3IXAA

Human class i mhc hla-a2(a150p) in complex with the tax peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAPHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ixaA01
3L3IB 2YD2A 4TNWF 1HSBB 1WGOA 3ULUF 1A2YA 3FTGB 1J12A 1ACZA 2F15A 5AZEL 5JHDD 3QUXB 15C8H 2JCCA 1IC4H 4HIIA 4G9FD 4WTZA 4Y5XA 5FKAA 3OAYH 4WFHD 1B6DA 4O4YH 1YEIL 1I1YA 1OSZA 3ARSA 1LMKA 1I1FB 4UIMA 2BC4A 4PJFF 2ICCA 1LO2H 2VXQL 4LLYA 1IKNA 2C3XA 3MJ9A 3LQZB 3GB7A 4UUJB 4Q2ZB 3OKEB 4PYGA 4P46B 1ZLVK 2UY7A 4QRPD 3MJ8B 2V2XA 4B7LA 1Q1JH 3TFKD 3D18A 1JN6A 4MJID 2W0FA 1MFEH 1NDGA 3U0WL 4MJ6B 2AK4B 1IAMA 3QH3B 4RGNC 2ZP0T 4HJGA 5E2VH 2XWTA 3LKQB 3NIFE 4BH8A 5L2KD 5TDNB 3PWLA 2HKFH 3IDJA 2NMSA 3OL2A 5EIQA 1FZMA 1JNJA 1L6XA 4PJIF 1FJ1A 1Q38A 4GLRH 1KJ2L 4ONGL 1NC2D 4XI5C 2VN4A 4OZ4A 3O6LL 4HFWB 2X1OA 2C7UA 5HGAB 3PWJA 3ECBB 3P4NA 3I2CH 1T21A 4N0FB 1CU4H 3V4PL 3FOLB 4OGZA 3UDWA 1FZJB 4XRCA 2R0LL 5EUOA 3VD9A 1ZMYA 1JYXA 2IFFL 5F6IC 4G8FB 4C58B 5MERB 2DOCA 4AEFA 3QUXC 2V17H 1FH5L 3QZWB 3GK8H 1WWCA 2XZCH 5K9JL 1F4WH 3KPRD 4X6DB 4XP9L 2G75A 1T0MB 4HZAA 2EIDA 5KANI 4B0MM 1V7NH 1LO0H 2HT4C 3I75A 4AYFA 1TJHL 4N5ED 3KPSE 1I3GH 5FO8A 2YWZA 2CRMA 5FYKL 3IVKB 1A3QA 1XIWA 4IJ3B 4KMTH 1DLHA 4JM2C 2DLEA 4UT6H 2PCPB 4E41D 3LKSA 3QCVL 5KVMC 2R69L 3STLA 1IILE 7FABL 2VDNL 4GG6A 4I0PA 5DJ2B 3STZB 3MTRA 1E27B 4KTEL 2X05A 1XGTA 2ZUTA 3DTXA 3TBVB 1A1OA 1D9KB 3PGDA 1IL1B 2IAND 4MAYB 4P99A 5EIVA 5HHVH 3V7AE 4BUHA 3X11A 3K4ZA 3E8UH 2HKHH 5IOPB 3QUKB 4XBPA 4MS8C 3CDGB 1J1PL 1I4FB 3TJHD 4HK3J 4YEFA 3VH8A 5JXEC 1TCRA 1HH6B 1KENL 4L4TE 1AQDB 3TH3T 3WFHA 1H3PH 4FFWD 1U8KB 1VB9A 2IBZX 35C8L 4GW5A 4M1CC 2FO1A 1H0DB 1WVZA 3DBXA 1ZOXA 1JGEB 3AM8A 2OSLA 4OB5H 3PGCA 4ELMF 2CDEA 3QUYA 5L8KB 3MV9E 1JPSH 3T1WA 4A6YB 4X5LA 3UEZA 3UJIH 3BQUD 3VFSB 4YFDB 1KJMA 3B2UC 4NN7B 1ETZB 5B4MD 1S78D 1AIFB 4F7CB 4LPVA 2VB5A 4OCNC 4O9HL 5IJVB 5C08A 3ZKXB 3EJZC 3TIDA 2CKBL 2CRYA 1SVZA 2JELH 1OM3L 5DS8A 2EDEA 5EDXA 5EU3A 4Y19E 5IF0B 3FCTB 4F3FA 5BOPA 1RHFA 3RZWA 4HKZA 3F5WA 3QA3A 4YHOL 3IU3A 4IOIB 1CD8A 4JPVH 1MELA 2VQ1B 1N0LA 5H35B 5LXGH 1JNLL 4JRXB 3PHOB 1QSFD 5GGQH 3JWDH 2HJLA 43C9A 5D7LD 3FOMA 5T3XH 5T1KD 5GGVY 1MJUH 1JFQH 3ARYA 3HZYB 4Z7UB 4RA3A 1TTGA 2RB8A 4LKCB 4GAJL 1D9KC 1CG9B 3C60D 1E6OL 1PYWB 4L4VB 5BQ7B 4PJAB 1N4XL 2VAJA 1DP0A 4U2YA 2YK1H 4PJXF 5C0DA 1S7QB 3RWFA 3PP3K 3MX0A 4EBQL 4POYA 2QSTA 4WWKA 4LSSL 5JIKA 5I17A 1I8KA 2APXA 2VXUL 3DX9B 2P7TA 4Y0GA 1U6AH 1X7QB 2AJXL 3MLRL 3HG1A 1CDBA 3HN3A 2V5MA 3MRGB 1T4KA 4ODWA 3BDBA 3DRTB 1A1MA 3H3PH 5I74B 4IDJH 1W0YT 1EO5A 2J4WH 2WUBH 4ODHL 2OP4H 1EMTL 1H3XA 1QZ1A 3E3QA 2DKUA 4KK8C 5KS9A 2FHCA 2VDOL 1MCWW 4APQC 5MI0B 4EOWL 4IMKA 4L8SA 5SWSD 5IV2A 4Z7VF 2CXGA 3IKCB 3ZE1F 1OGTB 4NKMB 3QJHB 3BZEB 7CGTA 2ZPKL 3LKNB 3CH8A 5HYEA 5TQ0H 3DVFA 5IB5A 1OD7A 2QTEA 3MLXL 1M7DB 5E6ZA 4JO4H 4UI2A 3SKOA 2B39A 5E6IB 2C9AA 1XZ0A 3IT8D 4Q58C 4Z7QE 4TSBL 3EDKA 3MV8A 4JVWA 1DEEA 4OUOA 1I8IA 3QIBA 4XPTH 5F3BB 5LBSL 2DM3A 4NZUH 3IFPA 3ARUA 3VFGL 5F7YC 1RULH 3KPMB 3FN9A 1EH9A 1MAMH 5C70A 4G59A 4G3YL 4MXVF 4OZHF 1T20A 5BS0E 4S11A 1QFWL 1AR1D 3TZVB 5K9OA 1P4LB 1S7SB 4L1HA 5IR1B 5DQJB 1MCSA 4LHJB 3VXPB 1AD9A 3VA6A 4PGCB 4JO1L 5HI4D 4G7VL 2EDWA 1TVBB 1DSFH 1YECH 3SDDB 3MNZB 3V6FA 4L29A 5DEGB 1PG7H 3TA3C 5GGRY 4NQDE 3VG9B 4DUWA 1QFPA 1SMOA 1T7YA 2NY5H 4KK5C 4LLMB 4YFLI 3BPNC 3VXNA 3GIVA 2F9BT 4HS3A 4LVOB 4DGVH 4CMHC 5F70A 6CGTA 3O6FB 3SE4C 4HEPG 4M8QA 5CZVL 3FB8B 3QO1B 4U1SB 2AEWA 1XCQB 3SKNA 3WE6A 1R5WA 1UZ6F 1JPTH 4X9IA 4XWOD 4A2MA 1U8IB 1KJ2B 2YPKA 2IALA 3BKCH 4OKVA 5BMFL 2JB5L 4GRMA 5DD0H 1IBGL 4RMUA 3RA7L 5EOCH 2HN7A 2NY3B 2NW2A 2V6HA 4L3EB 3AXLA 4XB7A 4PJGE 3QUZA 1X5AA 4R96B 5B22A 1NSNH 3SE9H 4UTAH 1UB6A 4MDJB 2JK5A 4BZ1H 1URLA 1BJ1H 1N2RB 3CFEA 2ESVE 4QOKD 2X10A 3NCJL 3FAXA 4HJJL 4PJ8A 3G6DL 1G6RA 3IETB 3MJ7A 1NBQA 1VPOH 3KPNA 3MRRB 4KAQH 4QYOB 4BSVB 3VCLB 1C5BL 4KKLD 1O7VA 2P24B 1AI1H 4N0CC 4NRXB 4M61A 4OGYL 4YH6A 4MXWL 2AK1H 5EH1A 2GJ6A 4DCQA 1S9VA 3QQ9D 3HPLA 2HG5B 2ZOKA 4DFHA 3O3DA 4N90D 1A14H 3OKNB 1IAII 2NX5D 4PRHB 5IHUH 3VG9C 1R3LA 2O61A 1G0YR 4TQEL 4HWEL 3JSSA 2D2OA 1CICD 4N9GA 4N0UB 4UILL 5IFHL 4RFNC 4Z95L 2J8UA 3MRBB 3I6GB 5CBAB 2DQEH 3QDJA 3KPPB 1J0YA 1E4XL 4ZOBA 4OFYD 4J6RH 4HXAL 2YRLA 4XH2B 3SCMA 2R8SH 3L7FA 3VGAB 1IGYB 2DRUA 2XN9A 1EEZA 1I9JL 3QNYA 5LGHL 4ETQA 3PWPD 1NBVH 4C54A 5FOJA 1S7RB 1DVFD 1QKZH 1FFOB 1P7QB 3RL1B 2VIRB 3G6JB 3RWDB 2B7DT 3SGJC 1Q9KA 4QF1A 1WZLA 4KY1H 5T5NG 4I2XB 2RFXB 4J7RA 4JZNA 5IB1B 4PGBA 5FYJD 4PV9B 2FNBA 1AGEA 1AQKL 2BNQB 4M03A 4RRPA 1OF2A 1KGCD 4QHLB 2R2EA 2CKBB 3HE7A 1VKXB 4FTVA 4G9DA 4E42A 5TPWH 3W0WD 1RPQA 4PRIB 3ZYZA 5KVDL 1LNUA 4ZOEA 2FZ3A 1HK6A 5C0CA 4IRSB 3LQAH 5B8CC 4PJ9B 3UXFA 5LQBL 4Q9RL 2F5AH 3VFMB 5TQ2H 2XWJA 2QEJA 3WD5H 1YC8A 4N1CA 5GSVA 4XNYH 4ORGA 2CLRA 2YPLB 5D5ME 5E94B 5L9DL 3CFKA 2BJML 5TDPB 4CMMA 2C1OA 4WEMB 2J6EL 3F58H 3B83A 3TIEA 5AD0A 4OQTH 2GTWB 2VZSA 4GQPH 4H88L 4HIXL 2HA1A 3ET9F 3L1OH 5E95B 3ARDA 5J6HB 1EFQA 5GS1C 3LEYH 5CSGA 1WT5C 4GOSA 3ULVD 2BVOA 5ICXB 1NGQL 