3IXCA

Crystal structure of hexapeptide transferase family protein from anaplasma phagocytophilum
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
170
structure length
166
Chain Sequence
b'MREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexapeptide transferase family protein
publication title Crystal structure of hexapeptide transferase family protein from Anaplasma phagocytophilum
rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 68
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3ixcA00
3R8YA 4N6AA 3OTMA 3P1BA 3R3RA 1KGTA 2V0LA 5U2KA 1KHRA 3C8VA 2OI5A 3D98A 3VBLA 3FOQA 3R5CA 4R37A 3OTZA 1HM9A 5E3QA 2RIJA 3VBJA 3R2WA 1KK6A 4G3PA 4EA7A 3BRKX 2GGQA 3DHOA 2QIVX 3KWEA 4E75A 1MR9A 4E6UA 2OI7A 3V4EA 1SSQA 4MZUA 2OEFA 3GOSA 3F1XA 5E3PA 3SRTA 3P47A 5AFUU 3FSXA 1YP3A 4EQYA 3PMOA 4FCEA 3R5AA 1T3DA 1LXAA 4ISXA 3EH0A 2WLFA 4HZCA 4G3SA 4KPXA 3TISA 5DG3A 1HV9A 3KWCA 3R5BA 4EA9A 3BXYA 2IC7A 3BFPA 4KPZA 2WLGA 1KK5A 1SSMA 3HSQA 1KK4A 2GGOA 4AA7A 4IHGA 1SSTA 2V0KA 4KNRA 3FSCA 2P2OA 5AFUV 3FWWA 3EEVA 1FWYA 3TK8A 2IU9A 1QRFA 2JF2A 3ECTA 5L6SA 3IGJA 4M98A 1QRGA 3FS8A 4M2BA 1V3WA 2IUAA 2WLDA 5DEMA 4EABA 3VBKA 4MFGA 3DJ4A 3MC4A 1KGQA 4HCQA 2ICYA 5L6VA 2AQ9A 3IXCA 1OCXA 1Z90A 4MYOA 1G97A 1YP4A 1MR7A 3D8VA 3FSBA 3R1WA 2TDTA 1QREA 4HUSA 1KRRA 1QRLA 1THJA 3FTTA 3R5DA 4J18A 3GVDA 3I3XA 3TDTA 1XATA 1J2ZA 5DEPA 4M99A 1S80A 1QQ0A 1QRMA 3FSYA 2ICXA 4EGGA 4J09A 4KQLA 2OI6A 2Q4JA 4N69A 3ST8A 4N6BA 3GUEA 4IHHA 3OUPA 4HURA 4R7PA 5ADXV 2XATA 1G95A 1HM0A 3R0SA 2NPOA 4M2AA 1XHDA 5E3RA 2I5KA 4M9CA 3VBPA 4G3QA 3TIOA 3BSSA 3VBMA 3HJJA 1TDTA 2JF3A 3VBIA 1KRVA 2VHEA 1HM8A 5ADXU 1YP2A 3CJ8A 3BSYA 2VD4A 4N27A 3BSWA 3EG4A 3I3AA 4E6TA 1KRUA 2V0JA 4HZDA 1MRLA 3OW5A 2QIAA 4H7OA 4K6RA 2WLEA 3MQHA 3MQGA 2V0IA 2WLCA 3TWDA 1KQAA 3SPTA 4G87A 4EAAA 5F42A 3Q1XA 4AAWA 4IHFA 2QKXA 2FKOA 2V0HA 2IU8A 2W0VA 3VNPA 4EA8A 3TV0A 4DCLA 1V67A 3VBNA 4M28A 3NZ2A 4AC3A 1FXJA 3T57A 3KWDA 3OU9A 2OEGA 3JQYA 4E79A 2W0WA 4E1KA 3R3IA 4R36A 3DK5A 4KNXA
