3IXSA

Ring1b c-terminal domain/rybp c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPMELYYAPTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RING2
publication title Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 111
sequence length 111
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.430 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ixsA00
3H8HA 3GS2A 3IXSA
chains in the Genus database with same CATH superfamily
3B9JA 1OFFA 5HFYA 2KJHB 2FCMA 3KUDB 3QWZB 5BMIA 3LJ3A 2VZKB 1XEEA 1WZ0A 1RFAA 4G50A 2IO2B 3DVNU 3PSEB 3PRMB 2INCC 3Q3FA 2IY0B 4BBNF 2HJ1A 5J18A 3UQBA 2L1AA 3TEYA 1Q5WB 3DCGA 2L0FA 1XF5L 2J42A 4GGQA 2JX5A 3EUB2 1YN5A 1FCCC 3Q8FA 3Q3NC 3ZRCA 2BF8B 2BS2B 2CJOA 3JSVB 4NNJB 3PV1A 4GIVA 2J0JA 4KDLB 2MCNB 4G3XB 3DWMA 1NBFC 2HTME 1I4PA 2GBMA 2LXAA 3ABVB 4IM3A 4IWPA 2NPTA 4DDID 3AE7B 2N1WA 1FO4A 1MHHE 1Y56A 3Q8BA 4FJYA 3BVZA 2XK5A 1WI0A 4M0WA 2V4LA 3JW0X 3VUXA 1GC7A 5IA7A 1TS4A 3AE8B 2MJ3A 2LUEA 2BWES 1SGHA 3KQ4A 3Q6BA 4ZHPA 3PREA 4E3CA 1B9RA 2VH1A 4BVUC 1HQRD 4KGSA 1ZDXA 4KZ0A 2BGFA 3MFGA 3Q2AC 3N1ZC 1VZ7A 3NS1A 2KLGA 2WX1A 1E7UA 2KX3A 4HWIB 1V49A 2FBWB 2O6VB 4C00A 1VRAB 5L83A 2M1MA 2WXRA 3CSTA 1WFYA 1T6BX 1AYFA 2IO0B 2JQRB 2BB6A 5E6OA 2Z0DB 1WGDA 1TYGB 4F8CB 2N4FA 4WWNA 3N1YC 2LJIA 3IT6B 1V1PA 2K8HA 1WM3A 3WAOA 5J17A 2ZCBA 2MLBA 3KLSX 2LGXA 3VVWB 4GDLB 2KFKB 3R7RA 1VZ8A 1YQBA 2LGSA 1TS2A 4GXBA 1AW7A 4N9F4 3AV8A 2MRPA 2INDC 4YTNB 2INPE 1QOBA 4IUMB 1KH0A 3IBEA 1KLUD 4DXFA 3N30A 4C4VB 2WGSA 1FNVA 5BYRA 4A90A 5AZHA 4LCDE 2KFJA 1S1QB 3CF6E 2Y5CA 3P4QB 3T9LA 3QIJA 1YN3A 2KN5A 2NCNA 2AQ2B 2LGDA 4FBJB 3I63C 2QHOA 4HDOA 2DYOA 1TGZB 4GLSC 2CS4A 3RI7C 2QSDA 3ZDMC 1NYRA 2PKOA 3GZNI 4KGRA 2RSUA 2NR2A 4MM3B 1FMAD 2GRIA 3Q3JA 3W5UB 2L83A 3DVNV 1F2RC 1LQBA 1AWDA 1JW9D 2DAFA 1QQRA 4C80A 2J0KA 4FJZA 1J7CA 3ZW3A 1VLBA 1ZP0B 2K39A 4RM8A 2C7NB 2IYDB 2EELA 2PLPA 2WQYB 4FADA 4TUUA 3U8ZA 4HROA 2AQ1B 1P9DU 2IZVB 2ZPNA 2WXKA 4NPNA 4LJPB 3WA0A 2IBIB 1T5XD 4I6LB 3WANA 2PE6B 5BMGA 2J52A 1DOIA 3T3NA 2WU2B 3RZWC 3ZYYX 1UD7A 2MP2B 3MC9A 4FHKA 1SE4A 2KTRA 5G5GA 1L0VB 2KOXA 2YEPB 3FILB 4ARCA 1KM7A 2D3BA 3TBLD 2M19A 4ZRQA 1H4RA 2WXGA 3W2DA 1J7AA 3PZDA 1TS3A 3ALBA 2M8SA 2ONQA 1OQQA 2ZJDA 4PK1A 1A70A 4O1NA 1R7SA 3KWVA 1ACCA 2WXIA 4M02A 2FIFA 3Q8CA 4OZBA 2NBVB 3IG3A 4AUQC 3MHSD 2FUG1 5FR6A 3P1MA 2J4XA 3VR8B 2M4NA 2K25A 4RNAA 2MP2A 4JL9A 3IAM1 1WJ6A 4MSQB 2D3CA 2KKCA 2BQQA 2MBHA 2EMTA 1SE9A 3BINA 1N6ZA 3PRZA 4K1RB 3SEBA 5LXIB 3Q69A 3A33B 1TTNA 2BW2A 4WWPA 3DPDA 3HVDA 1R4NB 2B3AA 1TY2A 3I3TB 3PRPB 2LD9A 1YOVB 5E6PA 5CTRC 5L95C 3D32A 3VFKA 3QK0A 1WE7A 1ENFA 4YL8A 3AEBB 3BY4B 4F1SA 1QKZA 1GAQB 2AL3A 4PS8A 3VDZA 4IOIE 3A1QB 4FA6A 1I4GA 2DNFA 4JE3B 2MBBB 4GSWA 1PUTA 1PFDA 1WY8A 3NZ3A 5JZEB 3VTUA 3L16A 3VRAB 1NVID 2C9WB 3M63B 4LK0M 1ZGUB 3ZXRA 2YLMA 1F0ZA 1V6EA 1E9MA 3H6NA 2WYQA 3MJWA 1H8CA 2CR5A 1C79A 3TL5A 4CQNA 1J19A 2PVGC 3JVZX 4IM0A 4K7UA 1SB3C 4YSZB 2CU3A 5D3IB 4W9FA 1V5OA 3H7PB 3QHTA 2KDFB 1WXVA 3NVYA 3N9YC 1L0XB 4JX1C 4AWJA 4HEA1 3A9JB 1WXAA 1QOFA 2KDBA 3DBLB 3C8YA 2K22A 3T3OA 1T0YA 4MSMB 2JT4B 1E8WA 1TKEA 3TJPA 3QAQA 4P7IA 1WM2A 2C60A 2REXA 1FRDA 1BMLC 3JYUA 3UIOB 2V0GA 2MBEA 2LJ5A 3GE8C 2RDBC 2N9KA 2WXFA 5CHVC 3WAMA 2KMAA 4W9EA 2NVUI 3PZ7A 1VCBA 2DX5B 4MGZE 2KQSA 3S2AA 1GG3A 3H7PA 2J7QB 2C5LC 2J53A 4A9AA 1GPXA 3TCAA 2O2VB 2KVZA 3PS6A 4P16A 2KACA 4F7ZA 2BB5A 4GU2A 1RWSA 3AB5A 1TZOA 1WR6E 1JWAD 2DZMA 2WDVB 4B0EA 2RPVA 4RGNA 3KVFB 3L4PA 1YNTE 2CKHB 4XGAB 1WXMA 4I6PA 4XE0A 2ZW1A 2AWTA 2GB1A 2K8BA 1IGDA 3MP9A 4PS7A 3RNAC 3R7QA 3B0AA 1TT5B 4EFOA 2N7JA 1ZOYB 2ZVNA 3DWGC 3TEWA 1UNSA 4AQ7A 3NUHB 1VDVA 3W1SA 2EMSA 3DBHB 1XCTL 4WAAA 4MJSA 2O2VA 3W1SC 1F52A 1GJZA 1QZEA 3OAWA 4DXAB 4UDUC 1ET6A 1N5XA 4ACFA 1M4VA 2PE9A 2V4IB 