4WEBL 3VXRD 1Y6KR 1EJOH 1G7HA 3UTSD 4Y4FC 5B39G 3NPSB 3BPCA 5D7SH 4OLZL 5DRZA 2R2CA 1KTKE 1QBAA 4DKDC 2F53A 5KG9A 1L4IA 1EV2E 1FVDB 1F3RB 2M1KA 4RA0C 1P5VA 3TV3H 3R8BB 2Q8BL 1C12B 4KWUA 2HJKA 1YEFL 4PJBE 1SYSB 2GCYB 3GSNB 4LAQL 4DVBA 4P3WA 4LHUB 4PJ9C 4GAGH 1U3HC 4P2CG 3SPVA 3D3VB 2VAAB 4PUBH 3TT1L 3OGCB 4HIJA 3MRQB 4RSVA 2H2PC 1KB5L 2DJ4A 2O5YH 4XPFH 1AXTL 2HTKC 1RUQL 2AJUL 1DN2A 1Q0XL 5GZND 4G9FA 5I1CH 3OXSB 5D1QC 2JCCE 2D0FA 2NW3A 3Q5TA 3ZE0E 4PRNA 1JCKA 5E99L 2EXWC 1U8PB 5IQ9B 3E2HA 1AP2B 5E2UH 3VFWB 3RWGA 2YMXH 5HHXH 1MWAH 5DHYB 5GS0D 1LK3H 5E24E 5DUBB 3DMMC 4LEXH 5IW3A 4OI7A 4U1MB 3QSKB 4CADB 4C83A 4QRPA 3KR3H 1IC7H 1WZ1L 4OLXL 3TFKA 4K94L 3T0VA 4MJIA 4Y16B 5DJ8A 4KKBD 3D69A 4X7TB 3EYFA 2F74B 1T1ZA 4JKWA 1YY9C 1YQ2A 2DQUH 2A9NL 3ULSA 1FBIL 3RWIA 2APTA 1G9EA 5L2KA 3SDXE 2VXSH 4WI8A 3NZ8A 3SOBL 5IJKC 1QSZA 2I25N 4UIKH 4OBSA 2JJVA 4QO1A 1NC2A 5GGSY 1FGNH 1S9WA 3EJYC 5CEXA 2QQLH 3ARFB 3C5ZC 4LOUC 3UTTB 3PL6C 3ISWA 4GW1B 2AS5M 2FSEB 2R9HD 1NGYB 1J18A 4R4BA 3MRKA 2APFA 1BZ9B 2XA8H 4FQIH 4DK6A 1XEDA 2EE6A 3PQYA 3MRCB 1FO0L 2ID5A 5IEKA 2VLMD 4FQJH 4OCXL 2BXZA 4UDTB 1ZANL 2EICA 1FLTX 2OTPA 5DA0B 5EBLA 3NACL 5SWZE 3MYJA 2OI9B 1N26A 3IFLL 1Z6JT 3QQ4A 1KACB 2BMKB 4N5EA 5IVOA 3BH9A 1D3CA 1FFQA 4OIBA 4BKLB 5L88H 4HC1A 5CJXA 3E6FA 3GGWB 3T3MF 1KPVB 4E41A 3O11B 5HPMB 3VXOB 2GK2A 3BIKA 1KIRB 2QQKL 4OM0H 3KWWA 1NAKL 4I9WE 4K3DL 1PQZA 2BVPA 3GJFA 3NH7L 4OF6A 4Y16C 3BD3A 2VQTA 5DK0B 3B6SB 4BFBD 1BZ7A 1XGRA 3H9ZA 3SEPA 3H9SB 4YGVB 3CX5K 1FAIH 3TJHA 3FHQA 5CD5C 2BVEA 3MBEB 4KMLB 4FOMA 2O5ZH 3QCUH 3ARFC 1UH3A 3TCLA 5MP6L 1C5DA 4NO5B 3HMXH 5DUML 2G2RB 2ICWB 4FQXD 1QFUL 5GGUA 1E28A 5L0QB 3QEQE 5DT1L 4N9OB 1SYVB 3B2VH 1BQUA 2LFGA 1LP9E 5HYQA 1IQWH 5CEZD 3GRWL 4GH7B 4HPOH 4MQXC 1RMFH 1GZQA 1HKLL 2UWEE 3TF7A 5C08E 1H15B 2OCFD 5MENE 5C0EA 4NGHL 2Q8AH 3O41A 4JHWH 1KCUH 2ZUQB 2V5RA 1MJ8L 4M43L 3H7BA 5I1EH 4PTTB 1MPAL 3U48A 1QFOA 1DFBL 5CIPB 4YFEA 1QSFA 1DL7H 1J8HE 1T7ZA 2XZAL 4M6AA 4PBVC 1A0QH 1IAKA 5T1KA 5E7FA 5IQ7L 1JF5A 2A6DB 4F9PA 4XNUL 1I8LC 5F1OB 1BAFL 2WP3O 3S37L 5EOTB 3C60A 4JFPB 3KYKL 5ALCH 2CH8A 4G6FD 1DJSA 3EZ8A 3SO5A 4Z7NF 1SEQL 4QTHA 1HN1A 1CBVL 3BKML 3V5KB 2DL9A 4YQXH 3RWHA 1DE4A 2XYCA 3GSVA 4WO4B 1OGAE 2HFTA 3VXSB 5LKNA 1A6AA 4JM2F 4FFYL 4J8RA 3IDIB 1DTUA 2VLKB 3MV7E 1PZ5B 4Z0BH 4XNQA 4LEOB 5L0QC 3UO1H 4BFGA 3L3GB 5DFVD 3PXHA 1JV5B 3FT3A 4U6VH 3T0DA 1NFIA 4KRMB 4LCCA 4TUOB 3U6RB 2JJUA 2OR7A 4IHOA 3HG1E 1J0HA 5CGYD 1DN0B 3OAZH 3ARED 4O2FB 4D0DA 5JDSB 5KVEH 1UB5A 1BVKA 3EDJA 4FXLA 4ZAKD 5F7EL 5A16B 5ID0B 2H6PB 3FFCD 5KS9E 1R3HB 4U6XB 2OR9L 1ROWA 3QFDA 5IIEB 1LE5B 2ZCHH 4D3CH 5L7XL 4XBEL 3AAZB 1TNMA 3LB6D 5SX5H 4C56D 5ISZB 4WHTA 4M93B 4OAWB 1R0AH 4ODXA 4D9RE 2W60A 2LABA 1UWXK 2FRGP 4V1DD 2GKIA 3FMGH 5E08H 2D7PA 5J57B 3WHXA 5I8CB 4ISVB 1F45A 3MV8E 3BE1H 1BOGA 1HI6A 3H6JA 2IH1A 1IT9L 1KB5B 1A64A 3MCLL 4X6DF 5L2JB 1BD2B 1MCEA 1QBBA 3QXAA 1BVLB 1MHEB 3HE6B 1PKQA 2X9YA 3MLYH 1W0WA 3L9RA 1JHLL 3SGEI 2FGZA 4I1NB 4QGTA 1TJGH 3JTTB 3MLZH 4IS6A 2DTSA 4U1IB 3N85L 2J8HA 5M95B 4P23C 1DBBL 2B5IB 3QISA 1A7OH 1MUJA 1KBGH 4QT5B 5IP4A 1ZVYA 3RBGA 4H25A 5E2TL 4OLVH 3VFOA 4D9LL 1HHJB 1OLLA 2P8MB 4XP5L 1T89A 1GRWA 5IEHA 5EO9A 4ONOA 3TBWB 2GUOA 5HDOA 2D7QA 1RFDL 1RV6X 1YYML 3RGVB 1JL8A 5E5UB 1JRHI 3ESUF 4S0UC 1Y0LB 3RBSA 2NTFA 5GRUL 1X6LA 1J8KA 4UNTA 2VISA 4Q9BA 5I18H 2XKNB 4R2GC 5DFTA 2WW8A 2C4XA 3HMWH 3U7YH 3DIFB 1IC5H 3TVMC 1M6OA 3CSPA 3EYVA 4BFEA 5I1KH 4YC2B 2CR3A 4OCLC 5D1ZB 4JFOA 4QOKA 5T5FH 3QXWA 5DHVA 3HZKB 1GGUA 2UYLA 3I9GL 4RDQG 3S88H 5BJTB 2VC2L 1AGBB 5EULV 4F2MA 1S9XA 3CJJA 5GRVL 3C8KA 4JY6B 4U6YA 4PJFA 4ZTOH 3F6IA 4RFOH 4XMLH 1CI5A 1W72L 4XZUA 3PDGA 1HILA 3BWAB 4M62H 5CHNA 4YX2H 4BZYA 5F9AC 1HHGA 1RUMH 2ZCLH 3R06B 1L7TL 4PJDB 4Z7UF 3CSGA 2NX5A 4NKOB 3D0VB 5C6TH 1CFTB 3A6CH 4Q6IB 5J6GA 5BRZB 1U8MA 1NEZG 1FNHA 2FECL 3NABH 4I5BB 2HH0H 4PJAF 5MHSE 5ILTL 2QADB 4CU7A 3WNLA 4K94C 4NHCH 4JN2A 3VRIA 2XFXA 3DXAE 4PS4L 4BELD 3V4UH 1FFPB 4PP2B 3BFOA 1WAAF 4WW2B 1FSKB 4M1DL 4YDVB 4KU1A 5IHZA 4MD5A 3GM8A 4KC3B 1MH5A 4X4XB 3PWPA 5F9JA 3HPJB 3O45B 2COQA 4HUWB 5C0AD 3X13A 1P7KB 5IMLA 1DVFA 2UV3A 5A2KH 1YEIH 5KVFH 4MNQB 1ZGLM 5F9DC 5JIHA 4YHZL 4KROD 3OB0K 1F6AB 2QQNL 3UAJD 1CDHA 4XAWH 3FQNB 2VXQH 1NEUA 2FLBT 3CUPA 4M6OL 5I0DA 4NNXA 1T04B 3B8YA 4MD4A 2X09A 4JQVC 3W0WA 3W5NA 4MNGA 1I7RA 2FWOA 3U9PL 3AVEA 4ZFFA 1JPST 3U36B 1S9YB 1KYOK 4BFIA 3G5YA 5C0CE 5DQ9A 3SKJL 4WU7A 5J0BA 1B0GA 1YDPB 3RZCB 3DRQB 4HDIB 2H32H 3KYOA 4OLEA 4XBGA 5IBTH 6FABL 5J4MA 1ZAGA 2WBJB 4KXZH 4CVUA 2EZ0C 4OCSL 3MUJA 4TYUA 3GMLA 3H0TB 2EC8A 4JFXB 4HWZB 1RUAL 2AKRA 3EYOA 3VXTA 2R4RL 3WJJC 4YNYA 4MA3A 4YK4B 4FZ8L 5DURB 1J0JA 1RJYA 4N8VG 3MGTB 1KNOB 4CNIA 4Y4HD 3TBSA 3U0TB 3RTQD 2BP3A 1FH5H 5CWSA 5CINL 1CGTA 1XF3A 4XP9H 3T0BA 3QNZB 4PY7B 3IJSB 4H1LH 3VXRA 1RAMA 1O7SA 2XWBA 3CU7A 4FQPA 3UTSA 3BYTA 4LASH 3CFIC 3GEWB 2HRPL 3MJ9L 1EAPA 3OF6D 5ESAA 1YY8A 1U93B 1V8HA 1X44A 2YZ1A 4MAUH 2NNAB 5HVGB 2F53E 3H8NA 2E7LA 1NCAH 4NDMB 2MSPA 2XACC 2X1XR 3OMZA 3RWEA 