3IXAA

Human class i mhc hla-a2(a150p) in complex with the tax peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAPHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ixaA01
3F7YA 3KYKH 4AG4H 4Q0XL 4R2GC 4BZ2H 1MRDH 3QEHA 5GSRA 4NKMB 2X4QB 3CUPA 4EI5A 2YN5A 4U31A 4F3FB 1CE1H 2NZIA 5EUOB 4LPXA 1J1OH 3PWNB 5F89B 4F9LA 2O61B 2XZQL 2ESVE 1VKXB 4MSWB 1HXMB 3V5KB 5HPOA 3HI6L 3HRPA 2DICA 2Z91B 4XZUB 2HWZL 1OAXH 1GZQB 1CQKA 2IAMD 1MSPA 5BMFL 4XNYH 1U8QB 3KYNA 1CWVA 3V4VL 5CJQL 4PR5B 4WENB 3DWTA 2VL5A 3JTTB 4LLVA 1I9JH 1U3ZA 1DBKL 1XCQA 1I1AC 2P49B 1UWGL 2N7BA 5GGVY 1GGBL 3AXLA 4N1CA 4MQ7B 3PWLB 5HGGS 4LLYB 4NZUL 3ABZA 1M7IA 2FLRT 4Q9QL 5GRXG 5ERWA 3ARYA 1MJ7L 5SWZE 1IGFL 2DYPD 1MAMH 4XPFH 1DQQB 3GK8H 4YAQB 5C0FB 1LO4H 2J8OA 2DN7A 4FZEL 5GS1C 2OR9L 4ZOBA 4DUWA 2ITDA 5GZOD 1IAIH 4KTDL 4PB9L 4XX1E 1GAFH 4LHJB 1PEWA 3M45A 4PJAA 1MCBA 1ES0A 3H9HA 3CCHA 4P2OA 4XPBL 3FRPA 1AJ7H 3TO4D 1KSRA 1RK1B 3G6DL 1CR9L 1CVRA 2YEZB 1INEH 4LDOB 3Q5OA 4XP6L 1Z5LB 5CZXC 1MUJA 4RA3A 3O3DA 5GGSA 3RA7H 1GPOL 3K2UL 4UTAL 2GQHA 2Q6WA 1OP9A 5C0AB 1QBLL 3LRSA 4X6EB 1XGQA 4NO2A 1I8IB 1NFDA 2BZDA 5JW5B 2OZ4H 3TPUA 3AREB 5D7JC 3QFJE 3U30C 1JF6A 2NXZB 2OTUA 5KSAD 1C12A 3A67L 3V0WH 4PBWD 3NCBB 5JORB 2H26A 4XBGB 1TMCA 35C8H 4I3SH 3HKFA 4HIIA 1SEQL 1U95A 3VXRD 4LSUH 4Q2ZB 2DIAA 3NOIA 1UXSB 3CZFA 3PDOA 3CFDB 4GAYA 3E0GA 1V3JA 1J9CT 1E28A 5FGSA 3PGCA 3FOLB 3RL2B 4R4FL 3ARBC 2EEAA 1MI5B 5TFSL 1FH5L 1WCBB 2P5EB 3VDAA 3SPVB 4M6ML 4F15B 5E5RB 1X5YA 4HIEB 2R0ZH 1WK0A 1S7RB 2A6KB 5DJ2A 3SE8H 5LVEA 1JRHL 3ILPB 3MRCA 1J0ZA 1MFDL 2COQA 2PTTB 3O4LD 3J7HA 4UDTB 3V0VA 1SY6A 4Y2DC 3SDDD 4IMKA 5HGHB 1A1OB 2V2TB 1OW0A 3O6FB 4XWGL 5E8PA 1DANU 3ARGC 2DQJL 3F65A 2R2EB 4R2GD 1MCJA 4LCCA 3TFKA 3QHTC 3RJDA 4OV5B 3WLBB 3JUZA 2A77L 1FGVH 3A6CH 2JB5L 1IKNA 3T0DA 1PZ5B 5E9DA 4GG6F 2X4PA 3AMLA 2NCMA 1MJJA 2CUMA 5GZNC 3C08H 3QFDA 2FWOB 3GZKA 5F7HA 5HYSB 2O93L 3NTCH 3IYLW 2R4SL 2W60A 5J06A 3Q2CA 2YXFA 5D7KE 4DN4L 3FQRA 5D1QA 2F54D 1BJ1H 2ADJB 2DQDH 2E3VA 3KLAA 2F5AH 2PW1B 2VXSL 2YA2A 5FO7A 1F4XL 1CFVL 1FZMB 4LP4A 5I16B 2DQUL 25C8H 2NW2A 5DK3A 5I8KL 1KCRH 5EU4A 5IMLA 4BH7B 1X5AA 3OR6A 4I18A 3S3SA 1I1AD 5DEGA 3RWIB 1K4DB 5SX5H 2IBZX 3L5WA 5E2VH 4YR6A 5J89A 2P7TA 5L6YL 3LDBC 4KKNA 3CVHB 3LKNB 1G1YA 4K7PL 2CKBB 2ARJQ 2VDNH 5IHUH 4C56D 1PX3A 1KACB 4OM1L 1D5MB 4KKBC 5FOJA 4HT1H 1FZJB 3KR3H 1P7QA 5F9AC 4Z0BH 3R8BB 7FABL 3DHJA 1BMGA 2VE6B 4H0HB 4U4BA 4JRXB 3OXRA 4BFBD 3MRKA 1HI6B 3SE4C 4N8PA 3T3PF 1YN6B 1S9VA 4M62L 3QP3A 3GKWH 1JJUA 5DMJB 2D7MA 4GRLA 5C07E 3O6MH 4PRID 4NJAL 2ZSWA 1H3XA 1AP2A 5LKNA 1BF2A 2O5ZH 2OJZL 1KTLB 5CZXD 3ULSA 4J3OC 5KG9B 1N26A 1K4CB 3WO3B 3GMRA 2V5SA 1BFTA 1FYHB 4Z0XA 1VFAB 5D7JD 2GTWB 3TIDB 3PHOB 4H1LB 1LEIB 2JJVA 4ZTOH 4F33A 4I0PA 4TVPL 4NPYB 5DJCA 3LKSB 3OKMB 3B9EA 3CFKA 3MRJA 4Y5YB 5E4IA 1IAII 1BWMA 4QRPE 2DQEH 4KMTH 3NFNA 5D7LD 1S7TA 4XBEH 2P8MA 2HFTA 2X05A 2XA3A 3CZJA 5JIPA 2AJYH 1UCBL 1CLYL 3U79A 1XH3A 3VH8G 3C8KB 2ITCA 1U8HA 5FIEA 3MROB 3ARBD 5HSFA 2VDOL 3QEGH 1CS6A 4YK4B 2P5WA 1IILE 1P4LB 3KPNA 3HA0A 4PJDE 5F9JB 3JZ7A 3AS1A 1XF1A 5DRZB 5ACZA 4OCYH 2HLAB 4L3CA 3QUMB 1LEGA 1LDPL 1IM9D 5I66A 1MREH 3BISA 3T77A 4DQOH 4H20L 2VABB 4UINH 5ALBL 3QQ3A 1FLTX 5I74B 1X5FA 4OSUH 4Y2DD 3THML 4JFOA 4ODSH 2OX5A 1GL4B 3H42H 3ARGD 3U1SH 4XHJC 2ESVA 1H3VA 3QXAA 2HFGL 4JRYE 4ZSOB 2O5XH 4PG2A 4PD4K 3EHBD 3UJTH 4GO6B 4MJIE 1YY9C 4MNGE 3NZHH 4OZFA 1JF1B 4NT6B 4R96B 4PP8C 4PJFF 1ACYL 1FIGH 4PJHE 3WXWH 5T3ZE 5GZND 4PJ9B 1U8LA 3DRTA 4HS3B 1JZ3A 3KAAA 4R4BB 1FO0A 1KFAH 4JFDE 2B1AH 1Z9MA 1G7MB 3DYPA 4L8BB 4U6TA 1QFWL 4ONGL 5DD3H 3WNNA 4TSAH 1D9KB 2FYYA 3WKNA 1QSED 1WZ1L 4G9FD 1TVDA 4M93B 32C2A 1YPZE 1FNSL 3QAZB 4X99B 4H26A 4RMTA 5F88B 1A7RL 4UV4H 2OI9A 4PJXF 1NC4D 4HUUA 5IK3B 4UQ2A 5E94B 1ZOXA 1P5VA 4X0KB 3DGGB 4RDQF 1BAFL 5KVGH 2CDGB 4Z7OE 2C3VB 2Z31C 4KKBD 1BIIB 3E3QE 1MIML 2CRIA 2DQHL 3KWWA 4ZXBB 3QDMB 4XAKE 4K2UL 3BESR 3OWEA 5T5FH 3OJDB 2XKUA 3SO3C 4AEIH 1E6OL 4RFNC 1FG9C 3D3VE 4MB4A 2BVOB 4YHOH 3KPSE 1CXEA 2ZCHH 4OCSH 5I0ZA 4LAQH 3VRLF 2V5RA 3WEXB 2X70B 3WS3A 4M8QB 3RAJL 3OKKA 1F8TH 3KLSA 5ICZB 4RMRA 3GMOA 4Y4KC 1X3DA 2E27H 3BP4A 4PJGB 3P4OB 4OZHA 5D2NE 1U9KA 4QT5A 1G7JB 1YJDH 3IDGB 3IVKB 1ZT7A 2R23B 3MJ7B 1I7TA 2V7HA 4LPCA 5F7YC 2BY3A 2VQ1A 2GSIB 3OZ9H 2BHUA 2NNAA 2MQ0A 2NY5H 2VLLB 4PYGA 3WD5L 4QLRA 3QA3A 1FAIL 2FBJL 3D2UB 5J3HC 2UY6A 2P4AB 1OARH 5HJ3B 5C0RH 2MPAH 3W0WE 4HLZG 3QEUB 4YXLL 2PYFA 3P0YH 5I1DB 1QR1A 4OBRA 4KXZI 1FC2D 3MFGB 1QFUH 1T1XA 3WE6A 4RGMB 4OCWH 5BV7H 1TZIA 4PRAB 1HILA 3T09A 3L3GA 1BZ9A 5GGRA 4X5WA 2N56A 3VXOA 1S8DB 1XF2A 2ZUXA 1TQBB 3C87A 4JCMA 3H9YA 4RSVA 5FUZH 2GSGA 4L4VD 1CQYA 2DWDA 3CSYB 1U58B 3WIFB 5A16B 1CK0H 4RAUB 2RHEA 4KDTA 4L3EB 3HC3H 3QG6B 1R5VB 3PWVA 4EDXA 5DUPL 4S2SB 1A7NL 3GRWH 3HZMB 4Y16B 3RWJB 4M3JA 5FGCE 2J88H 3B8YA 3IDXH 2V2WB 4PRPE 1ADQL 3HNSL 5IG7B 3SKMB 5CIPB 4JCLA 3V6FA 5IJVA 1RZIA 1LO5A 4NWUH 1JPSH 1Y6MR 5HYJA 1OSPH 2CLRA 3ES6A 5DD0L 4LGPB 2IPKA 4CJ1A 3X13B 2R0KH 4WI3A 3RY6A 4TNVF 5IROA 3DO7B 