1WGYA 1CK1A 2AYOB 2C7MB 4B0MA 5BYSA 2LUMA 3EA6A 2G4SA 1J0GA 1AARA 1WRDB 2MJDA 2K6QA 1BT0A 3VQIA 3DBSA 5IO9A 3IHPC 1D5MC 4BBNC 4DQOC 3P4RB 4FJVB 1I4HA 1KLGD 2DZKA 2D07B 1D6EC 3UF8A 1RLFA 1WRIA 2NPTB 3KYDD 1UF0A 4ICUA 1E10A 3PHXB 2QDFA 1WXQA 3V61A 3ZUNA 3RT3B 1CMXB 3A4RA 3R2TA 2B76B 2XK5B 2ZCCA 1Z5SB 4M0WB 1OEYJ 4B9KA 3RPFC 3ZJVA 1LGRA 2RD0A 3HVZA 2KJ6A 2EKEC 1JRUA 3L0WB 2KDEB 3RNFC 3BWUD 4OZAA 3ZO5B 3GE3C 3LYYA 5KHQA 4DDGD 2PEAA 3P4SB 2BKRB 1RM6C 2GBKA 4L1BA 1F9JA 4K7WA 1U4AA 5MPOA 2IDYA 3DHIC 1YN4A 2DBYA 2KC2A 4CO7A 4HCPB 4DHJD 3NJTA 2KAJA 4HPLB 2KNBA 4HK2A 3TSSA 4X57B 1FM0D 2XBBC 4LDTD 4W9HA 1EF5A 3OWEB 1X1MA 1D4BA 2HDEA 2BYEA 2ZW0A 2NBWB 2WWZA 5I4DA 4J3OD 4OZCA 1V80A 4RFBA 2CHWA 2FE8A 1HZ5A 1Q10A 1V1PB 2Y3AA 2FCNA 4KIKB 3L17A 4FLHA 4MACA 3RNEC 3NVZA 1IBXA 4RGTA 3ZLZA 2JYEA 2MW5A 2R2OA 3PPAA 3PLUA 1T0SC 4REZA 1XCQL 2GBRA 4K3BA 5D3DA 3RYTA 5HI1A 4BOZB 1D3ZA 1CQVA 2V9HA 4A6QA 4ZYNA 2HD5B 2ICIA 1FPYA 3KW5B 4ZRKA 2KT7A 3SU8X 4LNIA 4K81A 3IAS1 2MHJA 1E5WA 4US9A 2PW9A 1V8CA 3IVFA 2L32A 1YQ4B 3P4PB 4GB9A 3L10B 2KZRA 4KIKA 2M0XA 5D94A 2L05A 4IDIA 2WXNA 1JROA 5FKAC 3X0WA 1ISNA 1ZKHA 2H89B 3EHVA 3K9OB 4KX6B 4RF0A 3VTVA 3ZDTA 2L76A 2L00B 1NDDA 2JYTA 2WXHA 3VHTC 3DHHC 3DBRB 2QEJC 4A8XC 1P0RA 2WXMA 1JQ4A 2PTLA 1V9JA 4RH6A 1M94A 1ROEA 1MJDA 4HJGE 4FULA 4K3CA 5FR3A 3UIPB 2D11A 3RD2A 4K7SA 4WWOA 5DPWA 1WR1A 1RFKA 5E6NA 2N7EA 2R2QA 3BVGA 1FD6A 4ZYSA 1IYFA 1WWTA 2QCZA 4DHZB 4BAXA 4ZRIA 3W1YA 2CJNA 2K9XA 2IY1B 3RN9C 2LI5A 2SAKA 1E0ZA 3PT2B 2L3ZA 3U7DA 3H7SA 2LGYA 2I38A 3B1LX 3FKYA 2W3SA 1TIFA 3ENEA 1XO3A 1UELA 1UWMA 1OEYA 1XT9B 2KTRB 3TEXA 3PO0A 2NMQA 4MGKE 1C9FA 2RMMA 2WDQB 1UGMA 2WNMA 1QILA 2N1VA 3MJ5A 2WDRB 1MPEA 5C1ZA 3BIID 5EDSA 4HVBA 2DHZA 4DWFA 2JZZA 4DXGA 5J2RA 2MWSB 3SHQA 4YWGG 2ZNVC 3W5VB 2KQ7A 2D10A 3EFUA 2BYTA 3C0RB 2KWUB 1P3QU 1VR9A 1K8RB 2KYWA 5H8YE 5G55A 3QCAA 3AE1B 4MH0E 4WIPA 1ZXHA 1SEBD 3NHEB 5JHBA 2V3PA 2XN9C 4A20A 1FXTB 3WIMA 2ON8A 3W9CB 4JGHB 4Q2JA 3ZNGC 1L7YA 1WF9A 1V2YA 2KN4A 3V05A 2LHEA 1IPGA 1TJEA 2UU7A 2DYMA 4FXCA 3ZTCA 3VH3B 2NBUA 4NJ6A 3ECIA 1JCKB 1S3SG 3DHGC 3RCZA 2KWDA 2KO3A 2LVQA 2DZJA 1WE6A 2A5UA 3GOEA 2HJ8A 3CIRB 3VXWA 2JRHA 3L13A 2KC1A 2K3UA 1L2NA 4JQWC 2LMCA 2FCSA 3EFCA 1WSPA 3ETRA 4ANUA 2BTEA 2BPSA 4GDKA 2L52A 3PHWB 3MC0B 1YX6B 1K51A 2W3RA 4BOSC 1TS5A 3BK2A 2KLCA 4HLEA 1E8XA 2V1YA 1WJ4A 4EKUA 3AE2B 4IWQA 1C1YB 3OJ4B 1E6EB 1OQRA 2LZ6A 4RGOS 4US8A 4C7ZA 1FRRA 2OOBB 1T0RC 1FFUA 1PGBA 1LM8B 3DOWA 1C3TA 2KVRA 2AQ3B 5IN7A 5FK9C 4TV3A 3O65B 2KHWB 5EE9A 3DQVA 3LB8C 5CHWA 1GNUA 2WXLA 1R4NI 3PVLA 1WMHA 2FAZA 4NAWB 2ZVOA 5TSSA 3C19A 5C23A 4IC7B 2ACZB 4PT5A 1V86A 3SFDB 1DOYA 3P63A 1C78A 2LHDA 2LASA 3V6CB 2YEPF 1NEKB 1E8ZA 3AE5B 2K1FA 5AZGA 4OW0A 1C4PA 4EEWA 4B95A 4C7YA 1WJUA 2H88B 2I1JA 5JXVA 1MG4A 4N58A 1J7BA 4NAWA 3Q14C 5G5HA 2LVPA 1Q0WB 4KSKC 4HJKA 2KX0A 2RDHA 1SBBB 1K53A 1IP9A 2KDIA 4WQMA 2JUOA 3U4EG 4HRSA 2W82A 5LXHA 1SF0A 1PGXA 4EZJA 2BVCA 4TSSA 3K9PB 4EUTA 1GOZA 3R66C 2DYBA 1SSNA 3PGEA 1A5RA 2NTSA 3SFEB 1VD2A 2LVOA 2KANA 3AMZA 4PYUA 5D2MB 2GLSA 3VTWA 5G2NA 3QA8A 2JF5A 2K0PA 1GC6A 4DBGA 2M0AA 3DBLI 3WALA 2QILA 3LXFA 2GOWA 4ARIA 3CMMB 3PLVA 1J8CA 4ANWA 1TY0A 2KD0A 3AE4B 2JRIB 2WDTB 1PGAA 3AXCA 3PZ8A 4DK5A 4OHJA 1KRHA 2FUHB 4HPPA 4MJSB 4JLCA 1I42A 1JWBD 4WJNA 5AZFA 2A4ZA 4WJPA 1QOGA 2DENB 2MH7A 1E7VA 3N32A 3HM6X 2OJRA 4HKQA 3P2BA 2KWCA 4OVUA 1SIJA 3AE9B 4JIOU 3UI3A 4ITKA 4ICVA 2N0SB 5IOIA 5T8IA 3V62A 3R8BA 2IO3B 2XEWA 3QJZA 1HTQA 2XNAC 4QAYA 1ESFA 5GXGB 4MELA 1JWSD 3ZJTA 4RMAA 1ZDVA 2JZPA 1C4AA 1ZE3D 4LNFA 1ZPSA 1R4MB 4XX5A 4W9DA 3DBHI 2MEKA 2AX5A 2LRWA 1L4DB 3AU5A 1IUEA 3WCQA 1FNUA 4IWOA 4WAFA 1E8YA 4GMVA 4P6VF 2WP9B 3Q3OC 2G9HD 5IAAC 2BBCA 2MSED 3AN1A 4XYCA 4FN2A 1WGHA 4A55A 2WXQA 3KH0A 4XWTA 3AM9A 