;  1DJC A;  1E4D A;  3RFB A;  4P85 A;  3IWI A;  4IHQ A;  1VEU A;  4F3L A;  4JPM A;  3QP6 A;  2W3D A;  1XFN A;  5CEC A;  4P6Z M;  4NXF A;  2W1T B;  4HH2 A;  1CI9 A;  4OQ0 A;  3FKV A;  2HP9 A;  4X53 A;  1YSP A;  4FUW A;  3MFX A;  1OME A;  4PMA A;  5CGW A;  2VGJ A;  2H5S A;  3GSG A;  5CXW A;  5KMW A;  2LB5 A;  2BAS A;  1OTB A;  3H7W A;  4EV4 A;  3NUL A;  3NI9 A;  5HAP A;  3IHB A;  4HNB A;  2G2U A;  1XX2 A;  3UDF A;  3S1Y A;  2ZJ9 A;  2L0W A;  4PKY A;  4JXV A;  5DF9 A;  1OTD A;  4R4R A;  3WS4 A;  1JWV A;  4RVA A;  5CTN A;  3IF6 C;  1G28 A;  3LY4 A;  5HWT A;  2G7U A;  2J3W A;  3C4P A;  3V3S A;  3HUM A;  1FIK A;  3F1N A;  5GLB A;  1G6A A;  3A3D A;  4GLQ A;  4WF0 A;  4WYY A;  2JKT I;  1Y28 A;  3BFE A;  3SOI A;  4LV1 A;  4Y5F A;  4PAU A;  1HTZ A;  4UHU A;  4EU0 A;  1XKZ A;  3CPT B;  3D3O A;  3LR0 A;  1M40 A;  3T1X A;  1W63 Q;  3JYI A;  1GSX A;  1FCM A;  3IX4 A;  1ACF A;  3NC8 A;  4KZ6 A;  4FOF A;  3RXX A;  1MY8 A;  5GHY A;  1CK3 A;  3S7Q A;  3BFG A;  3VE3 A;  2Y2N A;  2W3H A;  1VET A;  4UQI S;  2ZC3 B;  2DRW A;  4KQR A;  2XA7 S;  4PPR A;  3W4O A;  3LEQ A;  2Q9M A;  4RX3 A;  2QMI A;  1FR6 A;  5EM1 A;  1JTD A;  3U4L P;  4OH0 A;  4B88 A;  3SH8 A;  4BBT A;  2RL3 A;  2GX5 A;  2XLN A;  1IYS A;  3UB5 P;  1WE4 A;  4DXC A;  1H0M A;  5FDH A;  1H8Z A;  4R1G A;  3ZG0 A;  4QJG A;  4Y13 A;  5F6A A;  2X01 A;  4ARZ A;  4R38 A;  1TD5 A;  1XGJ A;  4GKU A;  4IED A;  3RXW A;  2WKP A;  3R7W B;  2P74 A;  2WAF A;  2DMW A;  3G4P A;  4U3T A;  4FD8 A;  1K57 A;  3EQU A;  1Q2P A;  3C38 A;  3A0S A;  1ODV A;  2XK1 A;  2A24 A;  3VSK A;  1ALQ A;  4I5S A;  4IVI A;  4JXS A;  4Y0O A;  3T4S A;  5FQK A;  5DTK A;  1NRJ A;  2VV7 A;  1WYB A;  3UE3 A;  2HP5 A;  1LL9 A;  2W3G A;  2ZC7 A;  5EVI C;  3A0V A;  2ZQ7 A;  4QPR A;  1E3U A;  1GSW A;  3F1P A;  4LLO B;  3G2Z A;  4WBG A;  1VQQ A;  3PBN A;  3IH9 A;  5MC7 A;  3N7W A;  2PYR A;  3MQ0 A;  4PKY G;  1TS6 A;  4CLC D;  3LI8 A;  5HL6 A;  1LI0 A;  2JKR M;  4YWZ A;  2DNS A;  4R4S A;  3FPV A;  3G34 A;  2ZM8 A;  1GHI A;  3PBT A;  4N92 A;  3H82 B;  2P08 A;  3CWF A;  4HHD A;  1G68 A;  3RH8 B;  1VEU B;  3T1S A;  4GDN A;  4F3L B;  3FPW A;  4FCF A;  4E6X A;  3TOI A;  4ZDX A;  2XH9 A;  3IS2 A;  3QP8 A;  2ZC5 B;  2VJW A;  4ESP A;  4S2L A;  2ZQ9 A;  3PBO A;  3A3J A;  1XPB A;  5L10 A;  3F1O A;  2H10 A;  4GCZ A;  3H7W B;  3E4Q A;  1Q2Q A;  1DP8 A;  1PRQ A;  5DTT