3IX8A

Lasr-tp3 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
ALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein lasR
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix8A00
4Y15A 4LFUA 3QP2A 3IX3A 5L10A 5L09A 2UV0E 2Q0OA 3SZTA 4Y13A 3QP1A 5L07A 3IX4A 4Y17A 2AVXA 3IX8A 3QP5A 3QP6A 3QP8A 4NG2A 3JPUA 3QP4A 1H0MA 1L3LA 4LGWA
chains in the Genus database with same CATH superfamily
4ZJ3A 2OWHA 4KZ7A 4XXRA 2HV1A 1YSPA 2XLNA 4FTXA 4JXVA 3LUQA 1JTGA 2HP6A 5EOEA 1FR1A 1RP5A 4IVIA 3PHYA 4MBKA 1P9RA 4JXSA 4KZ9A 4G3WA 3H82B 2Y2OA 5J8XA 4BL3A 4EV4A 1OTEA 1PI5A 4YNRA 4N92A 2V0WA 4HIAA 2PT7A 1MZUA 5CTMA 4WN5A 4I5SA 2V9AA 1ONHA 3ZG5A 3V50A 3LFVA 3LCEA 4KZ3A 1N9LA 1O7EA 2WZZA 4G3VA 4JGQA 2JKFA 4N9LA 3T1SA 2ZOHA 3M6HA 3ZVTA 2XD5A 3ZGAB 4OLDA 1DJBA 3IH8A 5GLCA 4ZAMA 1W63M 3M6BA 4HBTA 1IFQA 5HL6A 4HHDA 3IF6C 4R4RA 1XX2A 2QHKA 4NETA 3ITBA 1PZOA 2EWWA 2X02A 3S7PA 1YMSA 1ESUA 3FG8A 1GA0A 5TR7A 4KUKA 5EVEA 3UB9A 3G4PA 3ISGA 3OZHA 4K08A 3Q07A 2BTFP 1LI0A 4LRZE 2VX8A 4UQIM 5U47A 1VEUB 3U4LP 1LL5A 2VGLM 5CERA 1JTDA 1TVFA 1NLZA 4LFUA 5KSCA 4BQMA 3NOTC 3VE4A 4Y0OA 3G31A 4E6XA 3UO9A 1VETA 3LY4A 3KX0X 3JPUA 3LIDA 5FQIA 4ARZB 3VP1A 4EESA 4IBRA 1DP9A 3PBSA 3CITA 1NRFA 1FOFA 4BENA 1K55A 3IXGA 1SKFA 2C5WB 3RH8B 4NG2A 2XF3A 2ZC4B 4CPKA 5DKLA 4OKPA 3IXHA 4ME4A 5EM0A 5HDSA 3QP2A 3UPNA 2VKSA 3A3IA 5HFOA 2EX2A 2R9XA 3GECA 1H8YA 2VK3A 2ZC5B 1HVBA 4JGOA 3FWLA 1T1BA 1J9MA 4QB8A 1S1ZA 3H7WA 5EVLA 1NWZA 5EPHA 3QNCA 1CEFA 1DJCA 3BLSA 4U0XA 1YLYA 3T50A 3WS5A 2ZBBA 1NYMA 4E04A 1MWUA 4HH3A 3C7UA 2X01A 1SDEA 1RGZA 2LB5A 2OWJA 1KGEA 3T1QB 4JBFA 1XJ6A 2JBFA 4PMAA 5DTSA 4OPRA 2PR5A 4X68A 5MC7A 1EROA 5AQBA 2JKTM 1OJGA 4P85A 5A91A 4HBUA 1PRQA 2ZQ9A 3G2YA 4OH0A 3N8SA 5DTKA 3HL9A 1TD5A 4HP9A 2R9WA 1K56D 4MBFA 1V9YA 3ZNTA 1XA7A 4DJ3A 3OPHA 3S7QA 1ALQA 4Y3IA 2NUPC 2ZQCA 4CQHA 4HESA 3MFDA 2BASA 1W8QA 2OOLA 4KZ6A 5FEFA 2ZMAA 1ESIA 2V1BA 4F94A 5TJJA 5M18A 5TFQA 4RX2A 4P6BA 5HW3A 3L9KA 5GL9A 5FI7A 4Q0JA 1OPXA 2Y2MA 3E0YA 1IKIA 1XXMA 4NKPA 4EWFA 5A8BA 5M19A 2Y2JA 1NLYA 3Q82A 4LCMA 2GX5A 4KZ4A 3V39A 5CGSA 3FYZA 4IUHA 2XR0A 4Y17A 4DMZA 5FQMA 5A90A 1BZAA 3SH9A 4E3MA 4E3LA 1YQSA 3Q1FA 3PAEA 2Y59A 3G34A 4GS9A 2EWVA 2ZJ9A 1U60A 4IJGA 1X0OA 3G6OA 3MF0A 4GZBA 1PW1A 3N7WA 2PAVP 4NEED 3ITAA 3IBRA 2B02A 2IWBA 2HJ9C 2J80A 3OOVA 1GSVA 3A0RA 4DDSA 3A0VA 3ZG9B 2H0YA 4OPZA 4I39A 4S2PA 1UWPX 4KZAA 2EA9A 3FPWA 2W1TB 1OT6A 4CLCD 1GHIA 3WRTA 4PHTA 3ICYA 5FI2A 2HDRA 2ZD8A 4WM9A 4CLCA 1PWDA 5FQJA 4PPRA 4DDYA 3LIFA 2XD1A 1YLZA 1JNUA 2UV0E 2L4RA 3FC7A 4YINA 4K0WA 2P04A 4K0XA 3IX8A 4EETB 2ZOIA 3MXSA 1EWZA 3CJMA 2W3DA 2Y2KA 2OSUA 1ZKJA 4RA7A 5KIZA 3NOPC 3O86A 4R1GA 4NXEA 3KSIA 4O8GA 1NZOA 1BT5A 3UE6A 2R78A 2J3TC 2J9PA 3BFEA 1MWSA 2KLIA 3HCYA 2XSSA 4Y15A 2IWCA 2WGWA 3N4IA 2JKRM 5L10A 4EBLA 3NOUC 3ZG8B 4GCZA 2K7SA 4GB7A 1ERMA 1L0GA 1KDWA 3HLWA 2ZLYA 5I94A 4MN5A 3BWLA 4UAAA 2JHEA 3E4QA 3UY6A 5FASA 5DFYA 5FAOA 3T12B 5GHYA 2HDSA 2Y2NA 2HDQA 3DTKA 3UB7A 5EFWA 4LLOB 3QP1A 1T1AA 3F1NA 2XK1A 1SKOA 4QY5A 3PBOA 4N9KA 1Q2QA 2W27A 1FQGA 1H5XA 1L2SA 3QP6A 5E43A 5GLAA 4S2IA 3CUEC 4KENB 3S4XA 1NJ4A 4QPRA 4BD1A 4ESPA 3IHBA 4QU3A 3BEBA 5CXWA 2XFTA 3SOIA 1BSGA 2K31A 5L09A 4M3KA 2QJ5A 1K4FA 4PKYG 3WS2A 4DE3A 4OPQA 4WZ5A 2H5SA 3TW8A 2X71A 3CPTA 4P0MA 1IEMA 5DF9A 