1AE6L 1UCBL 2OJZL 4U1LA 4GXVL 5SWQA 2BSTA 3S36X 1G0DA 5F7DB 3CDCA 3UBXI 3S97C 4JPKH 5IB3B 1A9EA 2OQJA 4Y2DB 4ZXBC 5JOPE 2O5XL 2CKNA 5B38G 1KENH 5BW7A 4HLZG 3WSQL 3BJ91 4XHJD 2VDML 35C8H 4X5XA 5JR1L 2VLRA 3ZKQD 4IOSD 5I16B 4WUUB 2Q1EA 1MCRA 1FE8L 3QIWC 4WFEE 4DWHA 12E8L 3PNWB 2DM2A 4UDUB 4YK4C 4AH2A 1VACB 3T2OA 2HFEA 4PLKD 3D39B 2NR6C 3O2DA 3QO0B 2GYSA 3MUGB 4O9HH 2EEBA 4JFYB 5CP7B 2AV1B 1CN4A 3L3KB 3V5HB 2FEEL 4O58H 1AD0A 1YPZE 4AEEA 3L5WB 2FJFA 3LS5L 2FD6L 4JZJA 4N0RA 4PJ7F 5JPMB 4QRRD 4P46D 1BBJA 1UM5L 4UNUA 3U7WL 3W39A 1QHOA 3G04B 3R0NA 5K59F 4PREB 3FQWA 3O3AA 1TXKA 3GSRB 4M7ZB 2AK4D 1BQHA 1A6PA 3QPQD 3B9KB 4DAGL 3BP4A 1JNLH 5CUSL 5F71A 5ITFA 2X7LB 4XVTH 5DJXA 3QDMD 5FUCE 4TUKL 1BREA 3VRLF 1JI1A 3ARGB 4EJ1C 3HR5A 3ETBF 5IMOB 2X4SB 4GAJH 2RHEA 5F96H 2R2BB 4M6ML 3CZFB 1VEOA 3GJFK 3C87A 3NCMA 1JMZA 2CIKB 3PQYE 2JLLA 3OXRB 1CE1L 4OZGB 4EBQH 5E2JA 1FLRL 5KSVB 3LAFA 3OGOE 5EO0B 5HTSA 4R7NA 4OD1L 1XGYL 3W2DL 3IB4A 3NCBB 2Z8RA 3MLRH 2MPAH 5I76B 1ZSDB 2JIXB 3EOTH 4OZHA 5H2BA 1IM9A 5C0BB 5JORB 3TJEL 3UYOD 4FQCL 4ODHH 3B5HA 1EMTH 1FGVL 4UMGA 1ZLUK 2YBRA 1CFSA 3PIQB 5INCA 4LRNL 2VDOH 3T0ED 4E41E 4EOWH 2HFFA 5D70L 3MLTA 1W72B 2E27L 5IVXA 3INUL 1HQ4A 2ZPKH 2E6JA 5I1JL 3B9VA 4NQCE 4MD0B 4P9HC 3MLXH 4C4KO 1QSED 3U83A 1IGTB 5E03A 4LSDA 3PJSB 4P2QA 3CFBB 3OAUH 4TSBH 1AGDA 1BFOA 3MRJB 3LEXB 3ARGC 2D0GA 5LBSH 1WBYA 4FQXA 4ODVL 4X6FA 4ZUWA 2IMMA 4JFDD 3DYOA 1PSKL 3D25B 4PGZA 3QHZL 5DDHA 3HLAB 4G3YH 3BP6B 3UZEA 5EU6D 3AMKA 3GBNH 1M4KA 5F1IB 4BQ9A 4M4RA 2ARJQ 4NHUA 5A2FA 1I7TB 1F3JA 3WIFA 2QR0A 4I18B 4TVPL 1A6TB 1NMAH 1TVHA 1U58B 5HI5D 5H94A 4IRZH 3MODL 4G7VH 3C8HA 3FRPG 4K9EL 1ITBB 3FN3A 4CW1B 1OOAA 3FT2B 3S5LB 1K2DA 3K4AA 3DURA 1G7IB 1REIA 2VZ3A 3MLVL 3HCVB 1KT2B 1QSFE 3LPGA 2UUDH 2OS7A 3FB6A 1CFNB 2A74B 4Y5YB 5HGBA 2ADFH 2D31A 1LVEA 2EEDA 4U49A 2YA0A 1FNFA 3V0VA 4F9LA 4P2RD 4R7DB 1GC1L 3BDYL 3QQ3B 2CK0H 3PF2A 3CXDL 4LVNC 1HCFX 3C6LB 1FL6A 4PRDA 3VWKC 5BMFH 1IBGH 3MRFA 3MRPB 2PW2A 3RA7H 1A9BA 1A7RL 5FUZH 1FL5B 3OPZH 4UNVA 3LSOB 2YRPA 1A2YB 4XP4H 2Y5EA 1PJ9A 5LG1A 5I8KH 5GSRB 2Q7YB 3MRLA 3GKWL 2FO4A 3NN8B 3C5JB 3PWNB 1R3KB 2YD7A 1U8HA 1KUMA 3ARWA 3NCJH 1T7XA 1J11A 4GRLD 3GMQB 4HJJH 4Y5XB 5FKAB 5EC1B 3G6DH 5LAXA 3CFDA 4S0SD 2FX9L 4TULL 2X4NB 3R8QA 1C5BH 3AREA 4PP1C 2YD5A 5ANMB 4YUEH 4MZ2A 1YUHA 4I18C 4OGYH 4MXWH 4PBWD 4UIMB 5GGVH 4U1JA 3T8XA 1J05A 3FFCA 3ZE2F 3RVVC 4GLRI 4L8DA 4HCRA 4PRAB 2OK0L 1FNEB 2WINB 1JYWA 1KPRB 1TTUA 4C56A 3LEVH 5FF6A 1OP3K 3RL2B 4OD3L 4PJHF 2V2XB 5E6ID 1Z0MA 4UILH 1LD9B 2VZOA 4QY8A 1JN6B 4PB9L 5D2LB 2W0FB 2YSSB 3SGKA 4V1DA 1EAJA 1UXWA 4HJGB 4BH8B 1EO7A 2E7BA 4HXAH 1CLCA 1DANT 2XZQL 1DBML 4PRPE 3W82A 3S4SG 3ZKND 3O6MH 4UQ2A 5KSBB 3OKDB 4MNHA 4Z78A 4PV8B 3BISA 3QUMH 1MY5A 2C7UB 3LN4B 3PWJB 4LBEA 1PKQE 1LK2A 4KKAD 3OR7A 3NIGE 3ZMRA 4XRCB 1RI8A 4H0IA 5IESH 1OTUC 4OGXL 2K7PA 3HFMH 3LKOB 3VI3F 3RX8A 4QXUL 3NOIA 3HC4H 1G6RL 4ZDHA 5J1AA 2H2SD 5JQHC 3M45A 4FABL 1PFCA 4N0YL 2WBWB 1R5IB 3GM0A 5DD6B 5LQBH 4K3JL 5FO8B 4WIQA 3SJVD 4QNPF 4K7PH 1IKNC 4CVWA 1JZ2A 1VEPA 3RJDA 5DO2C 1KCRL 2ADJB 5DLMH 1PLGL 5DK2A 1F3DJ 1MFBL 1C8PA 4M4PA 5HHQB 1BECA 3Q6FA 1T83A 4I0PB 3GZKA 1MFCH 1T6VN 5L9DH 1XGTB 1IVLA 1K4DA 3DTXB 5IM7B 1A1OB 4LCUB 5GISH 2J6EH 4FMKA 4R4NC 4QXTA 5FDYA 2VZTA 2W0KA 1WLHA 5EBMA 5FCUH 4ZUSB 1CD0A 5EU5A 3TNNB 4HIXH 3VH8B 1TCRB 1YEEL 4KRNA 1ORSA 1NAMH 3V6OA 1M7XA 1HWGB 1MCPL 3H42L 4XCYA 1X6NA 2NZ9C 1M7IB 1UVQB 4NWTH 2OSLB 3OR6A 2BNRB 4PY8I 3LN5A 3PGCB 1NGQH 4EUPA 3QUYB 4D0BB 5INDB 2E5EA 2NY0B 3UTQB 1AY1H 3UDWC 1M71A 2B2XL 4HS6B 3I6KB 4OLZH 1J88A 1YEDA 4F7EA 2CDGB 1MOEA 4ODBD 4PJFE 3RFZC 2D7MA 1MI5A 4F15B 4JG0L 1BFVH 1V7ML 4JR9L 2Q8BH 4WDIB 3EO9H 1YEFH 3UJTL 4MQTB 4J3SA 1FVEA 5FYLD 5HHME 4IMLA 4ZFGL 1UKSA 5SV4A 2R1WB 3IU3B 1QOKA 4MCYA 3BUYA 4QRSB 1PAMA 1A8JH 3TT1H 1XIWC 3BGMA 5DK3A 5LWYL 3WLWD 5F21B 4XXDB 1M1SA 2BSRA 1N8ZA 2HJLB 5C8JA 1FPTL 1RUQH 4PJIE 3ARBB 4I0PC 3ULUD 4ENED 4KTDL 1DLFL 4P3CL 1N6UA 4XCEB 5I1AA 1S7VA 1I9RL 1K3IA 5ID1B 4J4PD 2Z93A 4Z7OF 1IQDA 5E99H 4YPGB 1W2KT 4AG4L 2WUCH 1CFVL 1FC2D 5C2UB 4KI5F 1LO5B 3AM8C 2Q86A 3E1F1 2BOCA 3QUYC 4KZDL 2P7TB 3L3OA 1KEML 4OTXH 3U1SL 1HHIB 4IRSD 4K94H 4KMQA 2HVJA 1UXSA 3IYLW 4MNGE 3NMEA 5CJBA 1VGEH 2VLJA 1A1MB 2A9NH 4NYLA 1FBIH 4F15C 5F9OL 4ZD3H 3SOBH 5FGRA 5D8JL 1R6VA 2YPLD 1X4ZA 1WFNA 3MRMA 3S7GA 3VD4A 3HNTH 2QLVB 3KPOB 3DUSB 2EYTA 4QWWC 1NBZA 2CSPA 4KZEH 4W4OA 4YHIA 3EOAA 3JVGC 1D6EA 1MRCL 1OTTD 4NRYB 5IB5B 1ACYL 1FO0H 3LV3B 2VDRH 4AIOA 2GSIA 4JAMB 4OCXH 4NJAL 4NKDB 1XZ0B 4Y4HA 3RTQA 1K85A 4LGPB 4X98A 1MCFA 3QIBB 2BVUA 5D93B 2XQYK 4EN3D 3ZKMD 3L3JB 4P5MA 2NY2D 3ULVE 5CP3H 3IFLH 2J7LA 1FNGA 3WUWA 3T77A 4NN6C 3QIUA 1U8JA 4PG9A 5F88A 1JZ6A 3KNBA 3CLFL 4WV1A 5AAWA 1R5VA 1D6VH 4WGVB 4WWKC 4G8EB 1S7XA 4QRTA 8CGTA 1VESA 1OCWL 1C08A 1AD9B 3UZVB 3BZ4A 3T65A 2BY2A 3V6FB 4L29B 1WCQA 1A3LL 2X5PA 3L3IA 5CKAA 5D2NB 4K9EC 1HSBA 5I73C 4ZMAT 1KG0A 1ZS8B 5FB8A 3QEUB 2FBJH 3E3QC 3DV6B 2QKIB 3QDAA 3H2WA 1L7IL 1K8IB 1OB1B 3KGRA 4KHXL 4IMKC 1QFHA 4L8SC 