1HSBA 1NUNB 3L3IB 4XHJD 5FA3A 4Z5RB 3ESUF 2XRAH 1YY9D 3GHEL 1JHTA 3FT4A 4HBQA 4U1NB 5DJDB 2IMMA 1BOGA 5FDWB 1KTDB 3OPZH 3ULUC 2QKIA 5HHXL 4WHTA 1JCKA 3BT2L 1H8SA 3VXNB 4GS7B 2MHAB 5FUOL 1EDQA 2C7UA 2YUVA 4GJTB 3RVWC 1MCHA 4M7KH 4ODWB 5AG9A 2LAGB 2XWBB 3RU8H 3TP4A 5I1KL 1ORQB 2IH1A 4WW2F 4WFGD 5D5ME 4K9EH 4M6OL 1OTUC 1M1SA 3EYSL 1NUDA 2VITB 1YNTB 3F7VA 4ODUB 4WHYG 2LVEA 1UH3A 1ZE3C 1HH9A 3BYTA 1C5DB 3B8SA 4IMLB 4G6KL 1Q0YL 4QHLA 2M8XA 3UDWC 1ZSDB 3S36H 4M6NL 4HUWA 1BLNB 1R3IH 3DVNA 3BZFA 4HC1L 4RAVA 4XNXH 1MLBB 4K71B 2UYLB 3O6KH 3R0MA 1IC1A 2Z31D 1ED3A 2OZ4A 4JVPA 5C2BL 1BM3H 1D5IH 1MVUB 3LVEA 4TUOB 1T1WB 4L8SC 1JHLL 3H9SD 1ZLVK 4YH6A 4Q9RH 1Q94A 5M94B 3MZGB 3N1PC 1B4JL 1S7WA 4LHUA 1NGXB 4HX1A 3SCMB 5CAYB 3BPCB 3CC5B 3NFPA 3U82B 1YEFH 3MRDB 3QBTB 5BO1L 1DBAL 1DN0A 4N0FA 3PWUB 1BECA 3TEUA 3E6FB 4P5MA 3KYOB 4HWBA 3REVA 2X41A 3VFNB 4G80B 1N8ZA 2LU3A 4XT1C 3M8OL 4MWFB 4N0CC 4Y4KD 5JMOC 1CIUA 1MRFH 2K1MA 1I8MA 1BQHB 3D39E 4LCUA 4M7JH 3T0VA 2X1OA 4H1LG 1KENL 3ZSSA 1WZLA 4ZMAT 4MA8L 1FLRL 4NUGH 2LTQC 5F1KC 3RVUD 3UO1H 4QRPA 5A40E 4NJ9L 1A7OH 3RX5A 2QBWA 3VFTA 5I1JL 5CEZD 2NXYB 5T1KD 5D7IB 4PB0L 2ZNXA 4JJ5A 5EORL 2PW2B 1T21A 4KU1A 4LSTH 1U92B 2L4OA 3C6LA 5KSBE 5D8JL 1N7MH 3WIIH 3IDMA 3FB5B 4XP5L 3TIEA 5MEND 1FL5B 1ZHKB 2AABH 1N64L 5BJTB 4DVRH 1HINL 3L3KB 4M5ZH 2EDRA 5C9JA 4U1IA 3DX7A 3EOYG 4JO1L 4OFDA 1AGFA 3C9NA 2VZ3A 4K3DH 3LEXB 1PG7L 3AROA 5I1IH 4ZFZB 1JMZA 3VGEA 3D85B 3SEPA 2BNRB 4MCYA 3VXRE 5E5UB 3QXUA 2DQCL 3R1GH 3PUCA 3RWFB 1U8MA 5IM7B 3U4BL 4FQXB 1A6VH 3NN8B 1IGYB 4JRYA 1KB5B 4G8EB 3EOAB 4P46C 4Z7VE 4FABH 3G6JF 3BQUC 4MJIA 1FG2A 4MNGA 5DLML 3UPRA 1D3CA 3TBYA 2XTJD 4PY7B 1N0XH 5I8CA 1C5BH 4V1DB 4PJHA 5E6IC 3CFCL 2YD6A 5JUEL 2EIZA 5E5MA 1JYNA 5TDOB 1KLGB 2KZ1B 3L3JB 2BJML 4A6YL 5HYQB 2Q86A 3EO1A 5K33A 1BBDH 5FFLA 5KVEH 3CXHJ 4YQXL 4P49A 1U3HA 1T2XA 3WNLA 3O4LE 1HNGA 3ULUD 2HVKB 4JJHA 2A74A 1A9BB 1OT2A 1Z0MA 3ISWA 1YPZA 1J87A 4Y5XB 4RGNC 2VAJA 4J3UA 3VGAB 2IGFL 5L7XL 1NKRA 4JG1H 1ZHLA 3BPNC 5ID1B 3RVWD 3PXHA 2FJFA 1Q9WB 3QXWA 1IEBB 3WL9A 4PJFA 2NPLX 5GGTL 2EH8H 3GSXB 1OTUD 3PHQA 1CF8H 3K4AA 4JO3H 5ANMB 1CG9A 1X4XA 2OTWA 1A2YA 1UZ8B 3DMMA 4WO4B 3E3QA 1VCAA 4GAGL 5GQBA 5IB5A 4X4ZA 3MSPA 3B9VA 4R7DA 4DZ8B 4AQOA 1IL1A 3HNVL 3G9AB 4JHAH 3O0RH 1UXWA 3D3VA 1CICA 2BCKA 2L7JA 2GY7B 2C1OA 3KPSA 4MA7H 1VA9A 3MYJA 4HFUL 1CGYA 3EYFB 3P4MA 2OJEA 2YUXA 4K8RL 2E6QA 1T7VA 2IALB 4XVTH 1M7DB 4MGXA 4YDLC 3O41B 5IMKB 4ELKB 1OCWL 2QLVB 1RZ8A 3BKJH 4K94C 4X80H 2H3NA 2E9BA 5GS0C 1FFPA 3C2SA 5K9OA 4N0CD 5JQ6H 4MD4A 3QXVA 4FG6C 6FABH 4K7PX 4QHUA 3UTSA 5AZ2L 2BXYA 3B83A 3WUWA 5GGVH 1FFOB 1V7ML 3BP5B 3P4LA 2HTKC 5I71C 2DQTL 3TYFA 4OCRH 5HDLA 4U3HA 1ZT4A 3I6KA 4DTGL 1H3WM 4PRIE 5ESVB 3X3FH 3QNZA 3Q6GH 2C3HA 1UA6L 5TQ2L 3RX7A 3VE0A 4ZUUB 1KJVB 4OLZL 4I3RH 1HK6A 1MHPH 3PL6A 5JO5A 3IGAA 5K9JH 1A3LL 5CILH 4X8JB 5E8EA 1AO7D 4ZS7H 2EH7H 5I6XB 4WUUB 5IMMA 5TH2B 2DIBA 4POZC 1C5CH 5ENWB 1IAIM 3C8DA 4OLWL 4M1GL 1KC5L 4J4PC 4O2CB 1DBML 4PRPA 3CDYA 4NQDE 3RWDA 2ADGA 4Y4FA 4GW4A 3BPOB 5E24E 1L7TH 2HFEA 3RIFF 3MOAH 3G5VB 3SDAB 4BFEA 3B9AA 5D7LE 2BFVH 3SOBL 2QSCL 3JV4A 1LVEA 5EZLB 3QDJA 2EDYA 1F90L 1ULVA 3DOSA 1HQRA 4P46D 4N90D 2JIXB 3BQUD 5HI4C 5SWSB 2VDQL 5FKPB 5F7FA 1QBMH 3AB0C 4OGZA 2JCCB 1A3QA 5ACMA 1NGYA 1ZEAH 4ENED 5E6ID 1UCTA 3TCLA 1G7HB 1BWWA 2ICES 2XZAH 5ABDE 3DECA 4R3SB 5IEHA 4QRQB 3RVTD 3LS4L 1RUQH 3UTQA 5JLZB 4XB8A 3FN0L 4RIRB 3JUYA 4ONHB 3ZDZE 2YSSA 4E41E 2AV7A 2UUDH 1AD0A 2FB4H 1FNGA 1Q9KA 2YS4A 2PXYC 5EPMA 4DK6A 5LGHH 3OAYK 2CLZB 4ZFGL 5BVJB 2IQAA 5DR5H 2P8LA 4BELD 5D5MA 3MV8D 3U2SA 4YHMH 5F1IA 2WIIB 1QOKA 4RGND 1LK2A 2CXKA 4JFFB 2AEQH 2VDML 2VYRE 4E0RB 1CZ8L 3MJ9L 4GSDL 1CYGA 5J1SC 4MS8C 2IAMA 5E1HB 3SGJC 1GC1L 5FA4B 4N9GB 4WUKL 2XIDA 3MRLA 1NUFA 3N1GC 1TJGL 5AWNH 2W65B 5MEQB 3ESVF 2OR7A 3HI1B 4G7YL 1U8KB 3CU1A 3WN5B 5C08E 4JGJA 4B7LA 5BZWB 3WNKA 4TPRH 5C0CB 3FMGL 2DQIH 2VDPL 3QIUA 3Q3GA 1U42A 4FXGA 1OTSC 1YEKL 1L9MA 4YDIH 3QUZC 4YNYA 1OB1A 1OM3L 1HOCB 2MKLC 3IU3B 1QSEE 4UB0L 4P2QE 4G9FE 4BK5A 1FBIH 2Z93B 4KVCH 4MDJA 3W2DH 2DYPA 3EDDA 4NQUA 4QF1B 3MNZB 2W59A 3GB7B 1C8PA 4ZQKA 2NYYC 5DYOA 4ZUTA 3LN4B 4RFOL 5I18L 2DBJA 3ULVL 2YA1A 1HZHL 1MCRA 4ORGB 1LQSR 2Z92A 3MLYL 5C6TH 1BQHG 1E4KC 2XNAA 3FB7A 2XZCL 2NLJB 5I1HL 1FN4B 1PAMA 1QEWB 3PQYB 1NJ9A 3P4NB 5GS0D 3T4AA 4KMQA 3SKJL 1PQZB 3TO4A 2F58H 4FG6D 1MHEB 1XR9B 3WFBH 4A2LA 3EYUL 5BW7C 4X7DC 2X4TB 4HJ0C 4JFEE 5BS0B 3N50A 5DTFB 4ELMF 2UY7A 1F6LL 3TV3L 2HTKD 3UYPA 5J11B 1I1CA 3TBVB 4PJBF 3GRWA 4U1HA 3FQTB 3BXNB 3F7YB 1IGTA 3SGEI 4PJCF 3QEHB 4Z7UF 5KSAA 5GSRB 2B20A 4MHHG 1FORL 3CUPB 4MAYC 2VLME 4EI5B 4MA3A 1E6JL 2C3WA 4N0YH 3VXRA 3I9GL 2A9MH 1LWRA 3SE3A 5L0QB 4POZD 5EA0L 1A6UL 3EJYD 3WS6C 3LQAL 4J4PD 5IW3A 4OT1L 4FFYL 4NN5C 4Z95H 4MD5A 5IB4A 3GSWA 3TWCH 3QDGD 4Z7VA 1OGTA 4GKNA 4WHCA 4V3DB 1TCMA 5IV2A 4WJ5A 1N4XH 3KYNB 4KHXL 3TPKA 3MBEC 5HBBA 3FOMA 1JZ5A 1KBGL 2EDHA 2VL5B 4LVHB 4LLVB 4DN3H 2CJUH 4RBPH 5CEZH 1XCQB 3IDUA 5C3TA 3O4OB 4AIOA 4GW1A 4Y19D 4RWHA 4LRIC 5HI4D 