3IX4A

Lasr-tp1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
GFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords Transcriptional activator protein lasR
total genus 52
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix4A00
1H0MA 5L09A 4NG2A 5L10A 1L3LA 3IX3A 4Y15A 3QP6A 2UV0E 4LGWA 3QP8A 3QP1A 3QP5A 4LFUA 4Y17A 3SZTA 2Q0OA 3JPUA 3IX8A 3IX4A 3QP4A 2AVXA 5L07A 4Y13A 3QP2A
chains in the Genus database with same CATH superfamily
4WL9A 3D72A 1PZPA 1ERQA 3LCEA 5FAPA 3DTIA 1LHYA 5HX9A 3E4OA 2G7UA 4NETA 5HAPA 5E2HA 1N9BA 5KIZA 1L0FA 1L2SA 5U47A 3E98A 4G3VA 3S22A 4K0WA 4S2NA 2JKRM 1IYSA 1F98A 1F5MA 1Q2PA 4NXBA 1CI8A 4NXEA 4HOIA 4E04A 2PBYA 5DJTA 3LY4A 5TBMB 3PR6A 2ZM0A 2GZAA 3QP2A 2GNXA 4I39A 4BBUA 3GV9A 3A3IA 4PM7A 1L3LA 2A24A 2VV7A 1Z6FA 3QP6A 1KE0A 3LIBA 4OVDA 4OONA 4HBUA 1TVFA 3FKVA 2JC7A 1MWRA 3ZNTA 3VP1A 2Z6CA 4OP8A 2Z2LB 4HY8A 3VV4A 2VK3A 4U0XA 3VP0A 1GHIA 3IWQA 3N4IA 1T1BA 5F69A 3WRZA 1K57A 3N8SA 3QP4A 3UB5P 2EA9A 1ZG4A 5EFWA 3HLWA 2E8JA 4N1HA 3T4QA 1K25A 3PYPA 4L9EA 5AJGA 1BZAA 2ZC5B 3SH8A 4PM6A 2MJ6A 3E0YA 4UA6A 4IBRA 3B47A 4IVIA 2JCHA 4DE2A 4QY5A 4D2OA 5J3WA 4RA7A 4S2LA 2V2FF 1JTGA 4KQQA 2CC1A 4DF6A 2WKRA 4MCWA 4KG2A 4PKYA 4WELA 3KYEA 5F82A 5A8BA 3CHWP 2VLGA 3ZGAB 1A0KA 3F1OB 2EFXA 1ES2A 4JKTA 4ZJ3A 1P9RA 4LV2A 1MWSA 3HCYA 4HESA 4OQGA 3KSFA 1YLWA 4JGOA 3K2NA 1YMXA 4IEDA 3HUNA 1SCWA 4I3IA 3MFXA 1S66L 3KSIA 4OOMA 4CLCA 3ZQ5A 5G4YA 1MPLA 4CQHA 4DRTA 4S2MA 3HBRA 3NDGA 3OC2A 2NUTC 4UA7A 3BQAA 1VQQA 3HLEA 4Y15A 2UV0E 3VSKA 5J4EA 1LSVA 4EQ1A 2EX9A 3P7NA 2ZL1A 5HWWA 1FSWA 1GCEA 1K4EA 4GOGA 2Y2NA 3G4PA 3KX0X 5FDHA 2QKPA 4FOFA 1HD8A 1XP4A 4R3BA 4JXSA 2ZOIA 1Z09A 2FH5A 5CECA 5FDSA 2JHEA 4ZBEA 2EXBA 1STZA 2XQZA 3MKFA 2XDMA 1TDGA 2BTFP 1YQSA 4KZBA 2A49A 2EX2A 3T4KA 3G35A 1S1YA 2BLSA 1GHPA 3VMAA 3UB6A 1CI9A 4EEUA 3IF6A 2EXAA 4Y0TA 1S4RA 3KO6A 4EETB 4KZ7A 3LUQA 5L09A 1P0ZA 1PFLA 3C8CA 2A3UA 4WM9A 5FQJA 2P9VA 1MBLA 5HL1A 4UQIM 1Q2QA 1XFQA 4BJPA 4LFUA 1H3QA 1CQAA 3W4QA 3IXDA 5HDSA 2WGWB 3IS2A 3HLBA 2XEPA 3S7OA 2ZL1B 3MF0A 3O5YA 4X6TA 1I5QA 3NDEA 2WKQA 5EE8A 3MS6A 3Q81A 2ZOHA 3G2YA 1NLYA 5EOEA 3F1NB 1GA9A 5KSHA 5CGXA 1IYOA 2IWBA 2ZBBA 5GLAA 1SZVA 3VE3A 1N9NA 5M19A 5A90A 3M2KA 5C5KA 4R6LA 4PM8A 4GD8A 3OBFA 5D3OA 1AXBA 4IJGA 1K38A 2EFUA 2B02A 5CGSA 5FAQA 4EEPA 3T1RA 3EOIA 5CXWA 1DP9A 1N9OA 1ZHHB 1ZC2A 3B42A 3MFDA 2HDRA 4KZ3A 1OMEA 3PBSA 1GSXA 1XPBA 4Z1WA 1T18A 3A0SA 1IKIA 1D1JA 1RCJA 5EVIB 4KG6A 3IX8A 3PTEA 3QNCA 1QMFA 3T1QB 3FYZA 1ONGA 5HARA 2HDSA 4X1MA 1P9WA 3UDIA 4JXWA 2ZM8A 3F1PB 3V5MA 4QPRA 3EGDC 2IWCA 1TD5A 3HLDA 5BOHA 5IT5A 3SH9A 1XKZA 3JYIA 4G3WA 3ICYA 1E3UA 5CEDA 2JN7A 4ME4A 2OV5A 3BYDA 4PHTA 3ZHHA 2HJ9C 4KQRA 4ID4A 4CLCB 3CG5A 4BBVA 1LI0A 5L8MA 3BLMA 4E3LA 4OQHA 5KSCA 2WAEA 2Y2KA 4Y0UA 1PZOA 3UB8A 3OLOA 5F1GA 3QP8A 3VOLA 2GJ3A 1FCOA 1OT9A 5DFYA 3BFCA 4QU3A 3BW6A 4OH0A 4GDBA 2Q0OA 2OAP1 1DJCA 2XA7S 4GHIA 4XXRA 3K3CA 2PBDP 3UE0A 4UEYA 1KDSA 2RCXA 4ESPA 4MLLA 2VGLS 3TJZC 4PM9A 5FA7A 5HW3A 4KG5A 4OP5A 3BFDA 4LV3A 2JBFA 3KSHA 2ZC7A 2Y59A 3M6BA 2QWSA 3AGDA 4GJ4A 4MNRA 1J9MA 2A2LA 3VFFA 4DDSA 5EVID 4HBTA 5EECA 2V1AA 2QJ5A 4GZBA 4OLDA 5FSRA 3MMHA 3G32A 1CJFA 1XXMA 2M7UA 4H6JA 4Y13A 3UB7A 4EU0A 3EWKA 1MWUA 4PMAA 4LENA 2DCFA 2K2NA 1S67L 3ZCZA 2W1RA 1GSVA 1N4OA 4GS9A 2O9AA 2DRWA 