4G6JH 1DZBA 3L6FA 1U8NB 4HS3B 3CSBA 3L95A 1N5AA 5DUMH 1NCBL 4TTDC 1QFUH 3DVNA 2VLRE 1EHLL 3ARZA 4GRWB 3TBTB 3U4BL 1GC1C 1I1FA 2YPKB 2IALB 1B0WA 3GDBA 3GRWH 4GRMB 3UTPD 3F7PC 1NL0H 4PJXE 4S1RL 1P4BH 2OJEB 5E2WL 2NW2B 4JFZL 3AXLB 4UUJA 5I19H 5D93C 4X6CB 3OKEA 4PJDF 2WANA 4P46A 2X9XA 4MA1B 5DZOA 3JV0A 3MJ8A 1UB6B 4NGHH 5HJ3A 2JK5B 3MSPA 3RWCB 4JFEE 1MJ8H 3CFEB 3GO1H 4M43H 4MJ6A 2AK4A 3IDYB 1S9KC 1KEGH 4J3UA 1CDUA 1MPAH 4HC1L 3QH3A 3WS3B 1DFBH 2QSVA 5ICYB 3MJ7B 3KPNB 1KXTB 5TDNA 1E4JA 3IF1B 4LKXA 2YRZA 1AO7B 4M61B 4NO2B 4NFDA 5IQ7H 1HEZA 1EGJA 4XNUH 2Q6WA 3OJVC 5HGAA 3BOVA 1S9VB 3ECBA 4G8GE 2EKSA 5T3XE 3K7UA 1DUYB 3REWB 3U4AA 3KYKH 1CVRA 3PP3H 1X5LA 4LDOB 3QT2A 1OAXL 3UYPA 2R39A 5CSBA 1SEQH 1CBVH 4EDWL 3BKMH 3CMGA 4G8FA 5MERA 4HMEA 4OFIA 2J8UB 4K8RD 4HPYL 3JV4B 3UYRL 5GRXG 4ODTL 5F93C 3SCMB 3MUY1 3DO3A 5ITBH 4WEUD 4LLUA 1TQBB 4P5KB 3IVKA 1ZTXH 3FFDB 4MXVE 3IXTB 4OZHE 3E6HA 4P4RB 2PCPA 4HBCH 4XNZB 2P5WE 1PX4A 3QUZC 4EKXA 3EOBB 4G5ZH 3BESR 5DJ2A 3STZA 1ZHKB 1E27A 3TPKA 2OR9H 4PGBB 2PYEB 1AGEB 3DVGB 3TBVA 2R2EB 3EFFB 3ZSTA 3O9WB 1GHFL 4UQ3A 2BY3A 4FTVB 4E42B 4PJ8C 1FG2B 2CO6B 3H9SD 1QSEA 4MA8L 1NCUA 3QUKA 3CDGA 4DN4L 1QBLH 4R97C 3MBED 3H7LA 1U8KA 5I1HL 4XVJL 4P2QE 3SO3C 2XWJB 1JGEA 1ZT7B 2MQCA 4LARL 3ABZA 4Y1AE 5DJZA 2DB8A 1IT9H 3MCLH 4JFDA 4A6YA 3W5MA 3VFSA 2IG2H 4RMSA 1UZ6E 1ETZA 3J7HA 1AKJD 5DMIH 4F7CA 3CFKB 2F58L 3VDCA 4U1NB 3QG6A 4LCWB 3WDJA 2QHLA 2CMRL 4CMMB 2C1OB 4IM8A 5ALBL 4HF5L 2FR4A 4WCYH 5IF0A 3FCTA 3N85H 3SCMC 3LD8B 3Q0HA 3DHJA 4MXQD 4NKQB 2EECA 2GSGB 1A21A 1DBBH 2VQ1A 1JPGB 2PTUA 4P9HH 5DJCB 4HGMA 2P5EB 4JRXA 2AXHA 5IROA 4HWUA 1HHKB 1IFHL 4RAUA 5E2TH 1G7HB 4LDEB 4D9LH 4XP5H 3VD7A 1MLBA 3BPCB 5DRZB 2XV6B 1HHHB 1CGVA 1I1AB 1WUNT 2MCG1 3G5ZB 4LKCA 1QPXA 5FV2A 1CG9A 2Y6SD 1PYWA 3CFJB 3HE7C 3TYGH 4L4VA 4P2RA 5BQ7A 3VXMD 1JBJA 4DVBB 4V2BA 1RZFH 4HLJA 4MLIA 3CVIL 4Q6YA 3BGFC 1S7QA 4HMCA 5B3NA 5BV7B 1BGXL 3TN0D 4XC1L 4M3JA 4PJ5D 1P69B 3DX9A 1I1RA 1X7QA 1FYTE 2CPCA 4HJ0C 4EUPG 5JHDB 2DD8L 1V5JA 3MRGA 1EO8L 3DRTA 3I9GH 3QNXB 5AG9A 4AM0B 1MAJA 2Z8WC 3V52L 1T0PB 3KXFE 4Q9CA 1JFMA 3C6SB 3IKCA 3ARDC 3QJHA 3BZEA 3TPUE 3ESVF 1GGBL 3LKNA 3T2NH 2MTPA 2HFGL 2IF7A 5SX4H 5IHLB 5FGCB 4HG4K 1TPXC 1IJ9A 1GGCH 2DQIL 5E6IA 2WWKO 4DUVA 5ILTH 5FEBA 4MJIB 3EYFB 4PS4H 1GXEA 4HK0B 4OZGF 3MFFB 4I0CC 3RWIB 5F3BA 5JLZB 3UBXA 5GRJL 1BD2D 1NC2B 2C4FU 1X5YA 3KPMA 4Y4KD 2P47B 3KPQB 3J8F7 2BFVL 3HAEB 4P2OB 1S7SA 3KPLA 4YHZH 5EORH 5IEKB 5IR1A 3ILQD 1MNUH 4XMPL 1MCCA 3AROA 3VXPA 1TVBA 3SDDA 4FQ1H 3MNZA 4PR5B 3RPKA 4NCC1 5DEGA 5F89A 4LP5A 4NCC2 1PVHA 3KPRB 4KFZC 2X44D 4XPBL 3U9PH 2VR4A 2AGJH 3H3BC 4LCIL 1D5ZA 3MRNA 3E2HC 2BSED 3BH9B 4OIAA 2JB6A 2A9ML 3PP4L 1IMHC 1K4CB 2JKXA 3O6FA 3FB8A 2ZSVB 3QO1A 4L9DA 4U0QB 4U1SA 3D85D 2P42B 3EO0B 4Z18A 3BIKB 1U8IA 4X6EB 1KJ2A 5D5MF 4M5ZL 4JHZA 1PQZB 4JCMA 2BVPB 2XNAB 3P2TA 2NY4C 4S1QL 5FHBL 4YBLB 2IANB 4L3EA 2R4RH 3DX6B 4ZOCA 4R96A 1BZ7B 4GQ9L 1CF8L 4MDJA 5DSCB 3W9DB 3B8SA 3PG2A 5D1ZD 2PYFA 3R1GH 1N2RA 1FL3A 3HUJB 4M9PA 1YYLL 3TCLB 5CINH 4LLWB 3IETA 3MRRA 4BSVA 1CLZL 3VMPA 3VCLA 5GGUB 1E28B 2P24A 4XAKD 2YOCA 5I15L 3BQUB 1E6JL 4NRXA 3LN9A 1TVDA 4ZPVA 5FYJL 2HRPH 3MJ9H 4XVUD 1JVKA 3MO1A 5F1KC 1ONQA 2EDFA 2HG5A 3RWJB 3OKNA 3QWOB 3TP4A 4KJWD 3JWNC 1AE6H 1MI5E 2OJZH 4GXVH 4HUVA 5BRZD 1UWEH 5GGTA 4N0UA 5KVGL 1MHCB 4HD9A 3MRBA 3I6GA 1J10A 5C3TA 5CBAA 2ICWJ 5J06A 3KPPA 2O5XH 4PB0L 5CJXC 3OKMB 4Y7MA 3RDTB 1IGYA 5D7LB 1IAKB 3DETD 5T1KB 2VDMH 5JR1H 2APWA 3LS4L 3ORJA 1FE8H 1KLFA 4L4TB 5T3ZD 3G6JA 12E8H 5IK3A 4J4PA 4U3HA 4JQIL 5AG8A 4I2XA 4H20H 1C5CL 2RFXA 2XRAH 1KLGA 3LZFH 5D6CB 5DD5L 3TJHC 3MV9B 2BNQA 5DFWH 1NFKA 1DE4B 2DBJA 1AXIB 4FFWC 2X4OB 4QHLA 2CKBA 1L9NA 1CS6A 3ULVL 1VKXA 1A6AB 5DVLA 3LS5H 1GAFH 2FD6H 4WFFE 1TQCB 4DGYL 4PRIA 3U7WH 4X9HA 4IRSA 3TNMA 1INEL 3BRFA 1JTPA 3C09B 2E3VA 3VFMA 3FT3B 5E8EB 1UG9A 1S78C 3WNPA 4DAGH 3GI9L 4HULB 4IHOB 3GUTB 3MLSL 3ZYOA 2DQDL 5CUSH 5JUEL 5KJRH 4NQTA 3TF7C 3T3ME 2VLJE 1Q0YL 1QRNB 3IJYB 1UB5B 2YPLA 2DWEB 2VKWA 4TUKH 5SWSB 1JYVA 5AYUH 2WWMD 5E94A 1U91A 5FCSH 5BZWA 2YD9A 4UOW1 3D9AH 1I1CA 1F58L 3O8XD 5EZLA 2NY7H 2A1WL 1UM6L 2W91A 5KTEH 2VZ1A 2GTWA 5DURD 4ODXB 2D9QB 3QZWG 5EUOF 5J6HA 1CE1H 1G7JB 2VZVA 4F9PC 3HI6L 4YHLL 5CD3B 1GOFA 5ICXA 5I1GL 1HI6B 1XGYH 2IH3B 3C60C 2YUWA 2IH1B 3MZGB 1N3NB 5D1XD 3RU8L 1Q9OB 1NFDA 4JREB 3HS0A 4YDIH 5GJSH 3THML 1BF2A 3TJEH 5J12B 1FVDA 1YEJH 2DLGA 4U31A 5GS0L 1JNHB 4MVBA 1IKFH 5F6HI 4LRNH 1SYSA 5JW4R 3GSNA 4I13B 4XVSH 5D70H 4NN5B 2E27H 2DL2A 4GG6F 2OBGA 4LHUA 1MEXH 4Q9QL 5I1JH 3D3VA 3QXUA 2VAAA 4LCCC 4Y2DD 5DEFB 3OGCA 2VDPH 3MRQA 1UYWL 1RHHB 2M26A 4NP4L 3VFOB 2AV7B 5KAQF 1HWHB 2MFNA 3NFSH 2GUOB 1BQLL 3OXSA 2K9UA 5HI3D 1AGCB 3BX7C 1O0VA 1U8PA 4GO6B 4Z7NE 3D39D 3RRQA 3VFWA 3BI9X 3Q6GL 5DHYA 1IZJA 1AFVL 4V3EB 3A0OA 3HI1B 3VXUE 5DUBA 5DWUH 4FHBD 2W92A 4U1MA 4CADA 2E6QA 4X7SL 4JRYE 3MODH 3DVIA 5I9QB 4RGND 4JFOB 4MX7B 2BVQA 4K9EH 5DEZA 4X7TA 1B2WH 2F74A 2V5YA 3B9KD 4JKMA 2GHWB 1NH6A 3LRHA 4B53A 3RX7A 1AR1C 1UCTA 3GHBH 