3IX4A

Lasr-tp1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
GFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords Transcriptional activator protein lasR
total genus 52
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix4A00
1L3LA 3SZTA 4LGWA 5L09A 3QP6A 4LFUA 3QP5A 1H0MA 3QP8A 2UV0E 3IX8A 3QP4A 3QP2A 4Y17A 4Y13A 4NG2A 2Q0OA 4Y15A 2AVXA 3IX3A 5L10A 3QP1A 5L07A 3JPUA 3IX4A
chains in the Genus database with same CATH superfamily
2ZMFA 2ZC6B 3D3OA 5KIZA 4E3JA 3W2ZA 3SZTA 5HL6A 1PRQA 3A0RA 2VV7A 5JYPA 1D06A 3TOIA 3N8LA 3ZQ5A 1K57A 1LLBA 4EV4A 3QNCA 3HREA 2OV5A 4Y7PA 3AGDA 5HFOA 5F83A 1O07A 4UA9A 4NKPA 3A0SA 3QP1A 4Z1WA 2Y79A 4UA6A 4MLLA 5E2GA 5IS1A 4LRYC 4XT2A 5F82A 1Q2PA 5AJGA 1ONGA 3V67A 4DE1A 5IHVA 2IWCA 4H8RA 3NHQA 3G32A 3BQ8A 3T4LA 3LR0A 1PWGA 2P04A 4WUJA 4NETA 4B93A 2HDRA 1G5UA 3QP4A 3V39A 3AGEA 3KX0X 3IX3A 3U2AA 3UY6A 2I72A 1PW8A 4UAAA 2V1BA 3S1YA 1YSQA 3WRZA 3W8KA 3SS5A 4GW9A 2R78A 4E6XA 1W63M 4BWIA 4DKIA 3JYIA 1T1CA 1XGJA 2V8FA 4RVAA 3H82B 3IX4A 5FATA 5EUAA 4FH4A 3PTEA 1S67L 4LCMA 4DE0A 4WL9A 2Y2LA 3LFVA 4E04A 3VOZA 3G35A 3MZFA 2W1RA 3MQQA 2A2LA 4PKYG 2EX2A 4EUVA 1X0OA 4QU3A 3HLBA 3C38A 4HQAA 4WZ5C 4KZ5A 1E4DA 1IYQA 2RCXA 2Y2GA 4Z9QA 3OPRA 3UDXA 4HNBA 2NUTC 4RX3A 1YKDA 2WKHA 2A3UA 3L7HA 1V9ZA 3T1QB 5JYOA 1O7EA 1K4FA 2AVXA 3PBSA 3CPTB 2W3FA 3WS5A 3VV4A 5EVIA 4PM6A 4GNUA 1P9RA 3QP2A 2Q9MA 3GVBA 4R3JA 1JVJA 1XJ2A 2Y2JA 3CJMA 3M2KA 3UE0A 2QJ5A 4OVDA 5L09A 2MJ6A 2XSSA 2P7JA 1DJAA 2J80A 4X25A 3PAEA 1OTAA 1WA9A 1H3QA 2XRNA 1I2WA 2GJ3A 3JPUA 3D72A 5F68A 2WKPA 5CX7A 1K57C 5CHUA 3GQZA 2YKFA 4EETB 3FPVA 1TDGA 1KE3A 3ULFA 4R3BA 4RA7A 1SZVA 2J8YA 2UV0E 5GHZA 3ZVWA 3UE1A 1J3WA 3CAXA 3F1OA 3P7NA 1RGZA 5F1GA 1K4EA 4GDNA 3S7OA 1F9IA 1JWZA 2L1MA 3IS2A 4QD4A 2ZMVA 1LSXA 5DFXA 1MY8A 4C6YA 1IYOA 1CF0A 1DP6A 2A24A 5J3WA 1PI4A 4GLQA 3ZYTA 1XJ4A 4Y15A 5DTKA 5EECA 1RGYA 1DJBA 2HV1A 4HJ4A 4KG5A 5C5KA 3K3CA 1Q2QA 4FUWA 4BD0A 3F1OB 3BJNA 5GLDA 4EQIA 1ES5A 2ZMAA 2OLUA 3P01A 2LB5A 2J3TC 2PBYA 4JF4A 4M3KA 2ZM0A 3B42A 5LBRA 1NJ4A 2PAVP 3FWLA 3ICYA 1SHVA 3OPPA 2ZL1A 3BFDA 2WUQA 3MJQA 2QWSA 4MN6A 5E43A 3AGFA 1K38A 2Z6CA 1GSVA 5L2FA 3HL9A 1G68A 3IXBA 3KSHA 5CTNA 3MMHA 3DTKA 1OT6A 2B95A 3HUNA 2HJ9C 3T50A 5FDHA 3FPWA 1YAXA 4OQ0A 2GZAA 4YOFA 3VOLA 4K0XA 1AXBA 5G18A 3BQAA 4ARZA 1BULA 1JTDA 5GL9A 1YPRA 3K2NA 3IQAA 1CEGA 3GR2A 3V3SA 4HI4A 1L3LA 5A90A 2OLVA 1MXOA 4GKUA 1GHMA 4P87A 3VSLA 5A8BA 2KLIA 2W1TB 1H0MA 2GX5A 2H0YA 1XGIA 3GMWA 2VZWA 2XDMA 2JKTM 4R38A 4Y17A 3ZG7B 2FFYA 2PRFA 4GDBA 1JWPA 4CLCE 1OT9A 5EFWA 3TRCA 3FKVA 3JVVA 3T4QA 3UMDA 4PM8A 3TE8A 3S4XA 1NY0A 2FH5A 4HJ6A 1D1JA 4JGQA 2Q9NA 4WMCA 1XA7A 4DF6A 3VP3A 4D60A 1EI5A 1FILA 3ZGAB 4KG2A 3FZCA 1FSYA 2EFUA 4LPZA 3HBRA 4XXRA 3MKFA 4L0LA 2WGIA 1SDEA 1JNUA 1PWDA 1M40A 3ZG0A 2HP6A 2VGLS 2VGJA 1BZAA 5E2FA 3GTCA 4S2KA 4S2OA 3DAVA 4E3NA 2ZM2A 1MWUA 1EROA 1XJ6A 1GHIA 3IXDA 5HWTA 3JVUA 1FR6A 5HDDA 2EFXA 4IUKA 4IVKA 4WYYA 5CEDA 4OPQA 1GSXA 1YLPA 3CZDA 2VEAA 3E2KA 3S22A 1L0EA 3OCNA 2EXBA 1P9WA 5TBMA 3V50A 1FIKA 1WYBA 5FA7A 1RP5A 3IBRA 1ZC2A 2HDQA 2W3GA 1TDLA 4UQIM 2HZ5A 5TBMB 1S6RA 4X1MA 3UB9A 3HUOA 5J8XA 3I7JA 3UE3A 4BQMA 2XA7M 3WWXA 3E4PA 5M18A 1D7EA 5EVIB 4OKPA 3BRMA 1L0DA 2O9AA 4ETXA 4LENA 5HD5A 1YSPA 5A92A 3MF0A 4WELA 4EEPA 5FSRA 2UWXA 3EEHA 2JN7A 