4B4ZA 3OCNA 2PD8A 5AVFA 3EQVA 4QY6A 1KE4A 2B18A 3LIAA 5HZHA 5EVID 3FKVA 5EE8A 1Z6FA 5TBMA 3HVFA 3UPOA 3HLFA 5EVIA 1L0DA 1MC0A 4UA7A 2JN7A 1UGUA 1G5UA 3P09A 4LGWA 5JYOA 4S2NC 2V8FA 3QNBA 4KUOA 4WEJA 1GSWA 3C4OA 2XGNA 4WBGA 5HX9A 3A3FA 3IWIA 5AQAA 3PYPA 5HSQA 1FILA 3Q81A 3UMDA 2WAFA 1ACFA 2J7VA 4ZRRA 4GN2A 5FATA 2W3FA 4X25A 1IYPA 3OPPA 4L9EA 4JGPA 2PBYA 1VETB 5EUAA 4LV3A 1KOUA 1KGGA 3B3XA 5KMWA 1MKIA 2RCXA 2ZC6B 4KG6A 1GSXA 4GDNA 4X56A 5IS1A 2W1RA 3W4QA 3LY3A 3GQZA 2Y2IA 5F1GA 1WYCA 5AJGA 1PWCA 4WMCA 2D02A 3LR4A 2HDUA 2B5RA 4EXOA 4HOIA 2OLUA 1DJAA 4RX3A 2Y2QA 2AVXA 2JCHA 3T4QA 5TGFA 2ZQ7A 2XEPA 3VV4A 4R3JA 4LV2A 4ZDXA 4UQIS 3ZYTA 4FH4A 3WS1A 2VGLS 3LIEA 2WZXA 4OOMA 4YOFA 3S1YA 4BJPA 5F1FA 3NECA 1DP8A 4S2OA 3L7HA 5DTTA 5FDHA 2Q9NA 4Y13A 5D3OA 3H7WB 5DF8A 2WYXA 2QWSA 3HLGA 3KSFA 2V2FF 4AFIA 1YLPA 3G2ZA 2FH5A 1LT0A 3CWFA 4ETXA 4PM5A 1CK3A 1XGJA 4EUVA 3HUMA 3VP0A 4E6WA 1CQAA 1K57A 3PBRA 5F82A 4R3AA 3D72A 4L9GA 2EXAA 3C38A 3W4OA 2GDNA 1D06A 3OCLA 2PU2A 4O7DA 3HLCA 1S67L 5DKKA 1H8ZA 2M7UA 2PU4A 3UN7A 3ZCZA 2VZWA 2EX8A 5JYPA 1TF1A 1W79A 3JVVA 1YLWA 2O99A 3QP8A 2XA7M 4MLLA 1A0KA 1LLBA 1VHMA 3UDFA 4BWIA 5DF7A 4DRTA 2G7UA 2Z6CA 3RJUA 1VQQA 2VGKA 4UA9A 4DXCA 5M1AA 4MN7A 3DTEA 1YM1A 4RYEA 2RL3A 1MY8A 4JF5A 2LB9A 4C75A 3MXRA 3SH8A 1XA1A 1MKMA 4IVKA 4OLGA 3UB8A 4F3LA 4OONA 1ERQA 3VMAA 4Y0UA 2JE5A 2NUTC 1HTZA 4OQ0A 2HGVA 2BG1A 5EV0A 1P0ZA 4HH2A 4RQ9A 3UDXA 3CI6A 3K2NA 4JXWA 2HPBA 3PBQA 1T19A 2VEAA 5CTNA 2O9CA 3E4PA 2WKPA 3KYQA 4GHIA 4UHUA 4FCFA 4K91A 3ZDJA 2ZM8A 1QMEA 4NXFA 4WL9A 3MQOA 1G68A 5FA7A 3T4KA 4KQOA 4HY8A 5E2GA 3UNWA 4GJ4A 1WE4A 1O07A 1PNEA 2WAEA 5C5KA 1RCJA 2Y79A 5EOOA 2QYBA 2CC1A 5LBRA 1CI8A 4B93A 5J4EA 3LIBA 3PBNA 5IU1A 4I38A 1FIKA 4B9OA 5I5LA 2HF6A 1FSYA 2V0UA 3B33A 2V8CA 2W3HA 5HD3A 3MJQA 3AGDA 5HAPA 3EOIA 3WS4A 4KG2A 3TJZC 3IH9A 4R38A 3DBAA 3HLDA 2QMIA 4C6YA 2G2UA 2M1CA 1N9OA 3GR2A 1VM1A 1VEUA 2H0TA 3JYIA 4OQIA 1PFLA 4PAUA 1F5MA 4CLCB 4HEFA 1P9WA 3LR0A 1XFNA 2Y2HA 3JVUA 1RGYA 4CLCE 1YPRA 4ZJ1A 2EX9A 1JWVA 2HP9A 4OP5A 2WADA 2ZM2A 1BULA 3E4OA 1W7FA 4JF6A 3NIAA 2L0WA 4FH2A 4D2OA 3E98A 2EFUA 1KE0A 5F69A 2W0NA 1PWGA 1K4EA 3T4JA 3H9WA 3R7WA 1TS8A 1H8MA 1EW0A 3IXBA 1TEMA 3Q7VA 5AVEA 4UEYA 1XJ2A 2WGWB 4DF6A 4FD8A 5DJUA 2V20A 3LR5A 3ZG7B 3HBRA 1WA9A 2WK0A 3MS6A 1DY6A 1ZG4A 4MNRA 3W4PA 5F68A 4XUZA 4Q0HA 1M6KA 2J9OA 2DCFA 5IT5A 4NXBA 4JGRA 2VV6A 3CHWP 3S22A 2XRNA 4IBXA 3FV7A 4S2KA 4Y2FA 3MZDA 4R6LA 4CJNA 2PD7A 1OMEA 3F1NB 2ACGA 1SKOB 2QZ6A 3V5MA 3MQ0A 5HDDA 1FCNA 3LO7A 3UE3A 4A5RA 4KQQA 4KQRA 3F1PA 5DJTA 1XKZA 2WKQA 2ZMFA 3OPRA 3BY8A 3VE3A 1FCOA 1HZOA 5CEBA 3B42A 3BECA 4JKTA 4E3IA 1YMXA 3T1XA 3IT9A 4FUWA 1H0MA 4R0QA 3ZVWA 5FI6A 4S2JA 4I3AA 3EEAA 2HJEA 4KZ5A 3CPTB 2PDRA 3LR3A 3R4KA 3VSLA 3ZQ5A 3G32A 4N1XA 1L0FA 2K2NA 1GHMA 3GRJA 1BLPA 3EGXC 2ZQAA 3EWKA 4EQIA 3TG9A 3UB6A 3W8KA 5TBMB 3UE1A 2H28A 5EVIB 4ZBEA 1K54A 4GD6A 4OPYA 5CRFA 3TSGA 5GLDA 2JKTI 4LV0A 4OQHA 4GKUA 1TS6A 3GTCA 2PR6A 2O9BA 2ZQDA 4IEDA 1XJ3A 4X69A 2GZAA 3ULFA 1Y28A 5AQ7A 1AXBA 3C4PA 4MN6A 4E3OA 3NDEA 1S6RA 3KO6A 3NC8A 1CEGA 3G35A 4BBTA 1JVJA 2ZMVA 1UWNX 4WUJA 4ZTKA 3D9YA 2ZL1A 1L3LA 1K38A 1ONGA 1FR6A 4EU0A 2WUQA 2VA0A 1N4OA 3ZFZA 1PI4A 1IKGA 1I2WA 1LI9A 4GD8A 4II7A 3MXQA 2WKRA 3BRMA 2OLVA 2PRFA 1QMFA 4PKYA 4XT2A 3A0SA 3MMHA 