3IXCA

Crystal structure of hexapeptide transferase family protein from anaplasma phagocytophilum
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
170
structure length
166
Chain Sequence
MREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexapeptide transferase family protein
publication title Crystal structure of hexapeptide transferase family protein from Anaplasma phagocytophilum
rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 68
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3ixcA00
2JF2A 5ADXU 1QQ0A 4J18A 4K6RA 1KK5A 2V0KA 3T57A 2ICXA 1TDTA 2QIAA 2WLDA 4G87A 5AFUV 5DEMA 4M2BA 4N69A 1HM9A 3GOSA 3VBLA 3TISA 4EA7A 1V3WA 3D8VA 3R5CA 2ICYA 3BSSA 4DCLA 3GUEA 5AFUU 4H7OA 2QKXA 1SSQA 3MC4A 3SPTA 4ISXA 4E79A 1QRMA 4KPXA 2OEGA 3R8YA 1MRLA 3P1BA 4R37A 3I3XA 3EEVA 3KWEA 4KQLA 5DEPA 1KRUA 3FS8A 2RIJA 4N6BA 1FXJA 1SSMA 1G97A 1XHDA 3DK5A 4IHGA 4E75A 3Q1XA 1QRLA 2VD4A 4N27A 2WLCA 3BSYA 4HZDA 3SRTA 2IUAA 3V4EA 3VBPA 2XATA 3R5BA 4MYOA 4EA9A 1HM8A 1KRVA 3P47A 3R1WA 2TDTA 3TIOA 4G3SA 1QRGA 3VBIA 2I5KA 3HJJA 3NZ2A 3OUPA 4R7PA 4IHFA 3EH0A 1KGQA 1KK4A 3CJ8A 1XATA 4E6TA 5E3RA 1THJA 3FSYA 3ST8A 4MZUA 5DG3A 4KNRA 3IGJA 2AQ9A 1KQAA 3C8VA 3ECTA 2WLEA 3D98A 4MFGA 4EAAA 3KWDA 2OI5A 1SSTA 1KK6A 2JF3A 2W0VA 3FSBA 1OCXA 4G3PA 3TWDA 3BXYA 2WLFA 4J09A 3BSWA 3VBJA 3EG4A 3R5AA 3R2WA 4HURA 3OTMA 4M98A 3F1XA 3MQHA 4M28A 3TDTA 1KRRA 5L6VA 3DJ4A 4HUSA 2IC7A 5E3PA 2V0LA 3FSCA 3VNPA 1MR9A 3OU9A 4HCQA 1FWYA 4EA8A 4G3QA 3FSXA 4AAWA 3OTZA 1S80A 2IU8A 2W0WA 2WLGA 1KHRA 3VBMA 2QIVX 4IHHA 4AA7A 4E6UA 1Z90A 4N6AA 3R3IA 1QRFA 1HV9A 3I3AA 3TK8A 1V67A 2NPOA 3FTTA 2IU9A 2V0JA 3BRKX 3VBNA 3TV0A 2V0IA 1J2ZA 2OEFA 1T3DA 4EABA 2FKOA 4M99A 1HM0A 1YP4A 4EQYA 5L6SA 1MR7A 3BFPA 4M9CA 4AC3A 1YP3A 4KNXA 3IXCA 3R5DA 4M2AA 1LXAA 1QREA 3GVDA 4KPZA 3FOQA 5E3QA 3R0SA 1G95A 1KGTA 4FCEA 3FWWA 2GGOA 3VBKA 3R3RA 1YP2A 2P2OA 3PMOA 3JQYA 5F42A 4EGGA 4HZCA 2VHEA 3MQGA 3OW5A 2V0HA 3KWCA 4E1KA 5ADXV 2GGQA 5U2KA 4R36A 2OI7A 3HSQA 2Q4JA 2OI6A 3DHOA