4PKYA 2XD1A 1YLTA 4QJGA 2X01A 1XKZA 3BFGA 1ZHHB 4GN2A 2V8CA 1DP9A 1ERMA 4IUHA 5FAOA 4MMNA 1UGUA 3HLGA 3KYEA 2ZQCA 4R4SA 1FCNA 5CGSA 2P08A 1KE4A 3IXHA 5FI2A 3BECA 3N8SA 1ES2A 2HP5A 4E6WA 4OLDA 4QPRA 3C4PA 3SOIA 2IA2A 5TFQA 5F69A 4X1LA 2J9PA 3CWFA 4EERA 2V0UA 4HH2A 2FFFB 2R9XA 2QPNA 3LGOA 5M1AA 1NYYA 3BLMA 4O0PA 2PU4A 2XFTA 1W5DA 5DKLA 5FI7A 4D2OA 1JTGA 4KENB 1UWNX 1YLWA 3OCLA 5DF9A 1W63Q 3CPTA 1VHMA 2ZQ8A 3UDFA 5I94A 3ZNTA 4RYEA 4KZ8A 3BY8A 1LSVA 1HTZA 2VV6A 2XF3A 2GDNA 3VFHA 2I9VA 5HPFA 4LRZE 1NRFA 2XFSA 4E3MA 5DJTA 5GLBA 3PBRA 3MS6A 5DF8A 4EU0A 1KGEA 4LFUA 1LHYA 3C8CA 3TW8A 4UQIS 4K08A 1OTBA 5AQ7A 3LR5A 5HAIA 1BTLA 2KX6A 4HESA 4Y13A 2WYXA 2Z2MB 1VB6A 4OOMA 4KG6A 3MFDA 2Z2LB 1G6OA 2H0TA 5F6AA 3PBQA 3DW0A 2JCHA 5EVID 3NECA 5D3OA 1W8YA 3OBFA 4BJPA 4OQHA 3SS4A 4N1XA 1SDNA 4BL3A 3HLFA 4OP8A 1GHPA 4IBRA 5J7EA 1XA1A 3O86A 2VJWA 3VOYA 1IELA 1H5XA 1GCEA 2O9BA 3O87A 3OPHA 5HWWA 1PW1A 3RH8B 2PYRA 3MXRA 3UB8A 2W3HA 4NXBA 4DDSA 3HLWA 4FSFA 3BFCA 4BBTA 4GJ4A 4L9EA 3ZDJA 1BLHA 2ZC5B 3H82A 4WN5A 2PR6A 3IF5A 3OLOA 4PM5A 2IWBA 1SKOB 2V1AA 1IKIA 2Y2OA 5FAPA 2WKEA 2P9VB 4O7DA 2QKPA 1MWRA 3ITAA 3DTEA 3FC7A 1K55C 2EWWA 5EVIC 1L0GA 4O8GA 4KZ3A 2M7VA 4Y2FA 3LI8A 2FZ0A 1K54A 4X6TA 3IF6A 2JKFA 4ZBEA 4EBPA 5HD3A 4JF5A 4WLAA 2CC1A 4E3OA 1YM1A 4GS9A 1ES3A 5FQ9A 1DP8A 3IS2B 3V3RA 3WS4A 3IT9A 5DKKA 1FOFA 4I39A 3R7WB 3EGXC 1VEUA 2V2FF 4U3TA 2G7UA 3HVFA 1TS6A 4Y0OA 2ZC3B 2VGKA 1EWZA 2VA0A 3UN7A 1C3BA 4XT2B 5TGFA 3D9YA 1NZOA 2J3WA 2PD8A 1VEUB 1E3UA 4EQ1A 5EV0A 1PWCA 2WAEA 3ZHHA 3CUEA 2B5RA 1BYWA 1SKOA 2VX8A 3CITA 2B18A 2P9VA 2J9OA 4LCLA 5IT5A 4I38A 4Q8IA 1MBLA 4JXGA 1XX2A 1F98A 3A3EA 4Y0UA 3HLEA 4EEUA 2WGVA 2OAQ1 2X02A 2Y2HA 4R0QA 4HBUA 2Y2PA 4JGOA 5KSHA 4DDYA 4DRTA 3VP2A 3LUQA 1NYMA 1CJFA 3EEAA 1EW0A 4ZJ1A 2QHKA 2L4RA 4DJ3A 3A3JA 2LB9A 4MBFA 1K6SA 5DJUA 3LIFA 2ZLYA 3N7WA 4N1HA 4ZAMA 3VP4A 2C6WB 1Y4OA 3CI6A 1NXYA 4JF6A 4MDZA 5CHJA 4BENA 3NOTC 1CI8A 2M7UA 1PZPA 2WZZA 5CXWA 1BLSA 2W3DA 5EM0A 3MXSA 4JLFA 1Y28A 2HDUA 4HH3A 2EX9A 1VETB 2H28A 3HJIA 3TJZC 4RQ9A 2W0NA 4WM9A 2EA9A 1KDWA 3ZCZA 4C75A 3R4KA 4KZAA 4ETZA 3Q82A 2R9WA 1LI9A 3QP6A 4GZBA 2ZQ9A 3WS2A 5FI6A 4CPKA 4C3QA 4BMWA 1XFQA 3A3FA 4CLCD 2WKIA 1ZTUA 1CEFA 5J4EA 5A93A 3WS0A 2XH9A 4DE3A 1HZOA 3ZG8B 3DBAA 1F5MA 3IWIA 1UWPX 2K2NA 4N9LA 3T1SA 2C5WB 1NRJA 3NY4A 2QJ7A 1IYPA 2O99A 2PU2A 2XR0A 4PHTA 4F3LB 4OPZA 2WAFA 4CJNA 4BLMA 3NI9A 1S4SA 2B02A 3H7WA 2Y91A 1NWZA 3GSGA 3PBNA 5M19A 1XFNA 2EWVA 1FSWA 3C2WA 4B88A 3OC2A 4GD6A 1QMFA 2YKHA 3NDEA 5HWVA 4I3AA 2Y59A 4Q0IA 1T18A 4MCWA 1LT0A 1OTDA 3B33A 5EM1A 4JBFA 2BASA 5AVEA 1LL9A 5DTSA 2ZQ7A 3SS3A 2DMWA 4ZTKA 4BBVA 5E2EA 3BYDA 4XUZA 2Y2IA 4KQOA 5HAQA 3RTYA 4R70A 1FQGA 1W79A 4BBUA 3UNWA 3MQOA 1OJGA 2ZOIA 2QZ6A 4N92A 3PBOA 5KMWA 5FQIA 3HCYA 4OP5A 3E4OA 3U4LP 2P74A 2XEPA 4JXVA 3UB5P 2PYPA 3NULA 4IVIA 5MC7A 3VMAA 3BLSA 1XJ3A 2E8IA 1W7FA 4PAUA 4FD8A 5HDSA 3S7PA 4KUKA 4JPMA 4ZJ3A 4AFIA 1N4OA 2JBFA 4OQGA 2DNSA 1HLUP 3G4PA 1GA0A 2XLNA 3Q7VA 4KUOA 3T4OA 4HP9A 3GRJA 3G6OA 1QMEA 1ACFA 1TS8A 2Z6DA 1WE4A 4MN7A 3CG5A 4S2NA 4GHIB 1T19A 2ZQDA 3T4TA 4LV0A 3C5AA 3Q7VB 2PBDP 2VGLM 4EBLA 2M1CA 3C7VA 3CHWP 4P6BA 3LIAA 3E4QA 3V5MA 2ZJ9A 4IJGA 5HSQA 2ZQAA 5IU1A 1KGGA 4H6JB 4DE2A 4ARZB 2EXAA 4ZJ2A 4L9GA 5E2HA 1S4RA 2J3TD 3IF6C 3IX8A 3IWOA 4GS9B 