chains in the Genus database with same CATH superfamily
3R8YA 4N6AA 3OTMA 3P1BA 3R3RA 1KGTA 2V0LA 5U2KA 1KHRA 3C8VA 3GQ8A 3OH2A 2OI5A 3D98A 3VBLA 3FOQA 3R5CA 4R37A 3OTZA 1HM9A 5E3QA 2RIJA 3VBJA 3R2WA 1KK6A 4G3PA 4EA7A 3BRKX 2GGQA 3DHOA 2QIVX 3KWEA 4E75A 1MR9A 4E6UA 2OI7A 3V4EA 1N4IA 1SSQA 4MZUA 2OEFA 3GOSA 3F1XA 5E3PA 3SRTA 3P47A 5AFUU 3FSXA 1YP3A 4EQYA 3PMOA 4FCEA 3R5AA 1LXAA 1T3DA 4ISXA 3EH0A 2WLFA 3OH4A 4HZCA 4G3SA 4KPXA 3TISA 5DG3A 1HV9A 3KWCA 3R5BA 4EA9A 3BXYA 2IC7A 3BFPA 4KPZA 2WLGA 1EWWA 1Z2FA 1KK5A 1SSMA 3HSQA 1KK4A 2GGOA 4AA7A 4IHGA 1SSTA 2V0KA 4KNRA 3FSCA 2P2OA 5AFUV 3FWWA 3EEVA 1FWYA 3TK8A 2IU9A 1QRFA 2JF2A 3ECTA 3OH3A 5L6SA 3IGJA 4M98A 1QRGA 3FS8A 4M2BA 1V3WA 2IUAA 2WLDA 5DEMA 4EABA 3VBKA 4MFGA 3DJ4A 3MC4A 1KGQA 4HCQA 3OH0A 2ICYA 5L6VA 2AQ9A 3IXCA 1OCXA 1Z90A 4MYOA 1L0SA 3GQ9A 1G97A 1YP4A 1MR7A 3D8VA 3FSBA 3R1WA 2TDTA 1QREA 4HUSA 1KRRA 1QRLA 1THJA 3FTTA 3R5DA 4J18A 3GVDA 3I3XA 3TDTA 1XATA 1J2ZA 5DEPA 4M99A 1S80A 1QQ0A 1QRMA 3FSYA 2ICXA 3SUCA 4EGGA 4J09A 4KQLA 2OI6A 2Q4JA 3OH1A 4N69A 4N6BA 3ST8A 3GUEA 3OGZA 3OUPA 4HURA 4IHHA 4R7PA 5ADXV 2XATA 1G95A 1HM0A 3R0SA 2NPOA 4M2AA 1XHDA 5E3RA 2I5KA 4M9CA 3VBPA 4G3QA 3TIOA 3BSSA 3VBMA 3GQ7A 1TDTA 3HJJA 2JF3A 3VBIA 1KRVA 2VHEA 1HM8A 5ADXU 1YP2A 3CJ8A 3BSYA 2VD4A 4N27A 3BSWA 3EG4A 3I3AA 4E6TA 1KRUA 2V0JA 4HZDA 1MRLA 3OW5A 2QIAA 4H7OA 4K6RA 2WLEA 3MQHA 3MQGA 3GQAA 2V0IA 2WLCA 3TWDA 1KQAA 3SPTA 4G87A 4EAAA 5F42A 3Q1XA 4AAWA 4IHFA 1M8NA 2QKXA 2FKOA 2V0HA 2IU8A 2W0VA 3VNPA 4EA8A 3TV0A 4DCLA 1V67A 3VBNA 4M28A 3NZ2A 4AC3A 1FXJA 3T57A 3KWDA 3OU9A 2OEGA 3JQYA 4E79A 2W0WA 4E1KA 3R3IA 4R36A 3DK5A 4KNXA
chains in the Genus database with same CATH topology
3R8YA 4N6AA 3OTMA 3P1BA 3R3RA 1KGTA 2V0LA 5U2KA 1KHRA 3C8VA 2OI5A 3D98A 3VBLA 3FOQA 3R5CA 4R37A 3OTZA 1HM9A 5E3QA 2RIJA 3VBJA 3R2WA 1KK6A 4G3PA 4EA7A 3BRKX 2GGQA 3DHOA 2QIVX 3KWEA 4E75A 1MR9A 4E6UA 2OI7A 3V4EA 1SSQA 4MZUA 2OEFA 3GOSA 3F1XA 5E3PA 3SRTA 3P47A 5AFUU 3FSXA 1YP3A 4EQYA 3PMOA 4FCEA 3R5AA 1T3DA 1LXAA 4ISXA 3EH0A 2WLFA 4HZCA 4G3SA 