2L7RA 3J9CA 4MGYE 1SIFA 1VZ6A 3B2GA 3MC8A 4NQLB 2KDMA 4PS3A 3MHZA 4YT0B 5H92C 2AL6A 3NZSA 2K8CA 3NVWA 4KDIC 5JH5C 1XXGA 1CZPA 3BZDB 1KTKA 3QQ8B 1K52A 1Q1OA 3A9KB 4XZ4A 3L54A 2PPHA 1V81A 3LDZE 1UZXB 4W9CA 2L0TA 2RPQA 4KGTA 1I35A 5HG2A 2OHFA 4LNOA 1QF6A 3ZKJC 3CWIA 3GS2A 3NRZA 1DOXA 1F77A 2JY6A 1KOTA 4KKIA 2VRRB 4TQ1A 3ZTDA 2WX0A 2WLBA 4II2B 2Q5WD 3GB1A 4S17A 3ZJUA 2MX2A 2D5GA 1IBXB 1HTOA 3B2FA 4XDCA 2G1EA 1UBQA 3EC8A 1MVKA 2D3AA 2IPKD 1G6JA 1WX7A 4GN1A 2BKFA 1ET9A 1SXTA 3R3MA 5CHFA 4NY0A 3O13A 3A9KA 1T0QC 5DCNA 3H1UA 1FEHA 3RNGC 2KXJA 3ONSA 3FAHA 3VH4B 2UWQA 3FC4A 2BS4B 4EOYA 1WGKA 1SE2A 1DYQA 1FFVA 1NI3A 2JVCA 1V97A 2O6VD 1MHXA 2MA9B 2WXJA 3KUZA 1STEA 1XD3B 4W9LA 4II3B 2RGFA 4E74A 3RZFA 3L08A 5C2TB 3HRDD 4L2YA 4DHJB 3NS8A 4HPMB 1EU4A 4HKZE 1L6UA 4MEMA 3TEZA 5IP4D 3AEGB 3M95A 2DWQA 1UGJA 4LNKA 3CSFA 4IW0A 4KVGB 4LDTB 1V5TA 3KYCD 2G4DB 3DVGX 1P98A 1UUPA 2JWUA 4YTMB 3HUIA 5BMHA 3JSVA 1YD8U 4TMAB 2N9XA 3AH7A 3AE3B 2LFIA 4W9GA 2TSSA 4M00A 1HE8A 4L23A 4C56C 2BS3B 2V3SA 3Q8EA 2JXTA 5EE1A 1MI0A 2GBNA 2LRUA 3QARA 1WXSA 1L4ZB 3ZQ4A 2OJWA 1RAXA 3I57A 2KTFA 3KWLA 2AEHA 2KMMA 4TQ0A 4N59A 1F1HA 2K5PA 2FNJB 4BKTA 1FXAA 4P1CC 4WURA 2PIAA 4NZLB 2BYFA 4A3PA 4TKNA 4ZOHC 3RNBC 2G45B 5LLIA 1WH3A 2RDGA 3DBRI 3Q3MC 2JSVX 1KLVA 1OTRB 1CJEA 2LXCA 1F2RI 2W55A 2JPHA 4XDDA 3P42A 2Y5BB 1HA5A 2LEKA 3TUOA 3E9SA 3U7ZA 4MH8A 2BYVE 2W9NA 1ZXIA 2O6VA 2ZNVB 2ASQA 4ANXA 1KF6B 1TKGA 1YJ1A 2DZIA 1WYGA 4OVVA 5E6JA 3NOBA 2PJHA 5BO4B 4WH4A 4ZHOA 1NYQA 3ZNHB 2N9PC 3TMPB 4LNNA 3UINB 3URYA 1QT9A 1WYWB 3ZIMA 3H9DA 4R3DA 4G0NB 1K50A 3HK0A 1JALA 1Y8RC 2DLBA 3OJ3A 4GOCA 2JZ3B 3ML8A 2I2YA 1YIWA 2PVOD 3AEEB 1JRPA 3U30A 2BT6A 3HIZA 4BFRA 4JWUC 1FCLA 3RULA 1ZUD2 1FXIA 2HTHA 1N5WA 1UWXA 2M17A 3V3XA 4GDLA 2KFKA 4JWSC 4ZRPA 3U52E 3GZNB 1L6VA 1EUVB 2IGGA 2IJ0A 3ZXVA 1ZW7A 4NQKE 4ZDVA 1BUIC 3AULA 3M62B 3OLMD 1XLPA 5HKHA 1TZ1A 4MT5A 4BKSD 3SR6A 4GDKB 1V1OA 2QC8A 4P1BC 4RM9A 1I4RA 4I6NB 1HEZE 2G3QB 2N7DA 4C4VA 5AEKB 2E3TA 4YSXB 1OQYA 5IKCM 3B08A 1LXDA 4XC2A 1JWMD 1FNWA 4M8NA 2UYZB 3ZRFA 3ZVVA 2FCQA 3ZNID 4ZRJA 3SD5A 3VUYA 2SEBD 3HHMA 3M3JA 3QC8B 1EWYC 1RRBA 2IGHA 4YTPB 4M01A 2KWVB 1N62A 1N63A 1P1AA 3ZGZA 4CYEA 5C3JB 2QMTA 1L5PA 4MM3A 5TR5A 3A4SC 1WMHB 1XLQA 4N6EB 1XLOA 4D2KA 3X23A 1UH6A 5KHOA 2GI9A 1LFDA 2OEDA 2CU1A 1AN8A 2WXPA 2Z59B 4USAA 4KZCA 2CHZA 1MG8A 4W9JA 4AOFA 1IGCA 3TIXA 2Y5PA 4XWWA 4YSYB 4LTUA 3GP7A 2QIEB 2YVCA 1WX9A 1YX5B 2C7HA 2NTTA 1I4XA 4HXDA 3MTNB 2PMVA 3NVVA 3EECA 1YJJA 1QOAA 3AEDB 3EGRA 1TKYA 5D7GA 4BKSA 2IO1B 4M8MA 3E56A 3FILA 1P7FA 2X8XX 3AE6B 1B1ZA 4E71A 2NS5A 1C76A 2L8JA 1TBEA 3KUCB 2KMCA 4OVZA 5JHAA 4AJWA 2X38A 2LWPA 2R61A 2M56B 2E6XA 4JPSA 5GMVA 4FHJA 2WU5B 4MGIE 4RGMA 1N60A 2ZZPB 3APDA 3VUWA 1WIAA 4B6WA 2ZEQA 1EM7A 1XQQA 1YMHE 5LNK1 3UGBB 1WGRA 1I7HA 5AUIA 1GB1A 3NZUA 3I5JC 4AJYB 1HXYD 2Z0EB 4WQOB 4H2AA 1MFWA 4BKGA 2EKIA 3SDLC 4WJOA 5HHDG 3R2IA 2CHXA 4ANVA 1SJHD 2WS3B 5DPSA 1E7PB 4IKGA 4RCOA 3IT4B 1RYJA 1PDXA 1FIQA 2Z8LA 1I4QA 4S0RA 2RR9A 3Q8AA 3BYYB 2BWFA 4URKA 1C77A 1NENB 2MJEA 2D3GA 4EZKA 3IXSA 4LJOB 2GBJA 3V60A 2GMIC 1LO5D 1L0YB 2JXXA 3A1QA 4HDQA 1D5XC 1SJED 3U2SC 2KQ4X 1Z2MA 1KJTA 1YJIA 2LGIA 4W9IA 3HM3A 1XLNA 4MDKE 3PTFC 4IM2A 3AI5A 2IGDA 1P7EA 4HCNB 1GUAB 2FIDA 1EO6A 5EE0A 3I9V1 3RUIB 3RMKC 1E90A 1EF1A 4AS1A 1YQ3B 1EU3A 4DHZE 3H8HA 3RFZB 2MBQA 3AEAB 5BYQA 3RNCC 1N61A 4ASWC 3N1XC 4YXDB 1WGGA 3AU4A 2JU6X 4NJCA 1HZ6A 3N20C 2W54A 2DAJA 3AECB 2N9EB 1WZ3A 3APFA 4RF1A 3OG5A 4EE2A 3DDCB 4CHKA 5D6JB 1WX8A 2K6DB 5AUKA 4WWMA 1PQSA 2KJRA 3BYTB 4EZLA 5EE3A 1T3QA 1C4CA 1WJNA 3A9JA 3DVGY 3APCA 3NG0A 1OGWA 2ZPYA 4PYZA 3VR9B 3VRBB 3NY5A 4WJQA 1SE3A 3AEFB 4KSLC 3ZNZB 2MBOA 1R4MI 3QX1A 4KKJA 3N3KB 2INNE 3T8MA 1KFYB 1D5ZC 4LLGM 3VAWA 2D2QA 1UBIA 3BK1A 1JMLA 2JWZA 4J6IA 3ML9A 2V3NA 2MQJA 4W9KA 2I1KA 1JWUD 4KV2A 3BVMA 2VZKD 5DPTA 1BXTA 4IG7B 4NAMA 1VJKA 1DGJA 3V6EB 2WXOA 4G11A 2N9LA 1NI2A 3IFWB 1GB4A 2WHIA 4NJ7A 3UQAA 4A3OA 2KK8A 1PYWD 2J0MA 5CX3A 2VH2A 1QLBB 1EWCA 4AP4C 2HE7A 5DPRA 2QJLA 3WAPA 4BZAA