1Y54A 4YNRA 4KQQA 5L10A 5FQQA 4FCFA 2WKQA 2PR5A 1T1AA 3NIAA 2BLSA 1W8QA 4EWFA 2HJEA 3LYXA 5EOOA 2WADA 2HPBA 4YWZA 4DXCA 4X55A 3W4QA 1MPLA 1CI9A 3T12B 4UA7A 4UHUA 3GV9A 4GD8A 3UE6A 1XPBA 4MBHA 4NXFA 1MWTA 2JKRI 3IBJA 3W4PA 4NK3A 4QHCA 3IH9A 3T1XA 3HLDA 3M6BA 4KZ4A 4WMCD 2O0YA 2JE5A 1OJ5A 3TSGA 3VP0A 1ALQA 1ZG4A 3PBTA 5L07A 2XD5A 1MWSA 1P0ZA 1TVFA 4BL2A 4CQHA 5A91A 1XP4A 5FQJA 5FEFA 3BEBA 3MFXA 2OSUA 5EOEA 2ZM8A 1SCWA 4KZ9A 2BG1A 4Q0HA 5CERA 4YFMA 3C30A 4E3LA 1YMSA 3LICA 5BOHA 4KQRA 3EQUA 2Y2QA 5KSCA 3VFFA 3P98A 5CTMA 1KDSA 3PXPA 2Y4AA 1JWVA 3KO6A 5CHMA 4R1GA 3DWZA 1L2SA 3MR0A 4DXBA 3MXQA 3M6HA 3R7WA 4QB8A 3ZG5A 3QHYA 1FCOA 1KVLA 3KSIA 1I2SA 1ODVA 3EGDC 4NXEA 3IH8A 4YINA 5DTTA 2KDKA 1K0KA 3BW6A 4WBGA 1K55A 1OMEA 4UEYA 2D02A 2XA7S 4G3KA 3N6IA 3TG9A 4IHQA 5HZHA 1MZUA 1L0FA 4I3JA 3PHYA 4P85A 1FR1A 3B47A 1PIOA 1I5QA 1DY6A 4EBNA 5FAQA 4IEDA 3DTMA 3LR3A 3Q7ZA 4K91A 4NG2A 2Q0OA 4JGPA 4NXGA 1HVBA 1LI0A 1E3UD 3IXGA 3LY3A 3OPLA 4R4RA 4OQIA 3G34A 1CK3A 2ZBBA 4CLCC 3QP5A 1ES4A 4IBXA 3UPOA 5F1FA 4HBTA 4BD1A 4R23A 1YT4A 1VETA 2A24B 2JKGA 1HD8A 4MEZA 1ZKJA 3ITBA 4P0MA 3QNBA 3E2LA 1PNEA 2V20A 1S1YA 2WGWA 1PZOA 4HIAA 2JKTI 5F5YA 3KSGA 3MZEA 3MZDA 3Q07A 2WKRA 4JGRA 5L8MA 1M6KA 1U60A 2XK1A 2G2UA 3EQVA 4Q0JA 1NLZA 1PFLA 4II7A 3SH8A 2EX8A 4N9KA 3B3XA 2JC7A 2KOIA 1NLYA 4X69A 3VP1A 3RXXA 4NEED 5FQMA 4LV1A 3UMEA 3NCKA 3G2ZA 5HPIA 3PYPA 5GLAA 4KZ6A 2INWA 2PDRA 3T1RA 1GA9A 3PAGA 1K54C 2OOLA 2X71A 4GB7A 1ESUA 4PPRA 2XROA 3RJUA 5AQBA 2CMNA 4KQDA 3GDIA 2K7SA 3Q81A 2K31A 3KYQA 5DF7A 3UDIA 4X56A 3NJAA 4LV3A 4RX2A 2VLGA 3C4OA 3DTIA 4ZDXA 4P6ZM 3O3VA 2GNXA 4PMAA 4ESPA 1K56D 1LL5A 2OWHA 1K56A 2QMIA 2Y55A 3OZHA 5AQAA 5I5LA 3F1PA 5HX9A 1PI5A 2DCFA 2J7VA 3UPNA 2E8JA 3NOUC 2OWJA 1OTEA 4QY6A 5HL1A 3FG8A 1BSGA 1E25A 1OPXA 1LSWA 2D01A 2NUPC 5CEBA 1IFQA 2Y8HA 4I5SA 3NC8A 4KZBA 3LIDA 4HHDA 3QP8A 3A0VA 2WZXA 1H8YA 1F2KA 1BT5A 2ZD8A 4HP4A 2BTFP 1GSWA 3N8RA 4WEKA 4EW7A 4EESA 4OPYA 4DN0A 4XUXA 1S1ZA 3BFEA 5HAPA 3HUMA 1ZG6A 4R6LA 3LEQA 3ZNYA 1V9YA 1S66L 2HF6A 4U0XA 4Y5FA 5GLCA 4MNRA 4QY5A 3G30A 2HGVA 2ACGA 3H9WA 1J9MA 3VE3A 2ZC7A 1TEMA 3E98A 3BWLA 3BFFA 5FASA 4U0TA 1N9BA 2W3EA 3C7UA 4P6ZS 3Q1FA 1Z09A 3T4KA 4ZRRA 5AQ9A 2ZL1B 4B4ZA 3ZVTA 2HDSA 1N9OA 1IEMA 4F94A 3G31A 1IOUA 1S0WA 5CGWA 5G4YA 3WRTA 1BLPA 1VQQA 1KOUA 4WEJA 1ERQA 5GHYA 4S2NC 4MBKA 2VK3A 1TF1A 3NOPC 1TS0A 3LCEA 1YLJA 2RL3A 5EPHA 4EUZA 5HW3A 4OH0A 3MBZA 1DJCA 3VSKA 4JXWA 4PM9A 3VE4A 5TR7A 2VKSA 4GCZA 3EWKA 2XGNA 3MSHA 4S2MA 3IWQA 3T4JA 4LV2A 4OONA 3UPPA 3CMZA 1FCMA 1ONHA 3D4FA 1STZA 3S7QA 3W4OA 4LGWA 4WZ4A 4PM7A 3FYZA 3BM6A 1VM1A 4WF0A 3N4IA 2A49A 5FQKA 1LL8A 1H8ZA 3SH9A 1NZUA 2JHEA 1N9NA 2DRWA 4LLOB 3UO9A 3LR4A 4F3LA 4H6JA 1MC0A 2IWDA 3H7WB 4S2JA 3LY4A 2JKRM 2O9CA 3IHAA 3G2YA 4QWOA 1YQSA 1KGFA 2WK0A 4S2LA 2VV8A 1DRMA 3ISGA 4LRXC 3PR6A 4Y0TA 1AWIA 4JKTA 4R3AA 5FEGA 3CLOA 5AVFA 1CQAA 1ESIA 3WS1A 5CGXA 4DJ2A 3DWKA 4X53A 4ID4A 5DVAA 3O5YA 1N9LA 3MQ0A 3ZFZA 4DMZA 3O88A 5FDSA 4GOGA 3L9KA 1K25A 5G4ZA 2H10A 4HJ3A 5EVLA 3E0YA 1YLYA 1KVMA 1G28A 3A3DA 4K0WA 4L9FA 4E3KA 3M2JA 1IKGA 2L0WA 4FTXA 3RFBA 1A0KA 5K5BA 4HOIA 4CLCA 5TJJA 2Y2KA 3EOIA 4G3VA 3F1NA 4GHIA 2V1ZA 3UB6A 2W1TA 3LI9A 5EE8A 2XQZA 1PYYA 4S2IA 1MKIA 4OPRA 3OOVA 1BLCA 5HDCA 3SW1A 2QYBA 2V9AA 3ZG9B 2HP9A 1T1BA 2G2WA 3LIEA 