3UE3A 3UN7A 4OQIA 4I5SA 2HDQA 4X25A 1FQGA 2UWXA 4R4RA 3VE4A 3PAEA 5M18A 3CAXA 2W0NA 5F5YA 5K5BA 2G2UA 5FEGA 1LT0A 4Q0HA 4JLFA 2Y55A 4DE3A 3HLFA 3AGEA 3GTCA 1OT6A 3SS3A 1NYYA 1Y28A 3MZEA 2WK0A 1LL5A 3RH8B 2HZ5A 5FQ9A 4I38A 4DE1A 4DE0A 5FATA 1KE4A 1XGIA 3B33A 4MBKA 1ACFA 4ARZA 3HJIA 2YKFA 4Y0OA 4K91A 3GVBA 5HDCA 3T4TA 3A3EA 5G4ZA 5EVIC 5EVLA 4Y2FA 3NOPC 4H6JB 1IFQA 1OTDA 3S7NA 2XLNA 4RVAA 4E3IA 2WGIA 2PDRA 3KYQA 3Q07A 4DMZA 4DN0A 4WMCA 3UMDA 1LSXA 1FR6A 5FI2A 2WADA 1G6AA 2FFFB 5I5LA 1FCMA 1PI4A 2EWVA 1H8MA 2L0WA 4EERA 3IH8A 5EPHA 4D60A 3SW1A 3H7WA 3BRMA 2H0TA 4LRYC 3R7WB 3WS4A 2X02A 5HAQA 1NZOA 1F9IA 3VFHA 3TSGA 3IF5A 1NWZA 1YMSA 2ZJ9A 3C30A 4Y5FA 5CTNA 3NC8A 3CLOA 1NXYA 1XX2A 4GDNA 1ZG6A 5L07A 4EBNA 1XGJA 1L0EA 4ZRRA 1BYWA 3CPTB 4Q0JA 4EV4A 2XGNA 3QHYA 3C5AA 2E8IA 4LLOB 2I72A 2P9VB 2VKSA 1ESUA 2QPNA 1HLUP 2BASA 5EOOA 3A0VA 3V3SA 3PHYA 2OAQ1 1KVMA 4BMWA 2VZWA 4B4ZA 5DTKA 3IXHA 3NY4A 2YKHA 4EQIA 2XFTA 2M7VA 1DJAA 3N8RA 2XRNA 4JXGA 4MDZA 3Q1FA 2ZQ7A 4HQAA 3ZFZA 4S2IA 5HWTA 5DFXA 3BQ8A 2QJ7A 4DJ3A 4GNUA 5EV0A 3NCKA 2WZXA 3T50A 3OPPA 4QJGA 4QHCA 3CUEC 5HL6A 2P04A 1YPRA 5G18A 1XJ6A 5CGWA 4B93A 1DY6A 3LGOA 3MR0A 5HPIA 4HJ4A 5CEBA 2KLIA 1YT4A 1H8ZA 2LB9A 3PBNA 4ZTKA 4OKPA 1NLZA 2I9VA 3IS2B 2B95A 1E25A 2KOIA 4QY6A 4EWFA 3A3DA 4CPKA 1LLBA 4S2KA 1DP8A 3JVVA 5FI7A 1BSGA 3N7WA 1S4SA 2P74A 1KGEA 1ODVA 4E6WA 2B5RA 1YSQA 5A92A 1IOUA 1D06A 3SOIA 3C4OA 4DDYA 2FFYA 4C75A 3IXGA 3NHQA 2C6WB 3A0RA 4GW9A 3LO7A 4JXVA 4EUZA 3S1YA 4LV0A 1Y54A 4FTXA 4HNBA 1W8YA 2QHKA 3T12B 4S2JA 4RQ9A 3OPHA 5HWVA 2K7SA 1W63Q 3GR2A 1DJBA 1KGGA 4KZ8A 1HVBA 3FC7A 2JKGA 4L9FA 3HLCA 4R1GA 3ULFA 4WUJA 5CERA 1BTLA 4L9GA 4HJ6A 1YM1A 3MZFA 4OPYA 4OPQA 3ZG0A 5L2FA 3V50A 3FKWA 2M1CA 4U0TA 2JE5A 1ONHA 3ITAA 3H82B 4IHQA 3O3VA 4HH3A 1ZKJA 2O9BA 4MBFA 5CHJA 1OTAA 4HHDA 3HUOA 2CMNA 1NZUA 3MJQA 4F94A 1OTEA 2V20A 1ZTUA 3HREA 1PW8A 3D9YA 3OZHA 4HP4A 1KDWA 4ZJ1A 5GLBA 1IYPA 2WGWA 1VETA 3ZG7B 2V0UA 4X68A 3CZDA 2ZMVA 3Q7VA 1SKOA 3M6HA 1FSYA 3ZVTA 5EUAA 3GDIA 4N92A 2ZQAA 1JWZA 3BLSA 1ALQA 2IA2A 1W5DA 1TEMA 2W3HA 4KZ4A 3DWZA 2RL3A 4S2OA 1FR1A 2Z2MB 3F1PA 4C3QA 4P87A 3T4JA 4KZ9A 1VEUA 4O8GA 1TS6A 1SKFA 4LRZE 4WZ5A 1JVJA 3S7QA 3RJUA 3HJKA 4NXFA 4GKUA 3MBZA 3LYXA 2ZM2A 3IF6B 2D01A 2Y2QA 1JTDA 3T4OA 2ZQ8A 1EI5A 3IBJA 1H5XA 1NY0A 1FCNA 1KOUA 2HP5A 4LPZA 1OJGA 3DTMA 3EQVA 5CHUA 4CLCE 1H8YA 1YLTA 5HFOA 1SKOB 3BEBA 3R7WA 2L4RA 4JF6A 5DF7A 1DP6A 4MMNA 1K55C 2QMIA 4KUKA 4B9OA 2GX5A 4FCFA 2HV1A 1PWGA 2Q9NA 4KZAA 5HDDA 3LR5A 3EQUA 1K6SA 2WAFA 3BY8A 4BENA 3GMWA 3E4PA 3RTYA 2HP6A 2OSUA 4K0XA 2C5WB 5IS1A 3OPLA 2L1MA 3FPVA 3MXRA 5GHZA 4E3JA 3VOZA 2X01A 3CWFA 3IX4A 1TS0A 3GQZA 4WEJA 4R23A 4WEKA 2PU4A 3DBAA 4ZAMA 5KZHA 3PBRA 3G30A 2PAVP 3MZDA 2HF6A 1PWDA 4XT2A 5KMWA 3TW8A 3R4KA 2OLVA 4OOLA 1BLCA 4S2PA 4Q8IA 1TS7A 1V9YA 2W27A 2W3DA 5DF8A 4EESA 2W3EA 2VX8A 1YLYA 4HJ3A 1JWPA 2VGKA 1GA0A 1QMEA 3TRCA 3T4SA 5F1FA 1FILA 5AVFA 4E3KA 3C2WA 3IT9A 2XK1A 4B88A 3CUEA 3OCLA 3GRJA 3DW0A 1YLZA 3FG8A 2IWDA 1NRFA 4YFMA 3ZNYA 4KQOA 4K08A 1ES4A 3HLGA 5AQ9A 2XF3A 3WS1A 3SH7A 3IX3A 1HZOA 2PR6A 4OOYA 5TGFA 4P0MA 2V8FA 3QP1A 3QP5A 2V1ZA 4R38A 1EROA 5IHVA 4EXOA 3L7HA 3MKEA 2VV6A 2DMWA 2V0WA 2ZMFA 1TDLA 4M4XA 4WYYA 4EBLA 5CRFA 3CJMA 4E3OA 4RX3A 2Y8HA 4M3KA 1E3UD 4L0LA 2HP9A 3NULA 3B3XA 