chains in the Genus database with same CATH topology
1L0XB 3B9JA 2PIAA 4WURA 3CIRB 1OFFA 4NZLB 5HFYA 2K3UA 4JX1C 5BMIA 2LMCA 4ZOHC 4HEA1 1WSPA 2RDGA 2VZKB 3ETRA 1XEEA 2BTEA 2JSVX 1CJEA 2L52A 1QOFA 3MC0B 1F2RI 1K51A 2W55A 2W3RA 2K22A 3C8YA 3P42A 4XDDA 3T3OA 1TS5A 3BK2A 1HA5A 2LEKA 1TKEA 3TUOA 3E9SA 2L1AA 3TEYA 3U7ZA 1FRDA 1BMLC 4MH8A 3AE2B 2V0GA 1ZXIA 1XF5L 1E6EB 2J42A 1OQRA 4RGOS 4US8A 4C7ZA 1FRRA 2N9KA 2WXFA 1KF6B 1TKGA 2JX5A 1FFUA 3EUB2 1PGBA 1YN5A 1WYGA 1FCCC 3PZ7A 3Q8FA 5E6JA 2AQ3B 5FK9C 4WH4A 5EE9A 4ZHOA 1NYQA 2J53A 3LB8C 2BS2B 4A9AA 1GPXA 2CJOA 3URYA 1QT9A 2WXLA 4R3DA 1K50A 1JALA 2DLBA 4P16A 4NAWB 3DWMA 2KACA 2BB5A 2HTME 1I4PA 5TSSA 1RWSA 2I2YA 3ABVB 2PVOD 3AB5A 3AEEB 1JRPA 3AE7B 1TZOA 1JWAD 2ACZB 2WDVB 4PT5A 2BT6A 4B0EA 2RPVA 4JWUC 4RGNA 3L4PA 1YNTE 3SFDB 1FO4A 1FCLA 1MHHE 1DOYA 1ZUD2 1FXIA 1N5WA 1UWXA 1Y56A 3Q8BA 3P63A 2ZW1A 4XE0A 3V3XA 1C78A 2LHDA 3BVZA 4JWSC 4ZRPA 2GB1A 3U52E 4M0WA 1L6VA 2IGGA 2IJ0A 1TS4A 3AE8B 2YEPF 1IGDA 3MP9A 2MJ3A 1BUIC 2N7JA 3KQ4A 1NEKB 1ZOYB 4ZHPA 3AE5B 1XLPA 3DWGC 3TEWA 1B9RA 4OW0A 1UNSA 1C4PA 4MT5A 3NUHB 1VDVA 3W1SA 4AQ7A 1XCTL 3SR6A 1HQRD 4GDKB 1V1OA 4C7YA 4KGSA 1ZDXA 1I4RA 2H88B 1HEZE 3MFGA 4N58A 5JXVA 4UDUC 1ET6A 1N5XA 1J7BA 2E3TA 4YSXB 1VZ7A 5G5HA 3NS1A 1M4VA 2V4IB 1JWMD 1CK1A 1FNWA 2FBWB 2RDHA 4B0MA 1VRAB 1SBBB 1K53A 5BYSA 2LUMA 3EA6A 2SEBD 2WXRA 4WQMA 1EWYC 3U4EG 1T6BX 4HRSA 2IGHA 2MJDA 2W82A 4YTPB 1SF0A 1PGXA 1AYFA 1N62A 2JQRB 1N63A 4TSSA 2BB6A 3VQIA 3ZGZA 5C3JB 1GOZA 2QMTA 1D5MC 1SSNA 1L5PA 1TYGB 4DQOC 2NTSA 3SFEB 3P4RB 1XLQA 4N6EB 1XLOA 2LJIA 3AMZA 4D2KA 1I4HA 1V1PA 3IT6B 1KLGD 1D6EC 2GI9A 1WRIA 2OEDA 1AN8A 2K0PA 2WXPA 1E10A 4USAA 2M0AA 1WXQA 3KLSX 2QILA 1IGCA 3LXFA 3R2TA 4GDLB 2B76B 4ARIA 2Y5PA 3RPFC 3ZJVA 3HVZA 4XWWA 1VZ8A 4LTUA 4YSYB 3GP7A 1TY0A 2QIEB 3AE4B 3N9YC 1PGAA 1TS2A 2NTTA 1I4XA 1AW7A 2PMVA 3BWUD 3PZ8A 3AV8A 4OZAA 4OHJA 1KRHA 3NVVA 4YTNB 2INPE 1YJJA 1QOAA 3AEDB 3EGRA 3LYYA 1QOBA 1TKYA 3P4SB 1KH0A 1JWBD 5D7GA 1KLUD 4DXFA 1QOGA 1RM6C 2MH7A 3E56A 3FILA 4L1BA 1FNVA 5BYRA 4A90A 1P7FA 4HKQA 3AE6B 1B1ZA 5MPOA 1SIJA 1C76A 2IDYA 3AE9B 1YN4A 2DBYA 2Y5CA 3P4QB 1YN3A 2AQ2B 3UI3A 2KAJA 4ITKA 2N0SB 4OVZA 2DYOA 5T8IA 3TSSA 2X38A 3R8BA 4GLSC 1FM0D 2QSDA 2R61A 1NYRA 2PKOA 2M56B 3OWEB 2E6XA 4JPSA 1D4BA 2HDEA 4RGMA 2WU5B 2ZW0A 4KGRA 5I4DA 1N60A 4J3OD 2XNAC 4OZCA 4MM3B 1ESFA 5GXGB 1JWSD 4RFBA 3ZJTA 1FMAD 2GRIA 1EM7A 1ZDVA 2FE8A 2JZPA 1HZ5A 1Q10A 1C4AA 2L83A 1YMHE 1ZE3D 1V1PB 3W5UB 1ZPSA 2Y3AA 1F2RC 5LNK1 1AWDA 1JW9D 1QQRA 4C80A 1I7HA 4MACA 2MEKA 5AUIA 2AX5A 1L4DB 1GB1A 1IUEA 1J7CA 3NVZA 1IBXA 1VLBA 1ZP0B 4RGTA 2JYEA 3WCQA 1FNUA 4WAFA 1HXYD 2EELA 2PLPA 2WQYB 4H2AA 4P6VF 2EKIA 2WP9B 4HROA 2G9HD 2AQ1B 4REZA 1XCQL 5HHDG 3R2IA 2BBCA 5D3DA 1SJHD 2WXKA 5HI1A 2WS3B 3AN1A 1T5XD 1CQVA 4A6QA 1E7PB 4IKGA 4RCOA 5BMGA 2J52A 2ICIA 3IT4B 1RYJA 4A55A 2WXQA 1DOIA 3T3NA 2WU2B 1PDXA 4XWTA 3AM9A 3ZYYX 1FIQA 3IAS1 2Z8LA 1I4QA 3J9CA 4US9A 3Q8AA 1VZ6A 3B2GA 3BYYB 1SE4A 2KDMA 5G5GA 2PW9A 1L0VB 1V8CA 2YEPB 2L32A 1YQ4B 3FILB 3MHZA 3P4PB 4YT0B 4ARCA 1C77A 5H92C 1NENB 2MJEA 3NVWA 3IXSA 1XXGA 2M19A 4IDIA 1LO5D 2WXNA 4ZRQA 1L0YB 1D5XC 1CZPA 1SJED 3BZDB 1JROA 1KTKA 2WXGA 3U2SC 5FKAC 3W2DA 2KQ4X 1J7AA 2H89B 1K52A 1TS3A 4KX6B 1YJIA 4RF0A 2LGIA 2JYTA 2WXHA 2ONQA 1OQQA 4KGTA 1A70A 4O1NA 1XLNA 1R7SA 5HG2A 3KWVA 2OHFA 1ACCA 2QEJC 2WXIA 1QF6A 4A8XC 3CWIA 2IGDA 1P7EA 2WXMA 3Q8CA 4OZBA 3GS2A 1JQ4A 2PTLA 3NRZA 2FUG1 4RH6A 1DOXA 1F77A 3P1MA 2J4XA 5EE0A 1ROEA 3VR8B 3I9V1 