3IX8A

Lasr-tp3 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
b'ALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein lasR
molecule tags Transcription
source organism Pseudomonas aeruginosa
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix8A00
4Y13A 4LFUA 4Y17A 3IX4A 4LGWA 3IX3A 3JPUA 2AVXA 2Q0OA 4Y15A 3QP5A 3QP6A 3SZTA 3QP8A 3QP2A 1L3LA 3QP4A 5L07A 3IX8A 1H0MA 4NG2A 5L10A 3QP1A 5L09A 2UV0E
chains in the Genus database with same CATH superfamily
3H9WA 1P9WA 2WKEA 1NRFA 2B5RA 2KDKA 3NBLA 2PDRA 1NJ4A 4OH0A 4OP8A 3IHAA 1TDGA 3IS2A 1YLYA 5CRFA 1SKFA 3SH9A 4JPMA 3L9KA 3D3OA 1DY6A 4IBRA 4UAAA 1FQGA 4B88A 3ITAA 4N9LA 3GVBA 2GZAA 3CPTB 1QMFA 3F1PA 3F1PB 4BD0A 3T1QB 4Y13A 4KUKA 5FQJA 2O9BA 4GOGA 2MJ6A 1Y28A 2HDQA 3T4TA 3ZGAB 4Y15A 1L2SA 3IXDA 5DKLA 1PW8A 3M6HA 5L07A 2W27A 1KDSA 2B95A 5CEDA 2QWSA 3WS4A 2ZQ7A 4R6LA 4KG2A 4DN0A 5FDHA 1TS7A 1OTDA 1FOFA 4EXOA 1XKZA 2XQZA 3IX4A 4GS9A 2PT7A 3HJKA 2V0WA 3ZG7B 1HTZA 3WS1A 4KZ4A 4GJ4A 5IHVA 4KZ5A 4JF6A 1BLSA 3PBQA 2V8FA 1GSWA 1LSXA 3MZFA 3NC8A 4S2KA 1P9RA 2BG1A 3BRMA 3LR4A 3OOVA 3K2NA 1YSQA 2P04A 3Q81A 4JXVA 4P6BA 3ZG5A 4CLCB 5JYPA 4U0TA 4FUWA 1VQQA 1N9LA 1N9NA 2D02A 1XXMA 5BOHA 4E3NA 2ZJ9A 4LV0A 4GCZA 4HOIA 1LSVA 1T1CA 1K54A 3PHYA 3T50A 1CI9A 4E6WA 4B9OA 2GX5A 1S4SA 3NJAA 4E3IA 3OBFA 4GZBA 3UY6A 2ZC3B 2ZM8A 2ZQ9A 3OLOA 3HLBA 3BECA 5GLAA 3MQ0A 3NDGA 1KE0A 1U60A 4S2JA 2XDMA 2OAP1 4I3IA 1MC0A 1ERQA 2Z2LB 1K55A 1C3BA 1TDLA 3O3VA 3VE3A 2A2LA 1DJAA 5FAPA 3V3SA 3PBNA 5J3WA 4HQAA 4FOFA 1VM1A 1NWZA 1SDEA 4MBFA 2JN7A 2JCHA 3PAEA 3OZHA 3EEAA 4HBUA 2ZL1B 1N4OA 2PYPA 3BFDA 1P97A 2Y59A 3ZG0A 3UB8A 1S1YA 2HZ5A 2CMNA 3N6IA 1E4DA 2OLVA 3S7OA 1PZOA 4ARZB 2HP9A 3IWIA 3LYXA 4GKUA 1E3UA 2V0UA 5HDDA 4ZAMA 1KOUA 3K3DA 4RQ9A 5EVEA 3VFFA 3Q07A 1KGFA 5HWWA 3QP8A 1OMEA 2UWXA 2WGVA 4MN6A 4NG2A 3Q7VB 1XGIA 1LL9A 1K57C 5IU1A 3BFEA 4NXEA 3T4JA 1ERMA 1IYOA 5EECA 5F1GA 2EX6A 3PBRA 4PM8A 4B4ZA 4OPQA 1PYYA 2DMWA 4S2IA 5GLDA 3S7QA 4C6YA 1TS8A 4RYEA 2PBYA 1NLZA 3DBAA 4ETZA 4HBTA 5A92A 4Q0HA 4E3LA 3HCYA 3IX3A 5FDSA 4ZRRA 1SKOB 3KSGA 3CAXA 1PW1A 4LCMA 1PZPA 3MZEA 3QNCA 4FCFA 5EOEA 4PM9A 4NXFA 2EX2A 1LI9A 2H0YA 3FPVA 4EBNA 5C5KA 4HESA 2QZ6A 3P01A 1O07A 2Y2NA 5J8XA 5FI2A 1IELA 3V50A 2Y2OA 3ZFZA 2A49A 1LHYA 1OTIA 4E3JA 3SOIA 4YOFA 3NDEA 3VSLA 1EW0A 4Z9QA 2NUTC 4UA6A 2W0NA 4OPYA 4JGOA 1GHPA 1YLWA 4PPRA 1OT9A 3IQAA 4DMZA 3RTYA 3OPLA 2DNSA 3CMZA 1SDNA 3UB6A 4KZ6A 3Q7VA 4NEED 4CQHA 3PBSA 2L0WA 5CXWA 1K56A 2VV8A 3HUOA 2R9WA 4JF5A 1JWPA 4EQIA 3A3JA 4ARZA 2W1TB 3HLCA 3BW6A 4Q8IA 2KX6A 3T1SA 2Y79A 3OCNA 1NYYA 1XJ4A 4OPRA 2Y2KA 3B47A 5F83A 5L8MA 4WF0A 1GHIA 3DTIA 5CGXA 1BLPA 2BASA 4KG5A 4E3MA 2PBDP 3DTKA 1RGZA 3LICA 1GA9A 1YLPA 2HP5A 1T1AA 1DRMA 5DTKA 4E3KA 1CEGA 1NLYA 3IF6C 4OQGA 1DP9A 3OCLA 1HD8A 1I5QA 1SCWA 1J3WA 3NULA 2H0TA 3IH9A 5HFOA 3SZTA 2XGNA 5FEGA 3T4SA 4LLOB 3JVUA 5DF9A 3CG5A 1DP6A 5EM1A 2X02A 4X69A 1ZC2A 4KQRA 5FL3A 2K2NA 5CX7A 3WWXA 5FQMA 1KVLA 5DVAA 3IF5A 5J7EA 2E8IA 1K38A 1L0GA 4E6XA 1JTGA 5G4ZA 1YMSA 3EOIA 4Y3IA 1EWZA 4HH2A 3IS2B 2OV5A 3R7WA 4X53A 4F3LB 3VP0A 1CJFA 2ZC7A 4YNRA 3QP6A 3T12B 4KG6A 4P85A 3VSKA 2Z2MB 2XA7S 1Q2PA 3IBRA 2EX8A 2PU2A 4LV2A 4LRZE 1S6RA 2JKGA 3LIFA 3QNBA 3M6BA 3KSIA 1VETA 2WYXA 3C38A 4IBXA 3KYQA 3SH8A 1Z09A 4Y7PA 3SS5A 4BBTA 4WMCA 3R7WB 3ZCZA 