1S6RA 4IVKA 2PT7A 4YOFA 4CLCD 1U60A 1CEGA 4C6YA 2J3WA 3F1OA 2PYRA 1YSPA 4LRXC 1GHMA 2Y2JA 1GSWA 4P6ZM 2EWWA 1T1AA 1K6RA 3C4PA 3G34A 4YWZA 1BLHA 5GHYA 1VEUB 1VHMA 3I7JA 5GLCA 1XA7A 3U2AA 2OWHA 1KE3A 1LL8A 4WF0A 5FQMA 1WYCA 3DAVA 1K56D 2V8CA 1MC0A 3HL9A 2AVXA 4BL2A 3IWIA 4PKYG 3WS2A 4GLQA 3D3OA 3D4FA 4E3NA 4R70A 4JBFA 4DXBA 1LI9A 3P09A 4XUZA 3O87A 3HUMA 3TE8A 3UE6A 3OPRA 2HPBA 1IYQA 4BL3A 2JKTM 3UY6A 1XJ2A 1W63M 4LV1A 2Y79A 1VETB 3V67A 1UGUA 2B18A 1KVLA 1G68A 1J3WA 4RYEA 4BD1A 3RXWA 4NXGA 1PNEA 2PD8A 4X55A 2Y2MA 2J7VA 4BWIA 5J7EA 5I94A 2WZZA 3BJNA 1JNUA 3MQOA 3BY9A 4MBHA 2Y4AA 1EW0A 3TOIA 4JGQA 5HD5A 4IBXA 4OPZA 4R4SA 3EEHA 3T4LA 3LFVA 1NRJA 4ARZB 2XSSA 3TG9A 3UB9A 1K4FA 1P97A 1BUEA 3T1SA 3SZTA 1PI5A 1NYMA 1F2KA 1YLJA 3L9KA 2H28A 4RX2A 4KZ6A 3NIAA 3GECA 4Z9QA 4MN6A 4N1XA 1ES5A 1N9LA 5E2GA 1ERMA 3DTKA 4XT2B 3IHBA 3M2JA 3PXPA 2XROA 2LB5A 4QD4A 3LI9A 5GHXA 1EWZA 1MKMA 1T19A 4JGPA 3OOVA 1RP5A 5TFQA 3IF6C 4HEFA 3LEZA 4OLGA 2ZQ9A 3CITA 5IU1A 1G6OA 1I2WA 4WZ5C 3H7WB 2Y2GA 3ZG9B 1D7EA 3V39A 4KZ5A 1OPXA 2PRFA 3KYZA 2Y2OA 5F6AA 1O07A 4A5RA 3NBLA 1WA9A 1YLPA 5E2EA 1S1ZA 1E4DA 3QNBA 3NECA 2J8YA 3RXXA 4KQDA 4ZDXA 3E2KA 3LR0A 4JPMA 4H8RA 2HJEA 5A93A 3IWOA 3EEAA 1AWIA 5CX7A 5F68A 3MXSA 1JWVA 2ZLYA 2Y2IA 3JVUA 1TF1A 4P6ZS 1K0KA 5A91A 2PD7A 1XJ3A 1K55A 5AVEA 3FZCA 4N9LA 3UPNA 2PYPA 4CJNA 1KGFA 4LGWA 3N6IA 3O88A 1MKIA 4O01A 1DRMA 1M40A 3LY3A 5J8XA 3DTEA 4UA9A 4HIAA 5EVIA 2ZC3B 3PAGA 4BQMA 4GCZA 4II7A 2FZ0A 3W2ZA 3BECA 4I3AA 1PIOA 1RGYA 3FPWA 2PU2A 3UDFA 2ACGA 4Y17A 3UNWA 1WE4A 2XA7M 3MQQA 2HGVA 3A3JA 1SDNA 5E43A 2VJWA 2J80A 3NJAA 1ES3A 3WRTA 1K54C 1L0DA 4U3TA 1M6KA 3LIDA 5AQ7A 5FI6A 2ZC4B 1LL9A 2EX8A 2Y91A 2OLUA 3HVFA 4P85A 5DF9A 4NKPA 1V9ZA 1SDEA 4FUWA 4MN5A 5DKLA 2O9CA 5F83A 1W8QA 2WKPA 2BG1A 4Q0IA 3P01A 2NUPC 1BLSA 1OTBA 1OTIA 2XFSA 2WYXA 3FWLA 4BBTA 5GLDA 2ZC6B 4O0PA 2WGVA 4WMCD 5FQQA 5HSQA 3N8LA 3F1NA 1Y4OA 2R9WA 3EGXC 3VSLA 1MWTA 1LSWA 2V9AA 4GD6A 2ZQDA 4KENB 5AQAA 5HPFA 2ZMAA 4NEED 4S2NC 1PWCA 4HI4A 2JKFA 3BFEA 3IHAA 4JGRA 1T1CA 4PAUA 1CK3A 1G28A 3LICA 5HAIA 4FH2A 4CLCC 2H5SA 2QYBA 5EVEA 4G3KA 3Q7ZA 1S0WA 1W7FA 4FSFA 4F3LA 4MEZA 4NK3A 2G2WA 4NG2A 5FQKA 3W4OA 3S4XA 5L10A 3O86A 3UE1A 4HP9A 1K54A 3NI9A 1ESIA 1VB6A 4BD0A 4GN2A 2D02A 3UO9A 1CEFA 5DTTA 1XFNA 3ZVWA 2WKEA 3LI8A 5FEFA 1IELA 4YINA 5GL9A 4UAAA 4WZ4A 3PBOA 2ZQCA 2VGJA 4QWOA 3FV7A 5DKKA 2GDNA 5DJUA 2H0YA 2PR5A 1BLPA 2OWJA 1RGZA 3ITBA 1CF0A 3H9WA 1SHVA 3H82A 2V1BA 4P6BA 4WBGA 2JKTI 1TS8A 1XA1A 3CMZA 5FAOA 3VP4A 4EUVA 3NOTC 4B4XA 4WLAA 1O7EA 2Q9MA 5M1AA 3WS0A 3CI6A 3UPPA 2ZD8A 5DTSA 1PRQA 2R9XA 2EX6A 5EM1A 1UWPX 4JF4A 2Z6DA 4X56A 2QZ6A 1WYBA 5TJJA 3G2ZA 3IBRA 3AGFA 2K31A 3Q7VB 1IKGA 3PBQA 1MY8A 5CTMA 3KSGA 3UDXA 3IH9A 2VEAA 2Y2HA 3U4LP 5LBRA 1H0MA 3E2LA 4O7DA 5HZHA 4E6XA 4WN5A 3Q82A 1FIKA 2Y2PA 5EM0A 1X0OA 3MQ0A 4XUXA 2X71A 4X69A 4R3AA 1OJ5A 3LR3A 3JPUA 5FASA 1IEMA 4UQIS 5TBMA 2DNSA 3SS5A 4F3LB 1FOFA 2INWA 1K56A 3ZDJA 1C3BA 2KDKA 3GSGA 3VOYA 4GS9B 3LIFA 3BFGA 3C7UA 4MN7A 4GB7A 2OOLA 2XH9A 4X53A 2WUQA 3IXBA 4PPRA 2JKRI 3ZG5A 3E4QA 1PW1A 3A3FA 4HH2A 2W3FA 3UMEA 3K3DA 3WS5A 4JF5A 5HD3A 4ETZA 4E3MA 3V3RA 2XD5A 3VP2A 3BWLA 4LCMA 3BFFA 2VV8A 3PBTA 1XJ4A 2J3TD 2H10A 2HDUA 3UPOA 1YAXA 3W8KA 4Y3IA 4AFIA 5JYOA 1YKDA 4UHUA 5JYPA 3MXQA 3S7PA 2WKIA 5DVAA 