4RNAA 4HJGE 4KKIA 4TQ1A 5FR3A 4AS1A 1YQ3B 2WLBA 3IAM1 1EU3A 2Q5WD 3GB1A 3ZJUA 2D5GA 3H8HA 1RFKA 3RFZB 1IBXB 3AEAB 3B2FA 4XDCA 5BYQA 2G1EA 3BVGA 1MVKA 2IPKD 1FD6A 4ZYSA 1N61A 1WWTA 1ET9A 4YXDB 1SXTA 2JU6X 4NJCA 1HZ6A 2W54A 3AECB 2CJNA 3SEBA 3Q69A 2K9XA 4RF1A 2BW2A 3O13A 2SAKA 4EE2A 1E0ZA 3HVDA 1TY2A 1FEHA 5AUKA 4WWMA 3BYTB 2I38A 3FAHA 2W3SA 5EE3A 1T3QA 1C4CA 1XO3A 3FC4A 2BS4B 1ENFA 1UWMA 1WGKA 1SE2A 3TEXA 3PO0A 3AEBB 3VRBB 1DYQA 2NMQA 3VR9B 1C9FA 1SE3A 1FFVA 2RMMA 1NI3A 2WDQB 3AEFB 1V97A 2WNMA 1QKZA 1GAQB 1QILA 1MHXA 2WXJA 3MJ5A 4KKJA 2WDRB 1MPEA 4IOIE 2INNE 1KFYB 1STEA 1D5ZC 3BIID 1I4GA 4LLGM 4DXGA 5C2TB 4JE3B 3HRDD 4L2YA 4YWGG 1PUTA 1PFDA 3NZ3A 1EU4A 3BK1A 3W5VB 4HKZE 1L6UA 3TEZA 1JMLA 3AEGB 3VRAB 1NVID 4LK0M 2DWQA 1UGJA 2V3NA 2BYTA 1F0ZA 1E9MA 1VR9A 5H8YE 1JWUD 1UUPA 2JWUA 4YTMB 3AE1B 3HUIA 3BVMA 5BMHA 4WIPA 2VZKD 1ZXHA 1SEBD 4TMAB 1BXTA 3AH7A 2V3PA 3AE3B 2XN9C 2LFIA 4NAMA 2TSSA 2ON8A 4L23A 1C79A 3W9CB 4C56C 4Q2JA 1VJKA 2BS3B 1DGJA 3Q8EA 2JXTA 5EE1A 2WXOA 2N9LA 4CQNA 1MI0A 1GB4A 2KN4A 3V05A 2LHEA 2PVGC 1L4ZB 3ZQ4A 1TJEA 2DYMA 4FXCA 1SB3C 4YSZB 2CU3A 3I57A 1JCKB 5D3IB 3KWLA 2KMMA 1PYWD 2KWDA 4TQ0A 4N59A 2K5PA 1QLBB 1EWCA 1FXAA 3NVYA 2QJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8H A;  3GS2 A;  3IXS A; 
#chains in the Genus database with same CATH topology
 3B9J A;  1OFF A;  5HFY A;  2KJH B;  2FCM A;  3KUD B;  3QWZ B;  5BMI A;  3LJ3 A;  2VZK B;  1XEE A;  1WZ0 A;  1RFA A;  4G50 A;  2IO2 B;  3DVN U;  3PSE B;  3PRM B;  2INC C;  3Q3F A;  2IY0 B;  4BBN F;  2HJ1 A;  5J18 A;  3UQB A;  2L1A A;  3TEY A;  1Q5W B;  3DCG A;  2L0F A;  1XF5 L;  2J42 A;  4GGQ A;  2JX5 A;  3EUB 2;  1YN5 A;  1FCC C;  3Q8F A;  3Q3N C;  3ZRC A;  2BF8 B;  2BS2 B;  2CJO A;  3JSV B;  4NNJ B;  3PV1 A;  4GIV A;  2J0J A;  4KDL B;  2MCN B;  4G3X B;  3DWM A;  1NBF C;  2HTM E;  1I4P A;  2GBM A;  2LXA A;  3ABV B;  4IM3 A;  4IWP A;  2NPT A;  4DDI D;  3AE7 B;  2N1W A;  1FO4 A;  1MHH E;  1Y56 A;  3Q8B A;  4FJY A;  3BVZ A;  2XK5 A;  1WI0 A;  4M0W A;  2V4L A;  3JW0 X;  3VUX A;  1GC7 A;  5IA7 A;  1TS4 A;  3AE8 B;  2MJ3 A;  2LUE A;  2BWE S;  1SGH A;  3KQ4 A;  3Q6B A;  4ZHP A;  3PRE A;  4E3C A;  1B9R A;  2VH1 A;  4BVU C;  1HQR D;  4KGS A;  1ZDX A;  4KZ0 A;  2BGF A;  3MFG A;  3Q2A C;  3N1Z C;  1VZ7 A;  3NS1 A;  2KLG A;  2WX1 A;  1E7U A;  2KX3 A;  4HWI B;  1V49 A;  2FBW B;  2O6V B;  4C00 A;  1VRA B;  5L83 A;  2M1M A;  2WXR A;  3CST A;  1WFY A;  1T6B X;  1AYF A;  2IO0 B;  2JQR B;  2BB6 A;  5E6O A;  2Z0D B;  1WGD A;  1TYG B;  4F8C B;  2N4F A;  4WWN A;  3N1Y C;  2LJI A;  3IT6 B;  1V1P A;  2K8H A;  1WM3 A;  3WAO A;  5J17 A;  2ZCB A;  2MLB A;  3KLS X;  2LGX A;  3VVW B;  4GDL B;  2KFK B;  3R7R A;  1VZ8 A;  1YQB A;  2LGS A;  1TS2 A;  4GXB A;  1AW7 A;  4N9F 4;  3AV8 A;  2MRP A;  2IND C;  4YTN B;  2INP E;  1QOB A;  4IUM B;  1KH0 A;  3IBE A;  1KLU D;  4DXF A;  3N30 A;  4C4V B;  2WGS A;  1FNV A;  5BYR A;  4A90 A;  5AZH A;  4LCD E;  2KFJ A;  1S1Q B;  3CF6 E;  2Y5C A;  3P4Q B;  3T9L A;  3QIJ A;  1YN3 A;  2KN5 A;  2NCN A;  2AQ2 B;  2LGD A;  4FBJ B;  3I63 C;  2QHO A;  4HDO A;  2DYO A;  1TGZ B;  4GLS C;  2CS4 A;  3RI7 C;  2QSD A;  3ZDM C;  1NYR A;  2PKO A;  3GZN I;  4KGR A;  2RSU A;  2NR2 A;  4MM3 B;  1FMA D;  2GRI A;  3Q3J A;  3W5U B;  2L83 A;  3DVN V;  1F2R C;  1LQB A;  1AWD A;  1JW9 D;  2DAF A;  1QQR A;  4C80 A;  2J0K A;  4FJZ A;  1J7C A;  3ZW3 A;  1VLB A;  1ZP0 B;  2K39 A;  4RM8 A;  2C7N B;  2IYD B;  2EEL A;  2PLP A;  2WQY B;  4FAD A;  4TUU A;  3U8Z A;  4HRO A;  2AQ1 B;  1P9D U;  2IZV B;  2ZPN A;  2WXK A;  4NPN A;  4LJP B;  3WA0 A;  2IBI B;  1T5X D;  4I6L B;  3WAN A;  2PE6 B;  5BMG A;  2J52 A;  1DOI A;  3T3N A;  2WU2 B;  3RZW C;  3ZYY X;  1UD7 A;  2MP2 B;  3MC9 A;  