4F2MB 5GGSB 3MOBH 5D71H 1L0QA 4F7PB 1BEYL 1OWRM 3SDYL 1OT2A 3OSKA 2HWZH 3FQXB 1HILB 3CSYB 4W6WB 3UTTA 1K9TA 5HI4C 2FSEA 5FM4A 5C9JB 4RISH 1NGYA 4YXKL 5EBWA 1C1EL 1GC1H 2X4RB 4R8WL 2DQCL 1BM3L 3MRCA 1R3IL 4LNRB 3CX2A 1D5MA 5C07D 5LCVL 1U8MB 3MRHB 1IAIL 4UDTA 1CICB 4XX1G 1T89C 3RI5K 1A7RH 2HRLA 3BKJL 3MBXL 3EDFA 2XFXB 3KYMA 3RPIB 4TRPH 1S5HA 3P0YL 2HT4D 3O4LD 4CN4A 2OI9A 2P46B 3K46A 3GKWH 3IDNA 4X6DE 1MH5B 4X8JB 2BMKA 4XWOC 2JIXD 3VFVB 5FK9B 2Q7NA 3PWPB 3OV6A 5CEZL 1CXLA 1ZA6A 4BKLA 4P57A 4I48B 1DVFB 3GGWA 5D6DA 3PWVA 4JFFB 4MB5A 3O11A 5HPMA 3VXOA 1FIEA 3PV7A 4NQED 1MJ7H 5KS9F 2CUHA 3CPLA 1YN6A 2ZJSL 2MWCA 2OK0H 3WIIL 3CUPB 4KXZI 3WFBH 5DK0A 1UWXH 2DQJL 5JXED 1T66D 1NCCL 4F58H 3H9SA 3W0WB 4XPHL 2FWOB 4KKLC 2I60L 4LFHD 4M1CD 5CEYA 1CXEA 1MSPA 4ZFFB 4PB9H 1HINH 5J7CC 3MBEA 1QLEH 3NTCL 4BFIB 4P48A 4BSJA 4M6NL 4ODSL 4YO0B 3QQ9C 4W68A 2ICWA 3VFPA 2XZQH 3MJ6A 3SE8L 1JGDB 1P1ZA 3P40A 4W4NA 3KYOB 5TE6L 4H0HB 1SYVA 1AKJA 1D5XA 1VA9A 1HH9B 1WIPA 5T33H 2ZUVA 2DTML 3EYOB 3QEHA 4YE4H 3BGAA 4MA3B 3WXWL 1NPUA 1CXFA 3NAAL 3D87B 4QXUH 4PTTA 1G6RH 1OD9A 5CIPA 1A7PL 4FABH 3MZTA 5TE4H 1N64L 5FDWB 4N0YH 4KVNH 2QQQA 3VW3L 4JRXE 4M8VA 4TPRL 1FNSL 5HGHA 2IMNA 4HCRL 1YY8B 2XI9A 1F90L 3MQIA 1HOCB 2AEQH 3A6BL 4Z7UE 1MFBH 3VXMA 4K3GA 5E1AB 3NA9H 3C6LD 4GRWF 5D9SB 4L4VE 3EYQD 3VJ6A 2J8OA 3V5KA 5CJQL 3SQOL 1WJ3A 4PJAE 4WO4A 3B9DA 1CWVA 5T1LB 3P4MB 1A9EB 2OQJB 4WWID 1UACL 1OAZL 4L8CB 5GRZA 4YHNB 1WAAE 4ZFZB 1MCQA 4X6CF 3VXQA 4X7FC 4LEOA 1KTLA 4XX1E 1YEEH 1SM3L 5TGBA 4S1SL 5ABDE 3OJMB 3L3GA 1MCPH 4X5XB 3H42H 4OV5B 2SEBB 1NANH 1A6VL 4AENB 4UTBL 1F11B 5I1IL 4KK8D 1DN0A 1OHQA 2CQVA 3GFUA 2DDQL 1G7PA 3NFNB 4O2FA 3OQ3B 3S3JA 3UJJH 3PHQA 5A16A 2HFEB 2H6PA 3ZL4H 1R3HA 4U6XA 4I3GA 5FECB 5IIEA 1LE5A 4JG0H 1V7MH 4JR9H 3ARPA 3AAZA 5DMGD 4FNLH 4P2YA 4PLOB 5ISZA 3NIDF 4UOW0 5A2LH 3VD5A 3ULVC 3S96A 4U7MA 4NZRL 3RP1A 4OAWA 1K5NB 3QULB 4U1KB 4UBDC 4Y2OA 4HH8A 5KN5A 1LHZA 1ZK9A 3BN9D 3O3AB 4PJBB 3GBLA 5I30H 1BQHB 5I8CA 3BP4B 2J8UF 5LWYH 4JFQB 4OLWH 2ERJC 2FYYB 3D6GA 1RIVL 3MC0A 3SY0B 1MRFL 1CDIA 5DJXB 5E8PB 5L2JA 3OKOA 1BD2A 3QXVA 4NQSB 1MHEA 4Y4KA 3HE6A 2E7HA 4GUPB 3HR5B 1IGIL 2VDLL 1ZE3C 5MEPB 2HP4A 2LAGB 1YMMD 1HZHL 3CNKA 3QG7L 1QPPA 4M7JL 5C2BL 3SE3A 3MNWB 1RZKL 4LSTH 4AG4H 1I3RB 4WTXA 3TA3D 1CFVH 5BW7C 3AB0B 2E9WA 1EZVX 5GZNC 4DZ8A 4MHHI 2YEZB 4KZDH 1KEMH 1HHJA 1HNGA 4K71B 5DC4B 4NC0B 3TBWA 3FO2A 2VMFA 5F7KC 3MUZ1 5J13B 3RGVA 4JY5L 4DQOL 5F8RC 5KBNC 2Z4QB 3DNKA 3F12A 1CFSB 1Y0LA 3D85A 5D8JH 4JZJC 2YD4A 2OZ4H 3GI8L 5JO5B 3MLTB 1LQSR 2R0KL 4UV7L 2XKNA 1T1XA 4QTIH 5K93A 4D9QE 5HYFA 1YJDL 5EB9A 4RFEB 4J3OC 4NWUH 5HDBF 4GMSL 5EIIA 5EOQH 4D0CB 1JZ4A 1CFQB 4IRJD 4L3EE 2HTLD 1FQ9C 4NJAH 4EI5C 3T3PF 4U7KA 2HAZA 4IDLA 5D1ZA 4NUJB 1BFOB 1HDMA 3WLBB 1OY3B 2IC2A 1CXKA 1VGKB 1RUPL 3QFJD 5BJTA 4FQXB 1AGBA 2IPTH 4JCLA 1JHTB 2NY0D 4K2UL 5DDHB 2CLVB 4LSUH 4UINH 3BWAA 1JYNA 2H45A 5C6PB 1ED3B 4PRBA 3AB0C 4PJDA 3FN0L 3R06A 4LHUG 5FYKE 4NBZB 3D0VA 2YPVL 5EFIB 2QR0B 1CFTA 1UC6A 3VG0L 4NO0D 4Q6IA 5A3ID 1OCWH 4RIRA 2W59A 4PRHE 5H94B 5BRZA 4I5BA 2IJ0C 1A3LH 1ITCA 5B39B 5K59E 4NT6B 1U9KA 2I26N 1PKOA 3VGGA 1FFPA 5J13C 2BERA 1K2DB 4PP2A 3BT2L 3DURB 3NZHL 4WW2A 4EQ3A 5DXWA 5D7KD 4C55A 3ZHDA 1JGLL 3ARBD 4KHXH 2YXMA 1QQDA 3FB6B 4G7YL 3EOYG 3HPJA 3VRLE 3O45A 1NCDL 1OL0A 5HGBB 2EYRA 4DZBB 2D31B 1P7KA 3V0VB 1AJ7L 4CVZB 1EHLH 2W1NA 5IFAL 1F6AA 2KKQA 1NKRA 2HLFD 4G6FB 3U4BH 2OMBA 3BWUC 1RZGB 2NY1B 4PRDB 3G6JE 1CXHA 1D5IH 3M07A 4NNYA 3IDXL 4GAYA 5C09E 3F7VB 5IW1A 3MRFB 2QV2A 1A9BB 2ZKHL 4I2XE 4KK6D 5E2WH 5KZCD 3ZYJA 4JQXA 4EI6A 1DQJB 2BNQE 1LP9B 4PTUA 4FQXC 3RAJL 1PDKA 3T08A 2UWEB 3BVNB 1MREL 2WIIB 3ERYA 4QHKI 3U36A 4PRIE 1SY6A 4XP6L 2H1PL 4HC1H 5HYJD 1KLUB 4KPHL 3CFDB 4YBQD 3AREB 5EZOL 2YKLL 1MJJB 1YDPA 2MNUA 3DRQA 4HDIA 3RZCA 1YQVL 4NBXB 1LILA 3I02B 3WKMH 2WBJA 4IEFB 4ZAKB 4YXHH 1J05B 1J0KA 2WLYA 3GJFH 1J8HB 3H0TA 2EE2A 5FA3A 2EH7L 2RQ8A 4MCZB 5DHXB 4HT1L 3B4NA 3OWEA 1PG7W 3DGGB 1OAXH 4A2LA 4EDWH 1PY9A 1EIBA 3MGTA 1KNOA 3T4YB 5JXAL 3U0TA 4HPYH 1RUKL 4V1DB 1OTSC 3OKKA 3UYRH 3V7MA 1UXWB 3K3QA 4HLZH 2DQHL 4F9LC 4PY7A 3IJSA 1EUUA 4QXGL 1S8DA 1OGAB 5D1XA 1ZLUH 3DROA 3OG6B 4R26L 4UQ2B 3KJ4B 5I1LB 2BNUA 3MV7B 1IGJB 1U93A 1LK2B 1BFTA 4KJPD 2F54D 1WICA 3LKPB 5GXBB 3I50L 2EDKA 5HVHC 1IEAA 4CBPA 5JQ6L 1BWMA 1U3HD 5F6HJ 4OCYH 2V7HA 2R29L 1A7QL 5HVFB 4AEHL 5DFVC 2H2PD 1E4KA 2EDLA 4KJQC 1GHFH 4LPYA 4FS0A 4Y2DA 1AGFA 2LVEA 5CGYC 3S35X 4MA8H 2AJYH 3D3VE 3AREC 4DN4H 3VD3A 1HNFA 1VFAB 4I3RH 4XTRD 3KLHC 1OT1A 4AEIL 1EGJL 5D1QD 3U9UB 5I16A 4LARH 5FHAL 1U8QB 4HQQH 4PD4J 2VDKL 3HUJF 4NM8L 3V6ZB 4X4ME 4HIEA 5FO9B 3ALPA 4UDUA 3Q6FB 4K7PX 1VACA 1U3JA 3X14B 4YHML 4JKPH 3D39A 1INDL 3QO0A 1JRHL 3MUGA 2F58H 5D4QA 4JFYA 5I6XC 3DMMD 4PG2A 5CP7A 3SGKC 3L3KA 3V5HA 1U8OA 3M8OH 1F4XL 5ALBH 1UJTA 3L5WA 3N1GC 5ECJE 4LPUA 5JPMA 3UTOA 1MFAH 5EU5B 5DRXA 1YY9D 3GSRA 4K3EL 4D2NA 1U92B 3B9KA 4JN1L 4CU6A 1I3VA 2EDJA 3DV4B 3OR6B 3LN5B 1IFHH 5JW3H 2H8PB 3RVXC 3PL6D 4FXKB 4KJYB 1FVCA 1BZQK 3T0XA 5TH2B 