3W4PA 4ZJ2A 2KX6A 3OCNA 5MC7A 1NJ4A 3MSHA 4EBPA 3G6OA 3SS4A 2J3TC 3IQAA 2W3GA 3WWXA 1W79A 2J9OA 4KUOA 5FQIA 4Y7PA 1MXOA 3LEQA 2PHYA 1K57C 2A24B 4IUHA 4OQ0A 2P7JA 2P08A 1MZUA 4FD8A 4DKIA 4DJ2A 4LCLA 4BLMA 2O0YA 1UWNX 2R78A 4R0QA 3G31A 1BT5A 3C7VA 2WKHA 3BM6A 3LR4A 2XR0A 4X1LA 5TR7A 3RFBA 2O99A 2J9PA 4EW7A 1VM1A 3NOUC 3T1XA 4R3JA 2XD1A 4FH4A 4DXCA 4YNRA 1PYYA 1L0GA 1BULA 2W1TA 2W1TB 3VP3A 5CHMA 3P98A 1I2SA 3ZYTA 2VA0A 3CPTA 4I3JA 3LIEA 4QB8A 5AQBA 3LIAA 4IUKA 1G5UA 1HTZA 2Y2LA 3DWKA 4N9KA 3ZG8B 4OPRA 5E2FA 4PM5A 2VGLM 5FL3A 3ISGA 3C38A 4ETXA 4GHIB
chains in the Genus database with same CATH topology
1H0MA 5L09A 4NG2A 5L10A 1L3LA 3IX3A 4Y15A 3QP6A 2UV0E 4LGWA 3QP8A 3QP1A 3QP5A 4LFUA 4Y17A 3SZTA 2Q0OA 3JPUA 3IX8A 3IX4A 3QP4A 2AVXA 5L07A 4Y13A 3QP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0M A;  5L09 A;  4NG2 A;  5L10 A;  1L3L A;  3IX3 A;  4Y15 A;  3QP6 A;  2UV0 E;  4LGW A;  3QP8 A;  3QP1 A;  3QP5 A;  4LFU A;  4Y17 A;  3SZT A;  2Q0O A;  3JPU A;  3IX8 A;  3IX4 A;  3QP4 A;  2AVX A;  5L07 A;  4Y13 A;  3QP2 A; 
#chains in the Genus database with same CATH topology
 4WL9 A;  3D72 A;  1PZP A;  1ERQ A;  3LCE A;  5FAP A;  3DTI A;  1LHY A;  5HX9 A;  3E4O A;  2G7U A;  4NET A;  5HAP A;  5E2H A;  1N9B A;  5KIZ A;  1L0F A;  1L2S A;  5U47 A;  3E98 A;  4G3V A;  3S22 A;  4K0W A;  4S2N A;  2JKR M;  1IYS A;  1F98 A;  1F5M A;  1Q2P A;  4NXB A;  1CI8 A;  4NXE A;  4HOI A;  4E04 A;  2PBY A;  5DJT A;  3LY4 A;  5TBM B;  3PR6 A;  2ZM0 A;  2GZA A;  3QP2 A;  2GNX A;  4I39 A;  4BBU A;  3GV9 A;  3A3I A;  4PM7 A;  1L3L A;  2A24 A;  2VV7 A;  1Z6F A;  3QP6 A;  1KE0 A;  3LIB A;  4OVD A;  4OON A;  4HBU A;  1TVF A;  3FKV A;  2JC7 A;  1MWR A;  3ZNT A;  3VP1 A;  2Z6C A;  4OP8 A;  2Z2L B;  4HY8 A;  3VV4 A;  2VK3 A;  4U0X A;  3VP0 A;  1GHI A;  3IWQ A;  3N4I A;  1T1B A;  5F69 A;  3WRZ A;  1K57 A;  3N8S A;  3QP4 A;  3UB5 P;  2EA9 A;  1ZG4 A;  5EFW A;  3HLW A;  2E8J A;  4N1H A;  3T4Q A;  1K25 A;  3PYP A;  4L9E A;  5AJG A;  1BZA A;  2ZC5 B;  3SH8 A;  4PM6 A;  2MJ6 A;  3E0Y A;  4UA6 A;  4IBR A;  3B47 A;  4IVI A;  2JCH A;  4DE2 A;  4QY5 A;  4D2O A;  5J3W A;  4RA7 A;  4S2L A;  2V2F F;  1JTG A;  4KQQ A;  2CC1 A;  4DF6 A;  2WKR A;  4MCW A;  4KG2 A;  4PKY A;  4WEL A;  3KYE A;  5F82 A;  5A8B A;  3CHW P;  2VLG A;  3ZGA B;  1A0K A;  3F1O B;  2EFX A;  1ES2 A;  4JKT A;  4ZJ3 A;  1P9R A;  4LV2 A;  1MWS A;  3HCY A;  4HES A;  4OQG A;  3KSF A;  1YLW A;  4JGO A;  3K2N A;  1YMX A;  4IED A;  3HUN A;  1SCW A;  4I3I A;  3MFX A;  1S66 L;  3KSI A;  4OOM A;  4CLC A;  3ZQ5 A;  5G4Y A;  1MPL A;  4CQH A;  4DRT A;  4S2M A;  3HBR A;  3NDG A;  3OC2 A;  2NUT C;  4UA7 A;  3BQA A;  1VQQ A;  3HLE A;  4Y15 A;  2UV0 E;  3VSK A;  5J4E A;  1LSV A;  4EQ1 A;  2EX9 A;  3P7N A;  2ZL1 A;  5HWW A;  1FSW A;  1GCE A;  1K4E A;  4GOG A;  2Y2N A;  3G4P A;  3KX0 X;  5FDH A;  2QKP A;  4FOF A;  1HD8 A;  1XP4 A;  4R3B A;  4JXS A;  2ZOI A;  1Z09 A;  2FH5 A;  5CEC A;  5FDS A;  2JHE A;  4ZBE A;  2EXB A;  1STZ A;  2XQZ A;  3MKF A;  2XDM A;  1TDG A;  2BTF P;  1YQS A;  4KZB A;  2A49 A;  2EX2 A;  3T4K A;  3G35 A;  1S1Y A;  2BLS A;  1GHP A;  3VMA A;  3UB6 A;  1CI9 A;  4EEU A;  3IF6 A;  2EXA A;  4Y0T A;  1S4R A;  3KO6 A;  4EET B;  4KZ7 A;  3LUQ A;  5L09 A;  1P0Z A;  1PFL A;  