1H8MA 1P97A 1XXMA 4OOYA 5GHXA 3LEZA 3RXWA 1SKFA 1Z6FA 1YLZA 3KYZA 4EXOA 4WZ5A 4X68A 3S7NA 3NDGA 1G6AA 4OLGA 3GECA 4O01A 3MKEA 4OOLA 4MN5A 3CUEC 3BY9A 5HARA 2ZOHA 4FOFA 2PT7A 5DFYA 3P09A 5CECA 1BUEA 3NBLA 3HLCA 2ZC4B 2Y2MA 2W27A 3IHBA 2EX6A 3FKWA 2PHYA 1MKMA 3KSFA 4M4XA 2OAP1 4G3WA 1YMXA 3F1PB 1TD5A 1TS7A 4B9OA 4I3IA 2WGWB 1WYCA 4FH2A 3UB7A 3A3IA 3F1NB 3SH7A 3K3DA 4ME4A 2V0WA 4Y3IA 4HY8A 2Y2NA 5EVEA 4HEFA 1OTIA 1RCJA 4JXSA 1IYSA 4KZ7A 5KZHA 3FV7A 3HJKA 1KE0A 5U47A 4A5RA 4E3IA 2PD7A 3IF6B 4B4XA 5FL3A 3LIBA 3T4SA 4S2PA 1K6RA 4CLCB 2H5SA 3LO7A 5CRFA
chains in the Genus database with same CATH topology
1L3LA 3SZTA 4LGWA 5L09A 3QP6A 4LFUA 3QP5A 1H0MA 3QP8A 2UV0E 3IX8A 3QP4A 3QP2A 4Y17A 4Y13A 4NG2A 2Q0OA 4Y15A 2AVXA 3IX3A 5L10A 3QP1A 5L07A 3JPUA 3IX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3L A;  3SZT A;  4LGW A;  5L09 A;  3QP6 A;  4LFU A;  3QP5 A;  1H0M A;  3QP8 A;  2UV0 E;  3IX8 A;  3QP4 A;  3QP2 A;  4Y17 A;  4Y13 A;  4NG2 A;  2Q0O A;  4Y15 A;  2AVX A;  3IX3 A;  5L10 A;  3QP1 A;  5L07 A;  3JPU A;  3IX4 A; 
#chains in the Genus database with same CATH topology
 2ZMF A;  2ZC6 B;  3D3O A;  5KIZ A;  4E3J A;  3W2Z A;  3SZT A;  5HL6 A;  1PRQ A;  3A0R A;  2VV7 A;  5JYP A;  1D06 A;  3TOI A;  3N8L A;  3ZQ5 A;  1K57 A;  1LLB A;  4EV4 A;  3QNC A;  3HRE A;  2OV5 A;  4Y7P A;  3AGD A;  5HFO A;  5F83 A;  1O07 A;  4UA9 A;  4NKP A;  3A0S A;  3QP1 A;  4Z1W A;  2Y79 A;  4UA6 A;  4MLL A;  5E2G A;  5IS1 A;  4LRY C;  4XT2 A;  5F82 A;  1Q2P A;  5AJG A;  1ONG A;  3V67 A;  4DE1 A;  5IHV A;  2IWC A;  4H8R A;  3NHQ A;  3G32 A;  3BQ8 A;  3T4L A;  3LR0 A;  1PWG A;  2P04 A;  4WUJ A;  4NET A;  4B93 A;  2HDR A;  1G5U A;  3QP4 A;  3V39 A;  3AGE A;  3KX0 X;  3IX3 A;  3U2A A;  3UY6 A;  2I72 A;  1PW8 A;  4UAA A;  2V1B A;  3S1Y A;  1YSQ A;  3WRZ A;  3W8K A;  3SS5 A;  4GW9 A;  2R78 A;  4E6X A;  1W63 M;  4BWI A;  4DKI A;  3JYI A;  1T1C A;  1XGJ A;  2V8F A;  4RVA A;  3H82 B;  3IX4 A;  5FAT A;  5EUA A;  4FH4 A;  3PTE A;  1S67 L;  4LCM A;  4DE0 A;  4WL9 A;  2Y2L A;  3LFV A;  4E04 A;  3VOZ A;  3G35 A;  3MZF A;  2W1R A;  3MQQ A;  2A2L A;  4PKY G;  2EX2 A;  4EUV A;  1X0O A;  4QU3 A;  3HLB A;  3C38 A;  4HQA A;  4WZ5 C;  4KZ5 A;  1E4D A;  1IYQ A;  2RCX A;  2Y2G A;  4Z9Q A;  3OPR A;  3UDX A;  4HNB A;  2NUT C;  4RX3 A;  1YKD A;  2WKH A;  2A3U A;  3L7H A;  1V9Z A;  3T1Q B;  5JYO A;  1O7E A;  1K4F A;  2AVX A;  3PBS A;  3CPT B;  2W3F A;  3WS5 A;  3VV4 A;  5EVI A;  4PM6 A;  4GNU A;  1P9R A;  3QP2 A;  2Q9M A;  3GVB A;  4R3J A;  1JVJ A;  1XJ2 A;  2Y2J A;  3CJM A;  3M2K A;  3UE0 A;  2QJ5 A;  4OVD A;  5L09 A;  2MJ6 A;  2XSS A;  2P7J A;  1DJA A;  2J80 A;  4X25 A;  3PAE A;  1OTA A;  1WA9 A;  1H3Q A;  2XRN A;  1I2W A;  2GJ3 A;  3JPU A;  3D72 A;  5F68 A;  2WKP A;  5CX7 A;  1K57 C;  5CHU A;  3GQZ A;  2YKF A;  4EET B;  3FPV A;  1TDG A;  1KE3 A;  3ULF A;  4R3B A;  4RA7 A;  1SZV A;  2J8Y A;  2UV0 E;  5GHZ A;  3ZVW A;  3UE1 A;  1J3W A;  3CAX A;  3F1O A;  3P7N A;  1RGZ A;  5F1G A;  1K4E A;  4GDN A;  3S7O A;  1F9I A;  1JWZ A;  2L1M A;  3IS2 A;  4QD4 A;  2ZMV A;  1LSX A;  5DFX A;  1MY8 A;  4C6Y A;  1IYO A;  1CF0 A;  1DP6 A;  2A24 A;  5J3W A;  1PI4 A;  4GLQ A;  3ZYT A;  1XJ4 A;  4Y15 A;  5DTK A;  5EEC A;  1RGY A;  1DJB A;  2HV1 A;  4HJ4 A;  