4H6JA 1NZUA 3OPLA 1ODVA 2G2WA 2EXBA 4E3KA 4DXBA 3PR6A 2P9VA 3IF6A 3VFFA 4QHCA 3VOLA 3E2LA 1BLSA 1ZG6A 5CHUA 3PXPA 1YLJA 4BBVA 4YFMA 5BOHA 3UB5P 3C30A 2Z2LB 4OOYA 3BJNA 1PZPA 5EECA 5HARA 3NY4A 5KSHA 4RVAA 1XFQA 4DJ2A 4BBUA 2KDKA 3F1OA 2A24A 2W1TA 1XJ4A 5J7EA 2VV7A 3T4SA 3C7VA 4JXGA 3SZTA 4LCLA 3QP5A 5E2HA 1E4DA 2VJWA 2P74A 2XQZA 4KZ8A 4LRXC 4U3TA 2CMNA 3LI9A 4ZJ2A 5K5BA 5G4ZA 4D60A 3IF5A 4X6TA 2HP5A 1JWPA 3A3JA 1K6SA 3EEHA 4BD0A 5L07A 3IX4A 3BM6A 5L2FA 3MQQA 4CLCC 3IS2A 1ES2A 4GOGA 3A3EA 2PHYA 1IYQA 2DRWA 4ID4A 1T18A 3ZG0A 3PBTA 1BTLA 3IQAA 1PIOA 4R70A 1BLHA 4WMCD 1S4SA 3V3RA 3BQ8A 4LPZA 5L8MA 4MCWA 1AWIA 1L0EA 4U0TA 1LSXA 3ZHHA 3CG5A 3RFBA 3LI8A 4JLFA 2QKPA 4OP8A 3PAGA 4PM6A 3N6IA 4M4XA 1D1JA 3G30A 4P6ZM 4F3LB 4HQAA 3NHQA 4GW9A 1ZTUA 2UWXA 2I72A 4E3JA 2A2LA 4X53A 1ZC2A 2A3UA 1IYSA 3QP4A 5DVAA 1S0WA 1PW8A 2W3GA 3DWKA 3BY9A 2JKRI 1H3QA 3K3CA 4L9FA 1N9BA 4GHIB 3SW1A 3U2AA 3C8CA 1DP6A 1KGFA 4OOLA 1P97A 3CLOA 3DW0A 5J3WA 1NRJA 2XA7S 1N9NA 2Y2LA 3DAVA 3CZDA 1C3BA 3HUOA 4PM8A 4OVDA 4DE1A 3P98A 2HZ5A 1F98A 4E3NA 4Z1WA 1ES5A 4WF0A 2PBDP 3MBZA 2Q0OA 5CGXA 1YT4A 3NDGA 1Y4OA 3LICA 1G28A 3UMEA 3VOZA 1I5QA 1LL9A 3OC2A 4L0LA 2M7VA 4HJ6A 4UA6A 3EQUA 1PYYA 3LGOA 4BL2A 4WZ5C 4XUXA 3WS0A 1KVMA 4Q8IA 2V1AA 1FSWA 2OV5A 4EUZA 3A3DA 3S7OA 4JPMA 3HLBA 3BFCA 5CECA 1CF0A 1EI5A 2ZM0A 4QWOA 1TS7A 1XGIA 4H8RA 1NXYA 1TDLA 4WZ4A 3PTEA 5G4YA 3HUNA 5EVIC 5FDSA 4Y5FA 3IHAA 3UE0A 2P08A 1VB6A 4GLQA 4I3JA 1S1YA 2I9VA 4EEPA 3NI9A 2GNXA 3GVBA 4X55A 3MFXA 1E25A 1BYWA 3H82A 3B47A 3R7WB 3VFHA 4X1MA 4BMWA 2Z2MB 3QHYA 4Y7PA 3DTIA 3Q7VB 2QPNA 1I2SA 4HJ3A 4QD4A 3SS4A 4GNUA 2Y2GA 3KYZA 1SDNA 3MKEA 4WELA 1DRMA 5CHMA 3VP2A 1Q2PA 4B88A 3KYEA 4Z9QA 5HL1A 1M40A 3DWZA 3FKWA 4GS9B 3HJIA 3T4OA 3NULA 2XFSA 5FAQA 2Q9MA 3SH7A 3OBFA 1ZHHB 1IYOA 5FEGA 3VSKA 1LSWA 3AGEA 2QJ7A 1KDSA 3O87A 4PM7A 4DE2A 3Q7ZA 3BLMA 3RXWA 1JWZA 3BFFA 4DE0A 1WYBA 2P7JA 1MPLA 3F1PB 3I7JA 4Y0TA 4B4XA 2WKHA 3N8LA 2C6WB 1F2KA 3VP4A 2Z6DA 1D7EA 1G6OA 1SZVA 2ZC3B 1TS0A 1CJFA 3MSHA 1S66L 3LEQA 1BUEA 2J3TD 4EERA 1OTDA 5F6AA 4HI4A 1YLTA 1Z09A 2WGIA 4NXGA 1W5DA 1K57C 4O01A 3BFDA 2WKEA 3HLEA 2IWDA 4WYYA 2YKHA 2OAP1 3WRZA 4ARZA 3CMZA 1K56A 2J8YA 3V3SA 3T4TA 1Y54A 4EQ1A 3O3VA 4EBPA 3GDIA 3VP3A 1OTAA 4QJGA 5HWWA 1S4RA 1GHPA 1KE3A 1GA9A 4EW7A 5FQKA 2BLSA 2ZQ8A 2E8JA 1OTBA 3GV9A 5HAIA 4P87A 4C3QA 3T4LA 1V9ZA 5HPFA 3FPVA 1YSQA 5CGWA 4DN0A 1W63Q 1YKDA 2GJ3A 5HD5A 3CUEA 1K55C 1HD8A 2ZL1B 4ETZA 1F9IA 3MR0A 3M2KA 5GLBA 3SS5A 3IXDA 5A92A 4BLMA 5HPIA 2PYPA 2PYRA 4KG5A 2H10A 1ES3A 1HLUP 3GMWA 1BLCA 3C5AA 4XT2B 5KZHA 4H6JB 3GSGA 3NCKA 3D4FA 4Q0IA 5CX7A 5AQ9A 4N1HA 2VV8A 2Y2PA 5E2FA 3UPPA 3MKFA 3RXXA 2DNSA 2P9VB 4FSFA 3IF6B 3KSGA 4S2LA 4MBHA 4YWZA 3BYDA 5FAPA 3IWOA 1LHYA 3C2WA 1W8YA 1E3UD 4EEUA 1XP4A 3S7NA 2Y4AA 3W2ZA 1SHVA 4S2NA 2KX6A 1E3UA 2L1MA 3BQAA 3F1OB 2A24B 4R3BA 5E2EA 5HAQA 5A93A 2W3EA 1OTIA 3OLOA 4KZBA 1MWTA 1IELA 3BW6A 4EBNA 2V1ZA 5IHVA 1T1CA 3HJKA 2IA2A 2D01A 3NJAA 2KOIA 2JKGA 1LSVA 4IHQA 2WGVA 4FOFA 1TDGA 5FQQA 4R23A 3M2JA 3MZFA 4O0PA 3DTMA 3FZCA 4LRYC 3MZEA 2EFXA 4HP4A 1YAXA 5FL3A 1SCWA 1ES4A 4KQDA 4MDZA 5CEDA 3IS2B 2FFFB 4PM9A 3O88A 5DFXA 1FCMA 3WWXA 3TRCA 1K25A 1MWRA 2VLGA 4DKIA 3TOIA 1NYYA 2XDMA 2EX6A 4IUKA 4LV1A 4R4SA 2DMWA 5FSRA 3SS3A 4NK3A 3D3OA 4X1LA 1LL8A 