3C8C A;  2A3U A;  4WM9 A;  5FQJ A;  2P9V A;  1MBL A;  5HL1 A;  4UQI M;  1Q2Q A;  1XFQ A;  4BJP A;  4LFU A;  1H3Q A;  1CQA A;  3W4Q A;  3IXD A;  5HDS A;  2WGW B;  3IS2 A;  3HLB A;  2XEP A;  3S7O A;  2ZL1 B;  3MF0 A;  3O5Y A;  4X6T A;  1I5Q A;  3NDE A;  2WKQ A;  5EE8 A;  3MS6 A;  3Q81 A;  2ZOH A;  3G2Y A;  1NLY A;  5EOE A;  3F1N B;  1GA9 A;  5KSH A;  5CGX A;  1IYO A;  2IWB A;  2ZBB A;  5GLA A;  1SZV A;  3VE3 A;  1N9N A;  5M19 A;  5A90 A;  3M2K A;  5C5K A;  4R6L A;  4PM8 A;  4GD8 A;  3OBF A;  5D3O A;  1AXB A;  4IJG A;  1K38 A;  2EFU A;  2B02 A;  5CGS A;  5FAQ A;  4EEP A;  3T1R A;  3EOI A;  5CXW A;  1DP9 A;  1N9O A;  1ZHH B;  1ZC2 A;  3B42 A;  3MFD A;  2HDR A;  4KZ3 A;  1OME A;  3PBS A;  1GSX A;  1XPB A;  4Z1W A;  1T18 A;  3A0S A;  1IKI A;  1D1J A;  1RCJ A;  5EVI B;  4KG6 A;  3IX8 A;  3PTE A;  3QNC A;  1QMF A;  3T1Q B;  3FYZ A;  1ONG A;  5HAR A;  2HDS A;  4X1M A;  1P9W A;  3UDI A;  4JXW A;  2ZM8 A;  3F1P B;  3V5M A;  4QPR A;  3EGD C;  2IWC A;  1TD5 A;  3HLD A;  5BOH A;  5IT5 A;  3SH9 A;  1XKZ A;  3JYI A;  4G3W A;  3ICY A;  1E3U A;  5CED A;  2JN7 A;  4ME4 A;  2OV5 A;  3BYD A;  4PHT A;  3ZHH A;  2HJ9 C;  4KQR A;  4ID4 A;  4CLC B;  3CG5 A;  4BBV A;  1LI0 A;  5L8M A;  3BLM A;  4E3L A;  4OQH A;  5KSC A;  2WAE A;  2Y2K A;  4Y0U A;  1PZO A;  3UB8 A;  3OLO A;  5F1G A;  3QP8 A;  3VOL A;  2GJ3 A;  1FCO A;  1OT9 A;  5DFY A;  3BFC A;  4QU3 A;  3BW6 A;  4OH0 A;  4GDB A;  2Q0O A;  2OAP 1;  1DJC A;  2XA7 S;  4GHI A;  4XXR A;  3K3C A;  2PBD P;  3UE0 A;  4UEY A;  1KDS A;  2RCX A;  4ESP A;  4MLL A;  2VGL S;  3TJZ C;  4PM9 A;  5FA7 A;  5HW3 A;  4KG5 A;  4OP5 A;  3BFD A;  4LV3 A;  2JBF A;  3KSH A;  2ZC7 A;  2Y59 A;  3M6B A;  2QWS A;  3AGD A;  4GJ4 A;  4MNR A;  1J9M A;  2A2L A;  3VFF A;  4DDS A;  5EVI D;  4HBT A;  5EEC A;  2V1A A;  2QJ5 A;  4GZB A;  4OLD A;  5FSR A;  3MMH A;  3G32 A;  1CJF A;  1XXM A;  2M7U A;  4H6J A;  4Y13 A;  3UB7 A;  4EU0 A;  3EWK A;  1MWU A;  4PMA A;  4LEN A;  2DCF A;  2K2N A;  1S67 L;  3ZCZ A;  2W1R A;  1GSV A;  1N4O A;  4GS9 A;  2O9A A;  2DRW A;  3UE3 A;  3UN7 A;  4OQI A;  4I5S A;  2HDQ A;  4X25 A;  1FQG A;  2UWX A;  4R4R A;  3VE4 A;  3PAE A;  5M18 A;  3CAX A;  2W0N A;  5F5Y A;  5K5B A;  2G2U A;  5FEG A;  1LT0 A;  4Q0H A;  4JLF A;  2Y55 A;  4DE3 A;  3HLF A;  3AGE A;  3GTC A;  1OT6 A;  3SS3 A;  1NYY A;  1Y28 A;  3MZE A;  2WK0 A;  1LL5 A;  3RH8 B;  2HZ5 A;  5FQ9 A;  4I38 A;  4DE1 A;  4DE0 A;  5FAT A;  1KE4 A;  1XGI A;  3B33 A;  4MBK A;  1ACF A;  4ARZ A;  3HJI A;  2YKF A;  4Y0O A;  4K91 A;  3GVB A;  5HDC A;  3T4T A;  3A3E A;  5G4Z A;  5EVI C;  5EVL A;  4Y2F A;  3NOP C;  4H6J B;  1IFQ A;  1OTD A;  3S7N A;  2XLN A;  4RVA A;  4E3I A;  2WGI A;  2PDR A;  3KYQ A;  3Q07 A;  4DMZ A;  4DN0 A;  4WMC A;  3UMD A;  1LSX A;  1FR6 A;  5FI2 A;  2WAD A;  1G6A A;  2FFF B;  5I5L A;  1FCM A;  1PI4 A;  2EWV A;  1H8M A;  2L0W A;  4EER A;  3IH8 A;  5EPH A;  4D60 A;  3SW1 A;  3H7W A;  3BRM A;  2H0T A;  4LRY C;  3R7W B;  3WS4 A;  2X02 A;  5HAQ A;  1NZO A;  1F9I A;  3VFH A;  3TSG A;  3IF5 A;  1NWZ A;  1YMS A;  2ZJ9 A;  3C30 A;  4Y5F A;  5CTN A;  3NC8 A;  3CLO A;  1NXY A;  1XX2 A;  4GDN A;  1ZG6 A;  5L07 A;  4EBN A;  1XGJ A;  1L0E A;  4ZRR A;  1BYW A;  3CPT B;  4Q0J A;  4EV4 A;  2XGN A;  3QHY A;  3C5A A;  2E8I