3BQ8A 3MQQA 2LB9A 4GHIA 5EPHA 4DJ3A 3HREA 4MBKA 4XXRA 5A91A 3HLGA 4Y17A 4HJ4A 2VA0A 1JWVA 1EROA 2V1AA 3S7NA 1W5DA 1WA9A 3WS5A 5HSQA 4R70A 1L3LA 3CZDA 3ZVWA 2V9AA 4QY5A 4NK3A 5E2EA 3ZQ5A 3GQZA 4NETA 3JVVA 1I2SA 3UN7A 5EVIA 2ZOHA 2Z6DA 1F98A 1S67L 1TS0A 2XRNA 1BULA 3E4OA 2H10A 3MXQA 3CWFA 3SS4A 4PHTA 1G6AA 2R9XA 4FD8A 4ZBEA 3ZNYA 1NRJA 5L10A 1VETB 5DFXA 1T1BA 1T19A 4EV4A 4DJ2A 3MXSA 3G6OA 2WGWB 4Y0OA 4Q0IA 2EXBA 3UMEA 3HUMA 2O9AA 1BLHA 3ZG9B 2ZQCA 3LFVA 4OQHA 5HL6A 4D60A 4F3LA 1PRQA 4EEPA 2IWDA 2VX8A 1UWNX 4Y0UA 2EWWA 2WKIA 4HJ3A 1OTEA 2M1CA 5EUAA 1MZUA 3CLOA 5DTSA 4WLAA 4XT2A 1YAXA 2JKRM 4H6JB 2R78A 5DTTA 3L7HA 2W1TA 3C2WA 3AGEA 5F5YA 3VOYA 1MKMA 2LB5A 4KZ3A 4WZ5C 3VP4A 4LRYC 2JBFA 3CUEC 2G7UA 1FR6A 2EWVA 5EVID 5CGSA 3C7UA 5HD5A 2XFSA 2L4RA 3VV4A 5HARA 4BL3A 4GLQA 4Q0JA 2Q9NA 2JKRI 4KQOA 4R3JA 3EWKA 3D4FA 3A3DA 3CHWP 4L9FA 1K55C 5F1FA 4MCWA 4L9EA 1H8MA 2EFXA 4E3OA 2C6WB 4LENA 1FR1A 1K56D 1PWCA 2E8JA 1TVFA 3H7WB 2Y4AA 3IXGA 1MWSA 3MZDA 3DWKA 2IWCA 4BD1A 3ZHHA 3QP2A 3G2YA 1EI5A 2PD7A 4MDZA 1HVBA 3VMAA 4CJNA 2WADA 3O86A 2RCXA 2HDSA 2QPNA 1S66L 2P08A 1D1JA 1PWDA 2HJEA 4HIAA 3WS2A 4A5RA 1VHMA 3Q82A 1PFLA 5CTNA 2EXAA 2JHEA 2XFTA 4ZJ2A 3UDXA 2KLIA 1PNEA 5HPIA 3KX0X 3C7VA 4N1XA 4DXBA 5FATA 1YSPA 1MWUA 4R4SA 5DF7A 4CLCD 2J8YA 4L0LA 4RX2A 3G31A 4KZ7A 3H7WA 2PRFA 3PYPA 2W3FA 4H8RA 1WYBA 2GDNA 4XUZA 3A0RA 2JKTI 1KE3A 3GECA 3T4KA 2JKTM 3F1NA 4PM7A 2PR6A 5M1AA 1AXBA 4ZJ3A 1ZTUA 3RXXA 4GD6A 3W2ZA 2H5SA 4FSFA 1CQAA 2ZC4B 2IA2A 2Y2QA 3H82A 2FH5A 2PHYA 5CHUA 1FCMA 4ZTKA 3HBRA 1JWZA 4KUOA 3SH7A 2OWJA 2RL3A 1ZHHB 2OOLA 2VLGA 3P09A 1W79A 3CITA 3MMHA 4K0WA 2Y2MA 2V1ZA 4JXWA 1YLZA 5EVLA 1WE4A 3ZDJA 3QP4A 4O01A 2H28A 5IS1A 4OLDA 3EEHA 2ZQAA 3GR2A 4UQIS 2HDUA 4PKYG 5CHMA 2EA9A 1YM1A 5HPFA 2O99A 2WK0A 4RX3A 2HJ9C 4PMAA 4K0XA 1XA1A 2ZC5B 3BFFA 4N9KA 1QMEA 3S1YA 1A0KA 4LPZA 4BMWA 5K5BA 4GW9A 4IJGA 1KGGA 3G4PA 3MS6A 1UGUA 3IF6A 2VGLM 4NKPA 3W4QA 1VB6A 5HWVA 1XP4A 4X56A 3UB7A 2P7JA 2XD5A 3B42A 1YMXA 4GN2A 1L0FA 3KSHA 3UNWA 3A0SA 3DW0A 5HD3A 3ZG8B 2ZLYA 4N92A 3C4OA 3E4QA 1NZOA 4H6JA 4XT2B 2GJ3A 1OTBA 4DXCA 3NOPC 3IXBA 4GDNA 4AFIA 3IWOA 4X55A 3E98A 3B33A 4JGQA 3LGOA 2I9VA 1ES2A 1IKIA 4GB7A 2W3EA 2J3TC 4MLLA 3NCKA 1CEFA 2UV0E 4I3JA 5CGWA 4R3AA 4KZ9A 3PAGA 3LO7A 3QHYA 1ZG6A 3OPRA 3JYIA 4EUVA 1K54C 3VOLA 3A3FA 4FH4A 4OLGA 5FQ9A 4WEJA 1F5MA 1DJCA 3GTCA 2X71A 3DAVA 3LIBA 4DE1A 4JGPA 5E2FA 4UQIM 4EW7A 1YQSA 2HF6A 4WMCD 2QMIA 2J9PA 3M2KA 4R0QA 1ACFA 5KSCA 5L2FA 4LRXC 3CPTA 4BBVA 3BFCA 1BZAA 1FIKA 4Y2FA 2FFYA 5FQKA 4O8GA 2ZMFA 4OP5A 3LI8A 5HWTA 2Y55A 3E2LA 3MR0A 3NIAA 4JBFA 4OONA 4WZ5A 4DF6A 1ZG4A 5HAIA 3G35A 2Q9MA 2XK1A 1YLJA 1ALQA 2VGLS 2ZM0A 3O5YA 4WELA 5F69A 4YINA 5FAQA 5TJJA 2ACGA 2QKPA 2VGJA 1IKGA 2J3TD 2A24B 1TF1A 5HDCA 3LEZA 1S0WA 5D3OA 1BYWA 3PBOA 4GS9B 4N1HA 1PIOA 1P0ZA 4IUHA 3UB5P 1L0EA 3TOIA 1XJ6A 1K57A 4PM5A 2G2WA 5FASA 1RGYA 5CTMA 1Y54A 1BLCA 2Y2GA 3JPUA 1G28A 3QP5A 5EE8A 3G30A 1H5XA 5U47A 3U4LP 1KDWA 4S2NA 4P0MA 1FCOA 1G5UA 2V2FF 3C4PA 4I3AA 4WEKA 4FTXA 4RVAA 4JGRA 2HGVA 3IWQA 5FI6A 4QB8A 2D01A 4P6ZM 5AQBA 5HX9A 5DJTA 1FSWA 4MN5A 2Z6CA 4OQIA 1ONGA 3AGFA 5FSRA 1M40A 3LIDA 4K08A 4BJPA 4EWFA 2NUPC 5A90A 4EBPA 3PTEA 2O9CA 1W8YA 1MWRA 4EUZA 2VKSA 5TGFA 3OPPA 1E3UD 3IH8A 4JKTA 1LL8A 1LSWA 3NY4A 2BTFP 5CERA 4M4XA 