3IXSA

Ring1b c-terminal domain/rybp c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
b'ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPMELYYAPTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RING2
publication title Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 111
sequence length 111
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.430 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ixsA00
3IXSA 3GS2A 3H8HA
chains in the Genus database with same CATH superfamily
2KC2A 1FCLA 3TEZA 2ZEQA 4RF1A 2UYZB 2JQRB 5J17A 1MG8A 3NVZA 1TS3A 3RNFC 1D5XC 2INCC 5BO4B 3FILB 3U7DA 4JWUC 2JPHA 1DYQA 2KFJA 4YSZB 3DVGY 1WRDB 2N9EB 3JW0X 1I4QA 1WZ3A 3RNAC 5JXVA 1JROA 1LM8B 1XO3A 1MI0A 4KKIA 1S3SG 2IGDA 3ZO5B 2N4FA 1WE6A 1J0GA 1ZDVA 1BUIC 3BYYB 5EE0A 2KJ6A 2CU3A 1QOFA 2KLGA 3TSSA 4MH0E 4C7ZA 1VZ8A 1WWTA 5AZFA 1HA5A 4KX6B 1UWMA 2VZKB 3EC8A 3LB8C 2KO3A 2KJHB 3Q8BA 4FHKA 3AEFB 3KVFB 1TBEA 1RFAA 3ML9A 2IZVB 1FO4A 2L05A 1LGRA 4FJVB 3QCAA 3V61A 1E8WA 3Q14C 1WH3A 3B2FA 1WJ6A 3I63C 2AQ3B 5FR6A 2PKOA 4GDLA 2J53A 2MH7A 2WP9B 2M0XA 2PLPA 3D32A 3VRAB 1IGDA 4LLGM 4YT0B 4RGMA 3W2DA 3L17A 1TKYA 4LNNA 5AEKB 2V9HA 4BZAA 5J2RA 2G4DB 1RM6C 2AYOB 4N6EB 1T5XD 3LYYA 1WR1A 4NJCA 1J19A 1K53A 3IAS1 4ZRQA 3HRDD 2INPE 1P7FA 2IGHA 4GDKB 4N58A 4HWIB 1V8CA 2WDVB 2RD0A 4HCNB 2GRIA 1K51A 1WGDA 2V0GA 2DNFA 3IFWB 1WXAA 3BIID 3WANA 4AS1A 4HROA 2JT4B 5JHAA 2KHWB 1UELA 3Q3NC 2O6VB 3R66C 2H89B 1HEZE 2WYQA 2M56B 3RMKC 3V05A 4HXDA 3SFDB 3VH3B 3PLVA 3DBRI 1I4XA 2QILA 3KUCB 2LWPA 3HHMA 1JWAD 1FIQA 2KVZA 3MC9A 4IM3A 1DOYA 3NZSA 1EF1A 3L54A 3DBRB 1CJEA 4W9KA 4B0EA 2E6XA 2GLSA 1FPYA 3LJ3A 3AECB 4P1BC 1OFFA 1WJ4A 1SGHA 1HZ6A 2KOXA 1AW7A 1EF5A 3ZXRA 2LMCA 1PGAA 4FADA 1XXGA 3RYTA 2D3CA 3AE7B 5C23A 3DQVA 4BKSD 1JMLA 4X57B 1C1YB 3VUYA 4BOSC 1DGJA 1AYFA 3QHTA 1GUAB 1XD3B 4ZRIA 1JRUA 3I5JC 4PT5A 4WWPA 2IO1B 2WHIA 3E9SA 1UBQA 2AX5A 1TYGB 3NOBA 1L0VB 1M94A 4NAWB 1WGRA 2O2VB 4OZBA 1R4NI 1K8RB 1KF6B 2Z8LA 4GU2A 1XEEA 2IGGA 3AV8A 1V1OA 2PPHA 1TT5B 3ZJVA 4DHJD 4TQ1A 1IUEA 1R4NB 1VZ6A 3A9KA 3KUZA 3AE2B 2L52A 4GDKA 2RDHA 4KDIC 2K5PA 4K1RB 3ML8A 4WH4A 3DOWA 4PS3A 2HJ8A 3ETRA 1RAXA 2DLBA 5AUKA 3ENEA 3PSEB 2LGIA 3QARA 4J6IA 1FXTB 1C77A 4HDOA 1N61A 5BYRA 2RDBC 4WWNA 4GB9A 2BQQA 2X38A 4KSKC 2O6VA 2FCSA 3UIPB 4K81A 5BMIA 2YEPB 5D7GA 1KLGD 3LDZE 2D2QA 1N5XA 2G1EA 3C0RB 3PZDA 4JQWC 3U2SC 3DBLI 1F77A 2W54A 2D11A 3NY5A 1RFKA 1LO5D 2MJDA 1XLOA 2LI5A 2M4NA 3JSVA 1KLUD 2MP2B 2OJWA 4L1BA 4YSXB 2KLCA 1B1ZA 1RRBA 2PVGC 1UUPA 4KVGB 3DBLB 2Z0DB 1F52A 2VZKD 4ANWA 2ZNVB 1TY2A 3BK1A 3VFKA 2DYBA 3W9CB 2L3ZA 3IHPC 5D94A 3PREA 2Y5CA 4I6NB 2QCZA 3QJZA 2YEPF 4MJSB 2LJ5A 1PQSA 2BS2B 5LLIA 1AN8A 1PGBA 3JYUA 2B76B 3PZ8A 1D3ZA 2K8HA 1V1PB 2ZZPB 2WLBA 3I3TB 3MC0B 3ECIA 3P4QB 4H2AA 3QA8A 4ZRKA 4BBNF 4A8XC 2JRIB 5EDSA 4NAWA 3PPAA 2O2VA 2KFKB 2FUG1 1X1MA 4IM2A 1T0QC 1TGZB 2IY0B 4HJGE 3VRBB 1I7HA 3Q3JA 5CX3A 3RZFA 2K0PA 2C5LC 1XLNA 3PS6A 3MC8A 1ZPSA 3ZJTA 2OJRA 4EOYA 1Z5SB 1IPGA 1MVKA 2MBOA 2Z0EB 1E8XA 3W5UB 4OZCA 3QQ8B 4ZRPA 2I2YA 4GIVA 1E5WA 3C8YA 3IT4B 2W3RA 2LGYA 2AQ1B 1SB3C 1P1AA 1P98A 3M63B 4K7WA 1L6VA 4WIPA 3C19A 3OG5A 2WXGA 3U7ZA 3VR9B 3MJWA 4IKGA 1R4MB 2BKRB 2NVUI 3HUIA 4ICVA 1FRDA 2N1WA 3HVZA 1OTRB 4N9F4 2KMMA 1FFVA 2CS4A 1E7PB 1UZXB 4IW0A 5TSSA 2XEWA 2BB6A 3H1UA 3CSTA 1L5PA 2MP2A 4FULA 4WWOA 4RF0A 3ZNID 4US8A 2BVCA 3JVZX 2GB1A 3GZNI 1SE9A 2BT6A 2DZJA 1ET6A 2XN9C 2LRUA 3VR8B 1G6JA 2JUOA 1YN5A 2FE8A 2PEAA 4KZCA 4NNJB 4FN2A 2EKEC 2JU6X 3PRPB 3GZNB 5HKHA 1IBXA 1YN3A 1GAQB 2FCNA 1GPXA 3DHGC 4ZHPA 2LASA 4YTMB 2M17A 1ZKHA 2ZW0A 4F1SA 1D5MC 1I4RA 4FA6A 2NBWB 3ZW3A 3X23A 4MEMA 3BK2A 5HI1A 2D07B 3N9YC 2WXQA 3IT6B 5G5GA 1ISNA 4BBNC 4HVBA 4WWMA 4ITKA 2D3GA 3RULA 2KQ7A 4I6LB 3BWUD 2KACA 1TY0A 1YQ3B 2ZNVC 1E8YA 5C3JB 1WSPA 3Q3FA 4G0NB 5EE1A 3R7QA 2CHWA 2C60A 2ZVNA 3VUWA 1B9RA 4MACA 1L0YB 2N7JA 1NEKB 1PDXA 4LNOA 3DVGX 1T3QA 4C4VA 5AUIA 1BXTA 3ZTDA 3H7PB 2MCNB 1V5TA 2E3TA 3B2GA 1S1QB 3A1QA 3L08A 3SEBA 2FBWB 3AE4B 3P63A 2L0TA 2N7EA 2BKFA 1E6EB 2HTHA 1ZDXA 2TSSA 1ZE3D 3GE8C 4HCPB 3Q6BA 1UNSA 3AEAB 2X8XX 4BKTA 3TUOA 2WS3B 4MT5A 1WR6E 1FRRA 2WGSA 1WM3A 1L4ZB 4A6QA 2GMIC 2BYVE 2LUMA 2LRWA 3KQ4A 1STEA 2IBIB 4ZOHC 4DK5A 2VRRB 2M8SA 4ICUA 3AU5A 4HDQA 1T0RC 1XCTL 1LXDA 5JZEB 2JZZA 2C7NB 3QAQA 3WIMA 3MHZA 4DWFA 2L00B 1FM0D 2LEKA 3AXCA 3VTUA 3AEBB 5BMGA 2K6DB 1AWDA 1WMHA 4HEA1 3WAMA 4B6WA 1F0ZA 3RPFC 2IPKD 4IUMB 1WGKA 5AZGA 3AE5B 2KTFA 2KQ4X 4WAFA 2RPQA 5IAAC 3AE3B 3TIXA 2GBKA 2K25A 3B08A 2JZ3B 2KYWA 2ZCBA 2PE9A 3SFEB 1C78A 2L8JA 4A3OA 4CQNA 1WIAA 2M1MA 4GXBA 1YX6B 3KWVA 1C4PA 2I38A 2PW9A 4IOIE 3QX1A 1FEHA 3A9KB 4KSLC 3IAM1 1FCCC 4ZDVA 1MPEA 1BT0A 1WX9A 3I9V1 1ACCA 2Y5BB 3AMZA 3GE3C 3NS8A 2CHZA 3BVMA 1F1HA 1JRPA 1ROEA 4W9EA 1MJDA 2V3SA 4DQOC 4M01A 1SBBB 1CK1A 4IDIA 4PYZA 3H7PA 2JVCA 3RD2A 2JWZA 4RGOS 3AB5A 2H88B 2N9KA 4NJ6A 1C3TA 4B9KA 2CKHB 2KDFB 1GOZA 1QT9A 4O1NA 3ZDMC 5I4DA 3SHQA 2FIDA 3A9JA 1NI3A 3AN1A 3ZJUA 3ZYYX 4BOZB 1Q1OA 1F2RI 2SEBD 4US9A 3ZRFA 2DYOA 4HKZE 4EFOA 3NRZA 1N60A 