3IXCA

Crystal structure of hexapeptide transferase family protein from anaplasma phagocytophilum
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
170
structure length
166
Chain Sequence
MREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hexapeptide transferase family protein from Anaplasma phagocytophilum
rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
molecule keywords Hexapeptide transferase family protein
total genus 68
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3ixcA00
1KGQA 3BXYA 4HUSA 3VBLA 5E3PA 3VBIA 1T3DA 3OUPA 2P2OA 2WLCA 3KWDA 4EAAA 3R5DA 2RIJA 1KRVA 3VBJA 3TDTA 2OI7A 3SPTA 3IGJA 2IUAA 3TISA 1KGTA 1KK4A 3VNPA 3TIOA 5ADXU 3C8VA 2QKXA 4MYOA 3ST8A 2QIAA 3VBNA 4EQYA 1QRMA 2GGOA 3BSWA 3GVDA 3OW5A 4N27A 4E1KA 5E3QA 4EA9A 2VHEA 5DG3A 1SSMA 1G97A 1KK6A 3DK5A 1QQ0A 3FSYA 4AC3A 4ISXA 4E75A 2NPOA 3Q1XA 1KK5A 2IU9A 2OEGA 2JF3A 4J09A 2IU8A 4J18A 1KRRA 3TV0A 2I5KA 4IHGA 1G95A 3BSSA 3R5CA 1SSQA 5L6VA 3FS8A 4G87A 5AFUV 1FWYA 2V0LA 4FCEA 3OTMA 3TWDA 3BRKX 4KPZA 3R1WA 1YP3A 4M28A 4M2BA 4N6AA 4KPXA 4EABA 2WLFA 1HM9A 5AFUU 4HURA 3R5BA 4AAWA 3JQYA 1V3WA 1LXAA 2VD4A 3FTTA 4MZUA 3R3IA 4EA8A 2OEFA 2OI5A 2TDTA 1XHDA 1YP2A 3PMOA 2V0HA 4H7OA 3FOQA 3IXCA 3I3XA 2IC7A 4N69A 4KNXA 4MFGA 4G3QA 3VBMA 5ADXV 5DEMA 5L6SA 3MQGA 1S80A 3EG4A 2W0WA 2AQ9A 4E6TA 1KQAA 1SSTA 3DJ4A 5F42A 1QRFA 2WLDA 4KNRA 3EH0A 3BFPA 1YP4A 2Q4JA 3SRTA 3D8VA 2OI6A 1OCXA 3OU9A 4M99A 3HJJA 1KRUA 3T57A 5DEPA 2FKOA 3FSXA 3BSYA 3HSQA 2ICXA 2WLEA 3GUEA 3VBPA 1HM8A 3FSCA 4E79A 1MRLA 2QIVX 4M98A 4M9CA 1KHRA 1MR9A 1Z90A 3MQHA 4K6RA 3EEVA 3P47A 4IHFA 2ICYA 2WLGA 3FWWA 4HZDA 2V0JA 3R0SA 1HM0A 4R37A 3NZ2A 4N6BA 4M2AA 4E6UA 4HCQA 3OTZA 3I3AA 3R5AA 4EA7A 3GOSA 3TK8A 3FSBA 1QRLA 3R8YA 4DCLA 2V0IA 1QREA 3KWCA 1HV9A 2V0KA 1THJA 1QRGA 1V67A 2JF2A 1MR7A 3CJ8A 3D98A 3P1BA 3KWEA 1XATA 1FXJA 2GGQA 4G3SA 5U2KA 3R3RA 4EGGA 2XATA 3VBKA 3DHOA 4IHHA 4KQLA 3ECTA 1J2ZA 4G3PA 4HZCA 4R7PA 3F1XA 1TDTA 5E3RA 3MC4A 3R2WA 4R36A 4AA7A 3V4EA 2W0VA