3AXLB 4M7LT 1KJ2H 3MUZ1 1C7SA 4UNVA 1ZXQA 4Z8FL 5TQ0H 1M7IB 2CPCA 3O4LA 5ERWB 2NMSA 3LMJL 5T33H 1XR8A 1R24A 4TULH 2KPNA 4KQ3L 1XIWC 3HFML 4NQCA 4PRHD 1NBVH 4U6HA 2HRPL 2WQ8A 2ITDB 4CBPA 1YYMH 4JY5H 4XNZC 2MMXA 2PF6A 3CLFL 5BRZB 2CKBL 5D7SH 3X12A 3GI9H 3SKOA 2PXYD 5KVMC 4UTBH 1BQSA 3FCTA 4PJAB 3T04D 3LKRA 1ES0B 1G9EA 3RVVC 3H9HB 3CCHB 5F3BA 3MLPA 3MLZL 4P2OB 3CDCA 4PTTA 3MLXH 3OV6A 3BH9A 4MS8D 1CTOA 4FFZH 3ALWA 4BSVA 5I1EL 4BFIA 2NY3B 4TSCL 2YD7A 3GI8H 3BDBA 2OK0L 3S34L 1NAKH 2F54A 5IEKA 4IRZH 1MUJB 5EO0A 1J1XL 3O3DB 4GW5A 1RJZA 5GGSB 2FX9H 2Q6WB 1BJ8A 3LRSB 1XGQB 4NO2B 1NFDB 5T3XL 1JZ6A 4OQ1A 3TPUB 1I1AA 5AZEL 4XNUL 1OTSD 5FAAA 2VR5A 5EZJA 5FOBB 3QUZD 3GUTA 4EOWL 4NZDA 2BOBA 2OTUB 4M7LL 1C12B 4TNWF 2ADIA 3P73A 1ITCA 1WT5C 3ZYZA 1PKQE 4ODVH 4FNLL 4CUCA 2H26B 4PJ8D 2AXJA 4PJ5D 4RGOL 1TMCB 1YDPA 3H9ZA 3CFBA 5DJAA 3ULUH 4C56A 4H88H 4HIIB 3S37L 5E08L 1U95B 1R5IA 2NYYD 2DLHA 4O9HH 1RZKC 2GHWB 5DMKA 3I3EA 5GS1A 3CZFB 4OCXH 3PDOB 5DSCA 3QZWA 4GAYB 4X4ME 3KYAA 5DJ8A 5E8OA 1E28B 3KPRD 1REIA 3PGCB 3RNQA 4AH2A 2GYSA 1SBSH 1KLUA 4CDHA 2FEEI 3VMOA 3H9SE 1F13A 4QCIA 1NCWL 1BVZA 1CGUA 2EECA 5E6ZA 2IC2A 4HJ0D 1QP1A 4GMSH 4UV7H 4OZIE 3HG1E 3MRCB 2NY4B 1L4IA 2VSDA 5D93B 4JFHD 2LE9A 4YDKH 3V0VB 3MO1A 2DM3A 3QUML 2DD8H 5D7JA 1ZKAA 5E8PB 2V9TA 4URTB 4LCCB 1HN1A 1WBYA 2DLFL 1QLEL 4J2XA 4MAYD 5EWIL 2DBLL 5I8EA 3VFPA 5IVXE 5E9DB 3IDYB 3SE9L 1KN4L 2X4PB 4XHQA 1KEMH 1T2JA 3JWNC 1MJJB 1XGUA 5D7LA 5C0DA 3JSSA 3KYMB 3TF7C 3QFDB 5C0GA 5IQ9A 4C55A 1A0QH 2YZ1A 4J3VA 5FK9A 4I0KA 5A2LH 2AVGA 2W60B 1OLLA 3C6SA 3ELAT 3FQRB 1XGPA 4YDVA 3ARBA 1U8NA 3KLAB 2EDWA 3MBED 1EEZA 5FO7B 1F4WL 1CGXA 2F53E 2NW2B 5GGQL 3KPMA 2DQFA 5IMLB 3OR6B 1AKJD 5DK2A 4I18B 5DEGB 3RWHA 1MFEH 3L5WB 4YR6B 1Q1JL 2P7TB 2WLZA 5CHNA 2FX7L 5B4MC 5CJOL 2B5IC 3BD5A 2EKSA 1BHGA 2DMKA 4OM0L 4XMPL 5IT2L 2YRLA 4Y2DA 4NQXA 2UWEE 2P8PA 1XIWD 3ARGA 3QI9C 3QO0A 4FQ1L 1RFDL 5ETUA 3WXVL 1P7QB 1MIEH 3BZEA 3MXWH 2HLFC 3DVGA 1MRCL 1U8PA 4JO4L 4Z7QE 3UTZA 2XTJE 3VA2C 4TSBH 4OD3H 2CR3A 1NDMA 3OXRB 3N9GH 5JQHC 3MRKB 4F37F 5GJTL 1S9VB 5IVZB 4OLYL 4POYA 1IJ9A 4GRLB 1IQWL 5E99H 2XYCA 2ZSWB 3EYQC 5CCKL 1RUPH 3EGSA 1D5XA 4HLZH 3VU2A 1AP2B 2R56L 4ODHL 3O6LL 4JFYA 2ZUQC 1QSEA 1MNUH 4RA0C 3ULSB 5A1AA 1RV6X 3S35L 4E42A 4M5YL 3GMRB 1CGTA 2E8ZA 2CK0H 4WI6A 5F9OH 4QRUA 3NA4A 3SKUD 4Z0XB 3O2WH 3HR6A 2FGZA 5KAQF 1JHKH 5HHNA 1FPTL 1P9MC 2E7LE 4F33B 4I0PB 5DJCB 3UEZA 3MRRA 2ZUVA 3CFKB 1Y6KR 4FS0A 4ZD3L 4WU5A 3HAEG 5EUOE 3NFNB 2EDKA 2VXVL 1S7TB 4M7ZC 2P8MB 3NCCB 4KUCD 1HQ4A 4I48A 4LSPL 4MXWH 5CJXC 4K3GA 3UCRA 2BK8A 1XH3B 4U1GB 3MCG1 1YEEH 2ITCB 1U8HB 4PJDF 3OX8A 3SE4A 1JI2A 3GJFH 2B2XL 4WI5A 5J13B 2HVJA 3C2AH 2YN3A 3BPLB 1PY9A 1JYVA 1TTUA 2P5WB 4HCRH 4JAMA 4JDTL 3KPNB 1B0RA 5E8NA 1KN2L 3F58H 4AIZA 4XAWH 1RPQA 5E2TL 5ACZB 4JKKA 1S7SA 4LBEA 4LVNC 4XXCC 3S7GA 1MCSA 1OF2A 1VEOA 4L3CB 1LEGB 4LPUA 4MXVE 1UACL 2GTZA 3T77B 5F7LB 3FN3A 5L2JA 5INDB 3O2VH 3QQ3B 3EO0A 4NO0D 5AD0A 3VXMD 3A0OA 4JFOB 3CSPA 2XV6B 3O45A 4XPHL 4NC0B 3V4UH 1GGIL 3LRHA 1DE4A 2ESVB 3QXAB 3HPLA 3QXDA 5LGJA 3IU4L 4IDJL 4BM7A 3HI6H 1ZWIA 2GK0A 4OZFB 2VKXA 2MQ3A 3FFDA 5TF1H 5MP6L 3TJEH 1IC5L 3H7BA 1VGEH 4K94H 5GS0H 2J12B 1U8LB 3DRTB 4NDMA 4IEFB 1KGCD 2GFBA 1FO0B 2MCPH 4I4WA 2XQBH 3KPLA 3SDYL 1I85C 5HDOA 4PJCA 2QSVA 1B3JA 1T04A 4L4VA 5DEFA 2FYYB 5F72S 3VFGH 2NY2B 3MODH 5I30L 1I3VA 3ZDYE 2PUQT 4D9QD 5DQJA 1AE6H 32C2B 4HBCH 5TE7L 4MD0A 4H26B 4P9HL 4PP1C 2BY0A 1JZ4A 1KIQA 3ZDXF 2OI9B 2MCG1 5J6HA 4HUUB 4XI5D 3TH4T 4UQ2B 4D0DA 3ULVE 2EYSA 2JJTC 3MCLL 2D03L 3DARA 4HPYL 4UAOB 3DURA 4PDCE 3QI9D 2Y7QA 4MQTB 3FRPG 3JWDC 3G6DH 1QSZA 3KWWB 4N90E 4NM8L 3LH2L 3BSZH 1UB6A 5HPMA 1HKLL 2HLFD 3H7LA 2Y36H 5IW1A 3P0VH 1TLKA 1IGIH 4IRJC 2P44B 1WJ3A 2JLLA 1D6VH 4KUZL 1GHFL 2OBGA 4RMQA 3WS3B 3OKKB 4PYHA 4E9LA 3GMOB 3BP4B 2P5EE 1RQ5A 3EYQD 4OZHB 3HC4H 3PP4L 4QT5B 5C92A 5KSVA 5A2FA 4C83A 1ZT7B 1W72A 1CDJA 4LU5H 3QQ9C 1WICA 4QRSA 1I7TB 2V7HB 2VQ1B 5FGBC 5KOMC 1MCNA 2NNAB 5FYKU 3WFDH 5C09D 5LWYH 4RGNE 3HI5H 5A2IH 3HHRB 5EU3A 2XA8H 3U6RA 1LNUA 3BIBX 5GS3A 3RRQA 4XMKH 3IJHA 15C8L 2PYFB 1KXQE 4NHUE 4X4MA 5EH1A 1QR1B 2X40A 3D0VA 4RMUA 1J18A 3IFOA 1NBQA 3ALPA 3JWOL 4BYHA 2D2OA 3QNYA 2IFGA 1MVFA 3DTXB 4D9LH 4F7CA 9CGTA 3MRIA 1T1XB 4NSKA 3WE6B 2WUBL 4WEBL 4PGBA 5GISH 1UVQA 1TZIB 2Z31A 4I9WE 3FQXA 3KPPB 1MCKA 4C57C 5L2KD 5K59E 1QTYT 3MRMA 1HILB 3FO9A 3H9SA 4KI5E 3KXFD 3L3GB 4A2MA 1BZ9B 1Q8MA 5GGRB 4X5WB 4X6FA 3VXOB 2A83A 1XF2B 3DUSA 1KEGH 1QRND 1A14H 4OZIA 5L88L 2GSGB 1AXSA 4ERSH 2DWDB 4LSDA 1FGNH 2H9GA 3BMVA 3LZFH 3N85L 5I75C 5JHDD 1MQKL 1MFAL 1KUMA 2DL2A 3PWVB 4EDXB 4Y4KA 4LGSB 2GJ6A 4S1QL 1CLOL 5E7BA 3WFCL 2D7PA 3V6FB 4QXGL 1RZIB 1EUTA 3RNKA 5IJVB 1LO5B 2OL3H 3KHOA 4Y4HD 5HYJB 2G75B 2CLRB 3ES6B 3PXJA 3RDTD 3H3BC 5IVXA 3P9WB 5KVFH 2IPKB 1E4XL 5TE4L 5IQ7H 1HSBB 1KB5L 2G9HA 1Q9LA 5FA3B 2VXTH 3HMWL 4HSQA 5EOTA 1BGXL 1KJ2A 4LSVL 1JHTB 4X6CA 3FT4B 4JFXA 1BOGB 4N0RA 4WDIA 5MENA 3VFMA 5FEBA 1UKTA 2QKIB 3MUJA 4AM0A 2X1PA 3B43A 4QHKJ 4YEEA 4JDZA 4WHTB 4ZOEA 1A5FH 