2JY6A 1WGYA 1LQBA 4KIKB 5E6NA 3JSVB 4GOCA 1LFDA 4IM0A 1ZOYB 2OHFA 2NS5A 4YL8A 3RNEC 4JIOU 3UI3A 4WJPA 5H92C 1SIJA 2XNAC 4URKA 4K7UA 4E3CA 4FBJB 3ZTCA 4FLHA 2WXJA 2ZW1A 3SU8X 1QF6A 3Q3MC 3AULA 4L23A 3IVFA 3CSFA 3NZ3A 4LNIA 2MBBB 4GSWA 4M02A 1ZGUB 4P16A 1OQYA 3BYTB 2KTRB 1ZW7A 4YSYB 3L13A 2K8BA 4YTNB 2JYTA 1FNUA 3U4EG 4WJQA 2J0KA 1SF0A 2CHXA 4MH8A 4MM3A 1N63A 1ESFA 1I4GA 5IKCM 1YJJA 2MWSB 2D3BA 2DZIA 4B95A 2HDEA 1PUTA 3NVYA 1GB1A 2BB5A 1YX5B 1UBIA 4RFBA 4JPSA 2ZJDA 2WXIA 4MGIE 4NZLB 4DXFA 3KLSX 1WZ0A 1FFUA 2RMMA 3P4SB 3RI7C 4A3PA 3Q8FA 1MFWA 3UINB 3ZNHB 3NG0A 1YN4A 3R8BA 1V80A 2LVPA 1XF5L 2UWQA 5L83A 2R2OA 1ZUD2 1GNUA 4BVUC 3PGEA 1EUVB 1T6BX 1PFDA 1ET9A 4LK0M 3L10B 2GBRA 1FMAD 4Q2JA 1V97A 3BVGA 5LXHA 1D4BA 2J4XA 1VDVA 2QC8A 3VH4B 2LHDA 1VLBA 3UQAA 3ZGZA 5IOIA 4RM8A 4AJWA 3N32A 2NR2A 1KJTA 4UDUC 1WJUA 3V6CB 5GMVA 3V62A 4W9CA 1YMHE 2J52A 1I35A 5CHFA 3DCGA 4MELA 4EUTA 1V5OA 2PMVA 4CYEA 1YD8U 2LZ6A 1GJZA 2LFIA 4EEWA 2KMCA 2Y3AA 2JX5A 4XWTA 4KIKA 4RGTA 5DPTA 3S2AA 3DVNV 2M19A 1WGGA 1E7VA 3ZNZB 4LJOB 4NQKE 3PHXB 1KM7A 3L4PA 4WAAA 2LXAA 3ALBA 4RM9A 1N5WA 1EWYC 1XLPA 2DYMA 2GOWA 4W9LA 2K6QA 5E6OA 4S0RA 1UD7A 4G50A 2HD5B 2HTME 3ZXVA 3PHWB 5IP4D 3TEXA 1VD2A 4K7SA 1HTOA 4RMAA 3EFUA 1R7SA 1IBXB 2D3AA 3GB1A 5FR3A 1NYQA 1J7AA 2KTRA 1E90A 2DZMA 2MX2A 4NPNA 2G3QB 1WYGA 1L0XB 5G55A 4L2YA 4PK1A 3NHEB 3Q69A 2MA9B 2WDTB 1V81A 2FCQA 2CU1A 2WXFA 1L6UA 1QILA 4MGZE 3X0WA 5GXGB 2GBMA 1H8CA 2MW5A 4DHZB 2L7RA 3VTWA 5MPOA 3WAPA 1F2RC 2XBBC 3ZUNA 3IXSA 1V49A 1RLFA 2IY1B 5L95C 2WXNA 1WGHA 2DHZA 1WE7A 3VXWA 2RR9A 2G45B 4WURA 1ZP0B 4XYCA 1NBFC 2MJEA 1J7BA 3M62B 3NJTA 2YLMA 4HJKA 1K50A 3KYCD 3GS2A 4M0WB 4C4VB 3P2BA 4GLSC 4MDKE 1D6EC 2JSVX 4XX5A 3B9JA 3A1QB 2O6VD 1Q10A 1WX7A 4LNKA 1V9JA 1XT9B 2KC1A 2LD9A 2PVOD 1SIFA 4DBGA 2LJIA 3Q8AA 4WJOA 3MJ5A 2IO2B 2KK8A 2J7QB 1SE2A 3ZVVA 4TKNA 1OQRA 2XK5A 1ENFA 2B3AA 3PT2B 1J7CA 3KUDB 3RNGC 3EUB2 4ANVA 4HLEA 1WJNA 2IJ0A 3Q2AC 1GB4A 1NENB 2WX1A 5J18A 3I57A 3PRMB 3VTVA 2VH2A 4ASWC 5BYSA 2JXTA 4ZRJA 4REZA 1DOXA 2C9WB 5H8YE 2L0FA 3RZWC 2EMSA 4W9IA 1WM2A 3HM6X 3P4RB 4W9DA 4XZ4A 5CHVC 3R7RA 3PV1A 2HE7A 5HFYA 4LDTB 2KWUB 3OAWA 2DENB 4A55A 1C76A 2LVQA 1CMXB 2BS3B 2W55A 3H6NA 1QQRA 2ACZB 3IBEA 2DAFA 4HKQA 2JRHA 4PS7A 1QZEA 3SD5A 2ZCCA 1WMHB 3A33B 2AL6A 5D6JB 5DPWA 1NYRA 4BKGA 1TIFA 1WXSA 2NPTA 1WXVA 1VZ7A 2NTSA 3EHVA 2G9HD 3DVNU 1YQ4B 2LHEA 5BMHA 3PZ7A 3AE1B 3BINA 3URYA 2MHJA 3RT3B 1E10A 3KW5B 4FXCA 2D5GA 2BGFA 1VRAB 2KZRA 3APCA 1UGMA 4GGQA 2KAJA 3DDCB 1I42A 1GG3A 4JLCA 3TBLD 2KKCA 4WJNA 1WXQA 2MLBA 4OW0A 1JW9D 2K39A 2PE6B 1E9MA 3RFZB 3N20C 3PRZA 3AE9B 2MQJA 5AZHA 2KXJA 3U8ZA 4M0WA 4IWOA 3K9OB 3Q8CA 5KHOA 3APDA 3TMPB 1UF0A 2CR5A 2DWQA 2WU2B 5D3DA 1OEYJ 3N1ZC 4FJZA 3T8MA 3KWLA 5D2MB 4LNFA 1V2YA 2ICIA 3M3JA 4OHJA 2RGFA 3RUIB 3TEYA 3ABVB 1I4HA 1QKZA 2BYEA 4IWQA 4AOFA 2BWFA 3A9JB 1H4RA 4OVVA 1N62A 1IYFA 1TKGA 3VVWB 4M00A 3EECA 2INDC 4XE0A 3UIOB 3DBSA 4ANUA 1YJIA 5HHDG 3A4RA 4GMVA 4DXAB 2WU5B 3FAHA 4TQ0A 1AARA 1WRIA 3W5VB 5G2NA 2MBEA 2NCNA 2BTEA 2NMQA 4W9FA 1FD6A 5E6PA 1YIWA 2W3SA 2FUHB 3DWMA 1ZXIA 2KVRA 2W9NA 3L0WB 3V60A 1MHXA 1SSNA 3R3MA 2IO3B 4G3XB 2FNJB 5CHWA 2RDGA 4ZHOA 3DWGC 4OVUA 1V6EA 1WX8A 2BBCA 1OQQA 2V1YA 1FNWA 2J0MA 3DHHC 3WALA 5E6JA 4OZAA 3QK0A 2SAKA 3DHIC 3UQBA 3ZLZA 3IG3A 1T0SC 1WFYA 2L32A 2WXLA 4MM3B 2AQ2B 4BKSA 2WXHA 2PIAA 3AI5A 2Q5WD 4AJYB 2DBYA 4M8MA 5C2TB 3NS1A 2ONQA 2J42A 2RPVA 3BY4B 3VQIA 4ZYNA 3N1YC 2IYDB 1OEYA 2ASQA 1NI2A 2KN4A 4LCDE 1E8ZA 2N7DA 2WXOA 2K1FA 2GBJA 2KD0A 2DZKA 1P0RA 2KX3A 4A90A 3VAWA 4I6PA 2EMTA 3R2IA 1CQVA 4ARIA 2MJ3A 3A4SC 1EM7A 2DAJA 1F9JA 2QDFA 3P42A 1SXTA 3H8HA 4MSMB 4QAYA 4RNAA 2JF5A 1OGWA 2KNBA 2QJLA 2AEHA 3CIRB 1HTQA 2V3NA 2WDQB 3GOEA 1YOVB 2MRPA 3O65B 2KT7A 3ZIMA 3AEDB 4C00A 1EWCA 1UGJA 1VCBA 3VDZA 4C7YA 2LGSA 2KDIA 5JHBA 5C1ZA 5DPRA 3DBHI 1J8CA 4JGHB 3FILA 2NTTA 2AL3A 4J3OD 1P7EA 2R61A 3BZDB 4HRSA 4P7IA 1EU3A 3U52E 2WX0A 3PO0A 2GI9A 3DBHB 2I1JA 3CWIA 3KH0A 3T3OA 2V3PA 1NDDA 4ACFA 4LDTD 2IO0B 3BVZA 1WF9A 3HK0A 5IO9A 2KJRA 4USAA 5DPSA 1JWSD 2LGDA 3NZUA 3P1MA 4W9JA 4PYUA 1WI0A 4DHZE 2A5UA 5IA7A 3M95A 2CJNA 2A4ZA 3ONSA 3Q8EA 4G11A 2N9LA 2AWTA 1SE4A 2KX0A 2FAZA 1SEBD 3VUXA 3CF6E 3EA6A 1L4DB 3P4PB 2ZPYA 3AU4A 3EFCA 1WXMA 2EELA 2QIEB 4RCOA 4EKUA 2INNE 4ZYSA 1TKEA 4EE2A 4S17A 5EE9A 1KLVA 3N30A 1FXAA 3SDLC 2BYFA 3O13A 3OJ4B 1MHHE 3B1LX 1K52A 4M8NA 1EO6A 1UH6A 5JH5C 1XQQA 2IDYA 4HPPA 4WQMA 3VHTC 4JWSC 1XLQA 1A5RA 2JZPA 3HM3A 5T8IA 2WDRB 3N1XC 2R2QA 3NVVA 4MGYE 2MSED 2BYTA 2LVOA 4PS8A 2FCMA 2Z59B 2JXXA 1V86A 2GBNA 2HJ1A 3QC8B 3QWZB 1C4CA 2L1AA 4R3DA 4W9HA 1EU4A 5LNK1 2N0SB 2BS4B 2LXCA 3FKYA 2REXA 2YVCA 4MSQB 1BMLC 1TS2A 2WQYB 4CHKA 3AM9A 3HIZA 1HE8A 4KGSA 3W1SA 1RYJA 2XK5B 5CTRC 3AE6B 3TCAA 4KDLB 5FKAC 3QIJA 4K3CA 4II2B 5D3IB 2K8CA 4KGTA 1I4PA 3ZQ4A 2KANA 4NJ7A 2KWDA 3DPDA 5HG2A 4RGNA 2PJHA 4AP4C 2ZPNA 3UF8A 1TZ1A 1VR9A 2MBHA 4K3BA 2L76A 2CJOA 2RSUA 2K9XA 2VH1A 5EE3A 3K9PB 4F8CB 3SR6A 2N1VA 4WQOB 2KN5A 3CMMB 3ZRCA 1QLBB 2WWZA 2MBQA 1NVID 2QEJC 3RN9C 1YQBA 