chains in the Genus database with same CATH superfamily
1KGQA 3BXYA 4HUSA 3VBLA 5E3PA 3VBIA 1T3DA 3OUPA 2P2OA 2WLCA 3KWDA 4EAAA 3R5DA 2RIJA 1KRVA 3VBJA 3TDTA 2OI7A 3SPTA 3GQ8A 3IGJA 2IUAA 3TISA 1KGTA 1KK4A 3VNPA 3TIOA 5ADXU 3C8VA 2QKXA 4MYOA 3ST8A 2QIAA 3VBNA 4EQYA 1QRMA 2GGOA 3BSWA 3GVDA 3OW5A 4N27A 4E1KA 5E3QA 4EA9A 2VHEA 5DG3A 1SSMA 1G97A 1KK6A 3DK5A 1QQ0A 3FSYA 4AC3A 4ISXA 4E75A 3OH0A 2NPOA 3Q1XA 1KK5A 2IU9A 2OEGA 2JF3A 3OGZA 4J09A 2IU8A 4J18A 1KRRA 3TV0A 2I5KA 4IHGA 1G95A 3BSSA 3R5CA 1SSQA 5L6VA 3FS8A 4G87A 3OH1A 1FWYA 2V0LA 4FCEA 3OTMA 5AFUV 3BRKX 3TWDA 4KPZA 3R1WA 1YP3A 4M28A 4M2BA 4N6AA 4KPXA 4EABA 2WLFA 1HM9A 5AFUU 4HURA 3R5BA 4AAWA 3JQYA 1V3WA 1LXAA 2VD4A 3OH3A 3FTTA 4MZUA 3R3IA 4EA8A 2OEFA 2OI5A 2TDTA 1XHDA 1YP2A 3PMOA 2V0HA 4H7OA 3FOQA 3IXCA 3I3XA 2IC7A 4N69A 4KNXA 4MFGA 4G3QA 3VBMA 5ADXV 5DEMA 5L6SA 3GQAA 3MQGA 3GQ7A 1S80A 3EG4A 3OH2A 2W0WA 2AQ9A 4E6TA 1KQAA 1SSTA 3DJ4A 3GQ9A 1L0SA 5F42A 1QRFA 2WLDA 4KNRA 3EH0A 3BFPA 1YP4A 2Q4JA 3SRTA 3D8VA 2OI6A 1OCXA 3OU9A 4M99A 3HJJA 1KRUA 3T57A 5DEPA 2FKOA 3FSXA 3BSYA 3HSQA 2ICXA 2WLEA 3GUEA 3VBPA 1HM8A 3FSCA 4E79A 1MRLA 2QIVX 4M98A 4M9CA 1KHRA 1MR9A 1Z90A 3MQHA 4K6RA 3EEVA 3P47A 3OH4A 4IHFA 2ICYA 2WLGA 3FWWA 1Z2FA 4HZDA 2V0JA 3R0SA 1HM0A 4R37A 3NZ2A 4N6BA 4M2AA 4E6UA 4HCQA 3OTZA 3I3AA 3SUCA 1M8NA 3R5AA 4EA7A 3GOSA 3TK8A 3FSBA 1QRLA 3R8YA 4DCLA 2V0IA 1QREA 3KWCA 1HV9A 2V0KA 1THJA 1QRGA 1V67A 2JF2A 1MR7A 3CJ8A 3D98A 3P1BA 3KWEA 1XATA 1EWWA 1FXJA 2GGQA 4G3SA 5U2KA 3R3RA 4EGGA 2XATA 3VBKA 3DHOA 4IHHA 4KQLA 3ECTA 1J2ZA 4G3PA 4HZCA 4R7PA 1N4IA 3F1XA 1TDTA 5E3RA 3MC4A 3R2WA 4R36A 4AA7A 3V4EA 2W0VA
chains in the Genus database with same CATH topology
1KGQA 3BXYA 4HUSA 3VBLA 5E3PA 3VBIA 1T3DA 3OUPA 2P2OA 2WLCA 3KWDA 4EAAA 3R5DA 2RIJA 1KRVA 3VBJA 3TDTA 2OI7A 3SPTA 3IGJA 2IUAA 3TISA 1KGTA 1KK4A 3VNPA 3TIOA 5ADXU 3C8VA 2QKXA 4MYOA 3ST8A 2QIAA 3VBNA 4EQYA 1QRMA 2GGOA 3BSWA 3GVDA 3OW5A 4N27A 4E1KA 5E3QA 4EA9A 2VHEA 5DG3A 1SSMA 1G97A 1KK6A 3DK5A 1QQ0A 3FSYA 4AC3A 4ISXA 4E75A 2NPOA 3Q1XA 1KK5A 2IU9A 2OEGA 