A;  4LLO B;  2I72 A;  2P9V B;  2VKS A;  1ESU A;  2QPN A;  1HLU P;  2BAS A;  5EOO A;  3A0V A;  3V3S A;  3PHY A;  2OAQ 1;  1KVM A;  4BMW A;  2VZW A;  4B4Z A;  5DTK A;  3IXH A;  3NY4 A;  2YKH A;  4EQI A;  2XFT A;  2M7V A;  1DJA A;  3N8R A;  2XRN A;  4JXG A;  4MDZ A;  3Q1F A;  2ZQ7 A;  4HQA A;  3ZFZ A;  4S2I A;  5HWT A;  5DFX A;  3BQ8 A;  2QJ7 A;  4DJ3 A;  4GNU A;  5EV0 A;  3NCK A;  2WZX A;  3T50 A;  3OPP A;  4QJG A;  4QHC A;  3CUE C;  5HL6 A;  2P04 A;  1YPR A;  5G18 A;  1XJ6 A;  5CGW A;  4B93 A;  1DY6 A;  3LGO A;  3MR0 A;  5HPI A;  4HJ4 A;  5CEB A;  2KLI A;  1YT4 A;  1H8Z A;  2LB9 A;  3PBN A;  4ZTK A;  4OKP A;  1NLZ A;  2I9V A;  3IS2 B;  2B95 A;  1E25 A;  2KOI A;  4QY6 A;  4EWF A;  3A3D A;  4CPK A;  1LLB A;  4S2K A;  1DP8 A;  3JVV A;  5FI7 A;  1BSG A;  3N7W A;  1S4S A;  2P74 A;  1KGE A;  1ODV A;  4E6W A;  2B5R A;  1YSQ A;  5A92 A;  1IOU A;  1D06 A;  3SOI A;  3C4O A;  4DDY A;  2FFY A;  4C75 A;  3IXG A;  3NHQ A;  2C6W B;  3A0R A;  4GW9 A;  3LO7 A;  4JXV A;  4EUZ A;  3S1Y A;  4LV0 A;  1Y54 A;  4FTX A;  4HNB A;  1W8Y A;  2QHK A;  3T12 B;  4S2J A;  4RQ9 A;  3OPH A;  5HWV A;  2K7S A;  1W63 Q;  3GR2 A;  1DJB A;  1KGG A;  4KZ8 A;  1HVB A;  3FC7 A;  2JKG A;  4L9F A;  3HLC A;  4R1G A;  3ULF A;  4WUJ A;  5CER A;  1BTL A;  4L9G A;  4HJ6 A;  1YM1 A;  3MZF A;  4OPY A;  4OPQ A;  3ZG0 A;  5L2F A;  3V50 A;  3FKW A;  2M1C A;  4U0T A;  2JE5 A;  1ONH A;  3ITA A;  3H82 B;  4IHQ A;  3O3V A;  4HH3 A;  1ZKJ A;  2O9B A;  4MBF A;  5CHJ A;  1OTA A;  4HHD A;  3HUO A;  2CMN A;  1NZU A;  3MJQ A;  4F94 A;  1OTE A;  2V20 A;  1ZTU A;  3HRE A;  1PW8 A;  3D9Y A;  3OZH A;  4HP4 A;  1KDW A;  4ZJ1 A;  5GLB A;  1IYP A;  2WGW A;  1VET A;  3ZG7 B;  2V0U A;  4X68 A;  3CZD A;  2ZMV A;  3Q7V A;  1SKO A;  3M6H A;  1FSY A;  3ZVT A;  5EUA A;  3GDI A;  4N92 A;  2ZQA A;  1JWZ A;  3BLS A;  1ALQ A;  2IA2 A;  1W5D A;  1TEM A;  2W3H A;  4KZ4 A;  3DWZ A;  2RL3 A;  4S2O A;  1FR1 A;  2Z2M B;  3F1P A;  4C3Q A;  4P87 A;  3T4J A;  4KZ9 A;  1VEU A;  4O8G A;  1TS6 A;  1SKF A;  4LRZ E;  4WZ5 A;  1JVJ A;  3S7Q A;  3RJU A;  3HJK A;  4NXF A;  4GKU A;  3MBZ A;  3LYX A;  2ZM2 A;  3IF6 B;  2D01 A;  2Y2Q A;  1JTD A;  3T4O A;  2ZQ8 A;  1EI5 A;  3IBJ A;  1H5X A;  1NY0 A;  1FCN A;  1KOU A;  2HP5 A;  4LPZ A;  1OJG A;  3DTM A;  3EQV A;  5CHU A;  4CLC E;  1H8Y A;  1YLT A;  5HFO A;  1SKO B;  3BEB A;  3R7W A;  2L4R A;  4JF6 A;  5DF7 A;  1DP6 A;  4MMN A;  1K55 C;  2QMI A;  4KUK A;  4B9O A;  2GX5 A;  4FCF A;  2HV1 A;  1PWG A;  2Q9N A;  4KZA A;  5HDD A;  3LR5 A;  3EQU A;  1K6S A;  2WAF A;  3BY8 A;  4BEN A;  3GMW A;  3E4P A;  3RTY A;  2HP6 A;  2OSU A;  4K0X A;  2C5W B;  5IS1 A;  3OPL A;  2L1M A;  3FPV A;  3MXR A;  5GHZ A;  4E3J A;  3VOZ A;  2X01 A;  3CWF A;  3IX4 A;  1TS0 A;  3GQZ A;  4WEJ A;  4R23 A;  4WEK A;  2PU4 A;  3DBA A;  4ZAM A;  5KZH A;  3PBR A;  3G30 A;  2PAV P;  3MZD A;  2HF6 A;  1PWD A;  4XT2 A;  5KMW A;  3TW8 A;  3R4K A;  2OLV A;  4OOL A;  1BLC A;  4S2P A;  4Q8I A;  1TS7 A;  1V9Y A;  2W27 A;  2W3D A;  5DF8 A;  4EES A;  2W3E A;  2VX8 A;  1YLY A;  4HJ3 A;  1JWP A;  2VGK A;  1GA0 A;  1QME A;  3TRC A;  3T4S A;  5F1F A;  1FIL A;  5AVF A;  4E3K A;  3C2W A;  3IT9 A;  2XK1 A;  4B88 A;  3CUE A;  3OCL A;  3GRJ A;  3DW0 A;  1YLZ A;  3FG8 A;  2IWD A;  1NRF A;  