3VOYA 1MBLA 1OT9A 4MEZA 5CHJA 2MJ6A 2O0YA 1CI9A 1OJ5A 4HJ4A 2J3WA 4HNBA 2A49A 4JF4A 2FFYA 4MMNA 3EGDC 3P01A 3T1RA 3CAXA 2Y8HA 2INWA 3BFGA 2YKFA 5HWTA 2XROA 3IX3A 2XH9A 4S2MA 3NBLA 1J3WA 4I3IA 1MXOA 1K6RA 1STZA 4OQGA 2Y91A 3K3DA 2ZC7A 4G3KA 5HDCA 3P7NA 3IBJA 2FZ0A 3E2KA 3N8RA 2O9AA 3UDIA 5G18A 1KVLA 4WEKA 3HREA 2OAQ1 4P6ZS 4WLAA 1IOUA 3TE8A 3AGFA 2E8IA 3LEZA 1XPBA 1GCEA 3LYXA 5GHXA 1G6AA 2WKIA 3IWQA 5F83A 3V67A 4GDBA 5GHZA 4LENA 5HWVA 3ZNYA 2B95A 2VGJA 5EM1A 5F5YA 1K0KA 3KSHA 3O5YA 2Y55A 1K54C 1NY0A 2JC7A 3RTYA 5FQ9A
chains in the Genus database with same CATH topology
4Y15A 4LFUA 3QP2A 3IX3A 5L10A 5L09A 2UV0E 2Q0OA 3SZTA 4Y13A 3QP1A 5L07A 3IX4A 4Y17A 2AVXA 3IX8A 3QP5A 3QP6A 3QP8A 4NG2A 3JPUA 3QP4A 1H0MA 1L3LA 4LGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y15 A;  4LFU A;  3QP2 A;  3IX3 A;  5L10 A;  5L09 A;  2UV0 E;  2Q0O A;  3SZT A;  4Y13 A;  3QP1 A;  5L07 A;  3IX4 A;  4Y17 A;  2AVX A;  3IX8 A;  3QP5 A;  3QP6 A;  3QP8 A;  4NG2 A;  3JPU A;  3QP4 A;  1H0M A;  1L3L A;  4LGW A; 
#chains in the Genus database with same CATH topology
 4ZJ3 A;  2OWH A;  4KZ7 A;  4XXR A;  2HV1 A;  1YSP A;  2XLN A;  4FTX A;  4JXV A;  3LUQ A;  1JTG A;  2HP6 A;  5EOE A;  1FR1 A;  1RP5 A;  4IVI A;  3PHY A;  4MBK A;  1P9R A;  4JXS A;  4KZ9 A;  4G3W A;  3H82 B;  2Y2O A;  5J8X A;  4BL3 A;  4EV4 A;  1OTE A;  1PI5 A;  4YNR A;  4N92 A;  2V0W A;  4HIA A;  2PT7 A;  1MZU A;  5CTM A;  4WN5 A;  4I5S A;  2V9A A;  1ONH A;  3ZG5 A;  3V50 A;  3LFV A;  3LCE A;  4KZ3 A;  1N9L A;  1O7E A;  2WZZ A;  4G3V A;  4JGQ A;  2JKF A;  4N9L A;  3T1S A;  2ZOH A;  3M6H A;  3ZVT A;  2XD5 A;  3ZGA B;  4OLD A;  1DJB A;  3IH8 A;  5GLC A;  4ZAM A;  1W63 M;  3M6B A;  4HBT A;  1IFQ A;  5HL6 A;  4HHD A;  3IF6 C;  4R4R A;  1XX2 A;  2QHK A;  4NET A;  3ITB A;  1PZO A;  2EWW A;  2X02 A;  3S7P A;  1YMS A;  1ESU A;  3FG8 A;  1GA0 A;  5TR7 A;  4KUK A;  5EVE A;  3UB9 A;  3G4P A;  3ISG A;  3OZH A;  4K08 A;  3Q07 A;  2BTF P;  1LI0 A;  4LRZ E;  2VX8 A;  4UQI M;  5U47 A;  1VEU B;  3U4L P;  1LL5 A;  2VGL M;  5CER A;  1JTD A;  1TVF A;  1NLZ A;  4LFU A;  5KSC A;  4BQM A;  3NOT C;  3VE4 A;  4Y0O A;  3G31 A;  4E6X A;  3UO9 A;  1VET A;  3LY4 A;  3KX0 X;  3JPU A;  3LID A;  5FQI A;  4ARZ B;  3VP1 A;  4EES A;  4IBR A;  1DP9 A;  3PBS A;  3CIT A;  1NRF A;  1FOF A;  4BEN A;  1K55 A;  3IXG A;  1SKF A;  2C5W B;  3RH8 B;  4NG2 A;  2XF3 A;  2ZC4 B;  4CPK A;  5DKL A;  4OKP A;  3IXH A;  4ME4 A;  5EM0 A;  5HDS A;  3QP2 A;  3UPN A;  2VKS A;  3A3I A;  5HFO A;  2EX2 A;  2R9X A;  3GEC A;  1H8Y A;  2VK3 A;  2ZC5 B;  1HVB A;  4JGO A;  3FWL A;  1T1B A;  1J9M A;  4QB8 A;  1S1Z A;  3H7W A;  5EVL A;  1NWZ A;  5EPH A;  3QNC A;  1CEF A;  1DJC A;  3BLS A;  4U0X A;  1YLY A;  3T50 A;  3WS5 A;  2ZBB A;  1NYM A;  4E04 A;  1MWU A;  4HH3 A;  3C7U A;  2X01 A;  1SDE A;  1RGZ A;  2LB5 A;  2OWJ A;  1KGE A;  3T1Q B;  4JBF A;  1XJ6 A;  2JBF A;  4PMA A;  5DTS A;  4OPR A;  2PR5 A;  4X68 A;  5MC7 A;  1ERO A;  5AQB A;  2JKT M;  1OJG A;  4P85 A;  5A91 A;  4HBU A;  1PRQ A;  2ZQ9 A;  3G2Y A;  4OH0 A;  3N8S A;  5DTK A;  3HL9 A;  1TD5 A;  4HP9 A;  2R9W A;  1K56 D;  4MBF A;  1V9Y A;  3ZNT A;  1XA7 A;  4DJ3 A;  3OPH A;  3S7Q A;  1ALQ A;  4Y3I A;  2NUP C;  2ZQC A;  4CQH A;  4HES A;  3MFD A;  2BAS