4FHK A;  1SE4 A;  2KTR A;  5G5G A;  1L0V B;  2KOX A;  2YEP B;  3FIL B;  4ARC A;  1KM7 A;  2D3B A;  3TBL D;  2M19 A;  4ZRQ A;  1H4R A;  2WXG A;  3W2D A;  1J7A A;  3PZD A;  1TS3 A;  3ALB A;  2M8S A;  2ONQ A;  1OQQ A;  2ZJD A;  4PK1 A;  1A70 A;  4O1N A;  1R7S A;  3KWV A;  1ACC A;  2WXI A;  4M02 A;  2FIF A;  3Q8C A;  4OZB A;  2NBV B;  3IG3 A;  4AUQ C;  3MHS D;  2FUG 1;  5FR6 A;  3P1M A;  2J4X A;  3VR8 B;  2M4N A;  2K25 A;  4RNA A;  2MP2 A;  4JL9 A;  3IAM 1;  1WJ6 A;  4MSQ B;  2D3C A;  2KKC A;  2BQQ A;  2MBH A;  2EMT A;  1SE9 A;  3BIN A;  1N6Z A;  3PRZ A;  4K1R B;  3SEB A;  5LXI B;  3Q69 A;  3A33 B;  1TTN A;  2BW2 A;  4WWP A;  3DPD A;  3HVD A;  1R4N B;  2B3A A;  1TY2 A;  3I3T B;  3PRP B;  2LD9 A;  1YOV B;  5E6P A;  5CTR C;  5L95 C;  3D32 A;  3VFK A;  3QK0 A;  1WE7 A;  1ENF A;  4YL8 A;  3AEB B;  3BY4 B;  4F1S A;  1QKZ A;  1GAQ B;  2AL3 A;  4PS8 A;  3VDZ A;  4IOI E;  3A1Q B;  4FA6 A;  1I4G A;  2DNF A;  4JE3 B;  2MBB B;  4GSW A;  1PUT A;  1PFD A;  1WY8 A;  3NZ3 A;  5JZE B;  3VTU A;  3L16 A;  3VRA B;  1NVI D;  2C9W B;  3M63 B;  4LK0 M;  1ZGU B;  3ZXR A;  2YLM A;  1F0Z A;  1V6E A;  1E9M A;  3H6N A;  2WYQ A;  3MJW A;  1H8C A;  2CR5 A;  1C79 A;  3TL5 A;  4CQN A;  1J19 A;  2PVG C;  3JVZ X;  4IM0 A;  4K7U A;  1SB3 C;  4YSZ B;  2CU3 A;  5D3I B;  4W9F A;  1V5O A;  3H7P B;  3QHT A;  2KDF B;  1WXV A;  3NVY A;  3N9Y C;  1L0X B;  4JX1 C;  4AWJ A;  4HEA 1;  3A9J B;  1WXA A;  1QOF A;  2KDB A;  3DBL B;  3C8Y A;  2K22 A;  3T3O A;  1T0Y A;  4MSM B;  2JT4 B;  1E8W A;  1TKE A;  3TJP A;  3QAQ A;  4P7I A;  1WM2 A;  2C60 A;  2REX A;  1FRD A;  1BML C;  3JYU A;  3UIO B;  2V0G A;  2MBE A;  2LJ5 A;  3GE8 C;  2RDB C;  2N9K A;  2WXF A;  5CHV C;  3WAM A;  2KMA A;  4W9E A;  2NVU I;  3PZ7 A;  1VCB A;  2DX5 B;  4MGZ E;  2KQS A;  3S2A A;  1GG3 A;  3H7P A;  2J7Q B;  2C5L C;  2J53 A;  4A9A A;  1GPX A;  3TCA A;  2O2V B;  2KVZ A;  3PS6 A;  4P16 A;  2KAC A;  4F7Z A;  2BB5 A;  4GU2 A;  1RWS A;  3AB5 A;  1TZO A;  1WR6 E;  1JWA D;  2DZM A;  2WDV B;  4B0E A;  2RPV A;  4RGN A;  3KVF B;  3L4P A;  1YNT E;  2CKH B;  4XGA B;  1WXM A;  4I6P A;  4XE0 A;  2ZW1 A;  2AWT A;  2GB1 A;  2K8B A;  1IGD A;  3MP9 A;  4PS7 A;  3RNA C;  3R7Q A;  3B0A A;  1TT5 B;  4EFO A;  2N7J A;  1ZOY B;  2ZVN A;  3DWG C;  3TEW A;  1UNS A;  4AQ7 A;  3NUH B;  1VDV A;  3W1S A;  2EMS A;  3DBH B;  1XCT L;  4WAA A;  4MJS A;  2O2V A;  3W1S C;  1F52 A;  1GJZ A;  1QZE A;  3OAW A;  4DXA B;  4UDU C;  1ET6 A;  1N5X A;  4ACF A;  1M4V A;  2PE9 A;  2V4I B;  1WGY A;  1CK1 A;  2AYO B;  2C7M B;  4B0M A;  5BYS A;  2LUM A;  3EA6 A;  2G4S A;  1J0G A;  1AAR A;  1WRD B;  2MJD A;  2K6Q A;  1BT0 A;  3VQI A;  3DBS A;  5IO9 A;  3IHP C;  1D5M C;  4BBN C;  4DQO C;  3P4R B;  4FJV B;  1I4H A;  1KLG D;  2DZK A;  2D07 B;  1D6E C;  3UF8 A;  1RLF A;  1WRI A;  2NPT B;  3KYD D;  1UF0 A;  4ICU A;  1E10 A;  3PHX B;  2QDF A;  1WXQ A;  3V61 A;  3ZUN A;  3RT3 B;  1CMX B;  3A4R A;  3R2T A;  2B76 B;  2XK5 B;  2ZCC A;  1Z5S B;  4M0W B;  1OEY J;  4B9K A;  3RPF C;  3ZJV A;  1LGR A;  2RD0 A;  3HVZ A;  2KJ6 A;  2EKE C;  1JRU A;  3L0W B;  2KDE B;  3RNF C;  3BWU D;  4OZA A;  3ZO5 B;  3GE3 C;  3LYY A;  5KHQ A;  4DDG D;  2PEA A;  3P4S B;  2BKR B;  1RM6 C;  2GBK A;  4L1B A;  1F9J A;  4K7W A;  1U4A A;  5MPO A;  2IDY A;  3DHI C;  1YN4 A;  2DBY A;  2KC2 A;  4CO7 A;  4HCP B;  4DHJ D;  3NJT A;  2KAJ A;  4HPL B;  2KNB A;  4HK2 A;  3TSS A;  4X57 B;  1FM0 D;  2XBB C;  4LDT D;  4W9H A;  1EF5 A;  3OWE B;  1X1M A;  1D4B A;  2HDE A;  2BYE A;  2ZW0 A;  2NBW B;  2WWZ A;  5I4D A;  4J3O D;  4OZC A;  1V80 A;  4RFB A;  2CHW A;  2FE8 A;  1HZ5 A;  1Q10 A;  1V1P B;  2Y3A A;  2FCN A;  4KIK B;  3L17 A;  4FLH A;  4MAC A;  3RNE C;  3NVZ A;  1IBX A;  4RGT A;  3ZLZ A;  