3C30A 3DTMA 1TEMA 3LR3A 1Y4OA 3RFBA 4ME4A 4BENA 2V8CA 4WYYA 1PI5A 4GNUA 2P74A 5E2HA 4DDSA 3VP1A 3A0VA 3A3EA 1IYPA 1STZA 4JXGA 1LL5A 3CUEA 3UE1A 4WL9A 3IT9A 4BLMA 1IYSA 1G6OA 3UDIA 2KOIA 5AVEA 4EESA 1K4EA 3PBTA 2XH9A 2WAEA 3GV9A 3IBJA 3BYDA 3F1NB 3DTEA 3P7NA 3PR6A 4G3KA 2GNXA 4S2NC 1NYMA 2O0YA 5TFQA 3C5AA 3MQOA 3KO6A 2W1RA 4P6ZS 1Q2QA 3N4IA 3LI9A 3EGXC 1W8QA 3CJMA 4LFUA 1ZKJA 4NXGA 3LIEA 5AQAA 1UWPX 2WAFA 3RJUA 2J3WA 5HAPA 2AVXA 1BUEA 4NXBA 4G3WA 4MN7A 4PM6A 2FFFB 4B4XA 3V67A 3N7WA 3TJZC 4DKIA 2PYRA 3UB9A 3ULFA 2VZWA 1MXOA 2WUQA 5A8BA 1OJ5A 1D06A 5GHZA 1OJGA 1H3QA 2FZ0A 3G2ZA 3S22A 3S4XA 3HLFA 4QD4A 4JF4A 5EVIC 4YFMA 1LT0A 5AVFA 3FKWA 3K3CA 1SZVA 4KQDA 4I39A 2ZQ8A 4EU0A 3IX8A 5EOOA 5F6AA 3NECA 2OSUA 2XF3A 4QU3A 2WKQA 4ZDXA 1V9ZA 1KVMA 3OC2A 2K7SA 4Y0TA 2VV7A 4ETXA 3UDFA 4EEUA 1MWTA 3E0YA 4L9GA 2XROA 3T4LA 3MBZA 1K25A 1D7EA 3RXWA 3MF0A 4CLCA 4C75A 1XGJA 3D9YA 3F1OB 5G4YA 4F94A 1KE4A 4MNRA 4BBUA 3BY8A 5LBRA 4WN5A 1MPLA 1V9YA 3D72A 2XA7M 3HVFA 2VGKA 2Y2JA 1M6KA 5KIZA 3LEQA 4M3KA 1JNUA 3T4OA 3Q1FA 2BLSA 2VEAA 3M2JA 2W3GA 4CLCE 1T18A 4B93A 3GMWA 5M18A 3EQUA 1S1ZA 4OOMA 4HEFA 1S4RA 3UPNA 2YKFA 1H8YA 3BM6A 5EM0A 4FH2A 4DE2A 1J9MA 3VE4A 4R4RA 3UPPA 3TW8A 2ZMAA 1CK3A 4K91A 4QPRA 4XUXA 2K31A 3W4PA 4KZAA 1G68A 1ES5A 2PD8A 3C8CA 3MXRA 1XX2A 4LGWA 1I2WA 2J9OA 3HLDA 1CI8A 1NY0A 3TG9A 4DE0A 2WKHA 4MMNA 3HUNA 4Y5FA 3Q7ZA 5HDSA 3BFGA 5FQQA 1ES3A 5I5LA 1FILA 1IYQA 5AQ9A 3TE8A 1MKIA 2PU4A 1YLTA 3UPOA 3LY4A 3LR0A 1AWIA 4HH3A 3BWLA 3R4KA 4UA9A 5M19A 3UE3A 2HDRA 2Y2PA 5EV0A 5F82A 5TBMB 1XFNA 1X0OA 4ESPA 3MFXA 1W63Q 2INWA 1BTLA 4OKPA 1TD5A 3HJIA 3GDIA 1FSYA 3FZCA 4HHDA 2JE5A 1XJ3A 2ZM2A 4D2OA 1JTDA 3KYEA 3FG8A 4WBGA 4X1MA 4X6TA 1LLBA 5GHXA 4R1GA 4MEZA 2V20A 2C5WB 4ZJ1A 1KGEA 2YKHA 5EVIB 1YPRA 3LR5A 3BJNA 4OOYA 4PAUA 3AGDA 3ZNTA 1ES4A 4IEDA 1IOUA 4WUJA 2ZBBA 2ZQDA 3BQAA 2WZZA 1YKDA 4R23A 4G3VA 3LUQA 3ITBA 3U2AA 3LY3A 2DRWA 2W3HA 1IFQA 1XFQA 4IUKA 4X25A 3GSGA 3LIAA 4YWZA 3UE6A 4GD8A 5A93A 5KZHA 2Y2LA 3HLWA 1H0MA 4U0XA 4UHUA 4UA7A 3G32A 4UEYA 1W7FA 2QJ5A 3B3XA 5FA7A 3FWLA 5FAOA 5F68A 2X01A 2V1BA 5TBMA 2DCFA 4QJGA 5I94A 4DE3A 3EQVA 1BT5A 3HLEA 2M7VA 4CLCC 3QP1A 1K6SA 3ZVTA 5L09A 3F1OA 3CI6A 5DJUA 2XR0A 5GHYA 1DJBA 3MKFA 4I38A 1OTAA 2IWBA 2L1MA 2XLNA 4IVIA 3TSGA 2G2UA 2P9VA 4II7A 3P98A 3UMDA 1WYCA 4BQMA 5CECA 3IF6B 4HY8A 4U3TA 5KMWA 4BL2A 4CPKA 4Z1WA 3VP3A 1GA0A 3N8LA 4OOLA 4R3BA 3NI9A 4X1LA 4GDBA 3WRZA 4HI4A 4X68A 3WS0A 1BSGA 1GSVA 1NXYA 2M7UA 3BY9A 4HJ6A 4KENB 2XSSA 3PXPA 3TRCA 3ISGA 4S2OA 4LV3A 4S2MA 4WM9A 3E2KA 2WGIA 5CHJA 5DFYA 1SHVA 5KSHA 3MKEA 1RP5A 2B18A 1CF0A 5DKKA 1VEUB 3MJQA 5HAQA 3FC7A 3V5MA 1TS6A 1XA7A 3KYZA 2VV6A 5FEFA 4OQ0A 1SKOA 1N9OA 5FI7A 4EBLA 3FPWA 2QYBA 3H82B 3W8KA 3RH8B 3UE0A 4EQ1A 4WZ4A 1O7EA 3UO9A 4I5SA 3IXHA 4QWOA 2EFUA 2WZXA 4JXSA 2Y91A 1ODVA 4KZBA 3FYZA 2EX9A 1GSXA 5GLBA 4P87A 3LCEA 1ESIA 4OVDA 3O87A 1XJ2A 1OPXA 1RCJA 2HV1A 2WKRA 3IHBA 3NHQA 5TR7A 1PI4A 3DWZA 3SW1A 3ICYA 4RA7A 5GL9A 4C3QA 1MY8A 4DDYA 1Z6FA 4HP4A 3KSFA 4EERA 1E25A 5E2GA 5G18A 3BLMA 4R38A 3A3IA 2OWHA 3WRTA 1N9BA 2QHKA 1H8ZA 4OPZA 2J7VA 1LI0A 2ZMVA 4O0PA 4HP9A 5HW3A 4KQQA 1HZOA 1VEUA 1YT4A 3N8SA 4QHCA 1ONHA 3N8RA 3MFDA 3SS3A 5DF8A 2VK3A 4IHQA 5AQ7A 5E43A 5J4EA 1PWGA 2Y2IA 2XD1A 3T1RA 1MBLA 3E4PA 2WGWA 4DRTA 3I7JA 3HL9A 