4YFM A;  3ZNY A;  4KQO A;  4K08 A;  1ES4 A;  3HLG A;  5AQ9 A;  2XF3 A;  3WS1 A;  3SH7 A;  3IX3 A;  1HZO A;  2PR6 A;  4OOY A;  5TGF A;  4P0M A;  2V8F A;  3QP1 A;  3QP5 A;  2V1Z A;  4R38 A;  1ERO A;  5IHV A;  4EXO A;  3L7H A;  3MKE A;  2VV6 A;  2DMW A;  2V0W A;  2ZMF A;  1TDL A;  4M4X A;  4WYY A;  4EBL A;  5CRF A;  3CJM A;  4E3O A;  4RX3 A;  2Y8H A;  4M3K A;  1E3U D;  4L0L A;  2HP9 A;  3NUL A;  3B3X A;  1S6R A;  4IVK A;  2PT7 A;  4YOF A;  4CLC D;  1U60 A;  1CEG A;  4C6Y A;  2J3W A;  3F1O A;  2PYR A;  1YSP A;  4LRX C;  1GHM A;  2Y2J A;  1GSW A;  4P6Z M;  2EWW A;  1T1A A;  1K6R A;  3C4P A;  3G34 A;  4YWZ A;  1BLH A;  5GHY A;  1VEU B;  1VHM A;  3I7J A;  5GLC A;  1XA7 A;  3U2A A;  2OWH A;  1KE3 A;  1LL8 A;  4WF0 A;  5FQM A;  1WYC A;  3DAV A;  1K56 D;  2V8C A;  1MC0 A;  3HL9 A;  2AVX A;  4BL2 A;  3IWI A;  4PKY G;  3WS2 A;  4GLQ A;  3D3O A;  3D4F A;  4E3N A;  4R70 A;  4JBF A;  4DXB A;  1LI9 A;  3P09 A;  4XUZ A;  3O87 A;  3HUM A;  3TE8 A;  3UE6 A;  3OPR A;  2HPB A;  1IYQ A;  4BL3 A;  2JKT M;  3UY6 A;  1XJ2 A;  1W63 M;  4LV1 A;  2Y79 A;  1VET B;  3V67 A;  1UGU A;  2B18 A;  1KVL A;  1G68 A;  1J3W A;  4RYE A;  4BD1 A;  3RXW A;  4NXG A;  1PNE A;  2PD8 A;  4X55 A;  2Y2M A;  2J7V A;  4BWI A;  5J7E A;  5I94 A;  2WZZ A;  3BJN A;  1JNU A;  3MQO A;  3BY9 A;  4MBH A;  2Y4A A;  1EW0 A;  3TOI A;  4JGQ A;  5HD5 A;  4IBX A;  4OPZ A;  4R4S A;  3EEH A;  3T4L A;  3LFV A;  1NRJ A;  4ARZ B;  2XSS A;  3TG9 A;  3UB9 A;  1K4F A;  1P97 A;  1BUE A;  3T1S A;  3SZT A;  1PI5 A;  1NYM A;  1F2K A;  1YLJ A;  3L9K A;  2H28 A;  4RX2 A;  4KZ6 A;  3NIA A;  3GEC A;  4Z9Q A;  4MN6 A;  4N1X A;  1ES5 A;  1N9L A;  5E2G A;  1ERM A;  3DTK A;  4XT2 B;  3IHB A;  3M2J A;  3PXP A;  2XRO A;  2LB5 A;  4QD4 A;  3LI9 A;  5GHX A;  1EWZ A;  1MKM A;  1T19 A;  4JGP A;  3OOV A;  1RP5 A;  5TFQ A;  3IF6 C;  4HEF A;  3LEZ A;  4OLG A;  2ZQ9 A;  3CIT A;  5IU1 A;  1G6O A;  1I2W A;  4WZ5 C;  3H7W B;  2Y2G A;  3ZG9 B;  1D7E A;  3V39 A;  4KZ5 A;  1OPX A;  2PRF A;  3KYZ A;  2Y2O A;  5F6A A;  1O07 A;  4A5R A;  3NBL A;  1WA9 A;  1YLP A;  5E2E A;  1S1Z A;  1E4D A;  3QNB A;  3NEC A;  2J8Y A;  3RXX A;  4KQD A;  4ZDX A;  3E2K A;  3LR0 A;  4JPM A;  4H8R A;  2HJE A;  5A93 A;  3IWO A;  3EEA A;  1AWI A;  5CX7 A;  5F68 A;  3MXS A;  1JWV A;  2ZLY A;  2Y2I A;  3JVU A;  1TF1 A;  4P6Z S;  1K0K A;  5A91 A;  2PD7 A;  1XJ3 A;  1K55 A;  5AVE A;  3FZC A;  4N9L A;  3UPN A;  2PYP A;  4CJN A;  1KGF A;  4LGW A;  3N6I A;  3O88 A;  1MKI A;  4O01 A;  1DRM A;  1M40 A;  3LY3 A;  5J8X A;  3DTE A;  4UA9 A;  4HIA A;  5EVI A;  2ZC3 B;  3PAG A;  4BQM A;  4GCZ A;  4II7 A;  2FZ0 A;  3W2Z A;  3BEC A;  4I3A A;  1PIO A;  1RGY A;  3FPW A;  2PU2 A;  3UDF A;  2ACG A;  4Y17 A;  3UNW A;  1WE4 A;  2XA7 M;  3MQQ A;  2HGV A;  3A3J A;  1SDN A;  5E43 A;  2VJW A;  2J80 A;  3NJA A;  1ES3 A;  3WRT A;  1K54 C;  1L0D A;  4U3T A;  1M6K A;  3LID A;  5AQ7 A;  5FI6 A;  2ZC4 B;  1LL9 A;  2EX8 A;  2Y91 A;  2OLU A;  3HVF A;  4P85 A;  5DF9 A;  4NKP A;  1V9Z A;  1SDE A;  4FUW A;  4MN5 A;  5DKL A;  2O9C A;  5F83 A;  1W8Q A;  2WKP A;  2BG1 A;  4Q0I A;  3P01 A;  2NUP C;  1BLS A;  1OTB A;  1OTI A;  2XFS A;  2WYX A;  3FWL A;  4BBT A;  5GLD A;  2ZC6 B;  4O0P A;  2WGV A;  4WMC D;  5FQQ A;  5HSQ A;  3N8L A;  3F1N A;  