1JWMD 3UGBB 4II3B 4XC2A 2UU7A 3U30A 2KWVB 1A70A 1RWSA 3PVLA 1VJKA 1YNTE 4B0MA 2BWES 4YXDB 2EKIA 3W1SC 3ZNGC 3WA0A 4EZJA 2WXMA 4TMAB 4IWPA 3H7SA 2NPTB 3MTNB 3NUHB 3MHSD 1KRHA 3TL5A 2BF8B 2J0JA 4FJYA 2OEDA 5DCNA 3NVWA 4HK2A 1TJEA 4BAXA 4KKJA 3HVDA 2WNMA 1GC6A 2D10A 3KYDD 3OWEB 4LJPB 3PLUA 2C7MB 2L83A 4AQ7A 2K22A 2OOBB 2KDBA 2QHOA 1ZXHA 5KHQA 4YTPB 4IG7B 4E71A 2N9PC 4KV2A 4A9AA 1KTKA 2V4IB 3N3KB 1GC7A 4TUUA 2WXPA 1DOIA 1U4AA 3AH7A 2BPSA 4E74A 3E56A 4KGRA 4OVZA 2WXKA 1HXYD 3GP7A 5FK9C 2JWUA 1SJHD 1M4VA 1L7YA 1IP9A 3EGRA 1T0YA 3AEEB 3WCQA 1FXIA 1WY8A 3MFGA 5G5HA 4ANXA 4XDDA 2KDEB 1C4AA 4CO7A 1Z2MA 1R4MI 2W82A 4LTUA 3AE8B 2KWCA 2PTLA 4EZKA 4KZ0A 1TS5A 1TTNA 1QOAA 3OJ3A 2WXRA 2MEKA 1TS4A 4IC7B 2NBVB 4JL9A 5LXIB 1Y56A 3L16A 1C79A 4AUQC 4HPLB 1PYWD 4TV3A 3T9LA 3R2TA 3V6EB 3ZDTA 4EZLA 4JE3B 3LXFA 1QOGA 4MGKE 3ZKJC 1SE3A 1JQ4A 1CZPA 4HPMB 1C9FA 4W9GA 1Y8RC 1P9DU 4DXGA 4F7ZA 2QMTA 2C7HA 3H9DA 1E0ZA 2QSDA 2G4SA 1TZOA 4DDGD 1IGCA 1KFYB 2I1KA 3W1YA 5IN7A 3WAOA 1KH0A 4NY0A 1JALA 2LUEA 4N59A 3TEWA 4BFRA 2ZVOA 2V4LA 1FNVA 4DDID 4MJSA 4YWGG 3FC4A 4GN1A 1HQRD 4RH6A 2BW2A 1XCQL 3B0AA 4XDCA 1N6ZA 2Y5PA 3T3NA 2KQSA 1D5ZC 2KDMA 2DX5B 1L2NA 1V1PA 4GDLB 1WYWB 3AEGB 2K3UA 2N9XA 1JWUD 4JX1C 3RCZA 2KMAA 4D2KA 1Q5WB 1UWXA 2KFKA 4P1CC 3PTFC 3V3XA 2M0AA 4P6VF 1P3QU 1JWBD 1YJ1A 1Q0WB 3OLMD 4FHJA 3MP9A 3RNCC 1MG4A 4C56C 2LGXA 4DHJB 4ARCA 1PGXA 2NBUA 1KOTA 3APFA 2JYEA 4TSSA 3RNBC 5TR5A 1JCKB 4AWJA 2ON8A 1E7UA 4NQLB 4C80A 1HZ5A 4XGAB 4XWWA 3J9CA 2FIFA 5BYQA 3Q3OC 4NAMA 3TJPA 1QOBA 4A20A 1SJED
chains in the Genus database with same CATH topology
4UDUC 1FCLA 3TEZA 4RF1A 1L6VA 1YMHE 4WIPA 2J52A 3AEDB 1EWCA 1UGJA 2JQRB 4C7YA 2WXGA 3U7ZA 3VR9B 4IKGA 3NVZA 1TS3A 2PMVA 3HUIA 1FRDA 1D5XC 3FILB 3HVZA 2LFIA 4JWUC 1DYQA 4YSZB 3FILA 2NTTA 2KMMA 2Y3AA 2JX5A 1FFVA 4J3OD 1P7EA 1E7PB 1I4QA 4XWTA 2R61A 4RGTA 5TSSA 3BZDB 5JXVA 1JROA 1XO3A 4HRSA 2BB6A 2M19A 1MI0A 1L5PA 4KKIA 2IGDA 1EU3A 3U52E 4RF0A 3PO0A 2GI9A 4US8A 1ZDVA 3L4PA 1BUIC 3BYYB 5EE0A 2CU3A 1QOFA 3CWIA 1N5WA 1EWYC 1XLPA 2DYMA 3T3OA 2V3PA 2GB1A 3TSSA 3BVZA 4C7ZA 1VZ8A 1WWTA 2HTME 2BT6A 1ET6A 1HA5A 4KX6B 2XN9C 4USAA 1UWMA 1JWSD 3VR8B 2VZKB 3TEXA 3LB8C 1YN5A 3P1MA 2FE8A 3Q8BA 1R7SA 1IBXB 3AEFB 5FR3A 3GB1A 1NYQA 1J7AA 2JU6X 2CJNA 1IBXA 1YN3A 1GAQB 1FO4A 1WYGA 1L0XB 1GPXA 3Q8EA 2N9LA 4L2YA 4ZHPA 1SE4A 3B2FA 3Q69A 4YTMB 1SEBD 2AQ3B 2ZW0A 1D5MC 3EA6A 2WXFA 1I4RA 1L6UA 2PKOA 1QILA 1L4DB 2J53A 5GXGB 2MH7A 2WP9B 3P4PB 2EELA 2PLPA 2QIEB 3BK2A 4RCOA 2INNE 3VRAB 4ZYSA 1TKEA 4EE2A 5HI1A 5MPOA 3N9YC 5EE9A 1F2RC 2WXQA 3IT6B 1IGDA 4LLGM 4YT0B 5G5GA 4RGMA 1FXAA 3W2DA 4WWMA 4ITKA 3O13A 1MHHE 1K52A 1TKYA 3IXSA 3BWUD 2KACA 1TY0A 2IDYA 1YQ3B 2WXNA 4WQMA 4JWSC 5C3JB 4WURA 1WSPA 1ZP0B 1RM6C 1XLQA 2JZPA 4N6EB 5T8IA 2WDRB 5EE1A 1T5XD 3NVVA 3LYYA 2MJEA 2BYTA 1J7BA 1B9RA 1K50A 4NJCA 4MACA 3GS2A 1K53A 3IAS1 1L0YB 4ZRQA 3HRDD 2INPE 1P7FA 2N7JA 1NEKB 1PDXA 2IGHA 4GDKB 4GLSC 4N58A 1V8CA 2WDVB 1T3QA 1D6EC 1C4CA 2JSVX 2L1AA 4R3DA 3B9JA 5AUIA 1BXTA 1EU4A 5LNK1 2GRIA 2N0SB 1Q10A 1K51A 2BS4B 2E3TA 3B2GA 2V0GA 3SEBA 2PVOD 3BIID 2FBWB 1BMLC 1TS2A 2WQYB 3AE4B 3P63A 4HROA 4AS1A 3AM9A 2LJIA 3Q8AA 4KGSA 3MJ5A 1E6EB 1RYJA 2TSSA 1ZDXA 3W1SA 1SE2A 1ZE3D 3AE6B 1OQRA 1ENFA 5FKAC 1J7CA 1UNSA 2H89B 1HEZE 3AEAB 5D3IB 2M56B 4KGTA 1I4PA 3V05A 3ZQ4A 3TUOA 3EUB2 3SFDB 2WS3B 2KWDA 4MT5A 1FRRA 1I4XA 2IJ0A 5HG2A 4RGNA 2QILA 1GB4A 1JWAD 1FIQA 1L4ZB 1NENB 1VR9A 4A6QA 3I57A 2CJOA 2K9XA 2LUMA 5BYSA 2JXTA 3KQ4A 5EE3A 1DOYA 1STEA 4ZOHC 4REZA 1DOXA 3SR6A 1CJEA 5H8YE 4B0EA 1QLBB 2E6XA 1NVID 2QEJC 3AECB 1OFFA 3P4RB 1JWMD 5HFYA 1HZ6A 1AW7A 1XCTL 1PGAA 2LMCA 4A55A 1C76A 1XXGA 1A70A 2BS3B 1RWSA 3AE7B 3MHZA 2W55A 1VJKA 1YNTE 4B0MA 1JMLA 1FM0D 4YXDB 2EKIA 1QQRA 2LEKA 2ACZB 2WXMA 4HKQA 4TMAB 3AEBB 5BMGA 3NUHB 1KRHA 1DGJA 1AYFA 1NYRA 1AWDA 2OEDA 1VZ7A 2NTSA 4HEA1 2G9HD 3NVWA 1F0ZA 1TJEA 1YQ4B 4KKJA 4PT5A 2LHEA 3RPFC 2IPKD 3HVDA 1WGKA 2WNMA 5BMHA 3E9SA 3AE1B 3PZ7A 3URYA 2AX5A 3OWEB 1TYGB 3AE5B 2KQ4X 1E10A 4FXCA 1L0VB 2D5GA 4WAFA 2L83A 3AE3B 4NAWB 4AQ7A 2K22A 1VRAB 4OZBA 1ZXHA 3SFEB 1C78A 4YTPB 1KF6B 2KAJA 4CQNA 2Z8LA 4A9AA 1XEEA 2IGGA 3KWVA 1WXQA 3AV8A 1KTKA 1V1OA 2V4IB 4OW0A 1JW9D 1C4PA 1E9MA 2I38A 2PW9A 4IOIE 3RFZB 3ZJVA 3AE9B 4TQ1A 1FEHA 2WXPA 3IAM1 1FCCC 1DOIA 1IUEA 3AH7A 1MPEA 1VZ6A 3I9V1 3E56A 4M0WA 4KGRA 1ACCA 3AMZA 4OVZA 2WXKA 3AE2B 1HXYD 3GP7A 5FK9C 3Q8CA 2L52A 3BVMA 2JWUA 2RDHA 1SJHD 2K5PA 1M4VA 2DWQA 1JRPA 2WU2B 3EGRA 1ROEA 3AEEB 5D3DA 4DQOC 3WCQA 1FXIA 1SBBB 1CK1A 4WH4A 3MFGA 4IDIA 3ETRA 5G5HA 3KWLA 2DLBA 5AUKA 4XDDA 2LGIA 4RGOS 3AB5A 2H88B 2ICIA 2N9KA 4OHJA 1C77A 1C4AA 3TEYA 3ABVB 1I4HA 1GOZA 2W82A 1N61A 4LTUA 1QKZA 1QT9A 4O1NA 5BYRA 3AE8B 2PTLA 5I4DA 2X38A 1N62A 1TS5A 1TKGA 1QOAA 2WXRA 2MEKA 1NI3A 3AN1A 3ZJUA 3ZYYX 1TS4A 5BMIA 2YEPB 1F2RI 1KLGD 2SEBD 4XE0A 4US9A 5D7GA 1Y56A 1C79A 1YJIA 1N5XA 2G1EA 5HHDG 1PYWD 2DYOA 4HKZE 3U2SC 3NRZA 1F77A 1N60A 2WU5B 3R2TA 2W54A 3FAHA 4TQ0A 1RFKA 1LO5D 1ZOYB 1WRIA 2OHFA 4JE3B 2MJDA 3LXFA 3W5VB 1XLOA 