chains in the Genus database with same CATH superfamily
2JF2A 5ADXU 1QQ0A 4J18A 1L0SA 4K6RA 1KK5A 3OH2A 2V0KA 3T57A 2ICXA 1TDTA 2QIAA 2WLDA 4G87A 5AFUV 5DEMA 4M2BA 4N69A 1HM9A 3GOSA 3VBLA 3TISA 4EA7A 1V3WA 3D8VA 3R5CA 2ICYA 3BSSA 4DCLA 3GUEA 5AFUU 4H7OA 2QKXA 1SSQA 3MC4A 3SPTA 4ISXA 4E79A 1QRMA 4KPXA 2OEGA 3R8YA 1MRLA 3P1BA 4R37A 3I3XA 3EEVA 3KWEA 4KQLA 5DEPA 1KRUA 3FS8A 2RIJA 4N6BA 1FXJA 1SSMA 1G97A 1XHDA 3DK5A 4IHGA 4E75A 3Q1XA 1QRLA 2VD4A 4N27A 2WLCA 3BSYA 4HZDA 3SRTA 2IUAA 3V4EA 3VBPA 2XATA 1EWWA 3R5BA 4MYOA 4EA9A 1HM8A 1KRVA 3GQ8A 3P47A 2TDTA 3R1WA 3TIOA 4G3SA 1QRGA 3VBIA 2I5KA 3HJJA 3NZ2A 3OUPA 4R7PA 4IHFA 3EH0A 3SUCA 1KGQA 1KK4A 3CJ8A 1XATA 4E6TA 5E3RA 1THJA 3FSYA 3ST8A 4MZUA 5DG3A 4KNRA 3IGJA 1N4IA 2AQ9A 1KQAA 3C8VA 3ECTA 2WLEA 3D98A 4MFGA 4EAAA 3KWDA 2OI5A 1SSTA 1KK6A 2JF3A 2W0VA 1M8NA 1OCXA 3FSBA 3GQAA 4G3PA 3BXYA 3TWDA 3OH0A 2WLFA 4J09A 3BSWA 3VBJA 3EG4A 3R5AA 3R2WA 4HURA 3OTMA 4M98A 3F1XA 3MQHA 4M28A 3TDTA 1KRRA 5L6VA 3DJ4A 4HUSA 2IC7A 5E3PA 2V0LA 3OH3A 3OH4A 3FSCA 3VNPA 1MR9A 3OU9A 4HCQA 1FWYA 4EA8A 4G3QA 3FSXA 4AAWA 3OTZA 1S80A 2IU8A 2W0WA 2WLGA 1KHRA 3VBMA 2QIVX 4IHHA 4AA7A 4E6UA 1Z90A 4N6AA 3R3IA 1QRFA 1HV9A 3I3AA 3TK8A 1V67A 2NPOA 3FTTA 2IU9A 2V0JA 3BRKX 3VBNA 3TV0A 2V0IA 1J2ZA 3OH1A 2OEFA 1T3DA 4EABA 1Z2FA 2FKOA 4M99A 1HM0A 1YP4A 4EQYA 5L6SA 3OGZA 1MR7A 3BFPA 4M9CA 4AC3A 1YP3A 4KNXA 3IXCA 3R5DA 4M2AA 1LXAA 1QREA 3GVDA 4KPZA 3FOQA 5E3QA 3R0SA 1G95A 1KGTA 4FCEA 3FWWA 2GGOA 3VBKA 3GQ9A 1YP2A 2P2OA 3PMOA 3R3RA 3JQYA 5F42A 4EGGA 3GQ7A 4HZCA 2VHEA 3MQGA 3OW5A 2V0HA 3KWCA 4E1KA 5ADXV 2GGQA 5U2KA 4R36A 2OI7A 3HSQA 2Q4JA 2OI6A 3DHOA
chains in the Genus database with same CATH topology
2JF2A 5ADXU 1QQ0A 4J18A 4K6RA 1KK5A 2V0KA 3T57A 2ICXA 1TDTA 2QIAA 2WLDA 4G87A 5AFUV 5DEMA 4M2BA 4N69A 1HM9A 3GOSA 3VBLA 3TISA 4EA7A 1V3WA 3D8VA 3R5CA 2ICYA 3BSSA 4DCLA 3GUEA 5AFUU 4H7OA 2QKXA 1SSQA 3MC4A 3SPTA 4ISXA 4E79A 1QRMA 4KPXA 2OEGA 3R8YA 1MRLA 3P1BA 4R37A 3I3XA 3EEVA 3KWEA 4KQLA 5DEPA 1KRUA 3FS8A 2RIJA 4N6BA 1FXJA 1SSMA 1G97A 1XHDA 3DK5A 