4KPXA 3TISA 5DG3A 1HV9A 3KWCA 3R5BA 4EA9A 3BXYA 2IC7A 3BFPA 4KPZA 2WLGA 1KK5A 1SSMA 3HSQA 1KK4A 2GGOA 4AA7A 4IHGA 1SSTA 2V0KA 4KNRA 3FSCA 2P2OA 5AFUV 3FWWA 3EEVA 1FWYA 3TK8A 2IU9A 1QRFA 2JF2A 3ECTA 5L6SA 3IGJA 4M98A 1QRGA 3FS8A 4M2BA 1V3WA 2IUAA 2WLDA 5DEMA 4EABA 3VBKA 4MFGA 3DJ4A 3MC4A 1KGQA 4HCQA 2ICYA 5L6VA 2AQ9A 3IXCA 1OCXA 1Z90A 4MYOA 1G97A 1YP4A 1MR7A 3D8VA 3FSBA 3R1WA 2TDTA 1QREA 4HUSA 1KRRA 1QRLA 1THJA 3FTTA 3R5DA 4J18A 3GVDA 3I3XA 3TDTA 1XATA 1J2ZA 5DEPA 4M99A 1S80A 1QQ0A 1QRMA 3FSYA 2ICXA 4EGGA 4J09A 4KQLA 2OI6A 2Q4JA 4N69A 3ST8A 4N6BA 3GUEA 4IHHA 3OUPA 4HURA 4R7PA 5ADXV 2XATA 1G95A 1HM0A 3R0SA 2NPOA 4M2AA 1XHDA 5E3RA 2I5KA 4M9CA 3VBPA 4G3QA 3TIOA 3BSSA 3VBMA 3HJJA 1TDTA 2JF3A 3VBIA 1KRVA 2VHEA 1HM8A 5ADXU 1YP2A 3CJ8A 3BSYA 2VD4A 4N27A 3BSWA 3EG4A 3I3AA 4E6TA 1KRUA 2V0JA 4HZDA 1MRLA 3OW5A 2QIAA 4H7OA 4K6RA 2WLEA 3MQHA 3MQGA 2V0IA 2WLCA 3TWDA 1KQAA 3SPTA 4G87A 4EAAA 5F42A 3Q1XA 4AAWA 4IHFA 2QKXA 2FKOA 2V0HA 2IU8A 2W0VA 3VNPA 4EA8A 3TV0A 4DCLA 1V67A 3VBNA 4M28A 3NZ2A 4AC3A 1FXJA 3T57A 3KWDA 3OU9A 2OEGA 3JQYA 4E79A 2W0WA 4E1KA 3R3IA 4R36A 3DK5A 4KNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R8Y A;  4N6A A;  3OTM A;  3P1B A;  3R3R A;  1KGT A;  2V0L A;  5U2K A;  1KHR A;  3C8V A;  2OI5 A;  3D98 A;  3VBL A;  3FOQ A;  3R5C A;  4R37 A;  3OTZ A;  1HM9 A;  5E3Q A;  2RIJ A;  3VBJ A;  3R2W A;  1KK6 A;  4G3P A;  4EA7 A;  3BRK X;  2GGQ A;  3DHO A;  2QIV X;  3KWE A;  4E75 A;  1MR9 A;  4E6U A;  2OI7 A;  3V4E A;  1SSQ A;  4MZU A;  2OEF A;  3GOS A;  3F1X A;  5E3P A;  3SRT A;  3P47 A;  5AFU U;  3FSX A;  1YP3 A;  4EQY A;  3PMO A;  4FCE A;  3R5A A;  1T3D A;  1LXA A;  4ISX A;  3EH0 A;  2WLF A;  4HZC A;  4G3S A;  4KPX A;  3TIS A;  5DG3 A;  1HV9 A;  3KWC A;  3R5B A;  4EA9 A;  3BXY A;  2IC7 A;  3BFP A;  4KPZ A;  2WLG A;  1KK5 A;  1SSM A;  3HSQ A;  1KK4 A;  2GGO A;  4AA7 A;  4IHG A;  1SST A;  2V0K A;  4KNR A;  3FSC A;  2P2O A;  5AFU V;  3FWW A;  3EEV A;  1FWY A;  3TK8 A;  2IU9 A;  1QRF A;  2JF2 A;  3ECT A;  5L6S A;  3IGJ A;  