3UI3A 1QOGA 2BTEA 1KLUD 4L1BA 1SE3A 1JQ4A 1CZPA 4YSXB 5H92C 1B1ZA 1SIJA 1C9FA 2NMQA 2XNAC 2PVGC 1UUPA 1FD6A 4DXGA 2QMTA 2W3SA 1E0ZA 2QSDA 2VZKD 3DWMA 1ZXIA 2WXJA 1TY2A 3BK1A 1TZOA 2ZW1A 1IGCA 1KFYB 1QF6A 3W9CB 4L23A 1MHXA 1SSNA 1KH0A 3NZ3A 1JALA 4N59A 2RDGA 2Y5CA 3TEWA 4ZHOA 3DWGC 4P16A 2BBCA 1OQQA 2YEPF 1FNWA 1FNVA 3BYTB 2BS2B 4YSYB 5E6JA 4YWGG 4OZAA 2SAKA 1AN8A 4YTNB 2JYTA 1PGBA 3FC4A 1FNUA 1HQRD 4RH6A 2L32A 2BW2A 3U4EG 1XCQL 2B76B 3PZ8A 2WXLA 4MM3B 2AQ2B 2WXHA 4XDCA 2Y5PA 2PIAA 1V1PB 1SF0A 3T3NA 2Q5WD 2WLBA 1D5ZC 4MH8A 2KDMA 1N63A 1ESFA 2DBYA 1I4GA 1V1PA 3MC0B 4GDLB 1YJJA 5C2TB 3AEGB 4H2AA 3P4QB 2K3UA 2HDEA 1PUTA 3NS1A 3NVYA 4A8XC 1GB1A 2BB5A 2ONQA 1JWUD 4RFBA 4JPSA 2J42A 4JX1C 4D2KA 2WXIA 4NZLB 4DXFA 2FUG1 3KLSX 1FFUA 2RPVA 2RMMA 1UWXA 3P4SB 3V3XA 3VQIA 3Q8FA 2M0AA 4HJGE 3VRBB 1I7HA 1YN4A 2K0PA 4P6VF 3R8BA 1XLNA 1XF5L 1JWBD 2KN4A 1ZUD2 3MP9A 2WXOA 1ZPSA 3ZJTA 4A90A 4C56C 1T6BX 1PFDA 1MVKA 1ET9A 4ARCA 1PGXA 4LK0M 3R2IA 1FMAD 4Q2JA 2JYEA 1CQVA 1V97A 4TSSA 2MJ3A 4ARIA 3BVGA 3W5UB 1D4BA 1JCKB 2J4XA 4OZCA 1VDVA 1EM7A 4ZRPA 2I2YA 2ON8A 4C80A 1HZ5A 3P42A 3C8YA 1SXTA 3IT4B 4XWWA 2W3RA 2LHDA 3H8HA 3J9CA 2AQ1B 4RNAA 1VLBA 1SB3C 5BYQA 2QJLA 3ZGZA 4NAMA 1QOBA 3CIRB 1SJED 2V3NA 2WDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXS A;  3GS2 A;  3H8H A; 
#chains in the Genus database with same CATH topology
 2KC2 A;  1FCL A;  3TEZ A;  2ZEQ A;  4RF1 A;  2UYZ B;  2JQR B;  5J17 A;  1MG8 A;  3NVZ A;  1TS3 A;  3RNF C;  1D5X C;  2INC C;  5BO4 B;  3FIL B;  3U7D A;  4JWU C;  2JPH A;  1DYQ A;  2KFJ A;  4YSZ B;  3DVG Y;  1WRD B;  2N9E B;  3JW0 X;  1I4Q A;  1WZ3 A;  3RNA C;  5JXV A;  1JRO A;  1LM8 B;  1XO3 A;  1MI0 A;  4KKI A;  1S3S G;  2IGD A;  3ZO5 B;  2N4F A;  1WE6 A;  1J0G A;  1ZDV A;  1BUI C;  3BYY B;  5EE0 A;  2KJ6 A;  2CU3 A;  1QOF A;  2KLG A;  3TSS A;  4MH0 E;  4C7Z A;  1VZ8 A;  1WWT A;  5AZF A;  1HA5 A;  4KX6 B;  1UWM A;  2VZK B;  3EC8 A;  3LB8 C;  2KO3 A;  2KJH B;  3Q8B A;  4FHK A;  3AEF B;  3KVF B;  1TBE A;  1RFA A;  3ML9 A;  2IZV B;  1FO4 A;  2L05 A;  1LGR A;  4FJV B;  3QCA A;  3V61 A;  1E8W A;  3Q14 C;  1WH3 A;  3B2F A;  1WJ6 A;  3I63 C;  2AQ3 B;  5FR6 A;  2PKO A;  4GDL A;  2J53 A;  2MH7 A;  2WP9 B;  2M0X A;  2PLP A;  3D32 A;  3VRA B;  1IGD A;  4LLG M;  4YT0 B;  4RGM A;  3W2D A;  3L17 A;  1TKY A;  4LNN A;  5AEK B;  2V9H A;  4BZA A;  5J2R A;  2G4D B;  1RM6 C;  2AYO B;  4N6E B;  1T5X D;  3LYY A;  1WR1 A;  4NJC A;  1J19 A;  1K53 A;  3IAS 1;  4ZRQ A;  3HRD D;  2INP E;  1P7F A;  2IGH A;  4GDK B;  4N58 A;  4HWI B;  1V8C A;  2WDV B;  2RD0 A;  4HCN B;  2GRI A;  1K51 A;  1WGD A;  2V0G A;  2DNF A;  3IFW B;  1WXA A;  3BII D;  3WAN A;  4AS1 A;  4HRO A;  2JT4 B;  5JHA A;  2KHW B;  1UEL A;  3Q3N C;  2O6V B;  3R66 C;  2H89 B;  1HEZ E;  2WYQ A;  2M56 B;  3RMK C;  3V05 A;  4HXD A;  3SFD B;  3VH3 B;  3PLV A;  3DBR I;  1I4X A;  2QIL A;  3KUC B;  2LWP A;  3HHM A;  1JWA D;  1FIQ A;  2KVZ A;  3MC9 A;  4IM3 A;  1DOY A;  3NZS A;  1EF1 A;  3L54 A;  3DBR B;  1CJE A;  4W9K A;  4B0E A;  2E6X A;  2GLS A;  1FPY A;  3LJ3 A;  3AEC B;  4P1B C;  1OFF A;  1WJ4 A;  1SGH A;  1HZ6 A;  2KOX A;  1AW7 A;  1EF5 A;  3ZXR A;  2LMC A;  1PGA A;  4FAD A;  1XXG A;  3RYT A;  2D3C A;  3AE7 B;  5C23 A;  3DQV A;  4BKS D;  1JML A;  4X57 B;  1C1Y B;  3VUY A;  4BOS C;  1DGJ A;  1AYF A;  3QHT A;  1GUA B;  1XD3 B;  4ZRI A;  1JRU A;  3I5J C;  4PT5 A;  4WWP A;  2IO1 B;  2WHI A;  3E9S A;  1UBQ A;  2AX5 A;  1TYG B;  3NOB A;  1L0V B;  1M94 A;  4NAW B;  1WGR A;  2O2V B;  4OZB A;  1R4N I;  1K8R B;  1KF6 B;  2Z8L A;  4GU2 A;  1XEE A;  2IGG A;  3AV8 A;  1V1O A;  2PPH A;  1TT5 B;  3ZJV A;  4DHJ D;  4TQ1 A;  1IUE A;  1R4N B;  1VZ6 A;  3A9K A;  3KUZ A;  3AE2 B;  2L52 A;  4GDK A;  2RDH A;  4KDI C;  2K5P A;  4K1R B;  3ML8 A;  4WH4 A;  3DOW A;  4PS3 A;  2HJ8 A;  3ETR A;  1RAX A;  2DLB A;  5AUK A;  3ENE A;  3PSE B;  2LGI A;  3QAR A;  4J6I A;  1FXT B;  1C77 A;  4HDO A;  1N61 A;  5BYR A;  2RDB C;  4WWN A;  4GB9 A;  2BQQ A;  2X38 A;  4KSK C;  2O6V A;  2FCS A;  3UIP B;  4K81 A;  5BMI A;  2YEP B;  5D7G A;  1KLG D;  3LDZ E;  2D2Q A;  1N5X A;  2G1E A;  3C0R B;  3PZD A;  4JQW C;  3U2S C;  3DBL I;  1F77 A;  2W54 A;  2D11 A;  3NY5 A;  1RFK A;  1LO5 D;  2MJD A;  1XLO A;  2LI5 A;  2M4N A;  3JSV A;  1KLU D;  2MP2 B;  2OJW A;  4L1B A;  4YSX B;  2KLC A;  1B1Z A;  1RRB A;  2PVG C;  1UUP A;  4KVG B;  3DBL B;  2Z0D B;  1F52 A;  2VZK D;  4ANW A;  2ZNV B;  1TY2 A;  3BK1 A;  3VFK A;  2DYB A;  3W9C B;  2L3Z A;  3IHP C;  5D94 A;  3PRE A;  2Y5C A;  4I6N B;  2QCZ A;  3QJZ A;  2YEP F;  4MJS B;  2LJ5 A;  1PQS A;  2BS2 B;  5LLI A;  1AN8 A;  1PGB A;  3JYU A;  2B76 B;  3PZ8 A;  1D3Z A;  2K8H A;  1V1P B;  2ZZP B;  2WLB A;  3I3T B;  3MC0 B;  3ECI A;  3P4Q B;  4H2A A;  3QA8 A;  4ZRK A;  4BBN F;  4A8X C;  2JRI B;  5EDS A;  4NAW A;  3PPA A;  2O2V A;  2KFK B;  2FUG 1;  1X1M A;  4IM2 A;  1T0Q C;  1TGZ B;  2IY0 B;  4HJG E;  3VRB B;  1I7H A;  3Q3J A;  5CX3 A;  3RZF A;  2K0P A;  2C5L C;  1XLN A;  