4IHGA 4E75A 3Q1XA 1QRLA 2VD4A 4N27A 2WLCA 3BSYA 4HZDA 3SRTA 2IUAA 3V4EA 3VBPA 2XATA 3R5BA 4MYOA 4EA9A 1HM8A 1KRVA 3P47A 3R1WA 2TDTA 3TIOA 4G3SA 1QRGA 3VBIA 2I5KA 3HJJA 3NZ2A 3OUPA 4R7PA 4IHFA 3EH0A 1KGQA 1KK4A 3CJ8A 1XATA 4E6TA 5E3RA 1THJA 3FSYA 3ST8A 4MZUA 5DG3A 4KNRA 3IGJA 2AQ9A 1KQAA 3C8VA 3ECTA 2WLEA 3D98A 4MFGA 4EAAA 3KWDA 2OI5A 1SSTA 1KK6A 2JF3A 2W0VA 3FSBA 1OCXA 4G3PA 3TWDA 3BXYA 2WLFA 4J09A 3BSWA 3VBJA 3EG4A 3R5AA 3R2WA 4HURA 3OTMA 4M98A 3F1XA 3MQHA 4M28A 3TDTA 1KRRA 5L6VA 3DJ4A 4HUSA 2IC7A 5E3PA 2V0LA 3FSCA 3VNPA 1MR9A 3OU9A 4HCQA 1FWYA 4EA8A 4G3QA 3FSXA 4AAWA 3OTZA 1S80A 2IU8A 2W0WA 2WLGA 1KHRA 3VBMA 2QIVX 4IHHA 4AA7A 4E6UA 1Z90A 4N6AA 3R3IA 1QRFA 1HV9A 3I3AA 3TK8A 1V67A 2NPOA 3FTTA 2IU9A 2V0JA 3BRKX 3VBNA 3TV0A 2V0IA 1J2ZA 2OEFA 1T3DA 4EABA 2FKOA 4M99A 1HM0A 1YP4A 4EQYA 5L6SA 1MR7A 3BFPA 4M9CA 4AC3A 1YP3A 4KNXA 3IXCA 3R5DA 4M2AA 1LXAA 1QREA 3GVDA 4KPZA 3FOQA 5E3QA 3R0SA 1G95A 1KGTA 4FCEA 3FWWA 2GGOA 3VBKA 3R3RA 1YP2A 2P2OA 3PMOA 3JQYA 5F42A 4EGGA 4HZCA 2VHEA 3MQGA 3OW5A 2V0HA 3KWCA 4E1KA 5ADXV 2GGQA 5U2KA 4R36A 2OI7A 3HSQA 2Q4JA 2OI6A 3DHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JF2 A;  5ADX U;  1QQ0 A;  4J18 A;  4K6R A;  1KK5 A;  2V0K A;  3T57 A;  2ICX A;  1TDT A;  2QIA A;  2WLD A;  4G87 A;  5AFU V;  5DEM A;  4M2B A;  4N69 A;  1HM9 A;  3GOS A;  3VBL A;  3TIS A;  4EA7 A;  1V3W A;  3D8V A;  3R5C A;  2ICY A;  3BSS A;  4DCL A;  3GUE A;  5AFU U;  4H7O A;  2QKX A;  1SSQ A;  3MC4 A;  3SPT A;  4ISX A;  4E79 A;  1QRM A;  4KPX A;  2OEG A;  3R8Y A;  1MRL A;  3P1B A;  4R37 A;  3I3X A;  3EEV A;  3KWE A;  4KQL A;  5DEP A;  1KRU A;  3FS8 A;  2RIJ A;  4N6B A;  1FXJ A;  1SSM A;  1G97 A;  1XHD A;  3DK5 A;  4IHG A;  4E75 A;  3Q1X A;  1QRL A;  2VD4 A;  4N27 A;  2WLC A;  3BSY A;  4HZD A;  3SRT A;  2IUA A;  3V4E A;  3VBP A;  2XAT A;  3R5B A;  4MYO A;  4EA9 A;  1HM8 A;  1KRV A;  3P47 A;  3R1W A;  2TDT A;  3TIO A;  4G3S A;  1QRG A;  3VBI A;  2I5K A;  3HJJ A;  3NZ2 A;  3OUP A;  4R7P A;  4IHF A;  3EH0 A;  1KGQ A;  