1AO7D 4F7EB 1A4KA 3EYSL 2X4SA 3WHE1 2PKDA 3RKPA 1CK0L 3UTTE 4WU5B 3O0RH 4LRIA 1KN2L 3SN6N 3CZFA 5C07A 4PJHE 3QCTL 1N59A 4LSRH 2CIKA 1JE6A 3BUYB 5DZLA 1N0XL 3NCCB 2EDXA 4XC1H 5KSVA 3BGMB 5EO0A 3MCKB 5HHOE 5JOEA 2BSRB 1N8ZB 4ZQKB 1MLCB 2VKXA 1L8JA 5I76A 1ZSDA 2JIXA 1T83C 2APBA 2MCPH 1BPVA 1EO8H 3L3HB 3NGBC 4M00A 5C0AB 5I1AB 3PIQA 4NFCA 4KROB 1E4WL 2Z93B 1WWBX 4NQEA 2J12B 1RZKC 1OP3H 1W72A 1FIGL 3VI3E 2BVYA 2XTJD 3V6OC 1GGBH 4KI1A 1NBYA 2ZNXA 2HFGH 4MD0A 4JFHD 4KV5F 5CD5D 2BOCB 1RIUH 1PX3A 4YIQA 2OMNA 4TSCL 1JK8B 1LO3L 1IGTA 3RVUD 5K9KA 3PJSA 3CFBA 2VL5B 3H9SE 2QSCH 4KVCL 3LEXA 2DJUA 1WK0A 2V2WA 4JJHA 3GNMH 3WFZA 1RZJL 1EXUB 4NYLB 5EUKB 1SJVA 4ZOAA 3D25A 5GRJH 3F65A 4YBHA 3MRMB 4MQXD 4OZIB 1TJIL 1TFHA 4I3SL 5J9PB 3BP6A 2ZUUA 1NBZB 3D5OF 5DUPL 4LCWD 3GBML 4NJ9L 5F1IA 3CC5A 3QPXL 5HYSB 2BFVH 2IFGA 1I7TA 1YJDC 1F00I 4XMPH 4J23A 1IGCH 4X83A 1UZ8A 1U58A 5ESQB 5ICZB 1F42A 1ZHLB 2AJVL 4Y4HB 1GZPB 5DHVH 4OCWL 1FV1A 3S36L 3GSXA 4CW1A 5KOMC 3S5LA 1HYSD 5LVEA 1QNZH 1G7IA 3P0VH 4XPBH 4XHQA 1KT2A 2G5RA 1IZKA 3T77B 4LCIH 2DJSA 1QG3A 2B4CC 1CFNA 4KH2A 2A74A 1MCNA 4PG9B 1D5BB 5FXCH 2X70B 5I66B 3EDDA 4R7DA 5T1DL 1R5VB 3V7AG 3QQ3A 2XOTA 3RKDD 3C6LA 2FIKA 3KS0J 4YHPB 4ETYA 1FZKA 3EDEA 4FXGB 3MRPA 1SMAA 5AUMB 5FHBH 5CBEA 1FL5A 4WENB 3LSOA 1GL4B 1JMXA 1Z5LB 1KG0B 4OJFL 5FB8B 1CF8H 3VXSE 2NXYD 4E5XB 5GSRA 2Q7YA 2VLKE 3NN8A 3C5JA 3PWNA 1WWAX 4AL8H 1R3KA 3N9GL 5FFLA 5HY9B 3L6FB 3P30L 3GMQA 1T7VA 5EC1A 3L95B 1N5AB 4W4OC 1MVUB 2X4NA 3DVNB 5ADPL 1CXIA 5ERWB 5ANMA 1EZVY 1E6JH 1INQB 3CLEL 4Z7OE 3DUHA 1EHXA 1YEHL 5D96B 1IRAY 2FX7H 2FBOJ 4PRAA 4LLDA 5C0ND 2IWGA 4Y4HC 1TZGL 1B4JH 3RTQC 1FNEA 2HYMA 2WINA 1KPRA 4KI5E 5DA4A 4ONFL 4JGMA 1YEGL 4QRRB 2B1HL 3RL2A 4I4WB 5ISZE 5HJ3B 1LD9A 5KVGH 5D2LA 2YSSA 5IBLD 2VO5A 4LMQE 2BSSA 3QIUC 4GKSB 1T2XA 4HS8H 1A6UL 2Q3ZA 3LDBC 1WEJH 1G7MA 1ZEAL 4LKXB 4WV1C 5EZIH 4AMKL 3QDMB 5KSBA 3OKDA 4LSQL 2YN3A 4PV8A 1HEZB 2Q6WB 3LS4H 3LN4A 1J1XL 3QB7C 1NEZB 4R3SB 1EJ6A 2EKSB 5C6WH 3QXTA 1YMMA 4OFVA 4P2OD 1OAYL 4JQIH 1NLDL 3OTTA 2NY6B 3O3EA 1C5CH 3LKOA 5DD5H 5C0JB 3K4DA 3FO0H 4XHJC 5C7XH 2ICEB 4G42B 2HT2C 3ULVH 2JE8A 5CKGA 3Q2CA 5AEAA 3NBNA 4DGYH 3FQUB 4XCFL 3WKNA 1R5IA 3U79A 1INEH 1KXQE 1YPZB 4LLUB 5DD6A 3WFDL 3QDGE 4WHCA 4OZFA 3MLSH 1T03L 2DQDH 1DQQB 2ADJA 3E6HB 5CSZA 5JUEH 4F80A 4R4FH 1TETL 5HHQA 1BIHA 4P46C 5FYLL 3T0EB 4DW2L 2OXGA 2A77L 5GGTL 4NO3B 1A7NH 1N5YL 2OR8A 1K3ZA 3O2WH 5IM7A 4LCUA 4OQ1A 2XQBL 2A1WH 4UQ3B 3QPQC 1DQLL 1UM6H 4M7LT 1QSEB 4JO2L 2ADGB 5BVPH 4IRJA 2BHYA 4JO3H 1DEDA 4ZUSA 1QSVA 3TNNA 2RIKA 2GT9B 1BBDL 4AY0A 4D94A 4WI6A 4F33B 1F5WA 3ULUL 1ZWIB 4GXUN 1Y6MR 4YHLH 4UZGA 2GW5A 4NC1E 1M7IA 1UVQA 1SJEA 2BNRA 3QEGH 1OQOA 1FORL 3UTZB 5DJZB 3ULVF 4D0BA 5INDA 4JFDB 3RU8H 3UTQA 4HS6A 1XAUA 3I6KA 3O2DH 3GMOB 3THMH 2CDGA 4ZNCD 5EU6B 5FYKU 3ZTNL 3QG6B 1S3KL 5LGJB 3KPSD 4WDIA 2FR4B 4J12A 2GJJA 3IKKA 3WHE0 4PJDE 2IPKA 3ZO0A 2R1WA 4ZO8A 1EERB 3G5VA 4QRSA 3V4VL 4HIHA 5BRZE 3LRGA 1GGIL 2Y06H 2BCKB 2XA3A 1LEIB 2ZNWA 4IJ3C 1M05A 1KFAH 4XXDA 5KSAD 5JHLL 3SDAB 3RDTD 4RAUB 3HC3L 1OW0A 4NQCB 4NKIL 1MLBB 4G80B 3VWJD 3ARBA 4RCAA 3BH8B 4D8PA 1BQLH 1VFMA 2G5BB 4XCEA 3SGDH 4L4TD 2WK2A 4MAYC 4Y88A 4P2RB 5ID1A 3B3IB 4ONHB 4ZSOB 2Y4SA 5FUOL 3WNOA 1CD1B 4MNQE 4RAVB 4YPGA 3TWCL 1B3JA 4ZS7H 3SBWA 15C8L 5B38B 1IC4L 3MV9D 2Z8SA 3Q6GH 1KYOJ 1LO5A 4H1LA 4I8DA 2L4OA 5J56B 4X7SH 2DYPB 2AJZB 3BKYH 3NVQA 3MR9B 4Z5RB 1HHIA 5GRYA 5DGQA 5SV3A 4NN7C 4Y19D 1NGWB 5FKPB 2DS4A 4GRLB 2VDQL 5HYJA 4QHKJ 3ZKXC 4FMFA 4NOBA 2P8LB 1TZHA 2EZ0D 5F7HA 3GSNL 1QRND 1BEYH 3SDYH 3Q5YA 2F8OA 1ND0B 3HRPA 1BHGA 2ZG3A 5HI5C 2UZXB 3KPOA 5HYIA 3DUSA 1TDQA 2FJGA 1MFNA 4O00A 1HXMB 5TE7L 1QLRB 1ZGLB 4NRYA 1MCWM 3DSNA 2HKFL 4YFLF 2DQCH 3LV3A 5IROC 3MRDB 4KUCD 4JAMA 5LCVH 5C3LD 2X42A 1IAIH 4NKDA 3MBXH 3I2CL 4K7PY 2OXHA 1CU4L 4EDXB 3P0YH 4POUB 3L3JA 5IMMA 4GSDL 1BVZA 3UBXB 1T1WB 3P77A 5DRWB 2OTWB 3K8MA 4C59B 4FFVC 2R1XA 2EDOA 1F4WL 3F7YA 1BJ8A 3KPLB 4G8EA 4P59H 2QHRL 1P84J 1P53A 3FJTA 1FN4A 3EFDL 1T0NB 1JGVH 2ZJSH 3WIIH 1ZT4B 4LDLB 1KCSL 4KMTL 3TO4B 5IVXF 4UAOB 5F89B 4UT6L 5D2NA 4RGMB 2DQJH 5I74C 4GG8B 1NCCH 1ZS8A 3O3BA 3QEUA 3RUGB 4XPHH 3HA0A 2DMCA 3DV6A 2QKIA 1K8IA 3FB7B 1OB1A 5MI0C 1D5ZB 2I9TA 3MRNB 3SJVB 2CIIB 2JB6B 4HEME 1U8NA 1A5FH 3CGTA 3OHXB 5GHWL 1CLYL 2VERN 1T7WA 2HKHL 3SE8H 1MHPL 3QAZB 1UM4H 1Z9MA 2DIBA 1CL7I 2VQUA 4WUUE 2NR6D 4ZODA 5TE6H 3TBTA 4BQ8A 1YNTB 1MY7A 3JWOL 5IB4B 1K6QH 5E6IC 4K8RL 4PRPB 5E9DE 4G6KL 2OJEA 2R0WH 3LMJL 4L9LB 4X6CA 1JPSL 2YD8A 1Q9WA 5BS0D 3NAAH 4JY4B 3I84A 3S5LG 1HQRB 1XF2B 3RWCA 3ZKNC 2PYFB 3T4AB 1FL3B 1RK0B 3VFUB 4OLYH 3WS3A 1A6ZB 2IAMB 1A7PH 2JELL 1RSFA 5ICYA 2EDYA 2IPUK 1JWSB 1N64H 3TZVC 3IF1A 4KKAC 3VW3H 3RY5A 2WP3T 4OFDA 4NQDD 1AO7A 4NO2A 4TPRH 1RZ8B 4JPVL 4ZPVB 4M1GL 4HCRH 3PV6B 1T1YB 4KDWA 3SDDC 3MO1B 1LO4L 1ONQB 4Z7WA 3A6BH 1S7TA 1DUYA 5EO1A 5GRVK 1ZKAA 3REWA 3BEVB 5GGQL 2J5LB 4TSAH 1UJ3B 2VXVL 2UVFA 2H2SC 4HUVB 4ACPA 4S1DD 3VGBA 4LAJH 1MJUL 5EWIH 4LVEA 3JV4A 2VRAA 5I2IA 4TUJB 4LVOC 1OAZH 3MA9L 