2JYE A;  2MW5 A;  2R2O A;  3PPA A;  3PLU A;  1T0S C;  4REZ A;  1XCQ L;  2GBR A;  4K3B A;  5D3D A;  3RYT A;  5HI1 A;  4BOZ B;  1D3Z A;  1CQV A;  2V9H A;  4A6Q A;  4ZYN A;  2HD5 B;  2ICI A;  1FPY A;  3KW5 B;  4ZRK A;  2KT7 A;  3SU8 X;  4LNI A;  4K81 A;  3IAS 1;  2MHJ A;  1E5W A;  4US9 A;  2PW9 A;  1V8C A;  3IVF A;  2L32 A;  1YQ4 B;  3P4P B;  4GB9 A;  3L10 B;  2KZR A;  4KIK A;  2M0X A;  5D94 A;  2L05 A;  4IDI A;  2WXN A;  1JRO A;  5FKA C;  3X0W A;  1ISN A;  1ZKH A;  2H89 B;  3EHV A;  3K9O B;  4KX6 B;  4RF0 A;  3VTV A;  3ZDT A;  2L76 A;  2L00 B;  1NDD A;  2JYT A;  2WXH A;  3VHT C;  3DHH C;  3DBR B;  2QEJ C;  4A8X C;  1P0R A;  2WXM A;  1JQ4 A;  2PTL A;  1V9J A;  4RH6 A;  1M94 A;  1ROE A;  1MJD A;  4HJG E;  4FUL A;  4K3C A;  5FR3 A;  3UIP B;  2D11 A;  3RD2 A;  4K7S A;  4WWO A;  5DPW A;  1WR1 A;  1RFK A;  5E6N A;  2N7E A;  2R2Q A;  3BVG A;  1FD6 A;  4ZYS A;  1IYF A;  1WWT A;  2QCZ A;  4DHZ B;  4BAX A;  4ZRI A;  3W1Y A;  2CJN A;  2K9X A;  2IY1 B;  3RN9 C;  2LI5 A;  2SAK A;  1E0Z A;  3PT2 B;  2L3Z A;  3U7D A;  3H7S A;  2LGY A;  2I38 A;  3B1L X;  3FKY A;  2W3S A;  1TIF A;  3ENE A;  1XO3 A;  1UEL A;  1UWM A;  1OEY A;  1XT9 B;  2KTR B;  3TEX A;  3PO0 A;  2NMQ A;  4MGK E;  1C9F A;  2RMM A;  2WDQ B;  1UGM A;  2WNM A;  1QIL A;  2N1V A;  3MJ5 A;  2WDR B;  1MPE A;  5C1Z A;  3BII D;  5EDS A;  4HVB A;  2DHZ A;  4DWF A;  2JZZ A;  4DXG A;  5J2R A;  2MWS B;  3SHQ A;  4YWG G;  2ZNV C;  3W5V B;  2KQ7 A;  2D10 A;  3EFU A;  2BYT A;  3C0R B;  2KWU B;  1P3Q U;  1VR9 A;  1K8R B;  2KYW A;  5H8Y E;  5G55 A;  3QCA A;  3AE1 B;  4MH0 E;  4WIP A;  1ZXH A;  1SEB D;  3NHE B;  5JHB A;  2V3P A;  2XN9 C;  4A20 A;  1FXT B;  3WIM A;  2ON8 A;  3W9C B;  4JGH B;  4Q2J A;  3ZNG C;  1L7Y A;  1WF9 A;  1V2Y A;  2KN4 A;  3V05 A;  2LHE A;  1IPG A;  1TJE A;  2UU7 A;  2DYM A;  4FXC A;  3ZTC A;  3VH3 B;  2NBU A;  4NJ6 A;  3ECI A;  1JCK B;  1S3S G;  3DHG C;  3RCZ A;  2KWD A;  2KO3 A;  2LVQ A;  2DZJ A;  1WE6 A;  2A5U A;  3GOE A;  2HJ8 A;  3CIR B;  3VXW A;  2JRH A;  3L13 A;  2KC1 A;  2K3U A;  1L2N A;  4JQW C;  2LMC A;  2FCS A;  3EFC A;  1WSP A;  3ETR A;  4ANU A;  2BTE A;  2BPS A;  4GDK A;  2L52 A;  3PHW B;  3MC0 B;  1YX6 B;  1K51 A;  2W3R A;  4BOS C;  1TS5 A;  3BK2 A;  2KLC A;  4HLE A;  1E8X A;  2V1Y A;  1WJ4 A;  4EKU A;  3AE2 B;  4IWQ A;  1C1Y B;  3OJ4 B;  1E6E B;  1OQR A;  2LZ6 A;  4RGO S;  4US8 A;  4C7Z A;  1FRR A;  2OOB B;  1T0R C;  1FFU A;  1PGB A;  1LM8 B;  3DOW A;  1C3T A;  2KVR A;  2AQ3 B;  5IN7 A;  5FK9 C;  4TV3 A;  3O65 B;  2KHW B;  5EE9 A;  3DQV A;  3LB8 C;  5CHW A;  1GNU A;  2WXL A;  1R4N I;  3PVL A;  1WMH A;  2FAZ A;  4NAW B;  2ZVO A;  5TSS A;  3C19 A;  5C23 A;  4IC7 B;  2ACZ B;  4PT5 A;  1V86 A;  3SFD B;  1DOY A;  3P63 A;  1C78 A;  2LHD A;  2LAS A;  3V6C B;  2YEP F;  1NEK B;  1E8Z A;  3AE5 B;  2K1F A;  5AZG A;  4OW0 A;  1C4P A;  4EEW A;  4B95 A;  4C7Y A;  1WJU A;  2H88 B;  2I1J A;  5JXV A;  1MG4 A;  4N58 A;  1J7B A;  4NAW A;  3Q14 C;  5G5H A;  2LVP A;  1Q0W B;  4KSK C;  4HJK A;  2KX0 A;  2RDH A;  1SBB B;  1K53 A;  1IP9 A;  2KDI A;  4WQM A;  2JUO A;  3U4E G;  4HRS A;  2W82 A;  5LXH A;  1SF0 A;  1PGX A;  4EZJ A;  2BVC A;  4TSS A;  3K9P B;  4EUT A;  1GOZ A;  3R66 C;  2DYB A;  1SSN A;  3PGE A;  1A5R A;  2NTS A;  3SFE B;  1VD2 A;  2LVO A;  2KAN A;  3AMZ A;  4PYU A;  5D2M B;  2GLS A;  3VTW A;  5G2N A;  3QA8 A;  2JF5 A;  2K0P A;  1GC6 A;  4DBG A;  2M0A A;  3DBL I;  3WAL A;  2QIL A;  3LXF A;  2GOW A;  4ARI A;  3CMM B;  3PLV A;  1J8C A;  4ANW A;  1TY0 A;  2KD0 A;  3AE4 B;  2JRI B;  2WDT B;  1PGA A;  3AXC A;  3PZ8 A;  4DK5 A;  4OHJ A;  1KRH A;  2FUH B;  4HPP A;  4MJS B;  4JLC A;  1I42 A;  1JWB D;  4WJN A;  5AZF A;  2A4Z A;  4WJP A;  1QOG A;  2DEN B;  2MH7 A;  