1KK4 A;  3CJ8 A;  1XAT A;  4E6T A;  5E3R A;  1THJ A;  3FSY A;  3ST8 A;  4MZU A;  5DG3 A;  4KNR A;  3IGJ A;  2AQ9 A;  1KQA A;  3C8V A;  3ECT A;  2WLE A;  3D98 A;  4MFG A;  4EAA A;  3KWD A;  2OI5 A;  1SST A;  1KK6 A;  2JF3 A;  2W0V A;  3FSB A;  1OCX A;  4G3P A;  3TWD A;  3BXY A;  2WLF A;  4J09 A;  3BSW A;  3VBJ A;  3EG4 A;  3R5A A;  3R2W A;  4HUR A;  3OTM A;  4M98 A;  3F1X A;  3MQH A;  4M28 A;  3TDT A;  1KRR A;  5L6V A;  3DJ4 A;  4HUS A;  2IC7 A;  5E3P A;  2V0L A;  3FSC A;  3VNP A;  1MR9 A;  3OU9 A;  4HCQ A;  1FWY A;  4EA8 A;  4G3Q A;  3FSX A;  4AAW A;  3OTZ A;  1S80 A;  2IU8 A;  2W0W A;  2WLG A;  1KHR A;  3VBM A;  2QIV X;  4IHH A;  4AA7 A;  4E6U A;  1Z90 A;  4N6A A;  3R3I A;  1QRF A;  1HV9 A;  3I3A A;  3TK8 A;  1V67 A;  2NPO A;  3FTT A;  2IU9 A;  2V0J A;  3BRK X;  3VBN A;  3TV0 A;  2V0I A;  1J2Z A;  2OEF A;  1T3D A;  4EAB A;  2FKO A;  4M99 A;  1HM0 A;  1YP4 A;  4EQY A;  5L6S A;  1MR7 A;  3BFP A;  4M9C A;  4AC3 A;  1YP3 A;  4KNX A;  3IXC A;  3R5D A;  4M2A A;  1LXA A;  1QRE A;  3GVD A;  4KPZ A;  3FOQ A;  5E3Q A;  3R0S A;  1G95 A;  1KGT A;  4FCE A;  3FWW A;  2GGO A;  3VBK A;  3R3R A;  1YP2 A;  2P2O A;  3PMO A;  3JQY A;  5F42 A;  4EGG A;  4HZC A;  2VHE A;  3MQG A;  3OW5 A;  2V0H A;  3KWC A;  4E1K A;  5ADX V;  2GGQ A;  5U2K A;  4R36 A;  2OI7 A;  3HSQ A;  2Q4J A;  2OI6 A;  3DHO A; 
#chains in the Genus database with same CATH topology
 2JF2 A;  5ADX U;  1QQ0 A;  4J18 A;  1L0S A;  4K6R A;  1KK5 A;  3OH2 A;  2V0K A;  3T57 A;  2ICX A;  1TDT A;  2QIA A;  2WLD A;  4G87 A;  5AFU V;  5DEM A;  4M2B A;  4N69 A;  1HM9 A;  3GOS A;  3VBL A;  3TIS A;  4EA7 A;  1V3W A;  3D8V A;  3R5C A;  2ICY A;  3BSS A;  4DCL A;  3GUE A;  5AFU U;  4H7O A;  2QKX A;  1SSQ A;  3MC4 A;  3SPT A;  4ISX A;  4E79 A;  1QRM A;  4KPX A;  2OEG A;  3R8Y A;  1MRL A;  3P1B A;  4R37 A;  3I3X A;  3EEV A;  3KWE A;  4KQL A;  5DEP A;  1KRU A;  3FS8 A;  2RIJ A;  4N6B A;  1FXJ A;  1SSM A;  1G97 A;  1XHD A;  3DK5 A;  4IHG A;  4E75 A;  3Q1X A;  1QRL A;  2VD4 A;  4N27 A;  2WLC