3PS6 A;  3MC8 A;  1ZPS A;  3ZJT A;  2OJR A;  4EOY A;  1Z5S B;  1IPG A;  1MVK A;  2MBO A;  2Z0E B;  1E8X A;  3W5U B;  4OZC A;  3QQ8 B;  4ZRP A;  2I2Y A;  4GIV A;  1E5W A;  3C8Y A;  3IT4 B;  2W3R A;  2LGY A;  2AQ1 B;  1SB3 C;  1P1A A;  1P98 A;  3M63 B;  4K7W A;  1L6V A;  4WIP A;  3C19 A;  3OG5 A;  2WXG A;  3U7Z A;  3VR9 B;  3MJW A;  4IKG A;  1R4M B;  2BKR B;  2NVU I;  3HUI A;  4ICV A;  1FRD A;  2N1W A;  3HVZ A;  1OTR B;  4N9F 4;  2KMM A;  1FFV A;  2CS4 A;  1E7P B;  1UZX B;  4IW0 A;  5TSS A;  2XEW A;  2BB6 A;  3H1U A;  3CST A;  1L5P A;  2MP2 A;  4FUL A;  4WWO A;  4RF0 A;  3ZNI D;  4US8 A;  2BVC A;  3JVZ X;  2GB1 A;  3GZN I;  1SE9 A;  2BT6 A;  2DZJ A;  1ET6 A;  2XN9 C;  2LRU A;  3VR8 B;  1G6J A;  2JUO A;  1YN5 A;  2FE8 A;  2PEA A;  4KZC A;  4NNJ B;  4FN2 A;  2EKE C;  2JU6 X;  3PRP B;  3GZN B;  5HKH A;  1IBX A;  1YN3 A;  1GAQ B;  2FCN A;  1GPX A;  3DHG C;  4ZHP A;  2LAS A;  4YTM B;  2M17 A;  1ZKH A;  2ZW0 A;  4F1S A;  1D5M C;  1I4R A;  4FA6 A;  2NBW B;  3ZW3 A;  3X23 A;  4MEM A;  3BK2 A;  5HI1 A;  2D07 B;  3N9Y C;  2WXQ A;  3IT6 B;  5G5G A;  1ISN A;  4BBN C;  4HVB A;  4WWM A;  4ITK A;  2D3G A;  3RUL A;  2KQ7 A;  4I6L B;  3BWU D;  2KAC A;  1TY0 A;  1YQ3 B;  2ZNV C;  1E8Y A;  5C3J B;  1WSP A;  3Q3F A;  4G0N B;  5EE1 A;  3R7Q A;  2CHW A;  2C60 A;  2ZVN A;  3VUW A;  1B9R A;  4MAC A;  1L0Y B;  2N7J A;  1NEK B;  1PDX A;  4LNO A;  3DVG X;  1T3Q A;  4C4V A;  5AUI A;  1BXT A;  3ZTD A;  3H7P B;  2MCN B;  1V5T A;  2E3T A;  3B2G A;  1S1Q B;  3A1Q A;  3L08 A;  3SEB A;  2FBW B;  3AE4 B;  3P63 A;  2L0T A;  2N7E A;  2BKF A;  1E6E B;  2HTH A;  1ZDX A;  2TSS A;  1ZE3 D;  3GE8 C;  4HCP B;  3Q6B A;  1UNS A;  3AEA B;  2X8X X;  4BKT A;  3TUO A;  2WS3 B;  4MT5 A;  1WR6 E;  1FRR A;  2WGS A;  1WM3 A;  1L4Z B;  4A6Q A;  2GMI C;  2BYV E;  2LUM A;  2LRW A;  3KQ4 A;  1STE A;  2IBI B;  4ZOH C;  4DK5 A;  2VRR B;  2M8S A;  4ICU A;  3AU5 A;  4HDQ A;  1T0R C;  1XCT L;  1LXD A;  5JZE B;  2JZZ A;  2C7N B;  3QAQ A;  3WIM A;  3MHZ A;  4DWF A;  2L00 B;  1FM0 D;  2LEK A;  3AXC A;  3VTU A;  3AEB B;  5BMG A;  2K6D B;  1AWD A;  1WMH A;  4HEA 1;  3WAM A;  4B6W A;  1F0Z A;  3RPF C;  2IPK D;  4IUM B;  1WGK A;  5AZG A;  3AE5 B;  2KTF A;  2KQ4 X;  4WAF A;  2RPQ A;  5IAA C;  3AE3 B;  3TIX A;  2GBK A;  2K25 A;  3B08 A;  2JZ3 B;  2KYW A;  2ZCB A;  2PE9 A;  3SFE B;  1C78 A;  2L8J A;  4A3O A;  4CQN A;  1WIA A;  2M1M A;  4GXB A;  1YX6 B;  3KWV A;  1C4P A;  2I38 A;  2PW9 A;  4IOI E;  3QX1 A;  1FEH A;  3A9K B;  4KSL C;  3IAM 1;  1FCC C;  4ZDV A;  1MPE A;  1BT0 A;  1WX9 A;  3I9V 1;  1ACC A;  2Y5B B;  3AMZ A;  3GE3 C;  3NS8 A;  2CHZ A;  3BVM A;  1F1H A;  1JRP A;  1ROE A;  4W9E A;  1MJD A;  2V3S A;  4DQO C;  4M01 A;  1SBB B;  1CK1 A;  4IDI A;  4PYZ A;  3H7P A;  2JVC A;  3RD2 A;  2JWZ A;  4RGO S;  3AB5 A;  2H88 B;  2N9K A;  4NJ6 A;  1C3T A;  4B9K A;  2CKH B;  2KDF B;  1GOZ A;  1QT9 A;  4O1N A;  3ZDM C;  5I4D A;  3SHQ A;  2FID A;  3A9J A;  1NI3 A;  3AN1 A;  3ZJU A;  3ZYY X;  4BOZ B;  1Q1O A;  1F2R I;  2SEB D;  4US9 A;  3ZRF A;  2DYO A;  4HKZ E;  4EFO A;  3NRZ A;  1N60 A;  2JY6 A;  1WGY A;  1LQB A;  4KIK B;  5E6N A;  3JSV B;  4GOC A;  1LFD A;  4IM0 A;  1ZOY B;  2OHF A;  2NS5 A;  4YL8 A;  3RNE C;  4JIO U;  3UI3 A;  4WJP A;  5H92 C;  1SIJ A;  2XNA C;  4URK A;  4K7U A;  4E3C A;  4FBJ B;  3ZTC A;  4FLH A;  2WXJ A;  2ZW1 A;  3SU8 X;  1QF6 A;  3Q3M C;  3AUL A;  4L23 A;  3IVF A;  3CSF A;  3NZ3 A;  4LNI A;  2MBB B;  4GSW A;  4M02 A;  1ZGU B;  4P16 A;  1OQY A;  3BYT B;  2KTR B;  1ZW7 A;  4YSY B;  3L13 A;  2K8B A;  4YTN B;  2JYT A;  1FNU A;  3U4E G;  4WJQ A;  2J0K A;  1SF0 A;  2CHX A;  4MH8 A;  4MM3 A;  1N63 A;  1ESF A;  1I4G A;  5IKC M;  1YJJ A;  2MWS B;  2D3B A;  2DZI A;  4B95 A;  2HDE A;  1PUT A;  3NVY A;  1GB1 A;  2BB5 A;  1YX5 B;  1UBI A;  4RFB A;  4JPS A;  2ZJD A;  2WXI A;  4MGI E;  4NZL B;  4DXF A;  3KLS X;  1WZ0 A;  1FFU A;  2RMM A;  3P4S B;  3RI7 C;  4A3P A;  3Q8F A;  1MFW A;  3UIN B;  3ZNH B;  3NG0 A;  1YN4 A;  3R8B A;  1V80 A;  2LVP A;  1XF5 L;  2UWQ A;  5L83 A;  2R2O A;  1ZUD 2;  1GNU A;  4BVU C;  3PGE A;  1EUV B;  1T6B X;  1PFD A;  1ET9 A;  4LK0 M;  3L10 B;  2GBR A;  1FMA D;  4Q2J A;  1V97 A;  3BVG A;  5LXH A;  1D4B A;  2J4X A;  1VDV A;  2QC8 A;  3VH4 B;  2LHD A;  1VLB A;  3UQA A;  3ZGZ A;  5IOI A;  4RM8 A;  4AJW A;  3N32 A;  2NR2 A;  1KJT A;  4UDU C;  1WJU A;  3V6C B;  5GMV A;  3V62 A;  4W9C A;  1YMH E;  2J52 A;  1I35 A;  5CHF A;  3DCG A;  4MEL A;  4EUT A;  1V5O A;  2PMV A;  4CYE A;  1YD8 U;  2LZ6 A;  1GJZ A;  2LFI A;  4EEW A;  2KMC A;  2Y3A A;  2JX5 A;  4XWT A;  4KIK A;  4RGT A;  5DPT A;  3S2A A;  3DVN V;  2M19 A;  1WGG A;  1E7V A;  3ZNZ B;  4LJO B;  4NQK E;  3PHX B;  1KM7 A;  3L4P A;  4WAA A;  2LXA A;  3ALB A;  4RM9 A;  1N5W A;  1EWY C;  1XLP A;  2DYM A;  2GOW A;  4W9L A;  2K6Q A;  5E6O A;  4S0R A;  1UD7 A;  4G50 A;  2HD5 B;  2HTM E;  3ZXV A;  3PHW B;  5IP4 D;  3TEX A;  1VD2 A;  4K7S A;  1HTO A;  4RMA A;  3EFU A;  1R7S A;  1IBX B;  2D3A A;  