4KG5 A;  5C5K A;  3K3C A;  1Q2Q A;  4FUW A;  4BD0 A;  3F1O B;  3BJN A;  5GLD A;  4EQI A;  1ES5 A;  2ZMA A;  2OLU A;  3P01 A;  2LB5 A;  2J3T C;  2PBY A;  4JF4 A;  4M3K A;  2ZM0 A;  3B42 A;  5LBR A;  1NJ4 A;  2PAV P;  3FWL A;  3ICY A;  1SHV A;  3OPP A;  2ZL1 A;  3BFD A;  2WUQ A;  3MJQ A;  2QWS A;  4MN6 A;  5E43 A;  3AGF A;  1K38 A;  2Z6C A;  1GSV A;  5L2F A;  3HL9 A;  1G68 A;  3IXB A;  3KSH A;  5CTN A;  3MMH A;  3DTK A;  1OT6 A;  2B95 A;  3HUN A;  2HJ9 C;  3T50 A;  5FDH A;  3FPW A;  1YAX A;  4OQ0 A;  2GZA A;  4YOF A;  3VOL A;  4K0X A;  1AXB A;  5G18 A;  3BQA A;  4ARZ A;  1BUL A;  1JTD A;  5GL9 A;  1YPR A;  3K2N A;  3IQA A;  1CEG A;  3GR2 A;  3V3S A;  4HI4 A;  1L3L A;  5A90 A;  2OLV A;  1MXO A;  4GKU A;  1GHM A;  4P87 A;  3VSL A;  5A8B A;  2KLI A;  2W1T B;  1H0M A;  2GX5 A;  2H0Y A;  1XGI A;  3GMW A;  2VZW A;  2XDM A;  2JKT M;  4R38 A;  4Y17 A;  3ZG7 B;  2FFY A;  2PRF A;  4GDB A;  1JWP A;  4CLC E;  1OT9 A;  5EFW A;  3TRC A;  3FKV A;  3JVV A;  3T4Q A;  3UMD A;  4PM8 A;  3TE8 A;  3S4X A;  1NY0 A;  2FH5 A;  4HJ6 A;  1D1J A;  4JGQ A;  2Q9N A;  4WMC A;  1XA7 A;  4DF6 A;  3VP3 A;  4D60 A;  1EI5 A;  1FIL A;  3ZGA B;  4KG2 A;  3FZC A;  1FSY A;  2EFU A;  4LPZ A;  3HBR A;  4XXR A;  3MKF A;  4L0L A;  2WGI A;  1SDE A;  1JNU A;  1PWD A;  1M40 A;  3ZG0 A;  2HP6 A;  2VGL S;  2VGJ A;  1BZA A;  5E2F A;  3GTC A;  4S2K A;  4S2O A;  3DAV A;  4E3N A;  2ZM2 A;  1MWU A;  1ERO A;  1XJ6 A;  1GHI A;  3IXD A;  5HWT A;  3JVU A;  1FR6 A;  5HDD A;  2EFX A;  4IUK A;  4IVK A;  4WYY A;  5CED A;  4OPQ A;  1GSX A;  1YLP A;  3CZD A;  2VEA A;  3E2K A;  3S22 A;  1L0E A;  3OCN A;  2EXB A;  1P9W A;  5TBM A;  3V50 A;  1FIK A;  1WYB A;  5FA7 A;  1RP5 A;  3IBR A;  1ZC2 A;  2HDQ A;  2W3G A;  1TDL A;  4UQI M;  2HZ5 A;  5TBM B;  1S6R A;  4X1M A;  3UB9 A;  3HUO A;  5J8X A;  3I7J A;  3UE3 A;  4BQM A;  2XA7 M;  3WWX A;  3E4P A;  5M18 A;  1D7E A;  5EVI B;  4OKP A;  3BRM A;  1L0D A;  2O9A A;  4ETX A;  4LEN A;  5HD5 A;  1YSP A;  5A92 A;  3MF0 A;  4WEL A;  4EEP A;  5FSR A;  2UWX A;  3EEH A;  2JN7 A;  4PKY A;  2XD1 A;  1YLT A;  4QJG A;  2X01 A;  1XKZ A;  3BFG A;  1ZHH B;  4GN2 A;  2V8C A;  1DP9 A;  1ERM A;  4IUH A;  5FAO A;  4MMN A;  1UGU A;  3HLG A;  3KYE A;  2ZQC A;  4R4S A;  1FCN A;  5CGS A;  2P08 A;  1KE4 A;  3IXH A;  5FI2 A;  3BEC A;  3N8S A;  1ES2 A;  2HP5 A;  4E6W A;  4OLD A;  4QPR A;  3C4P A;  3SOI A;  2IA2 A;  5TFQ A;  5F69 A;  4X1L A;  2J9P A;  3CWF A;  4EER A;  2V0U A;  4HH2 A;  2FFF B;  2R9X A;  2QPN A;  3LGO A;  5M1A A;  1NYY A;  3BLM A;  4O0P A;  2PU4 A;  2XFT A;  1W5D A;  5DKL A;  5FI7 A;  4D2O A;  1JTG A;  4KEN B;  1UWN X;  1YLW A;  3OCL A;  5DF9 A;  1W63 Q;  3CPT A;  1VHM A;  2ZQ8 A;  3UDF A;  5I94 A;  3ZNT A;  4RYE A;  4KZ8 A;  3BY8 A;  1LSV A;  1HTZ A;  2VV6 A;  2XF3 A;  2GDN A;  3VFH A;  2I9V A;  5HPF A;  4LRZ E;  1NRF A;  2XFS A;  4E3M A;  5DJT A;  5GLB A;  3PBR A;  3MS6 A;  5DF8 A;  4EU0 A;  1KGE A;  4LFU A;  1LHY A;  3C8C A;  3TW8 A;  4UQI S;  4K08 A;  1OTB A;  5AQ7 A;  3LR5 A;  5HAI A;  1BTL A;  2KX6 A;  4HES A;  4Y13 A;  2WYX A;  2Z2M B;  1VB6 A;  4OOM A;  4KG6 A;  3MFD A;  2Z2L B;  1G6O A;  2H0T A;  5F6A A;  3PBQ A;  3DW0 A;  2JCH A;  5EVI D;  3NEC A;  5D3O A;  1W8Y A;  3OBF A;  4BJP A;  4OQH A;  3SS4 A;  4N1X