4M98 A;  1QRG A;  3FS8 A;  4M2B A;  1V3W A;  2IUA A;  2WLD A;  5DEM A;  4EAB A;  3VBK A;  4MFG A;  3DJ4 A;  3MC4 A;  1KGQ A;  4HCQ A;  2ICY A;  5L6V A;  2AQ9 A;  3IXC A;  1OCX A;  1Z90 A;  4MYO A;  1G97 A;  1YP4 A;  1MR7 A;  3D8V A;  3FSB A;  3R1W A;  2TDT A;  1QRE A;  4HUS A;  1KRR A;  1QRL A;  1THJ A;  3FTT A;  3R5D A;  4J18 A;  3GVD A;  3I3X A;  3TDT A;  1XAT A;  1J2Z A;  5DEP A;  4M99 A;  1S80 A;  1QQ0 A;  1QRM A;  3FSY A;  2ICX A;  4EGG A;  4J09 A;  4KQL A;  2OI6 A;  2Q4J A;  4N69 A;  3ST8 A;  4N6B A;  3GUE A;  4IHH A;  3OUP A;  4HUR A;  4R7P A;  5ADX V;  2XAT A;  1G95 A;  1HM0 A;  3R0S A;  2NPO A;  4M2A A;  1XHD A;  5E3R A;  2I5K A;  4M9C A;  3VBP A;  4G3Q A;  3TIO A;  3BSS A;  3VBM A;  3HJJ A;  1TDT A;  2JF3 A;  3VBI A;  1KRV A;  2VHE A;  1HM8 A;  5ADX U;  1YP2 A;  3CJ8 A;  3BSY A;  2VD4 A;  4N27 A;  3BSW A;  3EG4 A;  3I3A A;  4E6T A;  1KRU A;  2V0J A;  4HZD A;  1MRL A;  3OW5 A;  2QIA A;  4H7O A;  4K6R A;  2WLE A;  3MQH A;  3MQG A;  2V0I A;  2WLC A;  3TWD A;  1KQA A;  3SPT A;  4G87 A;  4EAA A;  5F42 A;  3Q1X A;  4AAW A;  4IHF A;  2QKX A;  2FKO A;  2V0H A;  2IU8 A;  2W0V A;  3VNP A;  4EA8 A;  3TV0 A;  4DCL A;  1V67 A;  3VBN A;  4M28 A;  3NZ2 A;  4AC3 A;  1FXJ A;  3T57 A;  3KWD A;  3OU9 A;  2OEG A;  3JQY A;  4E79 A;  2W0W A;  4E1K A;  3R3I A;  4R36 A;  3DK5 A;  4KNX A; 
#chains in the Genus database with same CATH topology
 3R8Y A;  4N6A A;  3OTM A;  3P1B A;  3R3R A;  1KGT A;  2V0L A;  5U2K A;  1KHR A;  3C8V A;  3GQ8 A;  3OH2 A;  2OI5 A;  3D98 A;  3VBL A;  3FOQ A;  3R5C A;  4R37 A;  3OTZ A;  1HM9 A;  5E3Q A;  2RIJ A;  3VBJ A;  3R2W A;  1KK6 A;  4G3P A;  4EA7 A;  3BRK X;  2GGQ A;  3DHO A;  2QIV X;  3KWE A;  4E75 A;  1MR9 A;  4E6U A;  2OI7 A;  3V4E A;  1N4I A;  1SSQ A;  4MZU A;  2OEF A;  3GOS A;  3F1X A;  5E3P A;  3SRT A;  3P47 A;  5AFU U;  3FSX A;  1YP3 A;  4EQY A;  3PMO A;  4FCE A;  3R5A A;  1LXA A;  1T3D A;  4ISX A;  3EH0 A;  2WLF A;  3OH4 A;  4HZC A;  4G3S A;  4KPX A;  3TIS A;  5DG3 A;  1HV9 A;  3KWC A;  3R5B