2JF3A 4J09A 2IU8A 4J18A 1KRRA 3TV0A 2I5KA 4IHGA 1G95A 3BSSA 3R5CA 1SSQA 5L6VA 3FS8A 4G87A 5AFUV 1FWYA 2V0LA 4FCEA 3OTMA 3TWDA 3BRKX 4KPZA 3R1WA 1YP3A 4M28A 4M2BA 4N6AA 4KPXA 4EABA 2WLFA 1HM9A 5AFUU 4HURA 3R5BA 4AAWA 3JQYA 1V3WA 1LXAA 2VD4A 3FTTA 4MZUA 3R3IA 4EA8A 2OEFA 2OI5A 2TDTA 1XHDA 1YP2A 3PMOA 2V0HA 4H7OA 3FOQA 3IXCA 3I3XA 2IC7A 4N69A 4KNXA 4MFGA 4G3QA 3VBMA 5ADXV 5DEMA 5L6SA 3MQGA 1S80A 3EG4A 2W0WA 2AQ9A 4E6TA 1KQAA 1SSTA 3DJ4A 5F42A 1QRFA 2WLDA 4KNRA 3EH0A 3BFPA 1YP4A 2Q4JA 3SRTA 3D8VA 2OI6A 1OCXA 3OU9A 4M99A 3HJJA 1KRUA 3T57A 5DEPA 2FKOA 3FSXA 3BSYA 3HSQA 2ICXA 2WLEA 3GUEA 3VBPA 1HM8A 3FSCA 4E79A 1MRLA 2QIVX 4M98A 4M9CA 1KHRA 1MR9A 1Z90A 3MQHA 4K6RA 3EEVA 3P47A 4IHFA 2ICYA 2WLGA 3FWWA 4HZDA 2V0JA 3R0SA 1HM0A 4R37A 3NZ2A 4N6BA 4M2AA 4E6UA 4HCQA 3OTZA 3I3AA 3R5AA 4EA7A 3GOSA 3TK8A 3FSBA 1QRLA 3R8YA 4DCLA 2V0IA 1QREA 3KWCA 1HV9A 2V0KA 1THJA 1QRGA 1V67A 2JF2A 1MR7A 3CJ8A 3D98A 3P1BA 3KWEA 1XATA 1FXJA 2GGQA 4G3SA 5U2KA 3R3RA 4EGGA 2XATA 3VBKA 3DHOA 4IHHA 4KQLA 3ECTA 1J2ZA 4G3PA 4HZCA 4R7PA 3F1XA 1TDTA 5E3RA 3MC4A 3R2WA 4R36A 4AA7A 3V4EA 2W0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGQ A;  3BXY A;  4HUS A;  3VBL A;  5E3P A;  3VBI A;  1T3D A;  3OUP A;  2P2O A;  2WLC A;  3KWD A;  4EAA A;  3R5D A;  2RIJ A;  1KRV A;  3VBJ A;  3TDT A;  2OI7 A;  3SPT A;  3IGJ A;  2IUA A;  3TIS A;  1KGT A;  1KK4 A;  3VNP A;  3TIO A;  5ADX U;  3C8V A;  2QKX A;  4MYO A;  3ST8 A;  2QIA A;  3VBN A;  4EQY A;  1QRM A;  2GGO A;  3BSW A;  3GVD A;  3OW5 A;  4N27 A;  4E1K A;  5E3Q A;  4EA9 A;  2VHE A;  5DG3 A;  1SSM A;  1G97 A;  1KK6 A;  3DK5 A;  1QQ0 A;  3FSY A;  4AC3 A;  4ISX A;  4E75 A;  2NPO A;  3Q1X A;  1KK5 A;  2IU9 A;  2OEG A;  2JF3 A;  4J09 A;  2IU8 A;  4J18 A;  1KRR A;  3TV0 A;  2I5K A;  4IHG A;  1G95 A;  3BSS A;  3R5C A;  1SSQ A;  5L6V A;  3FS8 A;  4G87 A;  5AFU V;  1FWY A;  2V0L A;  4FCE A;  3OTM A;  3TWD A;  3BRK X;  4KPZ A;  3R1W A;  1YP3 A;  4M28 A;  4M2B A;  4N6A A;  4KPX A;  4EAB A;  2WLF A;  1HM9 A;  5AFU U;  4HUR