1CFVH 1CI5A 3I3DA 1D5ZA 3MLWL 1CLCA 1YEJL 3BKMH 4M1CC 5C8JA 3G5ZA 1FNAA 5T3XE 3K8KA 3WSQL 4DGYH 4WEMB 4HD9A 1F58H 3QWRD 4P57A 2IH1B 2YBRA 2GCYA 5CJBA 2UWEA 2Y06L 2ZUSA 3MXVH 3F7VB 5EZIH 5I76A 3VDBA 3G6AA 3UTPD 1QYGH 4HKJA 1YEGH 4PP1D 1HH9B 1P1ZA 2R2CA 1T80A 1QFHA 3QDGE 1HHJA 4QHLB 2ID5A 3ZE2E 4YHKH 1SYVA 4HUWB 4NNPL 4J7RA 3TESA 2LFGA 1T7ZA 3DVNB 3BZFB 4RAVB 1AI1H 4UT9L 1DSFL 1ED3B 5B39G 5CGYC 4UOW1 2EXWC 3I50H 1Q94B 4Y19E 4ZAKC 1S7WB 4LHUB 4HX1B 5ITBL 3E8UL 4WWID 3BDXA 4CRPA 1DN0B 5EZOL 4N0FB 4WTXA 4GMTH 3SGKC 3RWEA 4P5MB 4PD4J 5EBMA 4IRJD 3REVB 4S1DC 5I1GL 3SBWC 2O5YL 5DJ0A 3AFLA 1N8ZB 2J5LC 1DZBA 4P9MH 1O7VA 1I8MB 4TOYH 4LCUB 3QHFH 5IESH 3QQ9D 2EIEA 2FHFA 2AXFA 5DA4A 4TVPH 1FYTD 5J12B 4NWTL 3QB7C 4S10A 1R3KA 4QRPB 1H15A 1TPXB 2ZPKH 4K3JH 3VFTB 1RZ7L 4PJ7E 4XVUD 5AAWA 1N3NA 4ZSOE 4JJ5B 4L9LB 1T21B 3TBTA 3UDWA 4OF0A 3C6LB 3X3GH 4JZOB 1YMMD 1EMTH 3FB6A 1DVFC 1M6OA 1AHWC 3WYRA 3IDMB 1UM5H 5I73B 3TIEB 4MA1B 1FZKA 3EFDL 4X5LA 1G6RH 2AJUH 4LVOB 4L8SA 3PJSA 4XCEA 5C9JB 4NRZA 4U1IB 3DX7B 1DEEA 3BAEH 1AGFB 5ACLA 1UADC 3C9NB 4HJJL 3T65A 1F4HA 1XGRA 1HSAA 5IVOA 5BOPA 1UM6L 3UJJH 1LO0H 1HKFA 4MCYB 5HVHC 1X5HA 3BD4A 1UJ3C 3W9EA 1U8MB 2WUCH 4N0CA 2CDFA 4GXVL 4MX7B 5IVNA 5FYJD 4JRYB 5IB3A 4OLVH 3SDXE 3OF6D 3CPLA 1LDSA 4G9DA 4DGIH 1UFUA 2R0WL 3BW9A 3S37X 4CN4A 3GBNH 4MJIB 2APTA 1FG2B 3MRQA 4MNGB 2E9JA 4ZNCD 3UPRB 3TBYB 5IFAH 3OKDA 5I8CB 2HH0L 2AW2A 4PJHB 4OI7A 3DI3B 1RZKH 2EIZB 3PQYD 2XXMB 4JB9L 5D70H 1RU9L 3NIFE 1JV5A 2Q86B 5C3LD 3EO1B 3UMTA 3KHQA 4JFDB 5E8DH 4C4KO 5DVNA 3GSVA 1RMFL 4FQCH 1U3HB 4JKMA 4W6WB 1S5HA 3NZ8B 1NCNA 4JFHE 4RRPG 1AO7A 3C5JA 3ET9F 1RVFL 1IEHA 2YPVL 3K8MA 2A74B 5D96B 1VENA 4NCC1 5A2JH 1X6LA 1YPZB 2VERN 3DSFL 4BK4A 2BSTA 1J0YA 2EICA 2B0SH 2FD6L 4EUPH 1A7RH 1QSFD 1ZHLB 3CH8A 1A7QL 2AEPL 4AK1A 2FJFB 3IXTA 4YPJA 4J1UA 3VW3H 1H0DA 1J1PL 3WL9B 4PJFB 3UJIH 1HDMA 3JXAA 3TVMC 1BAFH 5J8OA 3PHQB 1CG9B 1UZ6F 2OTWB 3RZCC 1A2YB 3DMMB 3EW3B 1U36A 3HE6C 4U6VL 3T0EC 4P46A 3NABH 5IB5B 3ARDC 3EJZC 4R7DB 3BQUA 4QOKD 3O3BA 1IL1B 2D4FA 3D3VB 1J11A 1CICB 2BCKB 2D7NA 3MZTA 5E6IA 2C1OB 3KPSB 1P7KA 5F9DC 2W1NA 1EXUB 3MYJB 5CGYD 2YOCA 3P4MB 3QPXL 2OJEB 2EXWD 1TQCC 2Q87A 4ZAKD 5B3JF 4R97B 4J8RA 1A6WL 1QVOA 4S1DD 3IJSA 4HW6A 1I9RH 3MV8A 1RZ8B 4JPKH 4CAGA 2H3NB 5FYLD 1NMBH 1FFPB 3K1KC 4MD4B 3SDCC 4M1DH 3SHSA 3V8CA 3DUUA 5KBNC 4QHUB 4JFZL 5KVDL 3UTSB 3WUWB 4CMMA 1OSZA 4MJ6A 4NHUA 4R26L 4TNVK 3HPJA 2ADFH 5GRVK 4XMLL 4G59A 3TYFB 1K5NB 4HCRA 1JGLL 1T4KA 2Q3ZA 3I6KB 4PFEA 4KDVA 4DAGH 3HS0B 5CUSL 1CVSC 1JGVL 3QXTA 3BEVA 5CKGA 3VE0B 2I9TA 1MQ8A 1KPRB 1YEIH 1DVFD 3PL6B 3IGAB 5JO5B 3S88H 2QQNH 1ZLSH 5E8EB 5IMMB 1HH6A 4KK6C 3MLVL 5FECA 3K7UA 4K23H 4UOJA 5DUPH 1QNZL 1V7NL 3MR9A 5FGCB 1GGTA 3S35X 3GNML 4PRPB 3RWDB 3WJLC 4HAGA 1EHNA 2ADGB 1IGML 2ICWI 4Y4FB 4GW4B 3ZKNC 3H3PH 1NKOA 5LXGL 4LSSL 5DD0H 5F71A 2A1WL 4ZNEA 1MELA 2XQYK 5DVKA 5DQDL 1CFBA 3QO1A 3JV4B 3K46A 3QDJB 1EAPA 4OF7A 3T3MF 4KZDL 1HQRB 4HXBL 2FX8H 4XCNA 4HWEL 2NX5D 3BP7A 5D71L 4AMKL 4M48L 3AAZB 2X44D 4ODBD 3TCLB 4OLXL 5J0BA 4JPVH 3HUJE 5HHXH 4LEXL 4JRWA 5IEHB 4X6DE 4ZO8A 4CL7A 1HHKA 1OWWA 2A73A 3IDIA 4GKOA 3UTQB 2LAAA 4HIJA 3ARQA 4KVNL 4M43L 4NKOA 5DD6A 1J7VR 2YC1A 2YSSB 4Q7DA 3FAWA 2AV7B 1JTTA 4O5LL 4F7TB 1AD0B 1OWRM 1FNGB 1Q9KB 4W4NA 2PTVA 5EPMB 1ZGLM 4ZS6C 2K7PA 3DVFA 4UIKL 3DNKA 3SY0A 1AXTH 2IQAB 5C71A 2P8LB 4JM2C 3HC0A 5D5MB 1FRGL 2D9CA 2MFNA 1ZS8A 1CD1A 3QJHA 2EKJA 5I19L 3U2SB 4OLUL 1YC8A 3LSOB 5F1IB 4G8IA 5IBUB 4J4PA 1LK2B 1OAKH 1KPVA 1FV1A 4P59H 4CVZA 3L5XH 2IAMB 2FNBA 3QDGA 4UIMA 2I26N 1MF2L 4U3XA 3MRLB 1JGUH 5EN2A 2C4FT 3ZTNH 1UB5A 4YK4C 4DVBA 5L9DH 1FSKB 3TVMD 4O2EB 4YC2C 1INDH 1L6ZA 4IOFC 4JHWH 1KGCE 3RZCD 4X9IA 2HT3C 2I5YH 4GRWF 3Q3GB 3HE6D 3LQZA 3T0ED 2B4CC 3ARDD 4Y19A 3EJZD 4YUEL 4YNYB 1OB1B 2ZUYA 2E9IA 2CR6A 5EU7E 4YXHH 5AG8A 2X4NA 4LPYA 1NBZA 5E6YA 3QH3A 4DOHB 1S3KH 4KAQH 4MDJB 2OP4H 1I3GL 2DYPB 5D1QD 1QO3A 4HKZA 3D9AH 4PRHA 1QFWI 4ZQKB 5DYOB 4ZUTB 4WGVB 2Q8BH 5DRXA 3QG7L 3GGWA 4G6AC 4JQVC 5ISZA 2Z92B 5C2UB 4Q6IC 3G08A 3L7FB 2PXYA 3U9PH 2XNAB 3FB7B 2BSSA 3ME0A 2NTSP 1U6AL 4YHZL 1FDLH 4L1DA 1K3IA 4HS8H 2R1XA 2BNRE 4XPTH 1NJ9B 1EHLH 3T4AB 3TO4B 2FGWL 3SDCD 5D72H 4MS8A 4KPHL 5E2WL 1UH4A 4PJ7A 3LD8C 3SGJA 1P7QD 4UT6H 3I2CL 3WHE0 4P4KC 2WLYA 4L4TD 5TJWK 5KSBB 1WCQA 4QNPF 1BIHA 4HPOH 1NLBH 4U1HB 1IGTB 3JWDH 1WISA 4Z77A 3QUZA 1NGPH 4C59B 5KSAB 2OL3A 3ECBA 4L1HA 1L7IH 4LPTA 3RKDD 4TUKL 1HCVA 4NN7C 4Z7NE 1SY6L 1Z3GH 4MA3B 4PJ5A 2M26A 2CRZA 1MCOH 1RURL 1YC7A 5HDQH 3VXRB 5D6CA 2OR8A 3FL7A 4KK6D 4U7KA 1ZA6B 2NTFA 3NAAL 1KIPA 1ZHBA 4AT6A 4M9OA 2DI7A 3FHAA 4FZ8L 1E4KA 4CMHC 4MD5B 3SDXA 5IB4B 1H8NA 4LLMA 1CDCA 4Z7VB 4QTHA 4YE4H 3ZKND 3KPRA 1OGTB 4GKNB 5AUMA 3KJ4C 4WJ5B 1I8KA 3MA9L 3PV7A 4RWYL 3FOMB 5EIIA 2ZKHH 3KXFE 4KRLB 3QUYC 1OP3K 5JUEH 5BW7A 1YEHH 4V3EB 5FHAL 1QRNE 4WWKC 3RUGA 4GW1B 2R8SH 4NFCA 2GY5A 1MCLA 5JHDE 4XC3L 5AYUL 1GOGA 3O4LB 1NCCL 2VXQH 2EE6A 1XR8B 2BRRL 1R24B 3SDDB 4AY0A 3V95A 5IGXL 4JR9H 3Q6FA 2IMNA 4EDWL 1BEYH 4NQCB 2J8UE 