A;  1W8Q A;  2OOL A;  4KZ6 A;  5FEF A;  2ZMA A;  1ESI A;  2V1B A;  4F94 A;  5TJJ A;  5M18 A;  5TFQ A;  4RX2 A;  4P6B A;  5HW3 A;  3L9K A;  5GL9 A;  5FI7 A;  4Q0J A;  1OPX A;  2Y2M A;  3E0Y A;  1IKI A;  1XXM A;  4NKP A;  4EWF A;  5A8B A;  5M19 A;  2Y2J A;  1NLY A;  3Q82 A;  4LCM A;  2GX5 A;  4KZ4 A;  3V39 A;  5CGS A;  3FYZ A;  4IUH A;  2XR0 A;  4Y17 A;  4DMZ A;  5FQM A;  5A90 A;  1BZA A;  3SH9 A;  4E3M A;  4E3L A;  1YQS A;  3Q1F A;  3PAE A;  2Y59 A;  3G34 A;  4GS9 A;  2EWV A;  2ZJ9 A;  1U60 A;  4IJG A;  1X0O A;  3G6O A;  3MF0 A;  4GZB A;  1PW1 A;  3N7W A;  2PAV P;  4NEE D;  3ITA A;  3IBR A;  2B02 A;  2IWB A;  2HJ9 C;  2J80 A;  3OOV A;  1GSV A;  3A0R A;  4DDS A;  3A0V A;  3ZG9 B;  2H0Y A;  4OPZ A;  4I39 A;  4S2P A;  1UWP X;  4KZA A;  2EA9 A;  3FPW A;  2W1T B;  1OT6 A;  4CLC D;  1GHI A;  3WRT A;  4PHT A;  3ICY A;  5FI2 A;  2HDR A;  2ZD8 A;  4WM9 A;  4CLC A;  1PWD A;  5FQJ A;  4PPR A;  4DDY A;  3LIF A;  2XD1 A;  1YLZ A;  1JNU A;  2UV0 E;  2L4R A;  3FC7 A;  4YIN A;  4K0W A;  2P04 A;  4K0X A;  3IX8 A;  4EET B;  2ZOI A;  3MXS A;  1EWZ A;  3CJM A;  2W3D A;  2Y2K A;  2OSU A;  1ZKJ A;  4RA7 A;  5KIZ A;  3NOP C;  3O86 A;  4R1G A;  4NXE A;  3KSI A;  4O8G A;  1NZO A;  1BT5 A;  3UE6 A;  2R78 A;  2J3T C;  2J9P A;  3BFE A;  1MWS A;  2KLI A;  3HCY A;  2XSS A;  4Y15 A;  2IWC A;  2WGW A;  3N4I A;  2JKR M;  5L10 A;  4EBL A;  3NOU C;  3ZG8 B;  4GCZ A;  2K7S A;  4GB7 A;  1ERM A;  1L0G A;  1KDW A;  3HLW A;  2ZLY A;  5I94 A;  4MN5 A;  3BWL A;  4UAA A;  2JHE A;  3E4Q A;  3UY6 A;  5FAS A;  5DFY A;  5FAO A;  3T12 B;  5GHY A;  2HDS A;  2Y2N A;  2HDQ A;  3DTK A;  3UB7 A;  5EFW A;  4LLO B;  3QP1 A;  1T1A A;  3F1N A;  2XK1 A;  1SKO A;  4QY5 A;  3PBO A;  4N9K A;  1Q2Q A;  2W27 A;  1FQG A;  1H5X A;  1L2S A;  3QP6 A;  5E43 A;  5GLA A;  4S2I A;  3CUE C;  4KEN B;  3S4X A;  1NJ4 A;  4QPR A;  4BD1 A;  4ESP A;  3IHB A;  4QU3 A;  3BEB A;  5CXW A;  2XFT A;  3SOI A;  1BSG A;  2K31 A;  5L09 A;  4M3K A;  2QJ5 A;  1K4F A;  4PKY G;  3WS2 A;  4DE3 A;  4OPQ A;  4WZ5 A;  2H5S A;  3TW8 A;  2X71 A;  3CPT A;  4P0M A;  1IEM A;  5DF9 A;  4B4Z A;  3OCN A;  2PD8 A;  5AVF A;  3EQV A;  4QY6 A;  1KE4 A;  2B18 A;  3LIA A;  5HZH A;  5EVI D;  3FKV A;  5EE8 A;  1Z6F A;  5TBM A;  3HVF A;  3UPO A;  3HLF A;  5EVI A;  1L0D A;  1MC0 A;  4UA7 A;  2JN7 A;  1UGU A;  1G5U A;  3P09 A;  4LGW A;  5JYO A;  4S2N C;  2V8F A;  3QNB A;  4KUO A;  4WEJ A;  1GSW A;  3C4O A;  2XGN A;  4WBG A;  5HX9 A;  3A3F A;  3IWI A;  5AQA A;  3PYP A;  5HSQ A;  1FIL A;  3Q81 A;  3UMD A;  2WAF A;  1ACF A;  2J7V A;  4ZRR A;  4GN2 A;  5FAT A;  2W3F A;  4X25 A;  1IYP A;  3OPP A;  4L9E A;  4JGP A;  2PBY A;  1VET B;  5EUA A;  4LV3 A;  1KOU A;  1KGG A;  3B3X A;  5KMW A;  1MKI A;  2RCX A;  2ZC6 B;  4KG6 A;  1GSX A;  4GDN A;  4X56 A;  5IS1 A;  2W1R A;  3W4Q A;  3LY3 A;  3GQZ A;  2Y2I A;  5F1G A;  1WYC A;  5AJG A;  1PWC A;  4WMC A;  2D02 A;  3LR4 A;  2HDU A;  2B5R A;  4EXO A;  4HOI A;  2OLU A;  1DJA A;  4RX3 A;  2Y2Q A;  2AVX A;  2JCH A;  3T4Q A;  5TGF A;  2ZQ7 A;  2XEP A;  3VV4 A;  4R3J A;  4LV2 A;  4ZDX A;  4UQI S;  3ZYT A;  4FH4 A;  3WS1 A;  2VGL S;  3LIE A;  2WZX A;  4OOM A;  4YOF A;  3S1Y A;  4BJP A;  5F1F A;  3NEC A;  1DP8 A;  4S2O A;  3L7H A;  5DTT A;  5FDH A;  2Q9N A;  4Y13 