A;  3R5B A;  4AAW A;  3JQY A;  1V3W A;  1LXA A;  2VD4 A;  3FTT A;  4MZU A;  3R3I A;  4EA8 A;  2OEF A;  2OI5 A;  2TDT A;  1XHD A;  1YP2 A;  3PMO A;  2V0H A;  4H7O A;  3FOQ A;  3IXC A;  3I3X A;  2IC7 A;  4N69 A;  4KNX A;  4MFG A;  4G3Q A;  3VBM A;  5ADX V;  5DEM A;  5L6S A;  3MQG A;  1S80 A;  3EG4 A;  2W0W A;  2AQ9 A;  4E6T A;  1KQA A;  1SST A;  3DJ4 A;  5F42 A;  1QRF A;  2WLD A;  4KNR A;  3EH0 A;  3BFP A;  1YP4 A;  2Q4J A;  3SRT A;  3D8V A;  2OI6 A;  1OCX A;  3OU9 A;  4M99 A;  3HJJ A;  1KRU A;  3T57 A;  5DEP A;  2FKO A;  3FSX A;  3BSY A;  3HSQ A;  2ICX A;  2WLE A;  3GUE A;  3VBP A;  1HM8 A;  3FSC A;  4E79 A;  1MRL A;  2QIV X;  4M98 A;  4M9C A;  1KHR A;  1MR9 A;  1Z90 A;  3MQH A;  4K6R A;  3EEV A;  3P47 A;  4IHF A;  2ICY A;  2WLG A;  3FWW A;  4HZD A;  2V0J A;  3R0S A;  1HM0 A;  4R37 A;  3NZ2 A;  4N6B A;  4M2A A;  4E6U A;  4HCQ A;  3OTZ A;  3I3A A;  3R5A A;  4EA7 A;  3GOS A;  3TK8 A;  3FSB A;  1QRL A;  3R8Y A;  4DCL A;  2V0I A;  1QRE A;  3KWC A;  1HV9 A;  2V0K A;  1THJ A;  1QRG A;  1V67 A;  2JF2 A;  1MR7 A;  3CJ8 A;  3D98 A;  3P1B A;  3KWE A;  1XAT A;  1FXJ A;  2GGQ A;  4G3S A;  5U2K A;  3R3R A;  4EGG A;  2XAT A;  3VBK A;  3DHO A;  4IHH A;  4KQL A;  3ECT A;  1J2Z A;  4G3P A;  4HZC A;  4R7P A;  3F1X A;  1TDT A;  5E3R A;  3MC4 A;  3R2W A;  4R36 A;  4AA7 A;  3V4E A;  2W0V A; 
#chains in the Genus database with same CATH topology
 1KGQ A;  3BXY A;  4HUS A;  3VBL A;  5E3P A;  3VBI A;  1T3D A;  3OUP A;  2P2O A;  2WLC A;  3KWD A;  4EAA A;  3R5D A;  2RIJ A;  1KRV A;  3VBJ A;  3TDT A;  2OI7 A;  3SPT A;  3GQ8 A;  3IGJ A;  2IUA A;  3TIS A;  1KGT A;  1KK4 A;  3VNP A;  3TIO A;  5ADX U;  3C8V A;  2QKX A;  4MYO A;  3ST8 A;  2QIA A;  3VBN A;  4EQY A;  1QRM A;  2GGO A;  3BSW A;  3GVD A;  3OW5 A;  4N27 A;  4E1K A;  5E3Q A;  4EA9 A;  2VHE A;  5DG3 A;  1SSM A;  1G97 A;  1KK6 A;  3DK5 A;  1QQ0 A;  3FSY A;  4AC3 A;  4ISX A;  4E75 A;  3OH0 A;  2NPO A;  3Q1X A;  1KK5 A;  2IU9 A;  2OEG A;  2JF3 A;  3OGZ A;  4J09 A;  2IU8 A;  4J18 A;  1KRR A;  