3S7PA 1ESUA 1K6RA 2CC1A 3MSHA 4PKYA 1GHMA 2ZOIA 3FKVA 1JVJA 4KZ8A 2W3DA 1FCNA 4S2LA 1OT6A 4BWIA 2PR5A 4ID4A 3G34A 3OPHA 1F9IA 4LV1A 5CEBA 5MC7A 3NOUC 2JC7A 3T4QA 5AJGA 3NOTC 4IVKA 3V3RA 3BLSA 2HP6A 2OLUA 4S2PA 2P9VB 2WKPA 4E04A 2VJWA 2I72A 5IT5A 4EETB 2Y2HA 3O88A 2ZL1A 1DP8A 4GHIB 3T1XA 1NZUA 4JLFA 2JKFA 1XPBA 4HNBA 3VFHA 1IEMA 2XEPA 1F2KA 2B02A 2PAVP 3VP2A 3FV7A 3EGDC 3ZYTA 2ZC6B 4MBHA 5FQIA 2QJ7A 2HPBA 3BEBA 4QY6A 1L0DA 5EFWA 2ZD8A 3V39A 1K0KA 2Q0OA 2Y8HA 1W63M 2A24A 1GCEA 3W4OA 3VOZA 4LCLA 3GRJA 2A3UA 2OAQ1 1HLUP 5HZHA 5HL1A 5JYOA 2J80A 4O7DA 5GLCA 1K4FA
chains in the Genus database with same CATH topology
4Y13A 4LFUA 4Y17A 3IX4A 4LGWA 3IX3A 3JPUA 2AVXA 2Q0OA 4Y15A 3QP5A 3QP6A 3SZTA 3QP8A 3QP2A 1L3LA 3QP4A 5L07A 3IX8A 1H0MA 4NG2A 5L10A 3QP1A 5L09A 2UV0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y13 A;  4LFU A;  4Y17 A;  3IX4 A;  4LGW A;  3IX3 A;  3JPU A;  2AVX A;  2Q0O A;  4Y15 A;  3QP5 A;  3QP6 A;  3SZT A;  3QP8 A;  3QP2 A;  1L3L A;  3QP4 A;  5L07 A;  3IX8 A;  1H0M A;  4NG2 A;  5L10 A;  3QP1 A;  5L09 A;  2UV0 E; 
#chains in the Genus database with same CATH topology
 3H9W A;  1P9W A;  2WKE A;  1NRF A;  2B5R A;  2KDK A;  3NBL A;  2PDR A;  1NJ4 A;  4OH0 A;  4OP8 A;  3IHA A;  1TDG A;  3IS2 A;  1YLY A;  5CRF A;  1SKF A;  3SH9 A;  4JPM A;  3L9K A;  3D3O A;  1DY6 A;  4IBR A;  4UAA A;  1FQG A;  4B88 A;  3ITA A;  4N9L A;  3GVB A;  2GZA A;  3CPT B;  1QMF A;  3F1P A;  3F1P B;  4BD0 A;  3T1Q B;  4Y13 A;  4KUK A;  5FQJ A;  2O9B A;  4GOG A;  2MJ6 A;  1Y28 A;  2HDQ A;  3T4T A;  3ZGA B;  4Y15 A;  1L2S A;  3IXD A;  5DKL A;  1PW8 A;  3M6H A;  5L07 A;  2W27 A;  1KDS A;  2B95 A;  5CED A;  2QWS A;  3WS4 A;  2ZQ7 A;  4R6L A;  4KG2 A;  4DN0 A;  5FDH A;  1TS7 A;  1OTD A;  1FOF A;  4EXO A;  1XKZ A;  2XQZ A;  3IX4 A;  4GS9 A;  2PT7 A;  3HJK A;  2V0W A;  3ZG7 B;  1HTZ A;  3WS1 A;  4KZ4 A;  4GJ4 A;  5IHV A;  4KZ5 A;  4JF6 A;  1BLS A;  3PBQ A;  2V8F A;  1GSW A;  1LSX A;  3MZF A;  3NC8 A;  4S2K A;  1P9R A;  2BG1 A;  3BRM A;  3LR4 A;  3OOV A;  3K2N A;  1YSQ A;  2P04 A;  3Q81 A;  4JXV A;  4P6B A;  3ZG5 A;  4CLC B;  5JYP A;  4U0T A;  4FUW A;  1VQQ A;  1N9L A;  1N9N A;  2D02 A;  1XXM A;  5BOH A;  4E3N A;  2ZJ9 A;  4LV0 A;  4GCZ A;  4HOI A;  1LSV A;  1T1C A;  1K54 A;  3PHY A;  3T50 A;  1CI9 A;  4E6W A;  4B9O A;  2GX5 A;  1S4S A;  3NJA A;  4E3I A;  3OBF A;  4GZB A;  3UY6 A;  2ZC3 B;  2ZM8 A;  2ZQ9 A;  3OLO A;  3HLB A;  3BEC A;  5GLA A;  3MQ0 A;  3NDG A;  1KE0 A;  1U60 A;  4S2J A;  2XDM A;  2OAP 1;  4I3I A;  1MC0 A;  1ERQ A;  2Z2L B;  1K55 A;  1C3B A;  1TDL A;  3O3V A;  3VE3 A;  2A2L A;  1DJA A;  5FAP A;  3V3S A;  3PBN A;  5J3W A;  4HQA A;  4FOF A;  1VM1 A;  1NWZ A;  1SDE A;  4MBF A;  2JN7 A;  2JCH A;  3PAE A;  3OZH A;  3EEA A;  4HBU A;  2ZL1 B;  1N4O A;  2PYP A;  3BFD A;  1P97 A;  2Y59 A;  3ZG0 A;  3UB8 A;  1S1Y A;  2HZ5 A;  2CMN A;  3N6I A;  1E4D A;  2OLV A;  3S7O A;  1PZO A;  4ARZ B;  2HP9 A;  3IWI A;  3LYX A;  4GKU A;  1E3U A;  2V0U A;  5HDD A;  4ZAM A;  1KOU A;  3K3D A;  4RQ9 A;  5EVE A;  3VFF A;  3Q07 A;  1KGF A;  5HWW A;  3QP8 A;  1OME A;  2UWX A;  2WGV A;  4MN6 A;  4NG2 A;  3Q7V B;  1XGI A;  1LL9 A;  1K57 C;  5IU1 A;  3BFE A;  4NXE A;  3T4J A;  1ERM A;  1IYO A;  5EEC A;  5F1G A;  2EX6 A;  3PBR A;  