4R2GB 4U6HB 4PS4L 3U7WL 2EYTA 1KT2A 4YHLL 1HIML 1DL7L 4OJFH 5E1AA 4MAYA 1DBJL 3X12B 3SKOB 1RULL 4OF3A 4KTEH 2FHCA 3LKRB 1GGYA 4JM2D 5F3BB 1VFMA 3WS6A 4PTTB 2Z8RA 2VRAA 5EUKA 4Z6AT 5KW9H 3T4YB 4YWGH 4XVJH 4JY4A 2YD5A 4NZRL 4BSVB 2WWMC 4BFIB 3O3AA 3DX6A 1RZJC 3TT3L 2F54B 2DWEA 3FTGA 5IEKB 5EO0B 3MBEA 4GW5B 1RJZB 1UGNA 3AGVA 3T2PA 4GLRH 3HAEH 1ZLWH 4IOFD 2ICWA 5CMAA 1WGOA 1KIUA 3RWCB 3NMEA 1AKJA 2HT3D 4L5FL 1NSNL 1I1AB 3CMOL 5IW6A 3RPIB 4LRIA 5EZJB 3GUTB 2BOBB 1CBVH 2ADIB 3P73B 1CGVA 1NAMH 1OCWH 1YDPB 5DJAB 3BIKA 4C56B 1XIWA 2PR4H 5IUSA 4RDQG 5DMKB 5EOQH 5GS1B 4KWUA 3GKZA 3RIFK 4G6AD 3OKEB 3ZO0A 5DSCB 1EK3A 4U6YA 3QEQD 3QZWB 2BSED 3OAYH 2FR4A 3T1FA 1HEZA 1S9YA 3WUWG 5DJ8B 5E8OB 2WWKT 1V7MH 3RNQB 4AH2B 2AS5M 12E8H 3CLEH 1TJIH 1G6RA 1KLUB 4PRIB 5EB9A 4QCIB 4YX2H 5LQBL 5ILTL 4QXUL 2F8XC 1UA6H 1MPAL 3QCUL 1F97A 1WZMA 1I7ZA 4P4KD 3VFUA 1C7TA 2VN7A 1AQKL 5FO8A 1OQXA 4G6JH 4XP1L 5GRWA 4AZ8A 5D2LF 3I6GA 3MO1B 2BXZA 4P2RD 1IBGH 2V9QA 1FC1A 1I3RA 3QCTL 5D7JB 3OL2A 5JW4M 3U30B 1H5BC 3PWPD 1B0WA 3BOVA 3RX8A 1CL7H 4X7SL 4Z7WF 4GQPH 1WT5A 1FYTE 2WP3T 4TYUA 1QKZH 3UPCA 4M03A 3VFPB 1DEDA 2D7TH 3OHXA 1KYOJ 1NGQH 3S4SA 1RUMH 2LV4A 5GHWH 2R0LH 1XGUB 3GIVA 3VD7A 5D7LB 5C0DB 3AVEA 5DHYA 4U1KA 5FYLH 4WY7L 5C0GB 2RB8A 5IQ9B 3OTTA 4FN0A 2ZSVA 1S9KC 4JFFE 5FK9B 1NL0H 2HYMA 4DKFH 1AY1H 1MCIA 2PYED 4YGAB 2GJZA 3GIZL 4JM4L 1MFBL 3C6SB 5JPMB 4F7EA 4LLUA 5DC9B 1XGPB 4YDVB 1B2WH 4OI8A 3ARBB 1U8NB 4Y1AD 3AC0A 5DURD 3IB4A 1FO0L 1EEZB 2DTML 5C0IA 4R8WH 1T83C 3HUJA 3QUYD 3KPMB 2DQFB 4GAFB 3RBSA 2X89D 4X6DA 1PSKH 5DK2B 1HE7A 1W2KT 4EUPA 1F6FB 4WWKD 2QHRH 3HZYA 4IDLA 1KXVC 1IM9B 3RWHB 4ESKA 2OMBA 5GRJH 5JXAL 5CHNB 2V2XA 3TH2T 4U2ZA 2EKSB 2AK1L 4QXTA 5SV3A 2CQVA 4NO0A 1U3JA 4NQXB 4Y2DB 3VXMA 2YWYA 1AR2A 1PKOA 2ERJC 3QQNA 3PE9A 5IWLC 4YIQA 4CDGC 2P8PB 4HF5L 2WANA 3MJ6A 3ARGB 3DBXB 4X9BA 3QO0B 3BUYA 1OHQA 4W4OC 5FYJE 5ETUB 5I9QC 3IXAA 4O2FA 5IBUG 2X4UA 4O02H 4KY1H 3BZEB 2F8VA 1U8PB 4CVWA 3UTZB 1DQJB 1UH2A 2QADC 1NDMB 1J8KA 2VWEC 3TYGH 5HYJD 4HFWA 1Q72L 3TF7A 4KK9C 2IQ9L 3BO8A 1A6ZA 3PQYE 1I9IH 1R0AL 2AXGA 1JNLH 3WHXA 5T1DL 4HS6A 4JANA 5HHVH 3EGSB 3SGDI 2WINA 2WWMD 4JFYB 1DQLH 3MLUH 3FQNA 1QSEB 5E00A 5DWUL 3MLRH 4GAJH 3JTCA 4E42B 1KCVL 3MV9D 2UUDK 1BP3B 3F5WA 4YBLC 1PW3A 4ZFFA 4J12A 4QRUB 2BVQA 3UPAA 4H8WL 5KJRH 5LBSH 1QSFE 5HHNB 2EZ0C 1NC4B 2YD3A 3LDBB 1F6AA 4OFKA 5EUOF 3LHPH 4O4YH 1N5AA 3CFEA 1ZANH 4YXKL 2HKHH 2R2HA 2XQYG 3MRRB 4FQHA 3WV0A 4WU5B 1AGCB 3MREA 4JQIL 3CD4A 1MY7A 3OR7A 3QI9A 3DX8A 4I2XE 4TRPL 1W8OA 1NEZA 2NZ9C 1HQ4B 1J8HD 4EZMA 2ZJSH 4I48B 5EG6C 2GIYA 3JTSA 2WIMA 2ATPA 1IKFL 4ZUWA 1KLFA 1KPUA 1PVHA 3OX8B 1RUAL 3KYKL 4OBSA 4AG4L 2KQMA 2BSRA 4ODTH 4BZ2L 1MRDL 2EEDA 2HVJB 3IRPX 1CLZH 4FHBD 2CGRH 4NQSA 4JAMB 2EYRA 1WZKA 1B0RB 5HXMA 5E8NB 2CMRH 3MBXH 1CE1L 2KL6A 4AIZB 1KJMA 5I2IA 4LBEB 1S7SB 1OF2B 5DJZA 1J1OL 1NQBA 4N8VG 5GGUA 4XP9H 3MOBH 2GTZB 5D1XC 5C09A 5IHZA 5L2JB 4CU7A 1JWMA 5FYLE 3EO0B 4OAWA 1EEUA 5AD0B 1NEUA 1OAXL 3O45B 1NH6A 4W6XB 4HGKC 1DE4B 1A6UH 3HPLB 3QXDB 2FH6A 2KZWA 4HEME 5B21A 1P9MA 2YKLL 4XNYL 1ZWIB 1G9MC 3VJ6A 2BHZA 2E7BA 1WWBX 1IM3A 2GK0B 3EOTH 3SQOH 1JNNH 4I3GA 3FFDB 1O5DT 2BVEA 4PJAE 1I9JL 4KK8C 3OB0H 3IAQA 3H7BB 2N4IA 2P43B 5L2KA 2XXCB 3MX0A 4KHXH 5IMOA 4ZG1A 4NDMB 1I7UA 5TGBA 3ILQC 3KXFA 1X5ZA 3KPLB 1JK8A 5CJXA 3CGTA 1CFTA 4X7FC 1QRNA 1VACA 4PJCB 1T04B 4L4VB 4P23C 4CW1A 1IGCH 1R3JA 1MAML 4XPFL 5DEFB 3UTTD 2AK4D 3BKYH 3GK8L 5JHDA 5FM5O 1LO4L 1SM3H 2WNGA 3QYCA 1JYXA 4R90H 1UENA 4I13B 1IAIL 1GAFL 5HYIA 3ULVF 5EO1A 1NFDE 2J8UA 4MD0B 4XXCA 2XWJA 2VXUH 2XI9A 2DL9A 3CVHH 5F96H 1KIQB 5J6HB 4D0DB 3RDTA 2VH5H 1AJ7L 2EYSB 1CL7I 2VQTA 5F9WC 2HMIC 5DDHA 1INEL 5FCUH 2B1HH 4G7VH 3DURB 5BQ7A 3IDNA 1BQLH 1G0DA 2MKWA 5K9KA 2Y7QB 4XCYA 4D3CH 2C3XA 1UB6B 5HPMB 1A6TA 4B53A 5IW1B 3U4EA 1FL6A 1RJCA 2K3TA 2NX5E 2VISA 2QADD 4RBPK 2OZ4L 4JVUA 4KK9D 3NBNA 3MOQA 3V0WL 3U7YH 3CAFA 1I85A 5HHOA 3TBWA 4XCFH 2UZXB 2MOVA 5HI5C 5KSVB 4C83B 35C8L 3EDKA 4HWBL 2ICEA 1W72B 4I3SL 4OZGA 5F7EL 4QRSB 2VAAA 2R1WA 3QWRA 4LSUL 2VLRD 4MJ5A 2R9HC 5CD3A 4NOBA 1FQ9C 3I02A 3V7AG 4FXKA 4WI7A 3BZDA 2FBOJ 3IT8D 1YZZA 5TPWH 5EU3B 3HZVA 5JMRA 4MQSB 4IRSC 4PJIE 3U6RB 1LNUB 3V9FA 2EZ0D 2EE3A 1T5WA 4KKCC 5IJKC 1Z2KA 3IJHB 2AEWA 5K59F 3D0VB 2JJTA 3IFOB 4KI5F 3QNYB 3B9KC 4F7CB 3MRIB 4NSKB 1NANI 1LHZA 4PGBB 1UVQB 4NUJA 2R0ZL 1TXKA 2Z31B 3FQXB 3BGFC 4G3YH 4PY8I 3MRMB 3SE8L 3FO9B 3H9SB 1HHIA 3T0EE 2NZ9D 3TO2A 5JIKA 1QFWM 4X6FB 2A83B 3SO3B 3DUSB 1RK0A 4DCQA 2DM2A 2E7MA 4RFNB 5JOPD 4OZIB 1GZPA 1AXSB 4X4YB 4YHIA 1OGAD 1JWSA 4IRJA 2H9GB 2F19H 1NDGA 1XCTB 4Y4KB 1FGVL 3A6CL 4WW2C 1ZVYA 3CJJA 3P77A 3VG0H 2RJMA 3V52H 2B4CH 5DRWA 3RNKB 5FGBA 7CGTA 3C08L 1FYTA 5D1XD 5DUBA 1J10A 1FJ1B 5IVXB 2FO1A 1BX2B 2BC4A 3LQMA 3NTCL 3CK0L 3GBMH 3P30H 2IFFH 1WAAF 2G9HB 4KJWC 1Q9LB 3DXAD 5T1KB 3LPGA 3GSRA 2DQDL 5EOTB 1KJ2B 1YMMA 4PREA 25C8L 4X6CB 4JFXB 3IKCA 1KCRL 4KK8D 4WDIB 5MENB 3VFMB 3LEYH 4AEHH 1C08A 4OB5H 4EBQH 1A64A 4AM0B 4U7MA 5D2LA 3ILQD 3NIGF 3M1BA 1JI1A 4JDZB 4KHTH 