3TV0 A;  2I5K A;  4IHG A;  1G95 A;  3BSS A;  3R5C A;  1SSQ A;  5L6V A;  3FS8 A;  4G87 A;  3OH1 A;  1FWY A;  2V0L A;  4FCE A;  3OTM A;  5AFU V;  3BRK X;  3TWD A;  4KPZ A;  3R1W A;  1YP3 A;  4M28 A;  4M2B A;  4N6A A;  4KPX A;  4EAB A;  2WLF A;  1HM9 A;  5AFU U;  4HUR A;  3R5B A;  4AAW A;  3JQY A;  1V3W A;  1LXA A;  2VD4 A;  3OH3 A;  3FTT A;  4MZU A;  3R3I A;  4EA8 A;  2OEF A;  2OI5 A;  2TDT A;  1XHD A;  1YP2 A;  3PMO A;  2V0H A;  4H7O A;  3FOQ A;  3IXC A;  3I3X A;  2IC7 A;  4N69 A;  4KNX A;  4MFG A;  4G3Q A;  3VBM A;  5ADX V;  5DEM A;  5L6S A;  3GQA A;  3MQG A;  3GQ7 A;  1S80 A;  3EG4 A;  3OH2 A;  2W0W A;  2AQ9 A;  4E6T A;  1KQA A;  1SST A;  3DJ4 A;  3GQ9 A;  1L0S A;  5F42 A;  1QRF A;  2WLD A;  4KNR A;  3EH0 A;  3BFP A;  1YP4 A;  2Q4J A;  3SRT A;  3D8V A;  2OI6 A;  1OCX A;  3OU9 A;  4M99 A;  3HJJ A;  1KRU A;  3T57 A;  5DEP A;  2FKO A;  3FSX A;  3BSY A;  3HSQ A;  2ICX A;  2WLE A;  3GUE A;  3VBP A;  1HM8 A;  3FSC A;  4E79 A;  1MRL A;  2QIV X;  4M98 A;  4M9C A;  1KHR A;  1MR9 A;  1Z90 A;  3MQH A;  4K6R A;  3EEV A;  3P47 A;  3OH4 A;  4IHF A;  2ICY A;  2WLG A;  3FWW A;  1Z2F A;  4HZD A;  2V0J A;  3R0S A;  1HM0 A;  4R37 A;  3NZ2 A;  4N6B A;  4M2A A;  4E6U A;  4HCQ A;  3OTZ A;  3I3A A;  3SUC A;  1M8N A;  3R5A A;  4EA7 A;  3GOS A;  3TK8 A;  3FSB A;  1QRL A;  3R8Y A;  4DCL A;  2V0I A;  1QRE A;  3KWC A;  1HV9 A;  2V0K A;  1THJ A;  1QRG A;  1V67 A;  2JF2 A;  1MR7 A;  3CJ8 A;  3D98 A;  3P1B A;  3KWE A;  1XAT A;  1EWW A;  1FXJ A;  2GGQ A;  4G3S A;  5U2K A;  3R3R A;  4EGG A;  2XAT A;  3VBK A;  3DHO A;  4IHH A;  4KQL A;  3ECT A;  1J2Z A;  4G3P A;  4HZC A;  4R7P A;  1N4I A;  3F1X A;  1TDT A;  5E3R A;  3MC4 A;  3R2W A;  4R36 A;  4AA7 A;  3V4E A;  2W0V A; 
#chains in the Genus database with same CATH homology