A;  4EA9 A;  3BXY A;  2IC7 A;  3BFP A;  4KPZ A;  2WLG A;  1EWW A;  1Z2F A;  1KK5 A;  1SSM A;  3HSQ A;  1KK4 A;  2GGO A;  4AA7 A;  4IHG A;  1SST A;  2V0K A;  4KNR A;  3FSC A;  2P2O A;  5AFU V;  3FWW A;  3EEV A;  1FWY A;  3TK8 A;  2IU9 A;  1QRF A;  2JF2 A;  3ECT A;  3OH3 A;  5L6S A;  3IGJ A;  4M98 A;  1QRG A;  3FS8 A;  4M2B A;  1V3W A;  2IUA A;  2WLD A;  5DEM A;  4EAB A;  3VBK A;  4MFG A;  3DJ4 A;  3MC4 A;  1KGQ A;  4HCQ A;  3OH0 A;  2ICY A;  5L6V A;  2AQ9 A;  3IXC A;  1OCX A;  1Z90 A;  4MYO A;  1L0S A;  3GQ9 A;  1G97 A;  1YP4 A;  1MR7 A;  3D8V A;  3FSB A;  3R1W A;  2TDT A;  1QRE A;  4HUS A;  1KRR A;  1QRL A;  1THJ A;  3FTT A;  3R5D A;  4J18 A;  3GVD A;  3I3X A;  3TDT A;  1XAT A;  1J2Z A;  5DEP A;  4M99 A;  1S80 A;  1QQ0 A;  1QRM A;  3FSY A;  2ICX A;  3SUC A;  4EGG A;  4J09 A;  4KQL A;  2OI6 A;  2Q4J A;  3OH1 A;  4N69 A;  4N6B A;  3ST8 A;  3GUE A;  3OGZ A;  3OUP A;  4HUR A;  4IHH A;  4R7P A;  5ADX V;  2XAT A;  1G95 A;  1HM0 A;  3R0S A;  2NPO A;  4M2A A;  1XHD A;  5E3R A;  2I5K A;  4M9C A;  3VBP A;  4G3Q A;  3TIO A;  3BSS A;  3VBM A;  3GQ7 A;  1TDT A;  3HJJ A;  2JF3 A;  3VBI A;  1KRV A;  2VHE A;  1HM8 A;  5ADX U;  1YP2 A;  3CJ8 A;  3BSY A;  2VD4 A;  4N27 A;  3BSW A;  3EG4 A;  3I3A A;  4E6T A;  1KRU A;  2V0J A;  4HZD A;  1MRL A;  3OW5 A;  2QIA A;  4H7O A;  4K6R A;  2WLE A;  3MQH A;  3MQG A;  3GQA A;  2V0I A;  2WLC A;  3TWD A;  1KQA A;  3SPT A;  4G87 A;  4EAA A;  5F42 A;  3Q1X A;  4AAW A;  4IHF A;  1M8N A;  2QKX A;  2FKO A;  2V0H A;  2IU8 A;  2W0V A;  3VNP A;  4EA8 A;  3TV0 A;  4DCL A;  1V67 A;  3VBN A;  4M28 A;  3NZ2 A;  4AC3 A;  1FXJ A;  3T57 A;  3KWD A;  3OU9 A;  2OEG A;  3JQY A;  4E79 A;  2W0W A;  4E1K A;  3R3I A;  4R36 A;  3DK5 A;  4KNX A; 
#chains in the Genus database with same CATH homology