A;  3BSY A;  4HZD A;  3SRT A;  2IUA A;  3V4E A;  3VBP A;  2XAT A;  1EWW A;  3R5B A;  4MYO A;  4EA9 A;  1HM8 A;  1KRV A;  3GQ8 A;  3P47 A;  2TDT A;  3R1W A;  3TIO A;  4G3S A;  1QRG A;  3VBI A;  2I5K A;  3HJJ A;  3NZ2 A;  3OUP A;  4R7P A;  4IHF A;  3EH0 A;  3SUC A;  1KGQ A;  1KK4 A;  3CJ8 A;  1XAT A;  4E6T A;  5E3R A;  1THJ A;  3FSY A;  3ST8 A;  4MZU A;  5DG3 A;  4KNR A;  3IGJ A;  1N4I A;  2AQ9 A;  1KQA A;  3C8V A;  3ECT A;  2WLE A;  3D98 A;  4MFG A;  4EAA A;  3KWD A;  2OI5 A;  1SST A;  1KK6 A;  2JF3 A;  2W0V A;  1M8N A;  1OCX A;  3FSB A;  3GQA A;  4G3P A;  3BXY A;  3TWD A;  3OH0 A;  2WLF A;  4J09 A;  3BSW A;  3VBJ A;  3EG4 A;  3R5A A;  3R2W A;  4HUR A;  3OTM A;  4M98 A;  3F1X A;  3MQH A;  4M28 A;  3TDT A;  1KRR A;  5L6V A;  3DJ4 A;  4HUS A;  2IC7 A;  5E3P A;  2V0L A;  3OH3 A;  3OH4 A;  3FSC A;  3VNP A;  1MR9 A;  3OU9 A;  4HCQ A;  1FWY A;  4EA8 A;  4G3Q A;  3FSX A;  4AAW A;  3OTZ A;  1S80 A;  2IU8 A;  2W0W A;  2WLG A;  1KHR A;  3VBM A;  2QIV X;  4IHH A;  4AA7 A;  4E6U A;  1Z90 A;  4N6A A;  3R3I A;  1QRF A;  1HV9 A;  3I3A A;  3TK8 A;  1V67 A;  2NPO A;  3FTT A;  2IU9 A;  2V0J A;  3BRK X;  3VBN A;  3TV0 A;  2V0I A;  1J2Z A;  3OH1 A;  2OEF A;  1T3D A;  4EAB A;  1Z2F A;  2FKO A;  4M99 A;  1HM0 A;  1YP4 A;  4EQY A;  5L6S A;  3OGZ A;  1MR7 A;  3BFP A;  4M9C A;  4AC3 A;  1YP3 A;  4KNX A;  3IXC A;  3R5D A;  4M2A A;  1LXA A;  1QRE A;  3GVD A;  4KPZ A;  3FOQ A;  5E3Q A;  3R0S A;  1G95 A;  1KGT A;  4FCE A;  3FWW A;  2GGO A;  3VBK A;  3GQ9 A;  1YP2 A;  2P2O A;  3PMO A;  3R3R A;  3JQY A;  5F42 A;  4EGG A;  3GQ7 A;  4HZC A;  2VHE A;  3MQG A;  3OW5 A;  2V0H A;  3KWC A;  4E1K A;  5ADX V;  2GGQ A;  5U2K A;  4R36 A;  2OI7 A;  3HSQ A;  2Q4J A;  2OI6 A;  3DHO A; 
#chains in the Genus database with same CATH homology