 1KGQ A;  3BXY A;  4HUS A;  3VBL A;  5E3P A;  3VBI A;  1T3D A;  3OUP A;  2P2O A;  2WLC A;  3KWD A;  4EAA A;  3R5D A;  2RIJ A;  1KRV A;  3VBJ A;  3TDT A;  2OI7 A;  3SPT A;  3IGJ A;  2IUA A;  3TIS A;  1KGT A;  1KK4 A;  3VNP A;  3TIO A;  5ADX U;  3C8V A;  2QKX A;  4MYO A;  3ST8 A;  2QIA A;  3VBN A;  4EQY A;  1QRM A;  2GGO A;  3BSW A;  3GVD A;  3OW5 A;  4N27 A;  4E1K A;  5E3Q A;  4EA9 A;  2VHE A;  5DG3 A;  1SSM A;  1G97 A;  1KK6 A;  3DK5 A;  1QQ0 A;  3FSY A;  4AC3 A;  4ISX A;  4E75 A;  2NPO A;  3Q1X A;  1KK5 A;  2IU9 A;  2OEG A;  2JF3 A;  4J09 A;  2IU8 A;  4J18 A;  1KRR A;  3TV0 A;  2I5K A;  4IHG A;  1G95 A;  3BSS A;  3R5C A;  1SSQ A;  5L6V A;  3FS8 A;  4G87 A;  5AFU V;  1FWY A;  2V0L A;  4FCE A;  3OTM A;  3TWD A;  3BRK X;  4KPZ A;  3R1W A;  1YP3 A;  4M28 A;  4M2B A;  4N6A A;  4KPX A;  4EAB A;  2WLF A;  1HM9 A;  5AFU U;  4HUR A;  3R5B A;  4AAW A;  3JQY A;  1V3W A;  1LXA A;  2VD4 A;  3FTT A;  4MZU A;  3R3I A;  4EA8 A;  2OEF A;  2OI5 A;  2TDT A;  1XHD A;  1YP2 A;  3PMO A;  2V0H A;  4H7O A;  3FOQ A;  3IXC A;  3I3X A;  2IC7 A;  4N69 A;  4KNX A;  4MFG A;  4G3Q A;  3VBM A;  5ADX V;  5DEM A;  5L6S A;  3MQG A;  1S80 A;  3EG4 A;  2W0W A;  2AQ9 A;  4E6T A;  1KQA A;  1SST A;  3DJ4 A;  5F42 A;  1QRF A;  2WLD A;  4KNR A;  3EH0 A;  3BFP A;  1YP4 A;  2Q4J A;  3SRT A;  3D8V A;  2OI6 A;  1OCX A;  3OU9 A;  4M99 A;  3HJJ A;  1KRU A;  3T57 A;  5DEP A;  2FKO A;  3FSX A;  3BSY A;  3HSQ A;  2ICX A;  2WLE A;  3GUE A;  3VBP A;  1HM8 A;  3FSC A;  4E79 A;  1MRL A;  2QIV X;  4M98 A;  4M9C A;  1KHR A;  1MR9 A;  1Z90 A;  3MQH A;  4K6R A;  3EEV A;  3P47 A;  4IHF A;  2ICY A;  2WLG A;  3FWW A;  4HZD A;  2V0J A;  3R0S A;  1HM0 A;  4R37 A;  3NZ2 A;  4N6B A;  4M2A A;  4E6U A;  4HCQ A;  3OTZ A;  3I3A A;  3R5A A;  4EA7 A;  3GOS A;  3TK8 A;  3FSB A;  1QRL A;  3R8Y A;  4DCL A;  2V0I A;  1QRE A;  3KWC A;  1HV9 A;  2V0K A;  1THJ A;  1QRG A;  1V67 A;  2JF2 A;  1MR7 A;  3CJ8 A;  3D98 A;  3P1B A;  3KWE A;  1XAT A;  1FXJ A;  2GGQ A;  4G3S A;  5U2K A;  3R3R A;  4EGG A;  2XAT A;  3VBK A;  3DHO A;  4IHH A;  4KQL A;  3ECT A;  1J2Z A;  4G3P A;  4HZC A;  4R7P A;  3F1X A;  1TDT A;  5E3R A;  3MC4 A;  3R2W A;  4R36 A;  4AA7 A;  3V4E A;  2W0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...