4PM8 A;  4B4Z A;  4OPQ A;  1PYY A;  2DMW A;  4S2I A;  5GLD A;  3S7Q A;  4C6Y A;  1TS8 A;  4RYE A;  2PBY A;  1NLZ A;  3DBA A;  4ETZ A;  4HBT A;  5A92 A;  4Q0H A;  4E3L A;  3HCY A;  3IX3 A;  5FDS A;  4ZRR A;  1SKO B;  3KSG A;  3CAX A;  1PW1 A;  4LCM A;  1PZP A;  3MZE A;  3QNC A;  4FCF A;  5EOE A;  4PM9 A;  4NXF A;  2EX2 A;  1LI9 A;  2H0Y A;  3FPV A;  4EBN A;  5C5K A;  4HES A;  2QZ6 A;  3P01 A;  1O07 A;  2Y2N A;  5J8X A;  5FI2 A;  1IEL A;  3V50 A;  2Y2O A;  3ZFZ A;  2A49 A;  1LHY A;  1OTI A;  4E3J A;  3SOI A;  4YOF A;  3NDE A;  3VSL A;  1EW0 A;  4Z9Q A;  2NUT C;  4UA6 A;  2W0N A;  4OPY A;  4JGO A;  1GHP A;  1YLW A;  4PPR A;  1OT9 A;  3IQA A;  4DMZ A;  3RTY A;  3OPL A;  2DNS A;  3CMZ A;  1SDN A;  3UB6 A;  4KZ6 A;  3Q7V A;  4NEE D;  4CQH A;  3PBS A;  2L0W A;  5CXW A;  1K56 A;  2VV8 A;  3HUO A;  2R9W A;  4JF5 A;  1JWP A;  4EQI A;  3A3J A;  4ARZ A;  2W1T B;  3HLC A;  3BW6 A;  4Q8I A;  2KX6 A;  3T1S A;  2Y79 A;  3OCN A;  1NYY A;  1XJ4 A;  4OPR A;  2Y2K A;  3B47 A;  5F83 A;  5L8M A;  4WF0 A;  1GHI A;  3DTI A;  5CGX A;  1BLP A;  2BAS A;  4KG5 A;  4E3M A;  2PBD P;  3DTK A;  1RGZ A;  3LIC A;  1GA9 A;  1YLP A;  2HP5 A;  1T1A A;  1DRM A;  5DTK A;  4E3K A;  1CEG A;  1NLY A;  3IF6 C;  4OQG A;  1DP9 A;  3OCL A;  1HD8 A;  1I5Q A;  1SCW A;  1J3W A;  3NUL A;  2H0T A;  3IH9 A;  5HFO A;  3SZT A;  2XGN A;  5FEG A;  3T4S A;  4LLO B;  3JVU A;  5DF9 A;  3CG5 A;  1DP6 A;  5EM1 A;  2X02 A;  4X69 A;  1ZC2 A;  4KQR A;  5FL3 A;  2K2N A;  5CX7 A;  3WWX A;  5FQM A;  1KVL A;  5DVA A;  3IF5 A;  5J7E A;  2E8I A;  1K38 A;  1L0G A;  4E6X A;  1JTG A;  5G4Z A;  1YMS A;  3EOI A;  4Y3I A;  1EWZ A;  4HH2 A;  3IS2 B;  2OV5 A;  3R7W A;  4X53 A;  4F3L B;  3VP0 A;  1CJF A;  2ZC7 A;  4YNR A;  3QP6 A;  3T12 B;  4KG6 A;  4P85 A;  3VSK A;  2Z2M B;  2XA7 S;  1Q2P A;  3IBR A;  2EX8 A;  2PU2 A;  4LV2 A;  4LRZ E;  1S6R A;  2JKG A;  3LIF A;  3QNB A;  3M6B A;  3KSI A;  1VET A;  2WYX A;  3C38 A;  4IBX A;  3KYQ A;  3SH8 A;  1Z09 A;  4Y7P A;  3SS5 A;  4BBT A;  4WMC A;  3R7W B;  3ZCZ A;  3BQ8 A;  3MQQ A;  2LB9 A;  4GHI A;  5EPH A;  4DJ3 A;  3HRE A;  4MBK A;  4XXR A;  5A91 A;  3HLG A;  4Y17 A;  4HJ4 A;  2VA0 A;  1JWV A;  1ERO A;  2V1A A;  3S7N A;  1W5D A;  1WA9 A;  3WS5 A;  5HSQ A;  4R70 A;  1L3L A;  3CZD A;  3ZVW A;  2V9A A;  4QY5 A;  4NK3 A;  5E2E A;  3ZQ5 A;  3GQZ A;  4NET A;  3JVV A;  1I2S A;  3UN7 A;  5EVI A;  2ZOH A;  2Z6D A;  1F98 A;  1S67 L;  1TS0 A;  2XRN A;  1BUL A;  3E4O A;  2H10 A;  3MXQ A;  3CWF A;  3SS4 A;  4PHT A;  1G6A A;  2R9X A;  4FD8 A;  4ZBE A;  3ZNY A;  1NRJ A;  5L10 A;  1VET B;  5DFX A;  1T1B A;  1T19 A;  4EV4 A;  4DJ2 A;  3MXS A;  3G6O A;  2WGW B;  4Y0O A;  4Q0I A;  2EXB A;  3UME A;  3HUM A;  2O9A A;  1BLH A;  3ZG9 B;  2ZQC A;  3LFV A;  4OQH A;  5HL6 A;  4D60 A;  4F3L A;  1PRQ A;  4EEP A;  2IWD A;  2VX8 A;  1UWN X;  4Y0U A;  2EWW A;  2WKI A;  4HJ3 A;  1OTE A;  2M1C A;  5EUA A;  1MZU A;  3CLO A;  5DTS A;  4WLA A;  4XT2 A;  1YAX A;  2JKR M;  4H6J B;  2R78 A;  5DTT A;  3L7H A;  2W1T A;  3C2W A;  3AGE A;  5F5Y A;  3VOY A;  1MKM A;  2LB5 A;  4KZ3 A;  4WZ5 C;  3VP4 A;  4LRY C;  2JBF A;  3CUE C;  2G7U A;  1FR6 A;  2EWV A;  5EVI D;  5CGS A;  3C7U A;  5HD5 A;  2XFS A;  2L4R A;  3VV4 A;  5HAR A;  4BL3 A;  4GLQ A;  4Q0J A;  2Q9N