A;  1SDN A;  4BL3 A;  3HLF A;  4OP8 A;  1GHP A;  4IBR A;  5J7E A;  1XA1 A;  3O86 A;  2VJW A;  3VOY A;  1IEL A;  1H5X A;  1GCE A;  2O9B A;  3O87 A;  3OPH A;  5HWW A;  1PW1 A;  3RH8 B;  2PYR A;  3MXR A;  3UB8 A;  2W3H A;  4NXB A;  4DDS A;  3HLW A;  4FSF A;  3BFC A;  4BBT A;  4GJ4 A;  4L9E A;  3ZDJ A;  1BLH A;  2ZC5 B;  3H82 A;  4WN5 A;  2PR6 A;  3IF5 A;  3OLO A;  4PM5 A;  2IWB A;  1SKO B;  2V1A A;  1IKI A;  2Y2O A;  5FAP A;  2WKE A;  2P9V B;  4O7D A;  2QKP A;  1MWR A;  3ITA A;  3DTE A;  3FC7 A;  1K55 C;  2EWW A;  5EVI C;  1L0G A;  4O8G A;  4KZ3 A;  2M7V A;  4Y2F A;  3LI8 A;  2FZ0 A;  1K54 A;  4X6T A;  3IF6 A;  2JKF A;  4ZBE A;  4EBP A;  5HD3 A;  4JF5 A;  4WLA A;  2CC1 A;  4E3O A;  1YM1 A;  4GS9 A;  1ES3 A;  5FQ9 A;  1DP8 A;  3IS2 B;  3V3R A;  3WS4 A;  3IT9 A;  5DKK A;  1FOF A;  4I39 A;  3R7W B;  3EGX C;  1VEU A;  2V2F F;  4U3T A;  2G7U A;  3HVF A;  1TS6 A;  4Y0O A;  2ZC3 B;  2VGK A;  1EWZ A;  2VA0 A;  3UN7 A;  1C3B A;  4XT2 B;  5TGF A;  3D9Y A;  1NZO A;  2J3W A;  2PD8 A;  1VEU B;  1E3U A;  4EQ1 A;  5EV0 A;  1PWC A;  2WAE A;  3ZHH A;  3CUE A;  2B5R A;  1BYW A;  1SKO A;  2VX8 A;  3CIT A;  2B18 A;  2P9V A;  2J9O A;  4LCL A;  5IT5 A;  4I38 A;  4Q8I A;  1MBL A;  4JXG A;  1XX2 A;  1F98 A;  3A3E A;  4Y0U A;  3HLE A;  4EEU A;  2WGV A;  2OAQ 1;  2X02 A;  2Y2H A;  4R0Q A;  4HBU A;  2Y2P A;  4JGO A;  5KSH A;  4DDY A;  4DRT A;  3VP2 A;  3LUQ A;  1NYM A;  1CJF A;  3EEA A;  1EW0 A;  4ZJ1 A;  2QHK A;  2L4R A;  4DJ3 A;  3A3J A;  2LB9 A;  4MBF A;  1K6S A;  5DJU A;  3LIF A;  2ZLY A;  3N7W A;  4N1H A;  4ZAM A;  3VP4 A;  2C6W B;  1Y4O A;  3CI6 A;  1NXY A;  4JF6 A;  4MDZ A;  5CHJ A;  4BEN A;  3NOT C;  1CI8 A;  2M7U A;  1PZP A;  2WZZ A;  5CXW A;  1BLS A;  2W3D A;  5EM0 A;  3MXS A;  4JLF A;  1Y28 A;  2HDU A;  4HH3 A;  2EX9 A;  1VET B;  2H28 A;  3HJI A;  3TJZ C;  4RQ9 A;  2W0N A;  4WM9 A;  2EA9 A;  1KDW A;  3ZCZ A;  4C75 A;  3R4K A;  4KZA A;  4ETZ A;  3Q82 A;  2R9W A;  1LI9 A;  3QP6 A;  4GZB A;  2ZQ9 A;  3WS2 A;  5FI6 A;  4CPK A;  4C3Q A;  4BMW A;  1XFQ A;  3A3F A;  4CLC D;  2WKI A;  1ZTU A;  1CEF A;  5J4E A;  5A93 A;  3WS0 A;  2XH9 A;  4DE3 A;  1HZO A;  3ZG8 B;  3DBA A;  1F5M A;  3IWI A;  1UWP X;  2K2N A;  4N9L A;  3T1S A;  2C5W B;  1NRJ A;  3NY4 A;  2QJ7 A;  1IYP A;  2O99 A;  2PU2 A;  2XR0 A;  4PHT A;  4F3L B;  4OPZ A;  2WAF A;  4CJN A;  4BLM A;  3NI9 A;  1S4S A;  2B02 A;  3H7W A;  2Y91 A;  1NWZ A;  3GSG A;  3PBN A;  5M19 A;  1XFN A;  2EWV A;  1FSW A;  3C2W A;  4B88 A;  3OC2 A;  4GD6 A;  1QMF A;  2YKH A;  3NDE A;  5HWV A;  4I3A A;  2Y59 A;  4Q0I A;  1T18 A;  4MCW A;  1LT0 A;  1OTD A;  3B33 A;  5EM1 A;  4JBF A;  2BAS A;  5AVE A;  1LL9 A;  5DTS A;  2ZQ7 A;  3SS3 A;  2DMW A;  4ZTK A;  4BBV A;  5E2E A;  3BYD A;  4XUZ A;  2Y2I A;  4KQO A;  5HAQ A;  3RTY A;  4R70 A;  1FQG A;  1W79 A;  4BBU A;  3UNW A;  3MQO A;  1OJG A;  2ZOI A;  2QZ6 A;  4N92 A;  3PBO A;  5KMW A;  5FQI A;  3HCY A;  4OP5 A;  3E4O A;  3U4L P;  2P74 A;  2XEP A;  4JXV A;  3UB5 P;  2PYP A;  3NUL A;  4IVI A;  5MC7 A;  3VMA A;  3BLS A;  1XJ3 A;  2E8I A;  1W7F A;  4PAU A;  4FD8 A;  5HDS A;  3S7P A;  4KUK A;  4JPM A;  4ZJ3 A;  4AFI A;  1N4O A;  2JBF A;  4OQG A;  2DNS A;  1HLU P;  3G4P A;  1GA0 A;  2XLN A;  3Q7V A;  4KUO A;  3T4O A;  4HP9 A;  3GRJ A;  