3MREB 3O6FC 4OZGE 4WTZG 2AABH 1SM3H 4OF7A 1WBXB 5TFSL 4P5KA 1IGFL 3FFDA 5I1IH 3IXTA 1NC4D 3NCYP 4JRWA 2DDQH 4P4RA 2NY3C 4JFFD 1G9NL 4NQUA 5C0BE 2ESVD 3JTCA 5IK3B 3EOBA 1F2QA 1ZHKA 2DLHA 1KLGB 2PYEA 3H3PL 3DVGA 4IDJL 5E8DH 2WUBL 2J4WL 3EFFA 3O9WA 1RD6A 1BIIB 1FG2A 3GSUB 3OKLA 4X4YB 3TNMB 3LRSB 3BUTA 4HWBA 4N8PA 2D4FA 2P43B 1ZT7A 5TQ0L 4PJCB 4XP1H 1MRFH 5IG7A 4JO4L 1C7TA 2J5LC 2XIDA 3QHFH 3CCHB 3L5JA 4U1HB 5FGSA 2W9DH 3W9EB 2FDBP 1U91B 2KH2B 2V7NB 3CH1B 5BZWB 1ULVA 2VDLH 3DX8A 4U1NA 4LCWA 2IGFL 5EZLB 3QG7H 5LJYH 4M7JH 5C2BH 1CGSL 1W8OA 3WLWC 1MIEL 1RZKH 1RULL 3P0GB 3VGAC 2GSGA 3VFTB 3JUYA 2G60L 4QRUB 1JPGA 4CAGA 2KDGA 4S2SB 4ENEC 5HSFA 5DJCA 2P5EA 2VXTH 4EUPH 4EN3B 3O4OB 4NC2B 2BY1A 1HHKA 3MGOA 2MKWA 2NY2B 1I8LA 1BX2A 4J4PC 1NFDB 1DSFL 3HS0B 2R56L 1CDCA 1HHHA 1I1AA 3CVHA 3MNVB 4NUGH 1OWWA 4JY5H 3G5ZA 4R90H 3CFJA 4KKCC 1QA9B 3GI8H 4Y8DC 2GY5A 2AI0H 1GVIA 3IDUA 5KSUA 3BPOB 4IRSC 4QHUB 2D3VA 2EE3A 5KAQG 4JB9H 5T1LD 4X80H 1YJDH 2ZOLA 1RJLA 4WW1A 3VH8G 4GMSH 1JPTL 4RNRB 4NZJA 3BKCL 3QUMA 5JHDA 5EOCL 3HI5H 3O6KL 3QNXA 1OAKL 4AM0A 4KDVA 4LGSB 2VE6A 4UTAL 4ZO9A 2ENSA 4BZ1L 3RVVD 2B4CH 2Z35A 5ANME 3C6SA 4PD4K 4ELMB 3P11L 3ES6B 2X4PA 1VPOL 4MA7H 3IFOB 2YPVH 4NNPL 3VG0H 3O4OC 1WBZB 3PHSA 3ZKMC 4NM4H 2OYPA 1XMWA 3ARVA 2NY2C 3NPSC 1HSAB 3T09A 2BVQB 3ZDYE 5F97E 1A14L 4HK0A 4JANA 3MFFA 5D2LE 5IHUL 4FP8H 3BT2H 3NZHH 5F1NB 1FFNB 4MVBC 1LDPH 5JLZA 1LE9B 1NGPH 3NA4A 3FQRA 2EYSB 4PYHA 1YNKL 3ELAT 5JOFB 5C1MB 4HKBB 4TOYH 4JDTH 4KDTA 5M94B 4U05A 1MCKA 5EBWB 2MHAB 3KPQA 5FGBA 3P4OB 1OTUD 4P2OA 3HAEA 1WFOA 4FG6D 5IFAH 2R8SL 5HVWA 3FO9A 4QEGA 1D5MB 4M48L 4DOHB 3MV01 2DLTA 1TITA 3DSFH 5EUOE 5GGRA 4PR5A 1JZ5A 2O93L 3KYMB 4GKOA 3KPRA 1S5HB 4QHNA 3RAJH 4POZD 5MEOB 4KY1L 4KRPD 3IDNB 1MREH 4LIQL 5D7JD 5K9QG 5HGDB 4LLQA 4XP6H 3IRZA 4NRZB 2RAMA 1ZA6B 3RHWK 1K4CA 1F8TH 1CDGA 4P57B 4RWHA 5TPWL 3PWVB 4JFEB 5EZOH 2YKLH 1NLBL 2ZSVA 3EO0A 1NUDA 1FDLL 3JV6A 3LQAL 4X6EA 2FCBA 4XMKL 5GRWA 1KCLA 3CPLB 1YN6B 2XNAA 2DKSA 4ZUVB 4GG6E 1NGXA 4OZIF 4DFIA 3WD5L 4HT1H 4ZO7A 2IANA 1FP5A 3DX6A 4HKXB 4FFEX 4XNYL 5ETUB 2A6JB 4Z7VB 4G8GB 2N4IA 5DSCA 1X5FA 5CEYB 3W9DA 5JXAH 1SBSH 1RUKH 2DQTH 3HUJA 2DQHH 4F37K 3QQNA 4LLWA 3F58L 4IOFC 5T3ZL 3VFPB 4QXGH 4OQTL 1P1ZB 1H9VA 1QEWB 1MRDL 2BNRE 3BQUA 4R26H 4FZEH 2PR4L 1AKJB 5SWZD 4NBYB 3JWOC 1D5XB 5B21A 1UQSA 4K8RC 3RWJA 4U2ZA 3QEHB 3QWOA 3KPSA 4V2CB 3I50H 5JQ6H 2OI9C 5D7SL 3SGEH 3KYNB 5J3HC 4QLRA 4NZTH 5CCKL 1A7QH 1CTNA 1SY6L 4CGTA 2C4FT 1MHCA 4J3VA 4J3TA 4O02H 4I9WD 5KSAA 5D6DC 3OKMA 4Y5VB 1I7ZB 3RDTA 4LCYB 5F7WC 5D7LA 3KAAA 3VWJA 1EGJH 5HGHB 4GKZA 2C1PB 43CAB 3W81A 4L4TA 5AWNH 2V9TA 3BHBA 3IU4L 1X4XA 3VU2A 2O5YL 3VXMB 4XPFL 5L8LB 3HB3C 1Q72H 2WNGA 4FRWA 2NY1D 4YHMH 3RVTC 1INDH 4Y1AB 3VJ6B 5D6CA 5JIIA 1JRHH 2AXGB 3MV9A 5T1MB 3MBEC 3QEQD 2X4OA 3TN0B 1KPUB 5MEQB 4DEPB 4PJ5B 1HXYB 1QTYT 3VXQB 4EIZC 3ARTA 1HYRC 1KTLB 5TGBB 5F44A 4TVPE 1MWAL 4K3EH 4Y19A 5E8EA 5MEND 4U0RB 4JN1H 1DANU 1I7UB 5TF1L 3GUTA 3IDMB 1OARL 2GQHA 1G7PB 4P4KD 1G9NC 3KR3L 4KKNA 1QRNA 3IJYA 5JPNA 1IC7L 3PHQB 2DWEA 3N1FC 5F7NC 2VUOA 1IE5A 3E3QE 4OV6F 5SWSA 1J8HD 3EYSH 3FAWA 2ZUQC 1DQMH 2I9LA 1A4JB 2W65B 4GAFB 4F57L 4DK3A 1KN2H 3S3PA 3ARXA 2VXSL 3S96B 4RQQB 2AJSH 3DGCR 5KN5B 2QQLL 1U3YA 1EBAA 1G7JA 2G9HA 1N0XH 3TO2A 1J86A 2CUIA 1KJVB 2H3NB 5CD3A 2XA8L 2CO7B 4FQIL 1RZ7L 2IH3A 2Y6SC 3HC0B 4FQJL 4A6YH 5BO1H 1OGAD 1N3NA 2ZSWB 3WO4B 4HXBL 1Q9OA 3OKOB 2VLLB 3RNQA 4Y4KB 3MV7D 3R4DA 2APVA 1QVOA 1XR8B 1JNHA 4WO4C 1VENA 3SKMB 3NCEB 5DYOB 4BJLA 1KC5L 3DLQR 4RRPG 1BLNB 5HD8C 2DWDB 4EXPX 4LK4A 3HG1D 1ZVSB 1K8DB 4R0LB 1RVFH 2LVCA 4C4KT 5DJYA 5L88L 2R0ZH 3GMPB 1S7WB 3OX8A 4MMZC 3REVB 2HJFB 4DZ8B 5DEFA 2Z92B 4L4JA 2LAAA 2JJSA 3RI5F 1RHHA 3DPBA 3Q1SH 3CK0L 3TPUB 1JNNL 1U41A 2AV7A 1J1OL 2BHUA 2XKSA 3IFNL 3FO2B 4TTDD 5E4EB 4BZ2H 1ZGLP 4KI5C 3GJEB 5C92A 3N06B 4D9RD 3C2SA 1H3WM 5CFHA 2AXFA 1VFUA 2J88L 1AGCA 3F12B 4P5TB 2Z31B 3D85B 4H26A 4WNQB 3UC0H 4XPAL 4M93C 4FN0A 3MV8D 4YDKH 4RBPH 4GRWE 1RK1B 2O5ZL 4I3SH 3QCUL 1T1XB 2X4UB 3GBMH 4J1UB 4NJ9H 4BQBA 3HMXL 4O2CB 3QPXH 3HI1A 3VGHA 5EIIB 3JUZA 2A2QT 4X6CE 2AJVH 4AJ0A 4JDZB 4MX7A 4Y4KC 3HE6C 1HDMB 3S36H 1VDGA 2DICA 3U30B 5DTFB 4CVXA 3BN3B 5DMKB 1FAKT 5GGSA 4F7PA 2Q8AL 3SE3C 2X4QB 3FQXA 3WN5A 3CSYA 4UT9H 2EC9T 4YPJA 5I1EL 4DVRL 5C9JA 4PRBB 1XT5A 2B5IC 4E0RA 4ODUB 1T5XB 2GJ6E 2PXYB 5T1DH 2X4RA 4PGEA 3NIDE 1A0QL 4LNRA 4RIRB 1G9ML 4KQ3L 3MRHA 3T2QA 1CICA 1H5BB 3RPIA 3K8LA 2UUDK 4OJFH 2J8UE 3RGVC 4OFYA 5ALCL 2UZIL 1S5IL 4MJ4A 3QDJE 5AZEH 3F8UB 4X8JA 4CJ1A 4PJGA 4YQXL 1QQDB 3VA2C 3VFVA 3N9GH 5FK9A 1AC6A 1ZVHA 3P30H 2XN9E 3U0PB 5CZXC 2EYRB 4I48A 4N1HB 5E5MA 1NC4A 3QUZD 1BJMA 1S7UB 3K1KC 3QI9B 4JFFA 1JJUA 4Z0BL 3BMWA 2ESVA 1P7HL 32C2B 3CLEH 3VE0B 1FCCA 1YEHH 4NNYB 4U6VL 4GAYB 4YC2C 4NC1C 5IW1B 4KHTL 1TZGH 4IBLT 4Y89A 5D1ZC 3SKUD 4ONFH 4EI6B 2GEEA 2PYEE 5KVEL 1YEGH 2B1HH 3MJGX 4PTUB 4OD2A 1JZ3A 1QO3B 4FTVE 1KTDA 4WI9A 3U0WH 2ZCHL 2R2HB 4D3CL 2WZPD 2GK0A 4XVUC 4YO0A 2A73B 5MHSD 1G84A 1ZEAH 3BXNB 3ARQA 1JGDA 1ZT1B 