A;  3IXD A;  4H8R A;  5KSC A;  3PBS A;  1LSW A;  5JYP A;  4L9G A;  2W3E A;  4QD4 A;  3BQA A;  1IEM A;  2HDU A;  2QJ5 A;  4GD8 A;  3RTY A;  2OOL A;  4E04 A;  2QKP A;  4N1H A;  4EXO A;  1G5U A;  1YT4 A;  5BOH A;  5FL3 A;  2OWH A;  3GTC A;  4S2O A;  1T19 A;  3A3F A;  4GJ4 A;  3BFF A;  1NZO A;  4M4X A;  2BTF P;  4KQD A;  3F1N B;  4FTX A;  1YSQ A;  3UDI A;  1K55 C;  1PYY A;  4GS9 A;  2I72 A;  2V1A A;  3K2N A;  2E8J A;  3CMZ A;  3CHW P;  4Y2F A;  2Q9N A;  5HWV A;  3T1R A;  3O88 A;  2J9P A;  2XSS A;  5F1F A;  2EFX A;  2Z6D A;  2XFT A;  2J7V A;  1JWZ A;  1VET B;  3JPU A;  3OLO A;  3ISG A;  4LV2 A;  1ES2 A;  4WZ5 C;  1V9Y A;  1X0O A;  1T1B A;  1YLZ A;  3V67 A;  2Y8H A;  3P98 A;  4OP8 A;  1PWD A;  3DTK A;  4LCM A;  3L9K A;  3TRC A;  4UA7 A;  5KIZ A;  2L4R A;  1UGU A;  3LID A;  2HF6 A;  2ZQ8 A;  3BY8 A;  2IWD A;  1W5D A;  4X69 A;  3H9W A;  3LGO A;  1T1A A;  1NYM A;  1SZV A;  5TGF A;  4H6J A;  4AFI A;  4X6T A;  3QP5 A;  2GNX A;  3TJZ C;  2M7U A;  1P9W A;  5FSR A;  4ARZ B;  5EV0 A;  5HDS A;  3KSF A;  1J3W A;  2IA2 A;  3UE1 A;  1GCE A;  3WS1 A;  5HWW A;  2P9V A;  4QHC A;  5TJJ A;  4I3A A;  4S2J A;  4S2M A;  3C7U A;  2A24 B;  2H0Y A;  3MSH A;  3EQV A;  4KZ4 A;  4MBF A;  1GSV A;  3IXG A;  1TS7 A;  3LYX A;  5EOO A;  3GDI A;  1MWT A;  3FV7 A;  1LLB A;  3IWQ A;  1FIL A;  2XQZ A;  3HBR A;  4U0X A;  3HJI A;  3ZNY A;  4JXG A;  4OQH A;  3V50 A;  2PR6 A;  5FAQ A;  2D01 A;  5AJG A;  3T1Q B;  3EEA A;  1DJB A;  3SW1 A;  4WN5 A;  1KE3 A;  2X02 A;  1YMX A;  3F1P B;  2D02 A;  4NXE A;  2Z6C A;  3GMW A;  1NZU A;  5FEG A;  4BBV A;  1BUE A;  3HVF A;  4DJ3 A;  4ZAM A;  2EX8 A;  1E25 A;  4XUX A;  1TF1 A;  4OON A;  5AQ9 A;  1NY0 A;  2XR0 A;  5HAR A;  5DJU A;  1XJ3 A;  3DWK A;  4R6L A;  5DFY A;  1W63 M;  4S2N C;  1FOF A;  1BZA A;  2PDR A;  4D60 A;  1J9M A;  3MZE A;  4YFM A;  3S7N A;  1S1Z A;  1KGF A;  5F68 A;  5HDC A;  4R23 A;  5GL9 A;  2Y4A A;  1Z09 A;  4IBX A;  1S0W A;  3HLC A;  2WGV A;  2Y2K A;  5HPF A;  3R7W A;  2Y91 A;  4OPY A;  4DMZ A;  3IS2 B;  3KYQ A;  2XFS A;  1JVJ A;  3D72 A;  4MEZ A;  3G6O A;  2V0U A;  4R0Q A;  1GHP A;  5TFQ A;  5J7E A;  4O7D A;  2O0Y A;  5EFW A;  3F1O B;  5EM0 A;  4G3K A;  2HZ5 A;  4LRZ E;  5E2H A;  3CUE A;  3LEZ A;  2VX8 A;  2Y2H A;  3NEC A;  1PZO A;  4WEK A;  3VP2 A;  3MZF A;  3UE6 A;  5C5K A;  3Q7V B;  3S22 A;  1O7E A;  4MN7 A;  4QY6 A;  1IYO A;  1MWR