3G6O A;  1QME A;  1ACF A;  1TS8 A;  2Z6D A;  1WE4 A;  4MN7 A;  3CG5 A;  4S2N A;  4GHI B;  1T19 A;  2ZQD A;  3T4T A;  4LV0 A;  3C5A A;  3Q7V B;  2PBD P;  2VGL M;  4EBL A;  2M1C A;  3C7V A;  3CHW P;  4P6B A;  3LIA A;  3E4Q A;  3V5M A;  2ZJ9 A;  4IJG A;  5HSQ A;  2ZQA A;  5IU1 A;  1KGG A;  4H6J B;  4DE2 A;  4ARZ B;  2EXA A;  4ZJ2 A;  4L9G A;  5E2H A;  1S4R A;  2J3T D;  3IF6 C;  3IX8 A;  3IWO A;  4GS9 B;  1Y54 A;  4YNR A;  4KQQ A;  5L10 A;  5FQQ A;  4FCF A;  2WKQ A;  2PR5 A;  1T1A A;  3NIA A;  2BLS A;  1W8Q A;  4EWF A;  2HJE A;  3LYX A;  5EOO A;  2WAD A;  2HPB A;  4YWZ A;  4DXC A;  4X55 A;  3W4Q A;  1MPL A;  1CI9 A;  3T12 B;  4UA7 A;  4UHU A;  3GV9 A;  4GD8 A;  3UE6 A;  1XPB A;  4MBH A;  4NXF A;  1MWT A;  2JKR I;  3IBJ A;  3W4P A;  4NK3 A;  4QHC A;  3IH9 A;  3T1X A;  3HLD A;  3M6B A;  4KZ4 A;  4WMC D;  2O0Y A;  2JE5 A;  1OJ5 A;  3TSG A;  3VP0 A;  1ALQ A;  1ZG4 A;  3PBT A;  5L07 A;  2XD5 A;  1MWS A;  1P0Z A;  1TVF A;  4BL2 A;  4CQH A;  5A91 A;  1XP4 A;  5FQJ A;  5FEF A;  3BEB A;  3MFX A;  2OSU A;  5EOE A;  2ZM8 A;  1SCW A;  4KZ9 A;  2BG1 A;  4Q0H A;  5CER A;  4YFM A;  3C30 A;  4E3L A;  1YMS A;  3LIC A;  5BOH A;  4KQR A;  3EQU A;  2Y2Q A;  5KSC A;  3VFF A;  3P98 A;  5CTM A;  1KDS A;  3PXP A;  2Y4A A;  1JWV A;  3KO6 A;  5CHM A;  4R1G A;  3DWZ A;  1L2S A;  3MR0 A;  4DXB A;  3MXQ A;  3M6H A;  3R7W A;  4QB8 A;  3ZG5 A;  3QHY A;  1FCO A;  1KVL A;  3KSI A;  1I2S A;  1ODV A;  3EGD C;  4NXE A;  3IH8 A;  4YIN A;  5DTT A;  2KDK A;  1K0K A;  3BW6 A;  4WBG A;  1K55 A;  1OME A;  4UEY A;  2D02 A;  2XA7 S;  4G3K A;  3N6I A;  3TG9 A;  4IHQ A;  5HZH A;  1MZU A;  1L0F A;  4I3J A;  3PHY A;  4P85 A;  1FR1 A;  3B47 A;  1PIO A;  1I5Q A;  1DY6 A;  4EBN A;  5FAQ A;  4IED A;  3DTM A;  3LR3 A;  3Q7Z A;  4K91 A;  4NG2 A;  2Q0O A;  4JGP A;  4NXG A;  1HVB A;  1LI0 A;  1E3U D;  3IXG A;  3LY3 A;  3OPL A;  4R4R A;  4OQI A;  3G34 A;  1CK3 A;  2ZBB A;  4CLC C;  3QP5 A;  1ES4 A;  4IBX A;  3UPO A;  5F1F A;  4HBT A;  4BD1 A;  4R23 A;  1YT4 A;  1VET A;  2A24 B;  2JKG A;  1HD8 A;  4MEZ A;  1ZKJ A;  3ITB A;  4P0M A;  3QNB A;  3E2L A;  1PNE A;  2V20 A;  1S1Y A;  2WGW A;  1PZO A;  4HIA A;  2JKT I;  5F5Y A;  3KSG A;  3MZE A;  3MZD A;  3Q07 A;  2WKR A;  4JGR A;  5L8M A;  1M6K A;  1U60 A;  2XK1 A;  2G2U A;  3EQV A;  4Q0J A;  1NLZ A;  1PFL A;  4II7 A;  3SH8 A;  2EX8 A;  4N9K A;  3B3X A;  2JC7 A;  2KOI A;  1NLY A;  4X69 A;  3VP1 A;  3RXX A;  4NEE D;  5FQM A;  4LV1 A;  3UME A;  3NCK A;  3G2Z A;  5HPI A;  3PYP A;  5GLA A;  4KZ6 A;  2INW A;  2PDR A;  3T1R A;  1GA9 A;  3PAG A;  1K54 C;  2OOL A;  2X71 A;  4GB7 A;  1ESU A;  4PPR A;  2XRO A;  3RJU A;  5AQB A;  2CMN A;  4KQD A;  3GDI A;  2K7S A;  3Q81 A;  2K31 A;  3KYQ A;  5DF7 A;  3UDI A;  4X56 A;  3NJA A;  4LV3 A;  4RX2 A;  2VLG A;  3C4O A;  3DTI A;  4ZDX A;  4P6Z M;  3O3V A;  2GNX A;  4PMA A;  4ESP A;  1K56 D;  1LL5 A;  2OWH A;  1K56 A;  2QMI A;  2Y55 A;  3OZH A;  5AQA A;  5I5L A;  3F1P A;  5HX9 A;  1PI5 A;  2DCF A;  2J7V A;  3UPN A;  2E8J A;  3NOU C;  2OWJ A;  1OTE A;  4QY6 A;  5HL1 A;  3FG8 A;  1BSG A;  1E25 A;  1OPX A;  1LSW A;  2D01 A;  2NUP C;  5CEB A;  1IFQ A;  2Y8H A;  4I5S A;  3NC8 A;  4KZB A;  3LID A;  4HHD A;  3QP8 A;  3A0V A;  2WZX A;  1H8Y A;  1F2K A;  1BT5 A;  2ZD8 A;  