A;  2JKR I;  4KQO A;  4R3J A;  3EWK A;  3D4F A;  3A3D A;  3CHW P;  4L9F A;  1K55 C;  5F1F A;  4MCW A;  4L9E A;  1H8M A;  2EFX A;  4E3O A;  2C6W B;  4LEN A;  1FR1 A;  1K56 D;  1PWC A;  2E8J A;  1TVF A;  3H7W B;  2Y4A A;  3IXG A;  1MWS A;  3MZD A;  3DWK A;  2IWC A;  4BD1 A;  3ZHH A;  3QP2 A;  3G2Y A;  1EI5 A;  2PD7 A;  4MDZ A;  1HVB A;  3VMA A;  4CJN A;  2WAD A;  3O86 A;  2RCX A;  2HDS A;  2QPN A;  1S66 L;  2P08 A;  1D1J A;  1PWD A;  2HJE A;  4HIA A;  3WS2 A;  4A5R A;  1VHM A;  3Q82 A;  1PFL A;  5CTN A;  2EXA A;  2JHE A;  2XFT A;  4ZJ2 A;  3UDX A;  2KLI A;  1PNE A;  5HPI A;  3KX0 X;  3C7V A;  4N1X A;  4DXB A;  5FAT A;  1YSP A;  1MWU A;  4R4S A;  5DF7 A;  4CLC D;  2J8Y A;  4L0L A;  4RX2 A;  3G31 A;  4KZ7 A;  3H7W A;  2PRF A;  3PYP A;  2W3F A;  4H8R A;  1WYB A;  2GDN A;  4XUZ A;  3A0R A;  2JKT I;  1KE3 A;  3GEC A;  3T4K A;  2JKT M;  3F1N A;  4PM7 A;  2PR6 A;  5M1A A;  1AXB A;  4ZJ3 A;  1ZTU A;  3RXX A;  4GD6 A;  3W2Z A;  2H5S A;  4FSF A;  1CQA A;  2ZC4 B;  2IA2 A;  2Y2Q A;  3H82 A;  2FH5 A;  2PHY A;  5CHU A;  1FCM A;  4ZTK A;  3HBR A;  1JWZ A;  4KUO A;  3SH7 A;  2OWJ A;  2RL3 A;  1ZHH B;  2OOL A;  2VLG A;  3P09 A;  1W79 A;  3CIT A;  3MMH A;  4K0W A;  2Y2M A;  2V1Z A;  4JXW A;  1YLZ A;  5EVL A;  1WE4 A;  3ZDJ A;  3QP4 A;  4O01 A;  2H28 A;  5IS1 A;  4OLD A;  3EEH A;  2ZQA A;  3GR2 A;  4UQI S;  2HDU A;  4PKY G;  5CHM A;  2EA9 A;  1YM1 A;  5HPF A;  2O99 A;  2WK0 A;  4RX3 A;  2HJ9 C;  4PMA A;  4K0X A;  1XA1 A;  2ZC5 B;  3BFF A;  4N9K A;  1QME A;  3S1Y A;  1A0K A;  4LPZ A;  4BMW A;  5K5B A;  4GW9 A;  4IJG A;  1KGG A;  3G4P A;  3MS6 A;  1UGU A;  3IF6 A;  2VGL M;  4NKP A;  3W4Q A;  1VB6 A;  5HWV A;  1XP4 A;  4X56 A;  3UB7 A;  2P7J A;  2XD5 A;  3B42 A;  1YMX A;  4GN2 A;  1L0F A;  3KSH A;  3UNW A;  3A0S A;  3DW0 A;  5HD3 A;  3ZG8 B;  2ZLY A;  4N92 A;  3C4O A;  3E4Q A;  1NZO A;  4H6J A;  4XT2 B;  2GJ3 A;  1OTB A;  4DXC A;  3NOP C;  3IXB A;  4GDN A;  4AFI A;  3IWO A;  4X55 A;  3E98 A;  3B33 A;  4JGQ A;  3LGO A;  2I9V A;  1ES2 A;  1IKI A;  4GB7 A;  2W3E A;  2J3T C;  4MLL A;  3NCK A;  1CEF A;  2UV0 E;  4I3J A;  5CGW A;  4R3A A;  4KZ9 A;  3PAG A;  3LO7 A;  3QHY A;  1ZG6 A;  3OPR A;  3JYI A;  4EUV A;  1K54 C;  3VOL A;  3A3F A;  4FH4 A;  4OLG A;  5FQ9 A;  4WEJ A;  1F5M A;  1DJC A;  3GTC A;  2X71 A;  3DAV A;  3LIB A;  4DE1 A;  4JGP A;  5E2F A;  4UQI M;  4EW7 A;  1YQS A;  2HF6 A;  4WMC D;  2QMI A;  2J9P A;  3M2K A;  4R0Q A;  1ACF A;  5KSC A;  5L2F A;  4LRX C;  3CPT A;  4BBV A;  3BFC A;  1BZA A;  1FIK A;  4Y2F A;  2FFY A;  5FQK A;  4O8G A;  2ZMF A;  4OP5 A;  3LI8 A;  5HWT A;  2Y55 A;  3E2L A;  3MR0 A;  3NIA A;  4JBF A;  4OON A;  4WZ5 A;  4DF6 A;  1ZG4 A;  5HAI A;  3G35 A;  2Q9M A;  2XK1 A;  1YLJ A;  1ALQ A;  2VGL S;  2ZM0 A;  3O5Y A;  4WEL A;  5F69 A;  4YIN A;  5FAQ A;  5TJJ A;  2ACG A;  2QKP A;  2VGJ A;  1IKG A;  2J3T D;  2A24 B;  1TF1 A;  5HDC A;  3LEZ A;  1S0W A;  5D3O A;  1BYW A;  3PBO A;  4GS9 B;  4N1H A;  1PIO A;  1P0Z A;  4IUH A;  3UB5 P;  1L0E A;  3TOI A;  1XJ6 A;  1K57 A;  4PM5 A;  2G2W A;  5FAS A;  1RGY A;  5CTM A;  1Y54 A;  1BLC A;  2Y2G A;  3JPU A;  1G28 A;  3QP5 A;  5EE8 A;  3G30 A;  1H5X A;  5U47 A;  3U4L P;  1KDW A;  4S2N A;  4P0M A;  1FCO A;  1G5U A;  2V2F F;  3C4P A;  4I3A A;  4WEK A;  4FTX