A;  2ZM2 A;  3FZC A;  3BLM A;  5GLA A;  2PU2 A;  4R70 A;  4WLA A;  1LHY A;  1I2W A;  4FH4 A;  4O01 A;  4LRY C;  1IKG A;  2J3T C;  3FWL A;  1OTI A;  3VSL A;  3UPP A;  5DF7 A;  3AGF A;  4GS9 B;  4OQG A;  3ZYT A;  5E2E A;  3N8L A;  1CEG A;  1I5Q A;  1XP4 A;  2PBY A;  3OCN A;  1SKO A;  3OPP A;  1N9B A;  4PHT A;  3HUN A;  3UY6 A;  4E3L A;  3C7V A;  1RCJ A;  1BYW A;  4P6Z S;  3PHY A;  1XJ4 A;  1NXY A;  1V9Z A;  4OLD A;  5M19 A;  1MZU A;  4JXW A;  3JVV A;  4HJ6 A;  3EOI A;  4E6W A;  4PM7 A;  3KSG A;  1IEL A;  3VP1 A;  5G4Y A;  3ZFZ A;  2XD1 A;  1ESI A;  1Y4O A;  3MKE A;  1CQA A;  2CC1 A;  4YIN A;  1LSV A;  3OC2 A;  4H6J B;  3DAV A;  4UEY A;  3ZQ5 A;  2Y59 A;  2LB9 A;  3TG9 A;  4JLF A;  4E3I A;  3G35 A;  4B4X A;  3VOZ A;  4WL9 A;  1ES5 A;  5M1A A;  2XRN A;  4QY5 A;  4EWF A;  4L0L A;  3VOY A;  1KDS A;  2Y2M A;  2ZM0 A;  2P9V B;  4L9E A;  4Q0H A;  1P0Z A;  1I2S A;  3A0R A;  2ZOH A;  1KGE A;  4X55 A;  2EFU A;  1K54 A;  4G3W A;  1D1J A;  1K6S A;  4E3K A;  4OLG A;  1YMS A;  3LIE A;  1IKI A;  4KZ3 A;  4HES A;  5E43 A;  3SS5 A;  5CHJ A;  1QMF A;  2YKH A;  3IBR A;  3D9Y A;  1PZP A;  2OLU A;  4DDY A;  2NUT C;  2A2L A;  5FI7 A;  3ZG9 B;  1PI4 A;  4KUK A;  2W3F A;  2V1B A;  2EA9 A;  1LL5 A;  2HDR A;  1JTG A;  2IWB A;  1D06 A;  1FCO A;  3CG5 A;  5I5L A;  2J80 A;  5A92 A;  2OAP 1;  3IT9 A;  4HIA A;  1L0F A;  2PYP A;  2WKH A;  3KYE A;  1SDN A;  4P0M A;  5E2G A;  3VV4 A;  3E0Y A;  2ZOI A;  5HL1 A;  1K4F A;  2UV0 E;  4E3N A;  3DBA A;  4P6B A;  2EWV A;  3OZH A;  1EWZ A;  3OBF A;  4CLC A;  3VMA A;  5L2F A;  3R4K A;  1P97 A;  1AWI A;  2HGV A;  1IYP A;  1C3B A;  4ZBE A;  2QHK A;  2XEP A;  2HP6 A;  4IBR A;  4HY8 A;  2QJ7 A;  2FFY A;  2ZMF A;  2B02 A;  2PRF A;  3LCE A;  4YNR A;  3N4I A;  2PD8 A;  4N1X A;  2QZ6 A;  1RGZ A;  5D3O A;  4ZJ2 A;  2M1C A;  5GLD A;  2X71 A;  3QNC A;  3MQQ A;  2YKF A;  3G32 A;  4XT2 A;  2QYB A;  3OPH A;  5I94 A;  3LUQ A;  1BSG A;  3CAX A;  4RYE A;  4Y0T A;  1KE0 A;  4L9F A;  3M6H A;  4LPZ A;  1XA7 A;  2VKS A;  4DXB A;  3PBQ A; 
#chains in the Genus database with same CATH homology
 4Y13 A;  3IX4 A;  4Y17 A;  4Y15 A;  3QP6 A;  3QP8 A;  2AVX A;  3JPU A;  5L07 A;  2Q0O A;  1L3L A;  3QP1 A;  4LGW A;  5L09 A;  4LFU A;  3IX8 A;  5L10 A;  3QP2 A;  3QP5 A;  3QP4 A;  1H0M A;  2UV0 E;  3IX3 A;  3SZT A;  4NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...