1Y4O A;  2R9W A;  3EGX C;  3VSL A;  1MWT A;  1LSW A;  2V9A A;  4GD6 A;  2ZQD A;  4KEN B;  5AQA A;  5HPF A;  2ZMA A;  4NEE D;  4S2N C;  1PWC A;  4HI4 A;  2JKF A;  3BFE A;  3IHA A;  4JGR A;  1T1C A;  4PAU A;  1CK3 A;  1G28 A;  3LIC A;  5HAI A;  4FH2 A;  4CLC C;  2H5S A;  2QYB A;  5EVE A;  4G3K A;  3Q7Z A;  1S0W A;  1W7F A;  4FSF A;  4F3L A;  4MEZ A;  4NK3 A;  2G2W A;  4NG2 A;  5FQK A;  3W4O A;  3S4X A;  5L10 A;  3O86 A;  3UE1 A;  4HP9 A;  1K54 A;  3NI9 A;  1ESI A;  1VB6 A;  4BD0 A;  4GN2 A;  2D02 A;  3UO9 A;  1CEF A;  5DTT A;  1XFN A;  3ZVW A;  2WKE A;  3LI8 A;  5FEF A;  1IEL A;  4YIN A;  5GL9 A;  4UAA A;  4WZ4 A;  3PBO A;  2ZQC A;  2VGJ A;  4QWO A;  3FV7 A;  5DKK A;  2GDN A;  5DJU A;  2H0Y A;  2PR5 A;  1BLP A;  2OWJ A;  1RGZ A;  3ITB A;  1CF0 A;  3H9W A;  1SHV A;  3H82 A;  2V1B A;  4P6B A;  4WBG A;  2JKT I;  1TS8 A;  1XA1 A;  3CMZ A;  5FAO A;  3VP4 A;  4EUV A;  3NOT C;  4B4X A;  4WLA A;  1O7E A;  2Q9M A;  5M1A A;  3WS0 A;  3CI6 A;  3UPP A;  2ZD8 A;  5DTS A;  1PRQ A;  2R9X A;  2EX6 A;  5EM1 A;  1UWP X;  4JF4 A;  2Z6D A;  4X56 A;  2QZ6 A;  1WYB A;  5TJJ A;  3G2Z A;  3IBR A;  3AGF A;  2K31 A;  3Q7V B;  1IKG A;  3PBQ A;  1MY8 A;  5CTM A;  3KSG A;  3UDX A;  3IH9 A;  2VEA A;  2Y2H A;  3U4L P;  5LBR A;  1H0M A;  3E2L A;  4O7D A;  5HZH A;  4E6X A;  4WN5 A;  3Q82 A;  1FIK A;  2Y2P A;  5EM0 A;  1X0O A;  3MQ0 A;  4XUX A;  2X71 A;  4X69 A;  4R3A A;  1OJ5 A;  3LR3 A;  3JPU A;  5FAS A;  1IEM A;  4UQI S;  5TBM A;  2DNS A;  3SS5 A;  4F3L B;  1FOF A;  2INW A;  1K56 A;  3ZDJ A;  1C3B A;  2KDK A;  3GSG A;  3VOY A;  4GS9 B;  3LIF A;  3BFG A;  3C7U A;  4MN7 A;  4GB7 A;  2OOL A;  2XH9 A;  4X53 A;  2WUQ A;  3IXB A;  4PPR A;  2JKR I;  3ZG5 A;  3E4Q A;  1PW1 A;  3A3F A;  4HH2 A;  2W3F A;  3UME A;  3K3D A;  3WS5 A;  4JF5 A;  5HD3 A;  4ETZ A;  4E3M A;  3V3R A;  2XD5 A;  3VP2 A;  3BWL A;  4LCM A;  3BFF A;  2VV8 A;  3PBT A;  1XJ4 A;  2J3T D;  2H10 A;  2HDU A;  3UPO A;  1YAX A;  3W8K A;  4Y3I A;  4AFI A;  5JYO A;  1YKD A;  4UHU A;  5JYP A;  3MXQ A;  3S7P A;  2WKI A;  5DVA A;  3W4P A;  4ZJ2 A;  2KX6 A;  3OCN A;  5MC7 A;  1NJ4 A;  3MSH A;  4EBP A;  3G6O A;  3SS4 A;  2J3T C;  3IQA A;  2W3G A;  3WWX A;  1W79 A;  2J9O A;  4KUO A;  5FQI A;  4Y7P A;  1MXO A;  3LEQ A;  2PHY A;  1K57 C;  2A24 B;  4IUH A;  4OQ0 A;  2P7J A;  2P08 A;  1MZU A;  4FD8 A;  4DKI A;  4DJ2 A;  4LCL A;  4BLM A;  2O0Y A;  1UWN X;  2R78 A;  4R0Q A;  3G31 A;  1BT5 A;  3C7V A;  2WKH A;  3BM6 A;  3LR4 A;  2XR0 A;  4X1L A;  5TR7 A;  3RFB A;  2O99 A;  2J9P A;  4EW7 A;  1VM1 A;  3NOU C;  3T1X A;  4R3J A;  2XD1 A;  4FH4 A;  4DXC A;  4YNR A;  1PYY A;  1L0G A;  1BUL A;  2W1T A;  2W1T B;  3VP3 A;  5CHM A;  3P98 A;  1I2S A;  3ZYT A;  2VA0 A;  3CPT A;  4I3J A;  3LIE A;  4QB8 A;  5AQB A;  3LIA A;  4IUK A;  1G5U A;  1HTZ A;  2Y2L A;  3DWK A;  4N9K A;  3ZG8 B;  4OPR A;  5E2F A;  4PM5 A;  2VGL M;  5FL3 A;  3ISG A;  3C38 A;  4ETX A;  4GHI B; 
#chains in the Genus database with same CATH homology
 1H0M A;  5L09 A;  4NG2 A;  5L10 A;  1L3L A;  3IX3 A;  4Y15 A;  3QP6 A;  2UV0 E;  4LGW A;  3QP8 A;  3QP1 A;  3QP5 A;  4LFU A;  4Y17 A;  3SZT A;  2Q0O A;  3JPU A;  3IX8 A;  3IX4 A;  3QP4 A;  2AVX A;  5L07 A;  4Y13 A;  3QP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...