3GB1 A;  5FR3 A;  1NYQ A;  1J7A A;  2KTR A;  1E90 A;  2DZM A;  2MX2 A;  4NPN A;  2G3Q B;  1WYG A;  1L0X B;  5G55 A;  4L2Y A;  4PK1 A;  3NHE B;  3Q69 A;  2MA9 B;  2WDT B;  1V81 A;  2FCQ A;  2CU1 A;  2WXF A;  1L6U A;  1QIL A;  4MGZ E;  3X0W A;  5GXG B;  2GBM A;  1H8C A;  2MW5 A;  4DHZ B;  2L7R A;  3VTW A;  5MPO A;  3WAP A;  1F2R C;  2XBB C;  3ZUN A;  3IXS A;  1V49 A;  1RLF A;  2IY1 B;  5L95 C;  2WXN A;  1WGH A;  2DHZ A;  1WE7 A;  3VXW A;  2RR9 A;  2G45 B;  4WUR A;  1ZP0 B;  4XYC A;  1NBF C;  2MJE A;  1J7B A;  3M62 B;  3NJT A;  2YLM A;  4HJK A;  1K50 A;  3KYC D;  3GS2 A;  4M0W B;  4C4V B;  3P2B A;  4GLS C;  4MDK E;  1D6E C;  2JSV X;  4XX5 A;  3B9J A;  3A1Q B;  2O6V D;  1Q10 A;  1WX7 A;  4LNK A;  1V9J A;  1XT9 B;  2KC1 A;  2LD9 A;  2PVO D;  1SIF A;  4DBG A;  2LJI A;  3Q8A A;  4WJO A;  3MJ5 A;  2IO2 B;  2KK8 A;  2J7Q B;  1SE2 A;  3ZVV A;  4TKN A;  1OQR A;  2XK5 A;  1ENF A;  2B3A A;  3PT2 B;  1J7C A;  3KUD B;  3RNG C;  3EUB 2;  4ANV A;  4HLE A;  1WJN A;  2IJ0 A;  3Q2A C;  1GB4 A;  1NEN B;  2WX1 A;  5J18 A;  3I57 A;  3PRM B;  3VTV A;  2VH2 A;  4ASW C;  5BYS A;  2JXT A;  4ZRJ A;  4REZ A;  1DOX A;  2C9W B;  5H8Y E;  2L0F A;  3RZW C;  2EMS A;  4W9I A;  1WM2 A;  3HM6 X;  3P4R B;  4W9D A;  4XZ4 A;  5CHV C;  3R7R A;  3PV1 A;  2HE7 A;  5HFY A;  4LDT B;  2KWU B;  3OAW A;  2DEN B;  4A55 A;  1C76 A;  2LVQ A;  1CMX B;  2BS3 B;  2W55 A;  3H6N A;  1QQR A;  2ACZ B;  3IBE A;  2DAF A;  4HKQ A;  2JRH A;  4PS7 A;  1QZE A;  3SD5 A;  2ZCC A;  1WMH B;  3A33 B;  2AL6 A;  5D6J B;  5DPW A;  1NYR A;  4BKG A;  1TIF A;  1WXS A;  2NPT A;  1WXV A;  1VZ7 A;  2NTS A;  3EHV A;  2G9H D;  3DVN U;  1YQ4 B;  2LHE A;  5BMH A;  3PZ7 A;  3AE1 B;  3BIN A;  3URY A;  2MHJ A;  3RT3 B;  1E10 A;  3KW5 B;  4FXC A;  2D5G A;  2BGF A;  1VRA B;  2KZR A;  3APC A;  1UGM A;  4GGQ A;  2KAJ A;  3DDC B;  1I42 A;  1GG3 A;  4JLC A;  3TBL D;  2KKC A;  4WJN A;  1WXQ A;  2MLB A;  4OW0 A;  1JW9 D;  2K39 A;  2PE6 B;  1E9M A;  3RFZ B;  3N20 C;  3PRZ A;  3AE9 B;  2MQJ A;  5AZH A;  2KXJ A;  3U8Z A;  4M0W A;  4IWO A;  3K9O B;  3Q8C A;  5KHO A;  3APD A;  3TMP B;  1UF0 A;  2CR5 A;  2DWQ A;  2WU2 B;  5D3D A;  1OEY J;  3N1Z C;  4FJZ A;  3T8M A;  3KWL A;  5D2M B;  4LNF A;  1V2Y A;  2ICI A;  3M3J A;  4OHJ A;  2RGF A;  3RUI B;  3TEY A;  3ABV B;  1I4H A;  1QKZ A;  2BYE A;  4IWQ A;  4AOF A;  2BWF A;  3A9J B;  1H4R A;  4OVV A;  1N62 A;  1IYF A;  1TKG A;  3VVW B;  4M00 A;  3EEC A;  2IND C;  4XE0 A;  3UIO B;  3DBS A;  4ANU A;  1YJI A;  5HHD G;  3A4R A;  4GMV A;  4DXA B;  2WU5 B;  3FAH A;  4TQ0 A;  1AAR A;  1WRI A;  3W5V B;  5G2N A;  2MBE A;  2NCN A;  2BTE A;  2NMQ A;  4W9F A;  1FD6 A;  5E6P A;  1YIW A;  2W3S A;  2FUH B;  3DWM A;  1ZXI A;  2KVR A;  2W9N A;  3L0W B;  3V60 A;  1MHX A;  1SSN A;  3R3M A;  2IO3 B;  4G3X B;  2FNJ B;  5CHW A;  2RDG A;  4ZHO A;  3DWG C;  4OVU A;  1V6E A;  1WX8 A;  2BBC A;  1OQQ A;  2V1Y A;  1FNW A;  2J0M A;  3DHH C;  3WAL A;  5E6J A;  4OZA A;  3QK0 A;  2SAK A;  3DHI C;  3UQB A;  3ZLZ A;  3IG3 A;  1T0S C;  1WFY A;  2L32 A;  2WXL A;  4MM3 B;  2AQ2 B;  4BKS A;  2WXH A;  2PIA A;  3AI5 A;  2Q5W D;  4AJY B;  2DBY A;  4M8M A;  5C2T B;  3NS1 A;  2ONQ A;  2J42 A;  2RPV A;  3BY4 B;  3VQI A;  4ZYN A;  3N1Y C;  2IYD B;  1OEY A;  2ASQ A;  1NI2 A;  2KN4 A;  4LCD E;  1E8Z A;  2N7D A;  2WXO A;  2K1F A;  2GBJ A;  2KD0 A;  2DZK A;  1P0R A;  2KX3 A;  4A90 A;  3VAW A;  4I6P A;  2EMT A;  3R2I A;  1CQV A;  4ARI A;  2MJ3 A;  3A4S C;  1EM7 A;  2DAJ A;  1F9J A;  2QDF A;  3P42 A;  1SXT A;  3H8H A;  4MSM B;  4QAY A;  4RNA A;  2JF5 A;  1OGW A;  2KNB A;  2QJL A;  2AEH A;  3CIR B;  1HTQ A;  2V3N A;  2WDQ B;  3GOE A;  1YOV B;  2MRP A;  3O65 B;  2KT7 A;  3ZIM A;  3AED B;  4C00 A;  1EWC A;  1UGJ A;  1VCB A;  3VDZ A;  4C7Y A;  2LGS A;  2KDI A;  5JHB A;  5C1Z A;  5DPR A;  3DBH I;  1J8C A;  4JGH B;  3FIL A;  2NTT A;  2AL3 A;  4J3O D;  1P7E A;  2R61 A;  3BZD B;  4HRS A;  4P7I A;  1EU3 A;  3U52 E;  2WX0 A;  3PO0 A;  2GI9 A;  3DBH B;  2I1J A;  3CWI A;  3KH0 A;  3T3O A;  2V3P A;  1NDD A;  4ACF A;  4LDT D;  2IO0 B;  3BVZ A;  1WF9 A;  3HK0 A;  5IO9 A;  2KJR A;  4USA A;  5DPS A;  1JWS D;  2LGD A;  3NZU A;  3P1M A;  4W9J A;  4PYU A;  1WI0 A;  4DHZ E;  2A5U A;  5IA7 A;  3M95 A;  2CJN A;  2A4Z A;  3ONS A;  3Q8E A;  4G11 A;  2N9L A;  2AWT A;  1SE4 A;  2KX0 A;  2FAZ A;  1SEB D;  3VUX A;  3CF6 E;  3EA6 A;  1L4D B;  3P4P B;  2ZPY A;  3AU4 A;  3EFC A;  1WXM A;  2EEL A;  2QIE B;  4RCO A;  4EKU A;  2INN E;  4ZYS A;  1TKE A;  4EE2 A;  4S17 A;  5EE9 A;  1KLV A;  3N30 A;  1FXA A;  3SDL C;  2BYF A;  3O13 A;  3OJ4 B;  1MHH E;  3B1L X;  1K52 A;  4M8N A;  1EO6 A;  1UH6 A;  5JH5 C;  1XQQ A;  2IDY A;  4HPP A;  4WQM A;  3VHT C;  4JWS C;  1XLQ A;  1A5R A;  2JZP A;  3HM3 A;  5T8I A;  2WDR B;  3N1X C;  2R2Q A;  3NVV A;  4MGY E;  2MSE D;  2BYT A;  2LVO A;  4PS8 A;  2FCM A;  2Z59 B;  2JXX A;  1V86 A;  2GBN A;  2HJ1 A;  3QC8 B;  3QWZ B;  1C4C A;  2L1A A;  4R3D A;  4W9H A;  1EU4 A;  5LNK 1;  2N0S B;  2BS4 B;  2LXC