A;  5D3O A;  3H7W B;  5DF8 A;  2WYX A;  2QWS A;  3HLG A;  3KSF A;  2V2F F;  4AFI A;  1YLP A;  3G2Z A;  2FH5 A;  1LT0 A;  3CWF A;  4ETX A;  4PM5 A;  1CK3 A;  1XGJ A;  4EUV A;  3HUM A;  3VP0 A;  4E6W A;  1CQA A;  1K57 A;  3PBR A;  5F82 A;  4R3A A;  3D72 A;  4L9G A;  2EXA A;  3C38 A;  3W4O A;  2GDN A;  1D06 A;  3OCL A;  2PU2 A;  4O7D A;  3HLC A;  1S67 L;  5DKK A;  1H8Z A;  2M7U A;  2PU4 A;  3UN7 A;  3ZCZ A;  2VZW A;  2EX8 A;  5JYP A;  1TF1 A;  1W79 A;  3JVV A;  1YLW A;  2O99 A;  3QP8 A;  2XA7 M;  4MLL A;  1A0K A;  1LLB A;  1VHM A;  3UDF A;  4BWI A;  5DF7 A;  4DRT A;  2G7U A;  2Z6C A;  3RJU A;  1VQQ A;  2VGK A;  4UA9 A;  4DXC A;  5M1A A;  4MN7 A;  3DTE A;  1YM1 A;  4RYE A;  2RL3 A;  1MY8 A;  4JF5 A;  2LB9 A;  4C75 A;  3MXR A;  3SH8 A;  1XA1 A;  1MKM A;  4IVK A;  4OLG A;  3UB8 A;  4F3L A;  4OON A;  1ERQ A;  3VMA A;  4Y0U A;  2JE5 A;  2NUT C;  1HTZ A;  4OQ0 A;  2HGV A;  2BG1 A;  5EV0 A;  1P0Z A;  4HH2 A;  4RQ9 A;  3UDX A;  3CI6 A;  3K2N A;  4JXW A;  2HPB A;  3PBQ A;  1T19 A;  2VEA A;  5CTN A;  2O9C A;  3E4P A;  2WKP A;  3KYQ A;  4GHI A;  4UHU A;  4FCF A;  4K91 A;  3ZDJ A;  2ZM8 A;  1QME A;  4NXF A;  4WL9 A;  3MQO A;  1G68 A;  5FA7 A;  3T4K A;  4KQO A;  4HY8 A;  5E2G A;  3UNW A;  4GJ4 A;  1WE4 A;  1O07 A;  1PNE A;  2WAE A;  5C5K A;  1RCJ A;  2Y79 A;  5EOO A;  2QYB A;  2CC1 A;  5LBR A;  1CI8 A;  4B93 A;  5J4E A;  3LIB A;  3PBN A;  5IU1 A;  4I38 A;  1FIK A;  4B9O A;  5I5L A;  2HF6 A;  1FSY A;  2V0U A;  3B33 A;  2V8C A;  2W3H A;  5HD3 A;  3MJQ A;  3AGD A;  5HAP A;  3EOI A;  3WS4 A;  4KG2 A;  3TJZ C;  3IH9 A;  4R38 A;  3DBA A;  3HLD A;  2QMI A;  4C6Y A;  2G2U A;  2M1C A;  1N9O A;  3GR2 A;  1VM1 A;  1VEU A;  2H0T A;  3JYI A;  4OQI A;  1PFL A;  4PAU A;  1F5M A;  4CLC B;  4HEF A;  1P9W A;  3LR0 A;  1XFN A;  2Y2H A;  3JVU A;  1RGY A;  4CLC E;  1YPR A;  4ZJ1 A;  2EX9 A;  1JWV A;  2HP9 A;  4OP5 A;  2WAD A;  2ZM2 A;  1BUL A;  3E4O A;  1W7F A;  4JF6 A;  3NIA A;  2L0W A;  4FH2 A;  4D2O A;  3E98 A;  2EFU A;  1KE0 A;  5F69 A;  2W0N A;  1PWG A;  1K4E A;  3T4J A;  3H9W A;  3R7W A;  1TS8 A;  1H8M A;  1EW0 A;  3IXB A;  1TEM A;  3Q7V A;  5AVE A;  4UEY A;  1XJ2 A;  2WGW B;  4DF6 A;  4FD8 A;  5DJU A;  2V20 A;  3LR5 A;  3ZG7 B;  3HBR A;  1WA9 A;  2WK0 A;  3MS6 A;  1DY6 A;  1ZG4 A;  4MNR A;  3W4P A;  5F68 A;  4XUZ A;  4Q0H A;  1M6K A;  2J9O A;  2DCF A;  5IT5 A;  4NXB A;  4JGR A;  2VV6 A;  3CHW P;  3S22 A;  2XRN A;  4IBX A;  3FV7 A;  4S2K A;  4Y2F A;  3MZD A;  4R6L A;  4CJN A;  2PD7 A;  1OME A;  3F1N B;  2ACG A;  1SKO B;  2QZ6 A;  3V5M A;  3MQ0 A;  5HDD A;  1FCN A;  3LO7 A;  3UE3 A;  4A5R A;  4KQQ A;  4KQR A;  3F1P A;  5DJT A;  1XKZ A;  2WKQ A;  2ZMF A;  3OPR A;  3BY8 A;  3VE3 A;  1FCO A;  1HZO A;  5CEB A;  3B42 A;  3BEC A;  4JKT A;  4E3I A;  1YMX A;  3T1X A;  3IT9 A;  4FUW A;  1H0M A;  4R0Q A;  3ZVW A;  5FI6 A;  4S2J A;  4I3A A;  3EEA A;  2HJE A;  4KZ5 A;  3CPT B;  2PDR A;  3LR3 A;  3R4K A;  3VSL A;  3ZQ5 A;  3G32 A;  4N1X A;  1L0F A;  2K2N A;  1GHM A;  3GRJ A;  1BLP A;  3EGX C;  2ZQA A;  3EWK A;  4EQI A;  3TG9 A;  3UB6 A;  3W8K A;  5TBM B;  3UE1 A;  2H28 A;  5EVI B;  4ZBE A;  1K54 A;  4GD6 A;  4OPY A;  5CRF A;  3TSG A;  5GLD A;  2JKT I;  4LV0 A;  4OQH A;  4GKU A;  1TS6 A;  3GTC A;  2PR6 A;  2O9B A;  