4HP4 A;  2BTF P;  1GSW A;  3N8R A;  4WEK A;  4EW7 A;  4EES A;  4OPY A;  4DN0 A;  4XUX A;  1S1Z A;  3BFE A;  5HAP A;  3HUM A;  1ZG6 A;  4R6L A;  3LEQ A;  3ZNY A;  1V9Y A;  1S66 L;  2HF6 A;  4U0X A;  4Y5F A;  5GLC A;  4MNR A;  4QY5 A;  3G30 A;  2HGV A;  2ACG A;  3H9W A;  1J9M A;  3VE3 A;  2ZC7 A;  1TEM A;  3E98 A;  3BWL A;  3BFF A;  5FAS A;  4U0T A;  1N9B A;  2W3E A;  3C7U A;  4P6Z S;  3Q1F A;  1Z09 A;  3T4K A;  4ZRR A;  5AQ9 A;  2ZL1 B;  4B4Z A;  3ZVT A;  2HDS A;  1N9O A;  1IEM A;  4F94 A;  3G31 A;  1IOU A;  1S0W A;  5CGW A;  5G4Y A;  3WRT A;  1BLP A;  1VQQ A;  1KOU A;  4WEJ A;  1ERQ A;  5GHY A;  4S2N C;  4MBK A;  2VK3 A;  1TF1 A;  3NOP C;  1TS0 A;  3LCE A;  1YLJ A;  2RL3 A;  5EPH A;  4EUZ A;  5HW3 A;  4OH0 A;  3MBZ A;  1DJC A;  3VSK A;  4JXW A;  4PM9 A;  3VE4 A;  5TR7 A;  2VKS A;  4GCZ A;  3EWK A;  2XGN A;  3MSH A;  4S2M A;  3IWQ A;  3T4J A;  4LV2 A;  4OON A;  3UPP A;  3CMZ A;  1FCM A;  1ONH A;  3D4F A;  1STZ A;  3S7Q A;  3W4O A;  4LGW A;  4WZ4 A;  4PM7 A;  3FYZ A;  3BM6 A;  1VM1 A;  4WF0 A;  3N4I A;  2A49 A;  5FQK A;  1LL8 A;  1H8Z A;  3SH9 A;  1NZU A;  2JHE A;  1N9N A;  2DRW A;  4LLO B;  3UO9 A;  3LR4 A;  4F3L A;  4H6J A;  1MC0 A;  2IWD A;  3H7W B;  4S2J A;  3LY4 A;  2JKR M;  2O9C A;  3IHA A;  3G2Y A;  4QWO A;  1YQS A;  1KGF A;  2WK0 A;  4S2L A;  2VV8 A;  1DRM A;  3ISG A;  4LRX C;  3PR6 A;  4Y0T A;  1AWI A;  4JKT A;  4R3A A;  5FEG A;  3CLO A;  5AVF A;  1CQA A;  1ESI A;  3WS1 A;  5CGX A;  4DJ2 A;  3DWK A;  4X53 A;  4ID4 A;  5DVA A;  3O5Y A;  1N9L A;  3MQ0 A;  3ZFZ A;  4DMZ A;  3O88 A;  5FDS A;  4GOG A;  3L9K A;  1K25 A;  5G4Z A;  2H10 A;  4HJ3 A;  5EVL A;  3E0Y A;  1YLY A;  1KVM A;  1G28 A;  3A3D A;  4K0W A;  4L9F A;  4E3K A;  3M2J A;  1IKG A;  2L0W A;  4FTX A;  3RFB A;  1A0K A;  5K5B A;  4HOI A;  4CLC A;  5TJJ A;  2Y2K A;  3EOI A;  4G3V A;  3F1N A;  4GHI A;  2V1Z A;  3UB6 A;  2W1T A;  3LI9 A;  5EE8 A;  2XQZ A;  1PYY A;  4S2I A;  1MKI A;  4OPR A;  3OOV A;  1BLC A;  5HDC A;  3SW1 A;  2QYB A;  2V9A A;  3ZG9 B;  2HP9 A;  1T1B A;  2G2W A;  3LIE A;  1H8M A;  1P97 A;  1XXM A;  4OOY A;  5GHX A;  3LEZ A;  3RXW A;  1SKF A;  1Z6F A;  1YLZ A;  3KYZ A;  4EXO A;  4WZ5 A;  4X68 A;  3S7N A;  3NDG A;  1G6A A;  4OLG A;  3GEC A;  4O01 A;  3MKE A;  4OOL A;  4MN5 A;  3CUE C;  3BY9 A;  5HAR A;  2ZOH A;  4FOF A;  2PT7 A;  5DFY A;  3P09 A;  5CEC A;  1BUE A;  3NBL A;  3HLC A;  2ZC4 B;  2Y2M A;  2W27 A;  3IHB A;  2EX6 A;  3FKW A;  2PHY A;  1MKM A;  3KSF A;  4M4X A;  2OAP 1;  4G3W A;  1YMX A;  3F1P B;  1TD5 A;  1TS7 A;  4B9O A;  4I3I A;  2WGW B;  1WYC A;  4FH2 A;  3UB7 A;  3A3I A;  3F1N B;  3SH7 A;  3K3D A;  4ME4 A;  2V0W A;  4Y3I A;  4HY8 A;  2Y2N A;  5EVE A;  4HEF A;  1OTI A;  1RCJ A;  4JXS A;  1IYS A;  4KZ7 A;  5KZH A;  3FV7 A;  3HJK A;  1KE0 A;  5U47 A;  4A5R A;  4E3I A;  2PD7 A;  3IF6 B;  4B4X A;  5FL3 A;  3LIB A;  3T4S A;  4S2P A;  1K6R A;  4CLC B;  2H5S A;  3LO7 A;  5CRF A; 
#chains in the Genus database with same CATH homology
 1L3L A;  3SZT A;  4LGW A;  5L09 A;  3QP6 A;  4LFU A;  3QP5 A;  1H0M A;  3QP8 A;  2UV0 E;  3IX8 A;  3QP4 A;  3QP2 A;  4Y17 A;  4Y13 A;  4NG2 A;  2Q0O A;  4Y15 A;  2AVX A;  3IX3 A;  5L10 A;  3QP1 A;  5L07 A;  3JPU A;  3IX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...