4XXCA 4AMKH 1KJ2H 4ONGH 5IFJB 3DXAD 4Q6IC 1RU9L 1XF5B 3TLRA 2NQCA 3O6LH 1H3VA 3FMGL 5E08L 1HH9A 2QADC 5FA3B 3O8XB 2DIAA 3TH2T 3BE1L 4P3DB 3V4PH 4YHYB 1DUZA 1OAYH 5I8EB 4L8BB 4LCWE 4LP4A 2R0LH 2K1MA 4WW2C 5HDBE 1FSKC 5BZDB 2IFFH 1GH7A 3C08L 1KF9B 5IT2L 4CDGC 4GW4A 4K3HA 3T3PE 3DETC 1NCWL 3OKKB 2FGWL 5K9JH 4GKNB 4GBXB 3S98A 5FDWA 3KG5A 1S8DB 2VH5L 5D1XB 1NMCB 2P5EE 1TJHH 3DROB 3WFDH 2BNUB 5FYKH 1MWAB 4YAQB 1T03H 2R1YB 4OLUL 1HOCA 2YC1B 5D7IB 2HMID 3QCVH 2P45B 4JQXC 5E7BA 3BZDA 2R69H 7FABH 4OLVL 2IADA 4YHKL 2VDNH 2ZG1A 5IBUG 5FYLH 5E1AA 4KGLA 1IEAB 5JNYB 5GGTH 5D9SA 4KTEH 1N5YH 3IS0X 2V7HB 3BDXA 1CE6B 3BD4A 5T1LA 3P4MA 2XQBH 2WQRA 1DQLH 3I6LE 1AGFB 4L8CA 1P84K 1Q94A 4YHNA 4ZFZA 1J1PH 3BO8B 1BBDH 3RZCC 1FRGL 4O51B 2WBJC 3NCYS 1B6UA 2SEBA 4O2EB 2WWMC 4OV5A 4I77L 3U7YL 4AENA 1F11A 2V2TA 5JHDE 3IJHB 4ZS6D 2X41A 2I24N 3NFNA 4G9FE 2YN5A 5CS7A 4S10A 3AU1A 4HIEB 4WFHE 2VNCA 4HG4J 1OAQL 3VGDA 5T5FL 3ZTNH 1GOHA 1ADQA 4BK4A 3FZUD 5FECA 2CKBH 1S3KH 2ZUWA 1WFUA 3LVEA 3OJ2C 3S88L 1U8OB 1QLFA 1OM3H 3QJFA 2AJ3B 1K5NA 3QULA 4U1KA 4RFOL 1P6FA 4XMLL 5D1XC 1P9MA 2F53D 5DRXB 4AQOA 2RR3A 4YHOH 5FGCE 1BFSA 4RGNB 4PJBA 4QRPE 3V4VH 2CRIA 1RUML 1GGIH 4MJIE 4JFQA 2FYYA 5C6TL 1X4YA 5JHLH 2L7UA 3P73B 3HC3H 3SY0A 3L7EB 5E8PA 1FVCB 5L2KE 1VEMA 2HH0L 3DO7B 4NQSA 5JOPD 3VGFA 4NHCL 4GUPA 1JI2A 1A4KB 5DRNB 2ITDB 2VABA 3V4UL 5GS2H 1E4KC 5MEPA 1E6OH 4Y2DC 5F6IB 2LU7A 3E0GA 2ATKB 3G6JF 3MNWA 5FUOH 3RNKA 1N4XH 2NY6D 3TWCH 5C07B 4MB4A 4OCMC 4WFED 1I3RA 1N59B 3EYUL 3GSQB 4JJ5B 5EA0L 2BRQA 3DX7B 5KVFL 4LSSH 1V05A 5HI3C 4YXLL 3S3SA 1B4RA 3WDIA 4G8IB 2VXUH 2YEZA 3O4LB 3X3FL 4XAWL 5E70A 2AJXH 3KPRE 2AVGA 5D7JA 2W9LA 3VXUB 1RIHL 4JM2B 3GHEL 2D9CA 3K2MC 1I8MB 2VDQH 4JRYB 1EVUA 2VL4A 4PG2C 1C16B 2Z4QA 3GSNH 4PJCF 4O5LL 4NQEB 2NY4D 5JO5A 4HX1B 3SDXA 3AC0A 2EIZB 2YXFA 3UX9B 3WNKA 2AW2A 4M7ZC 5TE7H 1NBYB 2JJTA 4RFEA 3B9KC 4YR6B 5AZ2L 1ZLSL 5IBTL 4YIQB 5DJDA 4D0CA 1CFQA 2IANE 2GFBA 5FA4B 5K9KB 1RURL 3BP5B 3QHTC 3PWUA 4NUJA 3WLBA 2IBBA 2V2WB 5FV1L 4BK5A 1VGKA 5GPRA 3PQYD 1ZLWH 3C9NA 3HUJE 4GSDH 2PNDA 4RWYL 4LRIC 1JHTA 3VFGH 2CLVA 2PO6D 5SWZA 4MZ3A 1NFDF 1JWMB 1ED3A 5DI8B 1QFWH 3CC5B 5EFIA 3GMMB 2IQAB 2QHRH 5FAAA 1UZ8B 1A22B 4MWFA 3EFDH 4LASL 4JO1H 1NCTA 1KCSH 5B39A 4NT6A 1FV1B 4MAUL 4E9LA 3GSXB 3WEXB 3JXAA 4OKDA 1NCAL 3SDAD 3TM6A 2FHFA 5D72L 4ELKB 4NQCD 3PGFL 1J5OL 1MCHA 2CDFA 4JPKL 5D7LE 5GHWH 1CLYH 4DZBA 1Z2KA 4B5EA 4CVZA 4LLVB 1MHPH 5CZVH 2W0LA 4PJEB 3WJLA 1T66C 1RZGA 2FIKB 3JWOH 3BAEL 1X5ZA 2JB5H 1G9MC 4G6AD 2BY0A 1FZKB 3F7VA 4K8RH 5GIRA 1PEZA 4G6KH 3QEQA 5CBEB 4KK9C 3LMJH 3L5XL 4ZYKA 1DQJA 1CT8B 3BEWB 1LP9A 4HV8B 1LDSA 2DYPD 3FKUS 2UWEA 3BVNA 2WIIA 2E9JA 5C0RL 4QGYA 5DVOA 1IGML 5MENA 3GSWA 4O58L 1QP1A 4EVNB 1KLUA 2YD6A 5ESVB 4APQB 4HUXB 4P4KA 5E56A 1MJJA 5KANG 1EX0A 3I02A 5F3HA 4ZAKA 4ZUUB 1X5JA 2Z9TA 3JVGA 3RGHA 1J8HA 4M1GH 4PP8C 5JZ7D 1QRNE 3RVWD 4LLDB 1DDHB 1SJHB 1LO4H 4MCZA 5SWSE 5FO7B 2VXVH 3DGGA 2RCSL 4TQEH 4XVTL 1WQVT 4KV5E 4NSKA 2W9EL 3VGEA 4HWEH 4HWNA 3T4YA 5IFHH 3I85A 4Z95H 1BP3B 3U46B 2XXMB 2BSSB 1KB9J 5C9KA 4Y5YC 4PGDB 2O26U 1E4XH 3MA9H 5F96L 1G7MB 4NCDA 1MHHB 2CD0A 2ICES 5C86A 1OGAA 4N5UA 1I9JH 5LGHH 5TFSH 3C6LC 5I1LA 3MA7A 3MV7A 2X40A 3EYQC 4HHAB 1IGJA 4WFGD 1IGFH 3P9LA 1XR9B 3FQTB 1G9NH 1Z0NA 1D7FA 1YMMB 3QBTB 3LKPA 2GTZB 4BSWA 1NGZA 1OP5K 2MPAL 5JIPA 1DBKL 2C26A 3EOTL 3O3EB 4HFUL 3V6BR 4OCRL 2R15A 3TA3B 8FABA 1AQKH 1ZA3B 4WY7L 1KSRA 5I1DB 3UMTA 3TO4D 5EU7C 4P49A 2JTDA 5CIPH 3WS6A 4WI3A 4Y5XC 4LL9A 1O5DT 3PABB 4PLNC 3BPNB 5KVDH 1VFAA 4YZFF 3HR6A 4RGOL 5ENWB 4CMHB 4OBRA 4Q9RH 3U9UA 5GZOD 4OZFB 1F4HA 4LF3B 1U8QA 4OIIL 5CSZB 5EZJB 3V6ZA 4X0KB 5DMGC 5CLTA 5FO9A 3OAUL 4NPYA 3X14A 1VADB 1H3GA 4PRPD 2IGFH 3BN9C 2XG4A 2BJMH 1P6AB 2DIJA 3HRZA 1CGSH 1B9ZA 3CU1A 1MIEH 4IRJB 2Q76A 4H88H 2MKLC 4AIZB 3TCXA 3I3DA 2G60H 3GBNL 1UKTA 1U92A 2IAMD 1SJEB 2ADIB 3WMSA 3UPRB 3DV4A 3QFJB 1KIUA 4QOKE 1KCGC 1ZHBB 4WEBH 1NMAL 2H8PA 1BMGA 4IRZL 3SQBA 4KJYA 4FXKA 5TH2A 3RIAK 4OM1L 1IAIM 2R56H 4EEEA 5JMRA 1WZKA 1TENA 4WU5A 4ZNEA 1P4IL 4NQVA 4LAQH 4PDCE 4NO0B 3SGDI 4N90E 2GITA 4RAHA 4RFNB 2NX5E 1A7BA 2IPKB 1I85A 2E8ZA 3HNVL 5IW6A 3G5VB 3VRJA 4HWBL 3AS2A 3GMNB 2ADFL 1CVSC 4HIHB 5E8OB 2Y5TB 2XQYG 3GSOB 3MCKA 1M05B 1KB5H 2CK0L 2H32B 2XPGA 4ZQKA 1MLCA 3M17B 2DQGL 1AXTH 1RJZA 2AJUH 1BF8A 3G6AB 1MF2L 3WYRA 1Q0XH 4LSPL 5FUZL 4D8PB 3L3HA 3OPZL 4MSWA 1KIPB 3D2UB 3O6KH 2AP2A 3O3UN 5C0AA 1OAKH 5JDJA 4XP4L 1QR1B 3PWPE 4AQ1B 2X1PA 5I8KL 5CJ5A 3U2SB 4JFFE 4IRJC 2HTLC 1EUTA 1ZLVH 4Z0XA 2RGSA 5B3JF 3P11H 4BM7A 5KZCB 1JUFB 5FYJE 2WWKT 4NNPH 2OTUB 4H1LB 5CAYB 1KGCE 5B8CB 4YUEL 1IAOB 4HZLA 1JK8A 1BQHG 2DQFB 5GGVL 5IMKB 4X5WA 3EKCA 1WZ1H 4OLXH 5ACZA 2NY0C 2VL5A 3C2AL 3W0WE 1QYGL 4HBQA 3CVHL 4PJ7B 4WI5A 3QR2A 5HHMD 3P9MA 1EXUA 1DQTA 5JW4N 4Q74A 5HYJB 4JLRB 1T3FB 1BQSA 4RZCB 5EUKA 1JWUB 1X5IA 3LEVL 4YEEA 1TZHB 2MOVA 2FEDD 1HKFA 1YNKH 1LGVA 3DXAA 4K07A 5A3IC 3NCFB 4OZIA 3ROOA 1Z3GL 5J9PA 5BV7L 4K7FB 2FJGB 2X9WA 5HYSA 3V2AR 3AY4A 3O6ML 5ESQA 4M48H 5GS1B 4HGKC 5ICZ