 2JF2 A;  5ADX U;  1QQ0 A;  4J18 A;  4K6R A;  1KK5 A;  2V0K A;  3T57 A;  2ICX A;  1TDT A;  2QIA A;  2WLD A;  4G87 A;  5AFU V;  5DEM A;  4M2B A;  4N69 A;  1HM9 A;  3GOS A;  3VBL A;  3TIS A;  4EA7 A;  1V3W A;  3D8V A;  3R5C A;  2ICY A;  3BSS A;  4DCL A;  3GUE A;  5AFU U;  4H7O A;  2QKX A;  1SSQ A;  3MC4 A;  3SPT A;  4ISX A;  4E79 A;  1QRM A;  4KPX A;  2OEG A;  3R8Y A;  1MRL A;  3P1B A;  4R37 A;  3I3X A;  3EEV A;  3KWE A;  4KQL A;  5DEP A;  1KRU A;  3FS8 A;  2RIJ A;  4N6B A;  1FXJ A;  1SSM A;  1G97 A;  1XHD A;  3DK5 A;  4IHG A;  4E75 A;  3Q1X A;  1QRL A;  2VD4 A;  4N27 A;  2WLC A;  3BSY A;  4HZD A;  3SRT A;  2IUA A;  3V4E A;  3VBP A;  2XAT A;  3R5B A;  4MYO A;  4EA9 A;  1HM8 A;  1KRV A;  3P47 A;  3R1W A;  2TDT A;  3TIO A;  4G3S A;  1QRG A;  3VBI A;  2I5K A;  3HJJ A;  3NZ2 A;  3OUP A;  4R7P A;  4IHF A;  3EH0 A;  1KGQ A;  1KK4 A;  3CJ8 A;  1XAT A;  4E6T A;  5E3R A;  1THJ A;  3FSY A;  3ST8 A;  4MZU A;  5DG3 A;  4KNR A;  3IGJ A;  2AQ9 A;  1KQA A;  3C8V A;  3ECT A;  2WLE A;  3D98 A;  4MFG A;  4EAA A;  3KWD A;  2OI5 A;  1SST A;  1KK6 A;  2JF3 A;  2W0V A;  3FSB A;  1OCX A;  4G3P A;  3TWD A;  3BXY A;  2WLF A;  4J09 A;  3BSW A;  3VBJ A;  3EG4 A;  3R5A A;  3R2W A;  4HUR A;  3OTM A;  4M98 A;  3F1X A;  3MQH A;  4M28 A;  3TDT A;  1KRR A;  5L6V A;  3DJ4 A;  4HUS A;  2IC7 A;  5E3P A;  2V0L A;  3FSC A;  3VNP A;  1MR9 A;  3OU9 A;  4HCQ A;  1FWY A;  4EA8 A;  4G3Q A;  3FSX A;  4AAW A;  3OTZ A;  1S80 A;  2IU8 A;  2W0W A;  2WLG A;  1KHR A;  3VBM A;  2QIV X;  4IHH A;  4AA7 A;  4E6U A;  1Z90 A;  4N6A A;  3R3I A;  1QRF A;  1HV9 A;  3I3A A;  3TK8 A;  1V67 A;  2NPO A;  3FTT A;  2IU9 A;  2V0J A;  3BRK X;  3VBN A;  3TV0 A;  2V0I A;  1J2Z A;  2OEF A;  1T3D A;  4EAB A;  2FKO A;  4M99 A;  1HM0 A;  1YP4 A;  4EQY A;  5L6S A;  1MR7 A;  3BFP A;  4M9C A;  4AC3 A;  1YP3 A;  4KNX A;  3IXC A;  3R5D A;  4M2A A;  1LXA A;  1QRE A;  3GVD A;  4KPZ A;  3FOQ A;  5E3Q A;  3R0S A;  1G95 A;  1KGT A;  4FCE A;  3FWW A;  2GGO A;  3VBK A;  3R3R A;  1YP2 A;  2P2O A;  3PMO A;  3JQY A;  5F42 A;  4EGG A;  4HZC A;  2VHE A;  3MQG A;  3OW5 A;  2V0H A;  3KWC A;  4E1K A;  5ADX V;  2GGQ A;  5U2K A;  4R36 A;  2OI7 A;  3HSQ A;  2Q4J A;  2OI6 A;  3DHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...