2ZQD A;  4IED A;  1XJ3 A;  4X69 A;  2GZA A;  3ULF A;  1Y28 A;  5AQ7 A;  1AXB A;  3C4P A;  4MN6 A;  4E3O A;  3NDE A;  1S6R A;  3KO6 A;  3NC8 A;  1CEG A;  3G35 A;  4BBT A;  1JVJ A;  2ZMV A;  1UWN X;  4WUJ A;  4ZTK A;  3D9Y A;  2ZL1 A;  1L3L A;  1K38 A;  1ONG A;  1FR6 A;  4EU0 A;  2WUQ A;  2VA0 A;  1N4O A;  3ZFZ A;  1PI4 A;  1IKG A;  1I2W A;  1LI9 A;  4GD8 A;  4II7 A;  3MXQ A;  2WKR A;  3BRM A;  2OLV A;  2PRF A;  1QMF A;  4PKY A;  4XT2 A;  3A0S A;  3MMH A;  4H6J A;  1NZU A;  3OPL A;  1ODV A;  2G2W A;  2EXB A;  4E3K A;  4DXB A;  3PR6 A;  2P9V A;  3IF6 A;  3VFF A;  4QHC A;  3VOL A;  3E2L A;  1BLS A;  1ZG6 A;  5CHU A;  3PXP A;  1YLJ A;  4BBV A;  4YFM A;  5BOH A;  3UB5 P;  3C30 A;  2Z2L B;  4OOY A;  3BJN A;  1PZP A;  5EEC A;  5HAR A;  3NY4 A;  5KSH A;  4RVA A;  1XFQ A;  4DJ2 A;  4BBU A;  2KDK A;  3F1O A;  2A24 A;  2W1T A;  1XJ4 A;  5J7E A;  2VV7 A;  3T4S A;  3C7V A;  4JXG A;  3SZT A;  4LCL A;  3QP5 A;  5E2H A;  1E4D A;  2VJW A;  2P74 A;  2XQZ A;  4KZ8 A;  4LRX C;  4U3T A;  2CMN A;  3LI9 A;  4ZJ2 A;  5K5B A;  5G4Z A;  4D60 A;  3IF5 A;  4X6T A;  2HP5 A;  1JWP A;  3A3J A;  1K6S A;  3EEH A;  4BD0 A;  5L07 A;  3IX4 A;  3BM6 A;  5L2F A;  3MQQ A;  4CLC C;  3IS2 A;  1ES2 A;  4GOG A;  3A3E A;  2PHY A;  1IYQ A;  2DRW A;  4ID4 A;  1T18 A;  3ZG0 A;  3PBT A;  1BTL A;  3IQA A;  1PIO A;  4R70 A;  1BLH A;  4WMC D;  1S4S A;  3V3R A;  3BQ8 A;  4LPZ A;  5L8M A;  4MCW A;  1AWI A;  1L0E A;  4U0T A;  1LSX A;  3ZHH A;  3CG5 A;  3RFB A;  3LI8 A;  4JLF A;  2QKP A;  4OP8 A;  3PAG A;  4PM6 A;  3N6I A;  4M4X A;  1D1J A;  3G30 A;  4P6Z M;  4F3L B;  4HQA A;  3NHQ A;  4GW9 A;  1ZTU A;  2UWX A;  2I72 A;  4E3J A;  2A2L A;  4X53 A;  1ZC2 A;  2A3U A;  1IYS A;  3QP4 A;  5DVA A;  1S0W A;  1PW8 A;  2W3G A;  3DWK A;  3BY9 A;  2JKR I;  1H3Q A;  3K3C A;  4L9F A;  1N9B A;  4GHI B;  3SW1 A;  3U2A A;  3C8C A;  1DP6 A;  1KGF A;  4OOL A;  1P97 A;  3CLO A;  3DW0 A;  5J3W A;  1NRJ A;  2XA7 S;  1N9N A;  2Y2L A;  3DAV A;  3CZD A;  1C3B A;  3HUO A;  4PM8 A;  4OVD A;  4DE1 A;  3P98 A;  2HZ5 A;  1F98 A;  4E3N A;  4Z1W A;  1ES5 A;  4WF0 A;  2PBD P;  3MBZ A;  2Q0O A;  5CGX A;  1YT4 A;  3NDG A;  1Y4O A;  3LIC A;  1G28 A;  3UME A;  3VOZ A;  1I5Q A;  1LL9 A;  3OC2 A;  4L0L A;  2M7V A;  4HJ6 A;  4UA6 A;  3EQU A;  1PYY A;  3LGO A;  4BL2 A;  4WZ5 C;  4XUX A;  3WS0 A;  1KVM A;  4Q8I A;  2V1A A;  1FSW A;  2OV5 A;  4EUZ A;  3A3D A;  3S7O A;  4JPM A;  3HLB A;  3BFC A;  5CEC A;  1CF0 A;  1EI5 A;  2ZM0 A;  4QWO A;  1TS7 A;  1XGI A;  4H8R A;  1NXY A;  1TDL A;  4WZ4 A;  3PTE A;  5G4Y A;  3HUN A;  5EVI C;  5FDS A;  4Y5F A;  3IHA A;  3UE0 A;  2P08 A;  1VB6 A;  4GLQ A;  4I3J A;  1S1Y A;  2I9V A;  4EEP A;  3NI9 A;  2GNX A;  3GVB A;  4X55 A;  3MFX A;  1E25 A;  1BYW A;  3H82 A;  3B47 A;  3R7W B;  3VFH A;  4X1M A;  4BMW A;  2Z2M B;  3QHY A;  4Y7P A;  3DTI A;  3Q7V B;  2QPN A;  1I2S A;  4HJ3 A;  4QD4 A;  3SS4 A;  4GNU A;  2Y2G A;  3KYZ A;  1SDN A;  3MKE A;  4WEL A;  1DRM A;  5CHM A;  3VP2 A;  1Q2P A;  4B88 A;  3KYE A;  4Z9Q A;  5HL1 A;  1M40 A;  3DWZ A;  3FKW A;  4GS9 B;  3HJI A;  3T4O A;  3NUL A;  2XFS A;  5FAQ A;  2Q9M A;  3SH7 A;  3OBF A;  1ZHH B;  1IYO A;  5FEG A;  3VSK A;  1LSW A;  3AGE A;  2QJ7 A;  1KDS A;  3O87 A;  4PM7 A;  4DE2 A;  3Q7Z A;  3BLM A;  