A;  3FKY A;  2REX A;  2YVC A;  4MSQ B;  1BML C;  1TS2 A;  2WQY B;  4CHK A;  3AM9 A;  3HIZ A;  1HE8 A;  4KGS A;  3W1S A;  1RYJ A;  2XK5 B;  5CTR C;  3AE6 B;  3TCA A;  4KDL B;  5FKA C;  3QIJ A;  4K3C A;  4II2 B;  5D3I B;  2K8C A;  4KGT A;  1I4P A;  3ZQ4 A;  2KAN A;  4NJ7 A;  2KWD A;  3DPD A;  5HG2 A;  4RGN A;  2PJH A;  4AP4 C;  2ZPN A;  3UF8 A;  1TZ1 A;  1VR9 A;  2MBH A;  4K3B A;  2L76 A;  2CJO A;  2RSU A;  2K9X A;  2VH1 A;  5EE3 A;  3K9P B;  4F8C B;  3SR6 A;  2N1V A;  4WQO B;  2KN5 A;  3CMM B;  3ZRC A;  1QLB B;  2WWZ A;  2MBQ A;  1NVI D;  2QEJ C;  3RN9 C;  1YQB A;  1JWM D;  3UGB B;  4II3 B;  4XC2 A;  2UU7 A;  3U30 A;  2KWV B;  1A70 A;  1RWS A;  3PVL A;  1VJK A;  1YNT E;  4B0M A;  2BWE S;  4YXD B;  2EKI A;  3W1S C;  3ZNG C;  3WA0 A;  4EZJ A;  2WXM A;  4TMA B;  4IWP A;  3H7S A;  2NPT B;  3MTN B;  3NUH B;  3MHS D;  1KRH A;  3TL5 A;  2BF8 B;  2J0J A;  4FJY A;  2OED A;  5DCN A;  3NVW A;  4HK2 A;  1TJE A;  4BAX A;  4KKJ A;  3HVD A;  2WNM A;  1GC6 A;  2D10 A;  3KYD D;  3OWE B;  4LJP B;  3PLU A;  2C7M B;  2L83 A;  4AQ7 A;  2K22 A;  2OOB B;  2KDB A;  2QHO A;  1ZXH A;  5KHQ A;  4YTP B;  4IG7 B;  4E71 A;  2N9P C;  4KV2 A;  4A9A A;  1KTK A;  2V4I B;  3N3K B;  1GC7 A;  4TUU A;  2WXP A;  1DOI A;  1U4A A;  3AH7 A;  2BPS A;  4E74 A;  3E56 A;  4KGR A;  4OVZ A;  2WXK A;  1HXY D;  3GP7 A;  5FK9 C;  2JWU A;  1SJH D;  1M4V A;  1L7Y A;  1IP9 A;  3EGR A;  1T0Y A;  3AEE B;  3WCQ A;  1FXI A;  1WY8 A;  3MFG A;  5G5H A;  4ANX A;  4XDD A;  2KDE B;  1C4A A;  4CO7 A;  1Z2M A;  1R4M I;  2W82 A;  4LTU A;  3AE8 B;  2KWC A;  2PTL A;  4EZK A;  4KZ0 A;  1TS5 A;  1TTN A;  1QOA A;  3OJ3 A;  2WXR A;  2MEK A;  1TS4 A;  4IC7 B;  2NBV B;  4JL9 A;  5LXI B;  1Y56 A;  3L16 A;  1C79 A;  4AUQ C;  4HPL B;  1PYW D;  4TV3 A;  3T9L A;  3R2T A;  3V6E B;  3ZDT A;  4EZL A;  4JE3 B;  3LXF A;  1QOG A;  4MGK E;  3ZKJ C;  1SE3 A;  1JQ4 A;  1CZP A;  4HPM B;  1C9F A;  4W9G A;  1Y8R C;  1P9D U;  4DXG A;  4F7Z A;  2QMT A;  2C7H A;  3H9D A;  1E0Z A;  2QSD A;  2G4S A;  1TZO A;  4DDG D;  1IGC A;  1KFY B;  2I1K A;  3W1Y A;  5IN7 A;  3WAO A;  1KH0 A;  4NY0 A;  1JAL A;  2LUE A;  4N59 A;  3TEW A;  4BFR A;  2ZVO A;  2V4L A;  1FNV A;  4DDI D;  4MJS A;  4YWG G;  3FC4 A;  4GN1 A;  1HQR D;  4RH6 A;  2BW2 A;  1XCQ L;  3B0A A;  4XDC A;  1N6Z A;  2Y5P A;  3T3N A;  2KQS A;  1D5Z C;  2KDM A;  2DX5 B;  1L2N A;  1V1P A;  4GDL B;  1WYW B;  3AEG B;  2K3U A;  2N9X A;  1JWU D;  4JX1 C;  3RCZ A;  2KMA A;  4D2K A;  1Q5W B;  1UWX A;  2KFK A;  4P1C C;  3PTF C;  3V3X A;  2M0A A;  4P6V F;  1P3Q U;  1JWB D;  1YJ1 A;  1Q0W B;  3OLM D;  4FHJ A;  3MP9 A;  3RNC C;  1MG4 A;  4C56 C;  2LGX A;  4DHJ B;  4ARC A;  1PGX A;  2NBU A;  1KOT A;  3APF A;  2JYE A;  4TSS A;  3RNB C;  5TR5 A;  1JCK B;  4AWJ A;  2ON8 A;  1E7U A;  4NQL B;  4C80 A;  1HZ5 A;  4XGA B;  4XWW A;  3J9C A;  2FIF A;  5BYQ A;  3Q3O C;  4NAM A;  3TJP A;  1QOB A;  4A20 A;  1SJE D; 
#chains in the Genus database with same CATH homology
 4UDU C;  1FCL A;  3TEZ A;  4RF1 A;  1L6V A;  1YMH E;  4WIP A;  2J52 A;  3AED B;  1EWC A;  1UGJ A;  2JQR B;  4C7Y A;  2WXG A;  3U7Z A;  3VR9 B;  4IKG A;  3NVZ A;  1TS3 A;  2PMV A;  3HUI A;  1FRD A;  1D5X C;  3FIL B;  3HVZ A;  2LFI A;  4JWU C;  1DYQ A;  4YSZ B;  3FIL A;  2NTT A;  2KMM A;  2Y3A A;  2JX5 A;  1FFV A;  4J3O D;  1P7E A;  1E7P B;  1I4Q A;  4XWT A;  2R61 A;  4RGT A;  5TSS A;  3BZD B;  5JXV A;  1JRO A;  1XO3 A;  4HRS A;  2BB6 A;  2M19 A;  1MI0 A;  1L5P A;  4KKI A;  2IGD A;  1EU3 A;  3U52 E;  4RF0 A;  3PO0 A;  2GI9 A;  4US8 A;  1ZDV A;  3L4P A;  1BUI C;  3BYY B;  5EE0 A;  2CU3 A;  1QOF A;  3CWI A;  1N5W A;  1EWY C;  1XLP A;  2DYM A;  3T3O A;  2V3P A;  2GB1 A;  3TSS A;  3BVZ A;  4C7Z A;  1VZ8 A;  1WWT A;  2HTM E;  2BT6 A;  1ET6 A;  1HA5 A;  4KX6 B;  2XN9 C;  4USA A;  1UWM A;  1JWS D;  3VR8 B;  2VZK B;  3TEX A;  3LB8 C;  1YN5 A;  3P1M A;  2FE8 A;  3Q8B A;  1R7S A;  1IBX B;  3AEF B;  5FR3 A;  3GB1 A;  1NYQ A;  1J7A A;  2JU6 X;  2CJN A;  1IBX A;  1YN3 A;  1GAQ B;  1FO4 A;  1WYG A;  1L0X B;  1GPX A;  3Q8E A;  2N9L A;  4L2Y A;  4ZHP A;  1SE4 A;  3B2F A;  3Q69 A;  4YTM B;  1SEB D;  2AQ3 B;  2ZW0 A;  1D5M C;  3EA6 A;  2WXF A;  1I4R A;  1L6U A;  2PKO A;  1QIL A;  1L4D B;  2J53 A;  5GXG B;  2MH7 A;  2WP9 B;  3P4P B;  2EEL A;  2PLP A;  2QIE B;  3BK2 A;  4RCO A;  2INN E;  3VRA B;  4ZYS A;  1TKE A;  4EE2 A;  5HI1 A;  5MPO A;  3N9Y C;  5EE9 A;  1F2R C;  2WXQ A;  3IT6 B;  1IGD A;  4LLG M;  4YT0 B;  5G5G A;  4RGM A;  1FXA A;  3W2D A;  4WWM A;  4ITK A;  3O13 A;  1MHH E;  1K52 A;  1TKY A;  3IXS A;  3BWU D;  2KAC A;  1TY0 A;  2IDY A;  1YQ3 B;  2WXN A;  4WQM A;  4JWS C;  5C3J B;  4WUR A;  1WSP A;  1ZP0 B;  1RM6 C;  1XLQ A;  2JZP A;  4N6E B;  5T8I A;  2WDR B;  5EE1 A;  1T5X D;  3NVV A;  3LYY A;  2MJE A;  2BYT A;  1J7B A;  1B9R A;  1K50 A;  4NJC A;  4MAC A;  3GS2 A;  1K53 A;  3IAS 1;  1L0Y B;  4ZRQ A;  3HRD D;  2INP E;  1P7F A;  2N7J A;  1NEK B;  1PDX A;  2IGH A;  4GDK B;  4GLS C;  4N58 A;  1V8C A;  2WDV