 3R8Y A;  4N6A A;  3OTM A;  3P1B A;  3R3R A;  1KGT A;  2V0L A;  5U2K A;  1KHR A;  3C8V A;  2OI5 A;  3D98 A;  3VBL A;  3FOQ A;  3R5C A;  4R37 A;  3OTZ A;  1HM9 A;  5E3Q A;  2RIJ A;  3VBJ A;  3R2W A;  1KK6 A;  4G3P A;  4EA7 A;  3BRK X;  2GGQ A;  3DHO A;  2QIV X;  3KWE A;  4E75 A;  1MR9 A;  4E6U A;  2OI7 A;  3V4E A;  1SSQ A;  4MZU A;  2OEF A;  3GOS A;  3F1X A;  5E3P A;  3SRT A;  3P47 A;  5AFU U;  3FSX A;  1YP3 A;  4EQY A;  3PMO A;  4FCE A;  3R5A A;  1T3D A;  1LXA A;  4ISX A;  3EH0 A;  2WLF A;  4HZC A;  4G3S A;  4KPX A;  3TIS A;  5DG3 A;  1HV9 A;  3KWC A;  3R5B A;  4EA9 A;  3BXY A;  2IC7 A;  3BFP A;  4KPZ A;  2WLG A;  1KK5 A;  1SSM A;  3HSQ A;  1KK4 A;  2GGO A;  4AA7 A;  4IHG A;  1SST A;  2V0K A;  4KNR A;  3FSC A;  2P2O A;  5AFU V;  3FWW A;  3EEV A;  1FWY A;  3TK8 A;  2IU9 A;  1QRF A;  2JF2 A;  3ECT A;  5L6S A;  3IGJ A;  4M98 A;  1QRG A;  3FS8 A;  4M2B A;  1V3W A;  2IUA A;  2WLD A;  5DEM A;  4EAB A;  3VBK A;  4MFG A;  3DJ4 A;  3MC4 A;  1KGQ A;  4HCQ A;  2ICY A;  5L6V A;  2AQ9 A;  3IXC A;  1OCX A;  1Z90 A;  4MYO A;  1G97 A;  1YP4 A;  1MR7 A;  3D8V A;  3FSB A;  3R1W A;  2TDT A;  1QRE A;  4HUS A;  1KRR A;  1QRL A;  1THJ A;  3FTT A;  3R5D A;  4J18 A;  3GVD A;  3I3X A;  3TDT A;  1XAT A;  1J2Z A;  5DEP A;  4M99 A;  1S80 A;  1QQ0 A;  1QRM A;  3FSY A;  2ICX A;  4EGG A;  4J09 A;  4KQL A;  2OI6 A;  2Q4J A;  4N69 A;  3ST8 A;  4N6B A;  3GUE A;  4IHH A;  3OUP A;  4HUR A;  4R7P A;  5ADX V;  2XAT A;  1G95 A;  1HM0 A;  3R0S A;  2NPO A;  4M2A A;  1XHD A;  5E3R A;  2I5K A;  4M9C A;  3VBP A;  4G3Q A;  3TIO A;  3BSS A;  3VBM A;  3HJJ A;  1TDT A;  2JF3 A;  3VBI A;  1KRV A;  2VHE A;  1HM8 A;  5ADX U;  1YP2 A;  3CJ8 A;  3BSY A;  2VD4 A;  4N27 A;  3BSW A;  3EG4 A;  3I3A A;  4E6T A;  1KRU A;  2V0J A;  4HZD A;  1MRL A;  3OW5 A;  2QIA A;  4H7O A;  4K6R A;  2WLE A;  3MQH A;  3MQG A;  2V0I A;  2WLC A;  3TWD A;  1KQA A;  3SPT A;  4G87 A;  4EAA A;  5F42 A;  3Q1X A;  4AAW A;  4IHF A;  2QKX A;  2FKO A;  2V0H A;  2IU8 A;  2W0V A;  3VNP A;  4EA8 A;  3TV0 A;  4DCL A;  1V67 A;  3VBN A;  4M28 A;  3NZ2 A;  4AC3 A;  1FXJ A;  3T57 A;  3KWD A;  3OU9 A;  2OEG A;  3JQY A;  4E79 A;  2W0W A;  4E1K A;  3R3I A;  4R36 A;  3DK5 A;  4KNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...