5E2VL 3QPQD 4ZYKA 1D5ZB 2QQLH 2APVA 4RNRA 5C8JB 3G5ZB 2VDNL 1DFBH 4P23D 5IHUL 3S9DB 2IG2H 2UV3A 4P57B 2YBRB 4HT1L 2VDRH 2GCYB 3D48R 3KR3L 4F7MA 1FVDA 4Z0BL 5F3HA 5IT2H 2GW5A 2UWEB 1I8LC 3ZE2F 2X2YA 4ZUVB 5I76B 3NPZB 3G6AB 3T0BA 4HKJB 3P40A 1P1ZB 2CIKA 3FO0H 1HHJB 4HXAH 2MWCA 1WLHA 5ADPH 1MCWM 3GKWL 5J6GA 1SYVB 3ZYOA 3MNWA 3O6ML 2OXHA 1RAMA 2R29H 2VLKD 3HAEA 2CO6B 3RL1A 3F7QA 2FIRT 3QJFB 3BWUC 2O5ZL 2UZIH 3O3UN 3P9LA 3PNWA 1NAMA 2IPTH 5FYKD 4MZ2A 3RWEB 5EBMB 3MUHL 1RI8A 1RIUH 5DJ0B 4BZ1H 1JWUA 3V6OC 4ZTOL 3LPWA 2H32H 3NCJH 4YPGA 5HI5D 1QSFA 3QRGH 2DQEL 4KMTL 4NHCH 2DDQL 2AXFB 3WJJC 4XBEL 1C1EH 2R9HD 5EC1A 3WDJA 5C9KA 4PTUA 2AJYL 4PV8A 1H15B 4IRSD 5ESQA 4I2XA 2AJVH 4P5TC 4FXLA 4KKCD 1N3NB 4QOKA 4B5EA 4Q9BA 3TBTB 3UYRH 3QEGL 3PHSA 3OKLB 4N1EA 3BJ91 3B9KD 3FB6B 1M6OB 3STZA 1SQ2N 3FFCD 4KZEH 3OAZK 1T5XA 4YFLI 5DZNA 2JF1A 1FZKB 4OCYL 4KRPC 4YZFE 4ONFH 1OOAA 4L8SB 3PJSB 1MREL 4LLQA 4XCEB 5SWQB 1RZGA 4BQ9A 1IEAA 4NRZB 4ZAKA 4DQOL 1TVHA 1DEEB 4UINL 3D18A 5I15H 4X98A 1IZKA 2QV2A 3RGVC 5C0JA 1HYRC 4QRRD 3QIUD 3T65B 4OSUL 3SGKA 5MHSD 1LD9A 1XGRB 5JIIA 4ODSL 1RZJH 4R7NA 3H42L 3U1SL 4Y0GA 3DRQA 3SBWA 4MSWA 2O5XL 4M9PA 3Q48A 4QTIH 3W9EB 2ZG2A 1KTRL 3UJTL 2CDFB 4XPHH 3NZHL 3TT1H 2Q8AH 1GGIH 1JFQH 4O51A 5J9PA 4ZTPH 1U0QA 1FIGL 3WKML 5IB3B 3F12A 1TJHH 4G9DB 3AM8C 3CPLB 3WXWL 1JFMA 5CWSA 3BW9B 3VWJC 2MQCA 3DETC 3MRQB 2LTQB 4C54A 4RX4D 3NIFF 1II4E 1TETH 5DFVC 2XG4A 3OKDB 1KFAL 5C7XH 1A3RH 4OGYH 2B1AL 1LP9F 3NIDF 4PGEA 4KJWD 5DD3L 4TSAL 3GJFK 2Y23A 3NFSH 4XWOC 1JV5B 2AJZA 3RJQB 5DC0A 5EBLA 1QLRA 3GSVB 1CIDA 3O8XC 5TDPA 2PN5A 1DVFA 1S5HB 1AHWA 3NVQA 5EDXA 2PO6C 5JPNA 1V5JA 4LFHD 4K3HA 2FEDC 1IT9H 4N9OB 1AO7B 3C5JB 4YAQA 4NM4H 4PJGF 5C0FA 4P2RE 5HHMD 1U41A 4UV4L 1WC7A 1KG0A 1BFVH 5DJ6A 2ZUTA 4CGTA 4TTDC 2BSTB 4NKIH 2ARJA 3QIBC 4OZHE 5DD1H 3GDBA 5KVGL 5M7QA 1JVKA 2A9NH 2DS4A 3U9UA 3C5ZC 3IXTB 3W5MA 4JKPH 4J1UB 1H0DB 4G43A 1DLHA 1UJ3A 2WBJC 4LASH 2YA0A 1HDMB 3RP1A 4U3CA 5T5FL 5JR1H 4AEIL 3TZVD 2P47B 1T1YA 1H9VA 1A1MA 4YHOL 4P46B 1UJTA 4XRCA 2ZCHL 5DEZA 4OCSL 4OFYD 5BZDA 3BQUB 4LAQL 3O3BB 5J7CC 4NZJA 3L95A 1F8TL 1DDHA 2NX5A 1DUZA 2E27L 4NRYA 5E6IB 1F3DH 1P7KB 1YJDL 1EH9A 4HQQH 2HFFA 1G0YR 3NGBC 5CD5C 2CKNA 1JPST 3OZ9L 2NY5L 4J8RB 3QCVH 1EJOH 4GBXC 1QVOB 1NLDH 1OARL 5C0RL 3RZWA 2MPAL 3IJSB 4I77H 4ZDHA 4JG0H 3MV8B 1MFNA 2HT4C 3P0YL 1P4IH 4RGNB 3CFDA 2H6PA 3QT2A 4QHKI 5FCSH 5DD5H 4NQCD 1QFUL 4PJIA 1G9NC 3LKPA 4OCWL 4CMMB 5BV7L 5TF0A 4DZBA 3HE7C 1OSZB 2Z4QA 3LN9A 4MJ6B 4NHUB 3HPJB 2CRMA 5HYJE 4JPWH 1OQOA 3TVMA 5C0BD 3KPOA 1T4KB 4IS6B 3RZCA 3T0XA 3EOBB 5FUZL 1TZGH 3HE6A 1F2XK 1JNHA 2BNUA 4P5TD 3T0EA 1LEKA 3ARDA 5JDSA 3BEVB 4FQJH 2I9TB 5I8OH 1CK0L 3PGDA 4PRNA 2IEPA 3BFOA 1VFUA 5EU6D 3HC3L 5EU5A 4F58H 5FV2A 3GRWL 1G1CA 4G6MH 5HGHA 2V2TA 2C1PA 2J88L 3IDXL 3MRHA 3PV6A 1HH6B 3QHZH 2ILLA 4KRPD 4UUJA 2QL1A 5CSBA 4KQ4L 1D7FA 2Z8SA 4NWUL 1JPSL 5FECB 2V17H 1OSPL 4PG9A 1FZOB 5F8RC 3MR9B 2W91A 3RGVD 4YDLB 3WFCH 2R0KL 1BJ1J 1TENA 3GJEA 1ITBB 1B6UA 4HMDA 4OF8A 3TA3C 5B38A 5EFIB 4WIQA 4NZTH 3BN3B 5DMIH 2UVEA 4GG6E 4Y2OA 3SDCA 2XRAL 2DQGL 2IBZY 1J8HE 3B5TA 1EAPB 1F4YL 2YD1A 3OPZL 4KXZH 4OZ4A 3K4DA 3VWJD 3DETD 3GSUA 1DQMH 4H5SA 4L4TA 5I71B 4OQTH 4XCNB 4OCMC 5DFVD 4WFFD 1MHHA 3BP7B 4UU9A 1VFOA 3WFEH 4PJEA 5IB2A 4P0DA 5HGDA 4AJ0A 5B39A 2I9LA 5F6HJ 4XWOD 4NFBA 3RU8L 1S7XA 3CVHA 1HHKB 3IDIB 5I1AA 4HIJB 1OAQH 4K9EL 5DD6B 4NKOB 1J88A 3O8XD 2YC1B 5L8LB 4FQLH 1WVZA 2E7HA 4FFEX 2PO6D 1WEJH 2FEDD 3W81A 4RCAA 3SY0B 3MLSH 3V6ZA 1ZS8B 1CD1B 3QJHB 4G8IB 1WAAA 1IC4H 3S36L 3D25B 4TTDD 1KPVB 3QIBD 1FV1B 3X14A 4HHAA 4U1GC 3WJLA 1R3IL 4CVZB 3KG5A 3HCVA 1EO7A 4NC1C 3QDGB 4UIMB 2RBLA 3O6KL 3QIWC 1NGZA 4HK0A 5EN2B 1BM3L 1D5IL 1UB5B 4XNQA 2WBJD 2VDLH 4DVBB 4Q9RL 5D7IF 4I5BA 4N5UA 3T3PE 3C09C 5KSUB 2NY1C 1YEFL 1DBBH 3U36A 1WTGT 3LQZB 2VIRA 4Y19B 1NGWA 1G9MH 1QZ1A 4MNQD 3UTTE 3CXDH 3D5OF 2IF7A 2FSEA 3R8QA 2X4NB 4XP4H 3AB0B 1NBZB 2DB8A 3QH3B 1IZJA 1MRFL 4M7JL 3WNPA 4X83A 1QO3B 4HKZB 4PRHB 2Y9RT 5CD5D 3GGWB 1GCFA 4Y8DC 2SEBA 4OD1H 5F1SA 4NUGL 3K8LA 2IH3A 3G08B 4GBXD 2PXYB 2IAND 5CP3H 3UO1L 2VJXA 2BSSB 3TN0C 1A7OL 1MH5A 1LE5A 4JM2A 2R1XB 1RJLA 1KXTB 3NPSC 2NY6C 2ED9A 2HT4D 4ACPA 4LSTL 1CU4H 4CVXA 3HMXH 3VRJA 1N7ML 2EC9T 3WIIL 1YNLH 5EOCH 4PJ7B 4NNYA 2AABL 2NY2C 3CMGA 2VWEE 2OM5A 3V2AR 4DVRL 2QEJA 4M5ZL 4WNQA 3KPTA 2AJSH 1EBAA 5HYEA 4K3DL 3INUH 5I1IL 3OXSA 3VXUD 4Z77B 3QUZB 1F5WA 2OL3B 3ECBB 3R1GL 3V5HA 1BFOA 2ZOKA 5FYKH 4RRPA 4UAOC 4PJ8B 4PJ5B 2O26U 1A6VL 3BWAA 3VFWA 1NC2D 5BXFA 5D6CB 5HDBF 4K3EH 2NTFB 4LNRA 1I9EA 4FABL 4IOSD 1KIPB 2EDXA 3ZKXC 5C0NC 1AFVH 4GXVH 4PBVC 4AT6B 1M4KA 3QEQA 4Q6IA 1VHPA 1N0XL 3ARFC 1N6QH 1C5BL 3Q0HA 1UWEH 3SDXB 4U0QB 4LLMB 3TA3D 4QTHB 3KPRB 1B0GA 2A6DA 2LQRA 5EBGA 1QR4A 2BY2A 4PJFE 1I8KB 3B3IA 5CGTA 1BBDL 3PGFH 5KVEL 1MLCA 3B5HA 5EIIB 5L8KB 1DTUA 1X5LA 4X8XA 3RUGB 5JOPE 4DKEH 1RJYA 2AV1A 4P4KA 5JW4Q 1RMFH 3GSNH 3FB8B 3RI5K 5E70A 1H3TA 4WI8A 4P2RA 4JG1L 3Q6FB 1U2CA 4K55A 1FCGA 4R9HA 1KCGC 3O2DH 3PWPA 2JKXA 2EYTB 1KT2B 4FP8H 