A;  4RVA A;  4JGR A;  2HGV A;  3IWQ A;  5FI6 A;  4QB8 A;  2D01 A;  4P6Z M;  5AQB A;  5HX9 A;  5DJT A;  1FSW A;  4MN5 A;  2Z6C A;  4OQI A;  1ONG A;  3AGF A;  5FSR A;  1M40 A;  3LID A;  4K08 A;  4BJP A;  4EWF A;  2NUP C;  5A90 A;  4EBP A;  3PTE A;  2O9C A;  1W8Y A;  1MWR A;  4EUZ A;  2VKS A;  5TGF A;  3OPP A;  1E3U D;  3IH8 A;  4JKT A;  1LL8 A;  1LSW A;  3NY4 A;  2BTF P;  5CER A;  4M4X A;  3C30 A;  3DTM A;  1TEM A;  3LR3 A;  1Y4O A;  3RFB A;  4ME4 A;  4BEN A;  2V8C A;  4WYY A;  1PI5 A;  4GNU A;  2P74 A;  5E2H A;  4DDS A;  3VP1 A;  3A0V A;  3A3E A;  1IYP A;  1STZ A;  4JXG A;  1LL5 A;  3CUE A;  3UE1 A;  4WL9 A;  3IT9 A;  4BLM A;  1IYS A;  1G6O A;  3UDI A;  2KOI A;  5AVE A;  4EES A;  1K4E A;  3PBT A;  2XH9 A;  2WAE A;  3GV9 A;  3IBJ A;  3BYD A;  3F1N B;  3DTE A;  3P7N A;  3PR6 A;  4G3K A;  2GNX A;  4S2N C;  1NYM A;  2O0Y A;  5TFQ A;  3C5A A;  3MQO A;  3KO6 A;  2W1R A;  4P6Z S;  1Q2Q A;  3N4I A;  3LI9 A;  3EGX C;  1W8Q A;  3CJM A;  4LFU A;  1ZKJ A;  4NXG A;  3LIE A;  5AQA A;  1UWP X;  2WAF A;  3RJU A;  2J3W A;  5HAP A;  2AVX A;  1BUE A;  4NXB A;  4G3W A;  4MN7 A;  4PM6 A;  2FFF B;  4B4X A;  3V67 A;  3N7W A;  3TJZ C;  4DKI A;  2PYR A;  3UB9 A;  3ULF A;  2VZW A;  1MXO A;  2WUQ A;  5A8B A;  1OJ5 A;  1D06 A;  5GHZ A;  1OJG A;  1H3Q A;  2FZ0 A;  3G2Z A;  3S22 A;  3S4X A;  3HLF A;  4QD4 A;  4JF4 A;  5EVI C;  4YFM A;  1LT0 A;  5AVF A;  3FKW A;  3K3C A;  1SZV A;  4KQD A;  4I39 A;  2ZQ8 A;  4EU0 A;  3IX8 A;  5EOO A;  5F6A A;  3NEC A;  2OSU A;  2XF3 A;  4QU3 A;  2WKQ A;  4ZDX A;  1V9Z A;  1KVM A;  3OC2 A;  2K7S A;  4Y0T A;  2VV7 A;  4ETX A;  3UDF A;  4EEU A;  1MWT A;  3E0Y A;  4L9G A;  2XRO A;  3T4L A;  3MBZ A;  1K25 A;  1D7E A;  3RXW A;  3MF0 A;  4CLC A;  4C75 A;  1XGJ A;  3D9Y A;  3F1O B;  5G4Y A;  4F94 A;  1KE4 A;  4MNR A;  4BBU A;  3BY8 A;  5LBR A;  4WN5 A;  1MPL A;  1V9Y A;  3D72 A;  2XA7 M;  3HVF A;  2VGK A;  2Y2J A;  1M6K A;  5KIZ A;  3LEQ A;  4M3K A;  1JNU A;  3T4O A;  3Q1F A;  2BLS A;  2VEA A;  3M2J A;  2W3G A;  4CLC E;  1T18 A;  4B93 A;  3GMW A;  5M18 A;  3EQU A;  1S1Z A;  4OOM A;  4HEF A;  1S4R A;  3UPN A;  2YKF A;  1H8Y A;  3BM6 A;  5EM0 A;  4FH2 A;  4DE2 A;  1J9M A;  3VE4 A;  4R4R A;  3UPP A;  3TW8 A;  2ZMA A;  1CK3 A;  4K91 A;  4QPR A;  4XUX A;  2K31 A;  3W4P A;  4KZA A;  1G68 A;  1ES5 A;  2PD8 A;  3C8C A;  3MXR A;  1XX2 A;  4LGW A;  1I2W A;  2J9O A;  3HLD A;  1CI8 A;  1NY0 A;  3TG9 A;  4DE0 A;  2WKH A;  4MMN A;  3HUN A;  4Y5F A;  3Q7Z A;  5HDS A;  3BFG A;  5FQQ A;  1ES3 A;  5I5L A;  1FIL A;  1IYQ A;  5AQ9 A;  3TE8 A;  1MKI A;  2PU4 A;  1YLT A;  3UPO A;  3LY4 A;  3LR0 A;  1AWI A;  4HH3 A;  3BWL A;  3R4K A;  4UA9 A;  5M19 A;  3UE3 A;  2HDR A;  2Y2P A;  5EV0 A;  5F82 A;  5TBM B;  1XFN A;  1X0O A;  4ESP A;  3MFX A;  1W63 Q;  2INW A;  1BTL A;  4OKP A;  1TD5 A;  3HJI A;  3GDI A;  1FSY A;  3FZC A;  4HHD A;  2JE5 A;  1XJ3 A;  2ZM2 A;  4D2O A;  1JTD A;  3KYE A;  3FG8 A;  4WBG A;  4X1M A;  4X6T A;  1LLB A;  5GHX A;  4R1G A;  4MEZ A;  2V20 A;  2C5W B;  4ZJ1 A;  1KGE A;  2YKH A;  5EVI B;  1YPR A;  3LR5 A;  3BJN A;  4OOY A;  4PAU A;  3AGD A;  3ZNT A;  1ES4 A;  4IED A;  1IOU A;  4WUJ A;  2ZBB A;  2ZQD A;  3BQA A;  2WZZ A;  1YKD A;  4R23 A;  4G3V A;  3LUQ A;  3ITB A;  3U2A A;  3LY3 A;  2DRW A;  