B;  1T3Q A;  1D6E C;  1C4C A;  2JSV X;  2L1A A;  4R3D A;  3B9J A;  5AUI A;  1BXT A;  1EU4 A;  5LNK 1;  2GRI A;  2N0S B;  1Q10 A;  1K51 A;  2BS4 B;  2E3T A;  3B2G A;  2V0G A;  3SEB A;  2PVO D;  3BII D;  2FBW B;  1BML C;  1TS2 A;  2WQY B;  3AE4 B;  3P63 A;  4HRO A;  4AS1 A;  3AM9 A;  2LJI A;  3Q8A A;  4KGS A;  3MJ5 A;  1E6E B;  1RYJ A;  2TSS A;  1ZDX A;  3W1S A;  1SE2 A;  1ZE3 D;  3AE6 B;  1OQR A;  1ENF A;  5FKA C;  1J7C A;  1UNS A;  2H89 B;  1HEZ E;  3AEA B;  5D3I B;  2M56 B;  4KGT A;  1I4P A;  3V05 A;  3ZQ4 A;  3TUO A;  3EUB 2;  3SFD B;  2WS3 B;  2KWD A;  4MT5 A;  1FRR A;  1I4X A;  2IJ0 A;  5HG2 A;  4RGN A;  2QIL A;  1GB4 A;  1JWA D;  1FIQ A;  1L4Z B;  1NEN B;  1VR9 A;  4A6Q A;  3I57 A;  2CJO A;  2K9X A;  2LUM A;  5BYS A;  2JXT A;  3KQ4 A;  5EE3 A;  1DOY A;  1STE A;  4ZOH C;  4REZ A;  1DOX A;  3SR6 A;  1CJE A;  5H8Y E;  4B0E A;  1QLB B;  2E6X A;  1NVI D;  2QEJ C;  3AEC B;  1OFF A;  3P4R B;  1JWM D;  5HFY A;  1HZ6 A;  1AW7 A;  1XCT L;  1PGA A;  2LMC A;  4A55 A;  1C76 A;  1XXG A;  1A70 A;  2BS3 B;  1RWS A;  3AE7 B;  3MHZ A;  2W55 A;  1VJK A;  1YNT E;  4B0M A;  1JML A;  1FM0 D;  4YXD B;  2EKI A;  1QQR A;  2LEK A;  2ACZ B;  2WXM A;  4HKQ A;  4TMA B;  3AEB B;  5BMG A;  3NUH B;  1KRH A;  1DGJ A;  1AYF A;  1NYR A;  1AWD A;  2OED A;  1VZ7 A;  2NTS A;  4HEA 1;  2G9H D;  3NVW A;  1F0Z A;  1TJE A;  1YQ4 B;  4KKJ A;  4PT5 A;  2LHE A;  3RPF C;  2IPK D;  3HVD A;  1WGK A;  2WNM A;  5BMH A;  3E9S A;  3AE1 B;  3PZ7 A;  3URY A;  2AX5 A;  3OWE B;  1TYG B;  3AE5 B;  2KQ4 X;  1E10 A;  4FXC A;  1L0V B;  2D5G A;  4WAF A;  2L83 A;  3AE3 B;  4NAW B;  4AQ7 A;  2K22 A;  1VRA B;  4OZB A;  1ZXH A;  3SFE B;  1C78 A;  4YTP B;  1KF6 B;  2KAJ A;  4CQN A;  2Z8L A;  4A9A A;  1XEE A;  2IGG A;  3KWV A;  1WXQ A;  3AV8 A;  1KTK A;  1V1O A;  2V4I B;  4OW0 A;  1JW9 D;  1C4P A;  1E9M A;  2I38 A;  2PW9 A;  4IOI E;  3RFZ B;  3ZJV A;  3AE9 B;  4TQ1 A;  1FEH A;  2WXP A;  3IAM 1;  1FCC C;  1DOI A;  1IUE A;  3AH7 A;  1MPE A;  1VZ6 A;  3I9V 1;  3E56 A;  4M0W A;  4KGR A;  1ACC A;  3AMZ A;  4OVZ A;  2WXK A;  3AE2 B;  1HXY D;  3GP7 A;  5FK9 C;  3Q8C A;  2L52 A;  3BVM A;  2JWU A;  2RDH A;  1SJH D;  2K5P A;  1M4V A;  2DWQ A;  1JRP A;  2WU2 B;  3EGR A;  1ROE A;  3AEE B;  5D3D A;  4DQO C;  3WCQ A;  1FXI A;  1SBB B;  1CK1 A;  4WH4 A;  3MFG A;  4IDI A;  3ETR A;  5G5H A;  3KWL A;  2DLB A;  5AUK A;  4XDD A;  2LGI A;  4RGO S;  3AB5 A;  2H88 B;  2ICI A;  2N9K A;  4OHJ A;  1C77 A;  1C4A A;  3TEY A;  3ABV B;  1I4H A;  1GOZ A;  2W82 A;  1N61 A;  4LTU A;  1QKZ A;  1QT9 A;  4O1N A;  5BYR A;  3AE8 B;  2PTL A;  5I4D A;  2X38 A;  1N62 A;  1TS5 A;  1TKG A;  1QOA A;  2WXR A;  2MEK A;  1NI3 A;  3AN1 A;  3ZJU A;  3ZYY X;  1TS4 A;  5BMI A;  2YEP B;  1F2R I;  1KLG D;  2SEB D;  4XE0 A;  4US9 A;  5D7G A;  1Y56 A;  1C79 A;  1YJI A;  1N5X A;  2G1E A;  5HHD G;  1PYW D;  2DYO A;  4HKZ E;  3U2S C;  3NRZ A;  1F77 A;  1N60 A;  2WU5 B;  3R2T A;  2W54 A;  3FAH A;  4TQ0 A;  1RFK A;  1LO5 D;  1ZOY B;  1WRI A;  2OHF A;  4JE3 B;  2MJD A;  3LXF A;  3W5V B;  1XLO A;  3UI3 A;  1QOG A;  2BTE A;  1KLU D;  4L1B A;  1SE3 A;  1JQ4 A;  1CZP A;  4YSX B;  5H92 C;  1B1Z A;  1SIJ A;  1C9F A;  2NMQ A;  2XNA C;  2PVG C;  1UUP A;  1FD6 A;  4DXG A;  2QMT A;  2W3S A;  1E0Z A;  2QSD A;  2VZK D;  3DWM A;  1ZXI A;  2WXJ A;  1TY2 A;  3BK1 A;  1TZO A;  2ZW1 A;  1IGC A;  1KFY B;  1QF6 A;  3W9C B;  4L23 A;  1MHX A;  1SSN A;  1KH0 A;  3NZ3 A;  1JAL A;  4N59 A;  2RDG A;  2Y5C A;  3TEW A;  4ZHO A;  3DWG C;  4P16 A;  2BBC A;  1OQQ A;  2YEP F;  1FNW A;  1FNV A;  3BYT B;  2BS2 B;  4YSY B;  5E6J A;  4YWG G;  4OZA A;  2SAK A;  1AN8 A;  4YTN B;  2JYT A;  1PGB A;  3FC4 A;  1FNU A;  1HQR D;  4RH6 A;  2L32 A;  2BW2 A;  3U4E G;  1XCQ L;  2B76 B;  3PZ8 A;  2WXL A;  4MM3 B;  2AQ2 B;  2WXH A;  4XDC A;  2Y5P A;  2PIA A;  1V1P B;  1SF0 A;  3T3N A;  2Q5W D;  2WLB A;  1D5Z C;  4MH8 A;  2KDM A;  1N63 A;  1ESF A;  2DBY A;  1I4G A;  1V1P A;  3MC0 B;  4GDL B;  1YJJ A;  5C2T B;  3AEG B;  4H2A A;  3P4Q B;  2K3U A;  2HDE A;  1PUT A;  3NS1 A;  3NVY A;  4A8X C;  1GB1 A;  2BB5 A;  2ONQ A;  1JWU D;  4RFB A;  4JPS A;  2J42 A;  4JX1 C;  4D2K A;  2WXI A;  4NZL B;  4DXF A;  2FUG 1;  3KLS X;  1FFU A;  2RPV A;  2RMM A;  1UWX A;  3P4S B;  3V3X A;  3VQI A;  3Q8F A;  2M0A A;  4HJG E;  3VRB B;  1I7H A;  1YN4 A;  2K0P A;  4P6V F;  3R8B A;  1XLN A;  1XF5 L;  1JWB D;  2KN4 A;  1ZUD 2;  3MP9 A;  2WXO A;  1ZPS A;  3ZJT A;  4A90 A;  4C56 C;  1T6B X;  1PFD A;  1MVK A;  1ET9 A;  4ARC A;  1PGX A;  4LK0 M;  3R2I A;  1FMA D;  4Q2J A;  2JYE A;  1CQV A;  1V97 A;  4TSS A;  2MJ3 A;  4ARI A;  3BVG A;  3W5U B;  1D4B A;  1JCK B;  2J4X A;  4OZC A;  1VDV A;  1EM7 A;  4ZRP A;  2I2Y A;  2ON8 A;  4C80 A;  1HZ5 A;  3P42 A;  3C8Y A;  1SXT A;  3IT4 B;  4XWW A;  2W3R A;  2LHD A;  3H8H A;  3J9C A;  2AQ1 B;  4RNA A;  1VLB A;  1SB3 C;  5BYQ A;  2QJL A;  3ZGZ A;  4NAM A;  1QOB A;  3CIR B;  1SJE D;  2V3N A;  2WDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...