5E1AB 1KCSH 4MAYB 1CD0A 4LMQI 2A6IA 2EH8L 4CU8A 2MNUA 1CF8L 1JGDA 3EO9H 4JO3L 1C16A 4PJXE 2WV3A 3ZLQC 4YBHA 2YUZA 1CFNA 1ORSA 1SJXA 3DXAE 1LP9A 1U8IA 5EUKB 4J6RH 4JKLA 5CINH 4NN5B 3O0RL 1KNOA 5DT1H 4JY4B 4WFHE 4XB7A 1E4XI 2PYEA 3MGTA 3NA9H 4MMZC 4MA7L 5B22A 3UTSE 2ZCKH 3DX6B 1YEDA 2DWEB 3FTGB 4WCYH 2X4OA 4Y1AA 5M95B 3MBEB 5FO9A 4XVTL 4C58B 3MJGX 3QUYA 2ICWB 2H32A 2L7UA 2NY1D 3IDGA 5CMAB 4DW2H 2X89A 1J05A 1AKJB 5A3IC 4WWKA 4HIHA 5IW6B 3VFSA 4YGVA 4X80L 3BKJL 4UZGA 3D69A 1TFHA 1YA5A 5JQ6L 3CXHK 1A7PH 1ZVSB 4QRTA 6FABL 3BIKB 3ALXA 1XIWB 5CLWA 5DHVB 1U8OA 5GGVL 2W0PA 3C60C 1JL8A 2VNCA 4XNZB 3OMZA 3WLWC 3FT3A 3GHBH 4U6YB 4OCRL 4LHQB 4ZFOA 2FR4B 3T1FB 1HEZB 3TN0D 4PP2A 1S9YB 2X4SA 3X3FL 4R26H 5IIEA 3Q6GL 4WI4A 2ZOLA 1G6RB 2NY6D 3RBGA 4XXDA 4NRXA 4AYFA 2XACC 4YDJA 4U05A 4NO5A 4OFVA 4I3RL 1X4ZA 1MHPL 5K9JL 1GRWA 3QDJE 5CILL 2JCCF 3Q1SH 4ZS7L 1EVTC 1QLFA 2EH7L 3BUTA 3FZUC 1I7ZB 3VFUB 1C5CL 5F7DA 4UOW0 5SWZD 5FO8B 2QJDA 5BVPH 3HZMA 4G6FD 3MV9A 1JPTH 3I6GB 4S1RH 4RQQA 3SKMA 3ZHDA 1Q38A 1YMHA 1I3RB 3MLVH 3TJHC 3UC0H 1L7TL 1T66C 3V5DA 1A21A 3MOAL 4F9PC 2XN9D 2F74A 2BFVL 4PBXA 3T1WA 1T7YA 4V2CB 2HAZA 4S1SH 5CSZA 3S4SB 3OHXB 4F8QA 4HULB 1EZVX 3GIVB 5F70A 3P2TA 2BMKA 1N0LA 4GG6A 4U1KB 4S0UC 5C0ND 4Q6YA 3OJ2C 4DUXA 1J8HA 1NMAH 2ZSVB 1QBML 4XPAH 5MEPB 1ZTXH 3ARFD 4U1NA 2PCPA 4NYLA 1CD8A 1ZEAL 1EJ6A 1KTDA 3CH1A 2GJZB 1ZLUK 2XZAL 2FH8A 4F7EB 4LLUB 3FFCE 5CKAA 2D31A 4HZAA 1JE6A 1YNKH 1NMCC 1RUQL 4LQFH 5C0IB 1IC7H 5DVMA 3HUJB 2JTDA 3QFJD 2FB4L 1FNEA 5LGHL 4X6DB 4QRRE 4EUPB 3HZYB 2X9XA 5DR5L 4P3CH 4YHML 2V2XB 3KJ6H 4D9RD 4MAUH 5KS9F 1OVZA 4QXTB 2AEQL 1TCRA 2VQUA 4UIKH 4NO0B 4DOHE 5IBTH 3VXMB 2BRQA 4YIQB 4QEGA 4ETQA 1H5BA 3BUYB 1Z9OA 1D6EA 4L9LC 2PETA 2Q76A 3IXAB 2X4UB 5AWNL 2GJ6D 4D8PA 1DLFH 4TPRL 2DQIL 4HFWB 2W9EH 2AQ3A 1FIEA 1A6ZB 1RIHH 3WIHH 4YDIL 2AXGB 1MAKA 3MPCA 3WHXB 3CC5A 3LS5H 4OF6A 5J3HD 3E2HC 2I60H 4HS6B 1FNFA 4JANB 4KVCL 4G8GD 3W2DL 2WINB 3UTTA 2AK4A 3FQNB 2NY7H 5E00B 3U0PA 3KLHC 2G2RA 2W0FA 5HHME 3DROA 4TQEH 2VN4A 1OP3H 1T83A 3F5WB 4ZFFB 5C6TL 2BVQB 1YY8A 1W72L 5A3ID 3TLRA 1MJUH 2CH8A 5J57B 2DM7A 1QFPA 1P2CA 3M07A 1F6AB 1KIRA 4FQIH 4RZCA 1CGWA 2B5IB 1N5AB 3CFEB 4JDVA 4BUGA 1TTGA 2F58L 4R4NC 2R2HB 2EE2A 4FQHB 5LAXA 4OD2A 3WFBL 5IWLA 3MREB 4HLJA 1JN6B 3OR7B 3QI9B 4W4OA 3C60D 2PW2A 1KJ3H 3DX8B 2WZPD 3WLWD 1NEZB 2HN7A 3MLTA 5JOFA 2G60H 1VPOH 3JTSB 5D7KD 2ATPB 4GFTB 4ZUWB 1KPUB 4B0MM 4H0IA 2BSRB 3CSBA 4U1MA 4U0RC 3VMPA 3KS0H 2Y25A 5DMGC 1KJMB 5I2IB 4FMKA 2ZUQB 4N0YL 5DJZB 1T6WA 1H3PH 2A9ML 2EDEA 3A6BH 1PY4A 3FZUD 5GGUB 3ZKMC 5GRUH 2GJJA 2VLRA 1KCUH 1CT8A 5C09B 5IHZB 3NCEB 1JWMB 4HWNA 5EBWA 1LO3H 4LARH 1IFHL 4OAWB 5ELIA 5MI0C 2PNDA 3TWCL 3TJHD 1T66D 4NQCE 1HXYA 2ZCLH 1ROWA 3IF1A 4OIAA 4PJAF 4H0GA 4IIQC 4R6UA 3ARXA 1CGSH 4OKVA 1N4XL 3VJ6B 4OQTA 1IM3B 5DFWH 4NNXA 5C0BE 4DN3L 2CJUL 3ZE0F 5ICYA 3GSOA 4QKXB 1KLGA 5TDOA 5CEZL 5L2KB 3CVIH 1G84A 2Y07H 5C07D 5IMOB 4M7ZB 4K7FA 1I7UB 5TGBB 1GIGH 3GMMA 3KXFB 1OAZH 1KJ2L 5D2NC 4HG4J 2XWTA 5TQ0L 1JK8B 5EU6E 1CFTB 1G9NH 4G5ZH 1QRNB 1VACB 3SKNA 5T33L 4TULL 4KROC 1OGAA 4CW1B 1R3JB 3M17A 1X7QA 1NBVL 5JHDB 2F54E 5AYUH 1YYML 4JY5L 1UM4H 4X9GA 5D7SL 3SGEH 4HK3N 3LV3A 3GI9L 2Z35A 3DPBA 3MRNA 5EO1B 2J8UB 4UTBL 4EVNA 4LLDA 4LVNB 2AGJH 4XH2A 2OQJA 4Y4HB 5D1XA 2Y4SA 3RDTB 3VGHA 3MLXL 5ANMA 3HTLX 4PJXA 3ZTJG 5JW4R 3V7AE 4W68A 5DDHB 4HUXA 3GBLA 4C56E 4FQ2H 5BQ7B 3IDNB 2N7AA 4FFZL 3VDCA 3DXAA 1CXIA 1JTPA 3GI8L 5K9KB 1NAKL 4IRZL 4XCYB 3LY6A 2FX9L 1A6TB 2H2SC 1LGVA 4W81A 3L1OH 3U4EB 1FL6B 2M2DA 4WFFE 2VISB 1KELH 4YJZL 3DO3A 1Y0LA 1DN2A 1FVCA 4LSQH 1E4WH 2WMPA 4K7PY 5D1ZC 2AEIT 5HVFB 1ZT1A 2F5BH 4N1HB 5HHOB 1HCFX 3TBWB 1NSNH 3JV5A 4P23A 5E95B 5CP3A 3ULUL 4OZGB 4LIQH 5H35A 2ICEB 4H88L 2VAAB 2R1WB 4JY6B 4O9HL 3KLHD 2GITA 1VEPA 2LVCA 2J6EH 4MJ5B 5CD3B 1UG9A 4OCXL 3QNXA 3I02B 4FXKB 4ALAH 1Y18A 4WFED 1BD2D 3HZVB 1MCPH 3HMXA 4MQXC 3ARUA 5H37G 1T5WB 1EGJH 3TGXA 2VC2H 4R4ND 1SBBA 1QQDA 2Y5EA 2VLKA 2VTFA 4ZOCA 5TE6H 3S36X 5T3ZD 1OTTC 1N5YH 4NUJB 2EXYC 4GMSL 4UV7L 3NCMA 1JP5A 3HB3C 1NCAH 3IETA 1HHIB 1NCBH 1A9EA 3TO2B 1P53A 3TNMA 4PPTA 1ZLWK 5IP4A 1RK0B 4YDKL 4DCQB 1GZPB 4YHIB 1JWSB 4IRJB 4FA8A 1NCDH 2DD8L 2GKIA 3U7AA 1NDGB 2P42B 1XGTA 3JV0A 2FJHB 2HJLA 4M02A 3P77B 1R5WA 5LCVH 5DMGD 3VGGA 1KEML 5ECJE 5DRWB 2AJ3A 1CD9B 3ZKMD 2APFA 1FYTB 5DUBB 1A0QL 4XBPA 3W5NA 3S4SG 2BC4B 5KTEH 5JW3H 4WTWA 5EZLA 4JZNA 3HNTH 5JOEA 3BHBA 3VI4F 3V4PL 4IRSA 4NIKB 4LKXA 4XAKD 3NH7L 3EFFA 4R0LC 5IJKA 3GSRB 2XOTA 1OAYH 3MRGA 4IBLT 3GSNA 1AD9A 2YMXH 1YMMB 4PREB 3B9KA 1MFBH 3F62A 3FFCA 3IKCB 1YUHA 4ZODA 3FT2A 3PABA 1C08B 1JZ2A 1KOAA 4L8DA 3K74B 1IAKB 1EIBA 3STBA 3IDJA 1MFEL 3VXUE 1A1NA 4E5XA 3O2DA 4RIRA 4ZYKB 5CP7A 3ZKQD 1ZV5A 3VFOA 2X1QA 3GSQA 2ARWA 1G7IA 3VG9C 4QRRA 4KROD 4AQ1B 1FAKT 4EUPG 2JELH 3B2UC 4PRDA 2JB6A 5I75B 3CX5J 1T22A 4JHBA 5ADOH 5F93C 1BZ7A 4F7MB 4OKDA 1FVDB 1E0OB 5F3HB 1XF3A 1MIEL 3W9DA 4WW2A 3MXWL 4LLWA 3QUXC 3W0WD 2ATKA 4UQ3A 4TSBL 4OD3L 5GSVA 3N9GL 5DI8A 4BUHA 1PEZA 1T3FA 2CIKB 5SX4H 