2W3H A;  1IFQ A;  1XFQ A;  4IUK A;  4X25 A;  3GSG A;  3LIA A;  4YWZ A;  3UE6 A;  4GD8 A;  5A93 A;  5KZH A;  2Y2L A;  3HLW A;  1H0M A;  4U0X A;  4UHU A;  4UA7 A;  3G32 A;  4UEY A;  1W7F A;  2QJ5 A;  3B3X A;  5FA7 A;  3FWL A;  5FAO A;  5F68 A;  2X01 A;  2V1B A;  5TBM A;  2DCF A;  4QJG A;  5I94 A;  4DE3 A;  3EQV A;  1BT5 A;  3HLE A;  2M7V A;  4CLC C;  3QP1 A;  1K6S A;  3ZVT A;  5L09 A;  3F1O A;  3CI6 A;  5DJU A;  2XR0 A;  5GHY A;  1DJB A;  3MKF A;  4I38 A;  1OTA A;  2IWB A;  2L1M A;  2XLN A;  4IVI A;  3TSG A;  2G2U A;  2P9V A;  4II7 A;  3P98 A;  3UMD A;  1WYC A;  4BQM A;  5CEC A;  3IF6 B;  4HY8 A;  4U3T A;  5KMW A;  4BL2 A;  4CPK A;  4Z1W A;  3VP3 A;  1GA0 A;  3N8L A;  4OOL A;  4R3B A;  3NI9 A;  4X1L A;  4GDB A;  3WRZ A;  4HI4 A;  4X68 A;  3WS0 A;  1BSG A;  1GSV A;  1NXY A;  2M7U A;  3BY9 A;  4HJ6 A;  4KEN B;  2XSS A;  3PXP A;  3TRC A;  3ISG A;  4S2O A;  4LV3 A;  4S2M A;  4WM9 A;  3E2K A;  2WGI A;  5CHJ A;  5DFY A;  1SHV A;  5KSH A;  3MKE A;  1RP5 A;  2B18 A;  1CF0 A;  5DKK A;  1VEU B;  3MJQ A;  5HAQ A;  3FC7 A;  3V5M A;  1TS6 A;  1XA7 A;  3KYZ A;  2VV6 A;  5FEF A;  4OQ0 A;  1SKO A;  1N9O A;  5FI7 A;  4EBL A;  3FPW A;  2QYB A;  3H82 B;  3W8K A;  3RH8 B;  3UE0 A;  4EQ1 A;  4WZ4 A;  1O7E A;  3UO9 A;  4I5S A;  3IXH A;  4QWO A;  2EFU A;  2WZX A;  4JXS A;  2Y91 A;  1ODV A;  4KZB A;  3FYZ A;  2EX9 A;  1GSX A;  5GLB A;  4P87 A;  3LCE A;  1ESI A;  4OVD A;  3O87 A;  1XJ2 A;  1OPX A;  1RCJ A;  2HV1 A;  2WKR A;  3IHB A;  3NHQ A;  5TR7 A;  1PI4 A;  3DWZ A;  3SW1 A;  3ICY A;  4RA7 A;  5GL9 A;  4C3Q A;  1MY8 A;  4DDY A;  1Z6F A;  4HP4 A;  3KSF A;  4EER A;  1E25 A;  5E2G A;  5G18 A;  3BLM A;  4R38 A;  3A3I A;  2OWH A;  3WRT A;  1N9B A;  2QHK A;  1H8Z A;  4OPZ A;  2J7V A;  1LI0 A;  2ZMV A;  4O0P A;  4HP9 A;  5HW3 A;  4KQQ A;  1HZO A;  1VEU A;  1YT4 A;  3N8S A;  4QHC A;  1ONH A;  3N8R A;  3MFD A;  3SS3 A;  5DF8 A;  2VK3 A;  4IHQ A;  5AQ7 A;  5E43 A;  5J4E A;  1PWG A;  2Y2I A;  2XD1 A;  3T1R A;  1MBL A;  3E4P A;  2WGW A;  4DRT A;  3I7J A;  3HL9 A;  3S7P A;  1ESU A;  1K6R A;  2CC1 A;  3MSH A;  4PKY A;  1GHM A;  2ZOI A;  3FKV A;  1JVJ A;  4KZ8 A;  2W3D A;  1FCN A;  4S2L A;  1OT6 A;  4BWI A;  2PR5 A;  4ID4 A;  3G34 A;  3OPH A;  1F9I A;  4LV1 A;  5CEB A;  5MC7 A;  3NOU C;  2JC7 A;  3T4Q A;  5AJG A;  3NOT C;  4IVK A;  3V3R A;  3BLS A;  2HP6 A;  2OLU A;  4S2P A;  2P9V B;  2WKP A;  4E04 A;  2VJW A;  2I72 A;  5IT5 A;  4EET B;  2Y2H A;  3O88 A;  2ZL1 A;  1DP8 A;  4GHI B;  3T1X A;  1NZU A;  4JLF A;  2JKF A;  1XPB A;  4HNB A;  3VFH A;  1IEM A;  2XEP A;  1F2K A;  2B02 A;  2PAV P;  3VP2 A;  3FV7 A;  3EGD C;  3ZYT A;  2ZC6 B;  4MBH A;  5FQI A;  2QJ7 A;  2HPB A;  3BEB A;  4QY6 A;  1L0D A;  5EFW A;  2ZD8 A;  3V39 A;  1K0K A;  2Q0O A;  2Y8H A;  1W63 M;  2A24 A;  1GCE A;  3W4O A;  3VOZ A;  4LCL A;  3GRJ A;  2A3U A;  2OAQ 1;  1HLU P;  5HZH A;  5HL1 A;  5JYO A;  2J80 A;  4O7D A;  5GLC A;  1K4F A; 
#chains in the Genus database with same CATH homology
 4Y13 A;  4LFU A;  4Y17 A;  3IX4 A;  4LGW A;  3IX3 A;  3JPU A;  2AVX A;  2Q0O A;  4Y15 A;  3QP5 A;  3QP6 A;  3SZT A;  3QP8 A;  3QP2 A;  1L3L A;  3QP4 A;  5L07 A;  3IX8 A;  1H0M A;  4NG2 A;  5L10 A;  3QP1 A;  5L09 A;  2UV0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...