3RXW A;  1JWZ A;  3BFF A;  4DE0 A;  1WYB A;  2P7J A;  1MPL A;  3F1P B;  3I7J A;  4Y0T A;  4B4X A;  2WKH A;  3N8L A;  2C6W B;  1F2K A;  3VP4 A;  2Z6D A;  1D7E A;  1G6O A;  1SZV A;  2ZC3 B;  1TS0 A;  1CJF A;  3MSH A;  1S66 L;  3LEQ A;  1BUE A;  2J3T D;  4EER A;  1OTD A;  5F6A A;  4HI4 A;  1YLT A;  1Z09 A;  2WGI A;  4NXG A;  1W5D A;  1K57 C;  4O01 A;  3BFD A;  2WKE A;  3HLE A;  2IWD A;  4WYY A;  2YKH A;  2OAP 1;  3WRZ A;  4ARZ A;  3CMZ A;  1K56 A;  2J8Y A;  3V3S A;  3T4T A;  1Y54 A;  4EQ1 A;  3O3V A;  4EBP A;  3GDI A;  3VP3 A;  1OTA A;  4QJG A;  5HWW A;  1S4R A;  1GHP A;  1KE3 A;  1GA9 A;  4EW7 A;  5FQK A;  2BLS A;  2ZQ8 A;  2E8J A;  1OTB A;  3GV9 A;  5HAI A;  4P87 A;  4C3Q A;  3T4L A;  1V9Z A;  5HPF A;  3FPV A;  1YSQ A;  5CGW A;  4DN0 A;  1W63 Q;  1YKD A;  2GJ3 A;  5HD5 A;  3CUE A;  1K55 C;  1HD8 A;  2ZL1 B;  4ETZ A;  1F9I A;  3MR0 A;  3M2K A;  5GLB A;  3SS5 A;  3IXD A;  5A92 A;  4BLM A;  5HPI A;  2PYP A;  2PYR A;  4KG5 A;  2H10 A;  1ES3 A;  1HLU P;  3GMW A;  1BLC A;  3C5A A;  4XT2 B;  5KZH A;  4H6J B;  3GSG A;  3NCK A;  3D4F A;  4Q0I A;  5CX7 A;  5AQ9 A;  4N1H A;  2VV8 A;  2Y2P A;  5E2F A;  3UPP A;  3MKF A;  3RXX A;  2DNS A;  2P9V B;  4FSF A;  3IF6 B;  3KSG A;  4S2L A;  4MBH A;  4YWZ A;  3BYD A;  5FAP A;  3IWO A;  1LHY A;  3C2W A;  1W8Y A;  1E3U D;  4EEU A;  1XP4 A;  3S7N A;  2Y4A A;  3W2Z A;  1SHV A;  4S2N A;  2KX6 A;  1E3U A;  2L1M A;  3BQA A;  3F1O B;  2A24 B;  4R3B A;  5E2E A;  5HAQ A;  5A93 A;  2W3E A;  1OTI A;  3OLO A;  4KZB A;  1MWT A;  1IEL A;  3BW6 A;  4EBN A;  2V1Z A;  5IHV A;  1T1C A;  3HJK A;  2IA2 A;  2D01 A;  3NJA A;  2KOI A;  2JKG A;  1LSV A;  4IHQ A;  2WGV A;  4FOF A;  1TDG A;  5FQQ A;  4R23 A;  3M2J A;  3MZF A;  4O0P A;  3DTM A;  3FZC A;  4LRY C;  3MZE A;  2EFX A;  4HP4 A;  1YAX A;  5FL3 A;  1SCW A;  1ES4 A;  4KQD A;  4MDZ A;  5CED A;  3IS2 B;  2FFF B;  4PM9 A;  3O88 A;  5DFX A;  1FCM A;  3WWX A;  3TRC A;  1K25 A;  1MWR A;  2VLG A;  4DKI A;  3TOI A;  1NYY A;  2XDM A;  2EX6 A;  4IUK A;  4LV1 A;  4R4S A;  2DMW A;  5FSR A;  3SS3 A;  4NK3 A;  3D3O A;  4X1L A;  1LL8 A;  3VOY A;  1MBL A;  1OT9 A;  4MEZ A;  5CHJ A;  2MJ6 A;  2O0Y A;  1CI9 A;  1OJ5 A;  4HJ4 A;  2J3W A;  4HNB A;  2A49 A;  4JF4 A;  2FFY A;  4MMN A;  3EGD C;  3P01 A;  3T1R A;  3CAX A;  2Y8H A;  2INW A;  3BFG A;  2YKF A;  5HWT A;  2XRO A;  3IX3 A;  2XH9 A;  4S2M A;  3NBL A;  1J3W A;  4I3I A;  1MXO A;  1K6R A;  1STZ A;  4OQG A;  2Y91 A;  3K3D A;  2ZC7 A;  4G3K A;  5HDC A;  3P7N A;  3IBJ A;  2FZ0 A;  3E2K A;  3N8R A;  2O9A A;  3UDI A;  5G18 A;  1KVL A;  4WEK A;  3HRE A;  2OAQ 1;  4P6Z S;  4WLA A;  1IOU A;  3TE8 A;  3AGF A;  2E8I A;  3LEZ A;  1XPB A;  1GCE A;  3LYX A;  5GHX A;  1G6A A;  2WKI A;  3IWQ A;  5F83 A;  3V67 A;  4GDB A;  5GHZ A;  4LEN A;  5HWV A;  3ZNY A;  2B95 A;  2VGJ A;  5EM1 A;  5F5Y A;  1K0K A;  3KSH A;  3O5Y A;  2Y55 A;  1K54 C;  1NY0 A;  2JC7 A;  3RTY A;  5FQ9 A; 
#chains in the Genus database with same CATH homology
 4Y15 A;  4LFU A;  3QP2 A;  3IX3 A;  5L10 A;  5L09 A;  2UV0 E;  2Q0O A;  3SZT A;  4Y13 A;  3QP1 A;  5L07 A;  3IX4 A;  4Y17 A;  2AVX A;  3IX8 A;  3QP5 A;  3QP6 A;  3QP8 A;  4NG2 A;  3JPU A;  3QP4 A;  1H0M A;  1L3L A;  4LGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...