2W65A 5J6GB 3P11H 4RX4A 4EIZC 3MNWB 5E99L 3HAEB 1NCTA 3BKCH 3RL1B 1RUPL 4YEFA 3U4AA 3R06A 2AJXH 1UKSA 1MNUL 2BDNL 5F6IC 3SO5A 2VZOA 3P9LB 3BVNA 2H2SD 2R1YA 3PNWB 4G8FA 5F9OL 1NAMB 1RHHA 2CK0L 3MNZA 4LRNH 3PG2A 5KS9A 3O2WL 1P4BH 5HHMA 1JHKL 4UBDC 5D1ZD 4XCCL 2IADA 1JWUB 4O58H 1KCVH 4N5EC 1OP5H 4YPGB 1QSFB 1JIBA 4AL8H 4N8VA 1T2QH 3FN9A 3LIZH 4QGYA 4UT7H 3VFRA 2I07A 3DSNA 4X7EC 5EC1B 1A4KA 4PTUB 1I8LA 3GO1H 4PV8B 4Y7MA 4MXWL 1RUKH 4MB3A 3TZVA 3VD3A 1BJMA 1YEEL 3DV6A 5ESQB 4JZJC 4MQXD 4I2XB 4OFYA 4LP5A 4QOKB 3IFNL 1NEZG 2R39A 4XC1H 3Q5TA 3C2AL 4HCRL 2GI7A 5IFHH 3FQTA 1QD0A 3SDDC 4FQQA 3STZB 3F58L 1RUAH 1OTTD 1QBAA 1T5XB 4XAWL 4UNUA 1UQSA 2EXYD 5JW4N 4IJ3C 3HB3D 1V3LA 4PJBE 3OBAA 5JHLH 4GT7A 4LLQB 1RZGB 2X9WA 4DGVH 4XPGH 1IEAB 4ZAKB 1SEBA 1TVHB 3D18B 4X98B 3O2VL 2BVYA 4EN3C 5C0JB 4PJCE 4Z7UE 4L4VE 1LD9B 1QA9A 2D7OA 3V4UL 4R7NB 3VMNA 4UILH 3DRQB 1MWAH 5MERA 4BA8A 3GMQA 2J5LB 3V6OA 1UYWH 2H41A 4AEFA 1VEMA 1X6NA 3FQWA 4N8CH 4O51B 1X9QA 5J9PB 5TF1L 1FNHA 4HJGA 3TJEL 4FOMA 3F12B 1VGEL 2AI0H 2YKLH 4K94L 2ZG3A 5CWSB 3WJJA 5GS0L 1I3UA 1KCKA 2I24N 5ISZD 3VWKC 5C0BA 3G6JA 3JV6A 2MCPL 2XQBL 2Z8VC 1AGBA 5GJSH 1FNLA 3L3OA 1HWGB 3RHWF 5C86A 4LCWD 5HYFA 4PGEB 4LCIH 2DLGA 4P5TA 1SVZA 3VFGL 2AJZB 3MODL 4NGHH 5EU6A 5EBLB 3JBG7 4XVSH 1QLRB 2DKSA 5TDPB 4CADA 1AE6L 1DVFB 1AHWB 4HBCL 4GKSA 3UZVB 5JPNB 2EDDA 4JGUA 3GEWB 2RCSH 3BN9C 4OZHF 1LK3H 1W0YT 3GFUA 1WC7B 1UWXK 1Z9LA 1KG0B 3D39D 5DJ6B 5BRZA 2XN9E 3FAXA 2A38A 3DX9A 3RGVA 2ARJB 3QDAA 3V6BR 4PGCA 3B2UD 3BDYH 3U9UB 1J5OL 1ND0A 5ALCH 5HVHB 4G43B 3BE1H 1DLHB 4TUJA 1UJ3B 2H1PH 4WFGE 3WIHA 3BSZL 5CZVH 5FV1L 1BF8A 3QUXD 4D0BA 2Y36L 3ETBF 3CSGA 1T1YB 5FUCC 2E6JA 4JO2L 3P0VL 1IGIL 3OB0K 3QDHA 1BZQK 1A1MB 3AM8A 4XRCB 1WBXA 3OG6B 3VWJA 5BZDB 2R4RH 1S5IH 1D6VL 3L95B 4GKZA 4Y8AA 1DDHB 2NX5B 1DUZB 1K9TA 3MACH 4NRYB 3S6CA 5CJ8A 5EC2A 5MEOA 3HC4L 2VDKH 2EDLA 2HFFB 5FOBA 4LU5L 3RTQC 3T2NH 1XT5A 4JREC 4JN1H 1CTNA 3NACH 3WFDL 4HK3J 5LWYL 2ZWLT 3O8XA 3VXSD 4D9RE 4EIGB 2PO6A 4HWBH 4EXPX 3HI5L 4BH8A 3MNVA 5DJ2B 2XA8L 5F7EH 4ZDHB 1GGCH 4MDIA 4UBDD 5IKCA 1RIVH 4K07A 3B4NA 4OIIL 3S3JA 4XMKL 1B9ZA 5I1CH 2H6PB 5HY9A 4N5ED 3QIBA 2GJ6E 2HT2C 4JFQA 4PJIB 4D9LL 3LKPB 1T89C 2QQKH 3C5ZA 3WBDA 5GISL 4DZBB 2R69H 2Z4QB 2N1KA 2QR0A 2WBJA 3QWOA 4ZUSA 3MRBA 2C9AA 3TVMB 5SX4I 4GQ9H 3KPOB 4BKLA 2GUOA 1KEGL 5B8CC 3RZCB 1A14L 2DLIA 2J4WH 3ROOA 1I4FA 4ERSL 2BNUB 3HE6B 1JNHB 1FGNL 4G8GE 3T0EB 1LEKB 5CEZE 3ARDB 3MC0A 5JDSB 3LZFL 4MNQA 3S5LG 1EO8H 2MJWA 3PGDB 1OD9A 4PRNB 1MFCH 1WWWX 5EU5B 2IBBA 5JDJA 4BZYA 1ZGLP 4X6CE 2C1PB 3L3DA 1TNMA 1WFOA 5D1QB 5MENE 3MRHB 3PV6B 4UUJB 1PYWA 2OL3L 1TQCB 3EHBC 4PG9B 1IQDA 2BNQD 4F57H 2FCBA 3B6SA 5EU4B 4EN3D 3WO4C 5KVFL 4GBXA 2IANA 4UNTA 1CDUA 2GEEA 3GJEB 1AH1A 1MJ8H 5B38B 3KYMA 5IQ7L 5GIRA 2IWGA 1FFNA 4CNIA 2XTLA 4TVPD 1G6VK 2VXTL 2GT9A 4TVSa 5CJ5A 5FHBH 4DWHA 3SDCB 3CK0H 1XF5A 1LMKA 1LE9A 1BBJA 3U0WH 1PG7X 2W0KA 1R3HA 3HE7A 3ZE1E 4QY8A 2FATH 4OZ4B 1YQVH 3GMPA 3GSUB 4H5SB 4L4TB 5HVGB 3KLDA 1A5FL 3VWKD 1MHHB 4UU9B 5T3ZH 3U48A 4PJEB 5IB2B 2HJFA 1FE8H 3BKML 3RVVD 4FRWA 5HGDB 5B39B 1PD6A 2I9LB 4APQC 3VXUA 1YYLH 4TN9A 4DGYL 2X7LA 1F58L 1S7XB 5I1AB 3MXVL 3OAZH 2HA1A 5EZIL 43CAA 1NC2A 1QYGL 1YEGL 3ULUE 3BN9D 3V6ZB 3LEVH 1L8JA 4YHKL 4ZPTA 1MEXH 3ZL4H 3X14B 4HHAB 2HKFH 5DZLA 5E03A 4GH7B 3HCVB 3TA3A 3IFLH 1AI1L 4OTXH 4HH9A 1IAOA 2X42A 5IHBA 1NGZB 4HK0B 5IVZA 4U1SA 4XNQB 5IFJA 3I50L 4WV1C 4RISH 4NP4H 3MRJB 4OFPA 43C9A 1WSST 4I5BB 4OUUA 4N68A 2JJWA 3LOWA 2RFXA 4GMTL 1HWHB 3U36B 2VIRB 1NGWB 2ORBH 3ROLA 3QUKA 1Q9OA 3BIAX 2FSEB 2W9DH 2J6EA 1JF5A 4PIRF 1UEMA 4P9ML 2ZNWA 1OPGH 1JPGA 4TOYL 5J4MA 3QHFL 5IESL 5DUMH 1XGYH 3O9WC 3RTQD 5E2UH 1F3JA 3F6LA 3G9VA 1WFUA 4BQCA 3UBXI 5E4EC 4NQDD 1AIFA 2SEBB 1T03H 1EGJA 2YK1H 3MV7D 2IH3B 4Q0XH 1WTLA 5I66B 1MH5B 2DDQH 1T1ZA 2ZPKL 4K3JL 5CLTA 1LE5B 4JM2B 3X17A 1RJLB 2L0DA 5ICXA 2XFXA 1Z9SA 2RAMA 1BREA 3X3GL 2HT2D 1F02I 4NKQB 4CVXB 1EMTL 3VRJB 2XZQH 1UM5L 4NNYB 3QIWA 4PJHF 3QSKB 1G6RL 2AJUL 1DANT 2HWZH 5I17A 4ELMA 4WNQB 4YC2B 4FTVA 4PV9A 3BAEL 4GG8A 2YWZA 5BMFH 3UZQA 1T0MA 4ORZC 4PJBA 3V4VH 5CJQH 4JVWA 3OXSB 3K1DA 2HP4A 3UJJL 4E41D 1LO0L 5INDA 4KV5E 3V5HB 1DBKH 4EXKA 1BFOB 2ZOKB 2WUCL 4Z7UA 3S3PA 1UWGH 2ED7A 1YPZF 5LJYH 1GGBH 2NY0C 3BWAB 1CFQA 3SJVD 3VFWB 5BXFB 1AO7E 3T8XA 1KTKE 4DEPB 1L0XA 3BGMA 1BD2E 4OLVL 4WFEE 4NZUH 4DGIL 4Q9QH 4LNRB 2VZTA 1MJ7H 3GBNL 1VADA 4BSJA 1IGFH 1ZAGA 3QEQB 2B39A 4Q6IB 5IFAL 1WIPA 4KJYA 1DJSA 5F7KC 3WKMH 1TVBA 3TN0A 4FZEH 2OR9H 5HD8C 1RZKL 2OXGA 3BGAA 2VLJD 1B0GB 2A6DB 2FIKA 4Z7OF 3RIAF 5B4MD 4KTDH 4PB9H 5D70L 4JE4B 2P24A 4JGMA 3B3IB 5C08D 5KANG 1MLCB 5E8DL 5T1MA 4FQCL 4YHYC 1JNJA 3BZ4A 4XPBH 3PDDA 3LD8B 3P3YA 1FCCA 4P2QD 1CR9H 1RJYB 2AV1B 4P4KB 5SWZA 5DJXA 4JPIA 2CUIA 4NQTA 3OQ3B 4XP6H 4HUVA 2B0SL 4P2RB 3EDFA 3IRZA 4APQD 1GPOH 3K2UH 4UTAH 3PWPB 3VW3L 4NFDA 1QBLH 2XN9A 4MB5A 5I1LA 5F7MC 2E9WA 3UJIL 3C5SA 2A6IB 4NN7B 3TM6A 3T0WA 1JGDB 3PWJA 3TBSA 3ZDXE 1C16B 4L8CA 4KJQC 4HMCA 3WHE1 1X5KA 3B2VL 3A67H 4HWZA 1CFNB 4HZLA