1E7V A;  3N32 A;  3HM6 X;  2OJR A;  4HKQ A;  3P2B A;  2KWC A;  4OVU A;  1SIJ A;  3AE9 B;  4JIO U;  3UI3 A;  4ITK A;  4ICV A;  2N0S B;  5IOI A;  5T8I A;  3V62 A;  3R8B A;  2IO3 B;  2XEW A;  3QJZ A;  1HTQ A;  2XNA C;  4QAY A;  1ESF A;  5GXG B;  4MEL A;  1JWS D;  3ZJT A;  4RMA A;  1ZDV A;  2JZP A;  1C4A A;  1ZE3 D;  4LNF A;  1ZPS A;  1R4M B;  4XX5 A;  4W9D A;  3DBH I;  2MEK A;  2AX5 A;  2LRW A;  1L4D B;  3AU5 A;  1IUE A;  3WCQ A;  1FNU A;  4IWO A;  4WAF A;  1E8Y A;  4GMV A;  4P6V F;  2WP9 B;  3Q3O C;  2G9H D;  5IAA C;  2BBC A;  2MSE D;  3AN1 A;  4XYC A;  4FN2 A;  1WGH A;  4A55 A;  2WXQ A;  3KH0 A;  4XWT A;  3AM9 A;  2L7R A;  3J9C A;  4MGY E;  1SIF A;  1VZ6 A;  3B2G A;  3MC8 A;  4NQL B;  2KDM A;  4PS3 A;  3MHZ A;  4YT0 B;  5H92 C;  2AL6 A;  3NZS A;  2K8C A;  3NVW A;  4KDI C;  5JH5 C;  1XXG A;  1CZP A;  3BZD B;  1KTK A;  3QQ8 B;  1K52 A;  1Q1O A;  3A9K B;  4XZ4 A;  3L54 A;  2PPH A;  1V81 A;  3LDZ E;  1UZX B;  4W9C A;  2L0T A;  2RPQ A;  4KGT A;  1I35 A;  5HG2 A;  2OHF A;  4LNO A;  1QF6 A;  3ZKJ C;  3CWI A;  3GS2 A;  3NRZ A;  1DOX A;  1F77 A;  2JY6 A;  1KOT A;  4KKI A;  2VRR B;  4TQ1 A;  3ZTD A;  2WX0 A;  2WLB A;  4II2 B;  2Q5W D;  3GB1 A;  4S17 A;  3ZJU A;  2MX2 A;  2D5G A;  1IBX B;  1HTO A;  3B2F A;  4XDC A;  2G1E A;  1UBQ A;  3EC8 A;  1MVK A;  2D3A A;  2IPK D;  1G6J A;  1WX7 A;  4GN1 A;  2BKF A;  1ET9 A;  1SXT A;  3R3M A;  5CHF A;  4NY0 A;  3O13 A;  3A9K A;  1T0Q C;  5DCN A;  3H1U A;  1FEH A;  3RNG C;  2KXJ A;  3ONS A;  3FAH A;  3VH4 B;  2UWQ A;  3FC4 A;  2BS4 B;  4EOY A;  1WGK A;  1SE2 A;  1DYQ A;  1FFV A;  1NI3 A;  2JVC A;  1V97 A;  2O6V D;  1MHX A;  2MA9 B;  2WXJ A;  3KUZ A;  1STE A;  1XD3 B;  4W9L A;  4II3 B;  2RGF A;  4E74 A;  3RZF A;  3L08 A;  5C2T B;  3HRD D;  4L2Y A;  4DHJ B;  3NS8 A;  4HPM B;  1EU4 A;  4HKZ E;  1L6U A;  4MEM A;  3TEZ A;  5IP4 D;  3AEG B;  3M95 A;  2DWQ A;  1UGJ A;  4LNK A;  3CSF A;  4IW0 A;  4KVG B;  4LDT B;  1V5T A;  3KYC D;  2G4D B;  3DVG X;  1P98 A;  1UUP A;  2JWU A;  4YTM B;  3HUI A;  5BMH A;  3JSV A;  1YD8 U;  4TMA B;  2N9X A;  3AH7 A;  3AE3 B;  2LFI A;  4W9G A;  2TSS A;  4M00 A;  1HE8 A;  4L23 A;  4C56 C;  2BS3 B;  2V3S A;  3Q8E A;  2JXT A;  5EE1 A;  1MI0 A;  2GBN A;  2LRU A;  3QAR A;  1WXS A;  1L4Z B;  3ZQ4 A;  2OJW A;  1RAX A;  3I57 A;  2KTF A;  3KWL A;  2AEH A;  2KMM A;  4TQ0 A;  4N59 A;  1F1H A;  2K5P A;  2FNJ B;  4BKT A;  1FXA A;  4P1C C;  4WUR A;  2PIA A;  4NZL B;  2BYF A;  4A3P A;  4TKN A;  4ZOH C;  3RNB C;  2G45 B;  5LLI A;  1WH3 A;  2RDG A;  3DBR I;  3Q3M C;  2JSV X;  1KLV A;  1OTR B;  1CJE A;  2LXC A;  1F2R I;  2W55 A;  2JPH A;  4XDD A;  3P42 A;  2Y5B B;  1HA5 A;  2LEK A;  3TUO A;  3E9S A;  3U7Z A;  4MH8 A;  2BYV E;  2W9N A;  1ZXI A;  2O6V A;  2ZNV B;  2ASQ A;  4ANX A;  1KF6 B;  1TKG A;  1YJ1 A;  2DZI A;  1WYG A;  4OVV A;  5E6J A;  3NOB A;  2PJH A;  5BO4 B;  4WH4 A;  4ZHO A;  1NYQ A;  3ZNH B;  2N9P C;  3TMP B;  4LNN A;  3UIN B;  3URY A;  1QT9 A;  1WYW B;  3ZIM A;  3H9D A;  4R3D A;  4G0N B;  1K50 A;  3HK0 A;  1JAL A;  1Y8R C;  2DLB A;  3OJ3 A;  4GOC A;  2JZ3 B;  3ML8 A;  2I2Y A;  1YIW A;  2PVO D;  3AEE B;  1JRP A;  3U30 A;  2BT6 A;  3HIZ A;  4BFR A;  4JWU C;  1FCL A;  3RUL A;  1ZUD 2;  1FXI A;  2HTH A;  1N5W A;  1UWX A;  2M17 A;  3V3X A;  4GDL A;  2KFK A;  4JWS C;  4ZRP A;  3U52 E;  3GZN B;  1L6V A;  1EUV B;  2IGG A;  2IJ0 A;  3ZXV A;  1ZW7 A;  4NQK E;  4ZDV A;  1BUI C;  3AUL A;  3M62 B;  3OLM D;  1XLP A;  5HKH A;  1TZ1 A;  4MT5 A;  4BKS D;  3SR6 A;  4GDK B;  1V1O A;  2QC8 A;  4P1B C;  4RM9 A;  1I4R A;  4I6N B;  1HEZ E;  2G3Q B;  2N7D A;  4C4V A;  5AEK B;  2E3T A;  4YSX B;  1OQY A;  5IKC M;  3B08 A;  1LXD A;  4XC2 A;  1JWM D;  1FNW A;  4M8N A;  2UYZ B;  3ZRF A;  3ZVV A;  2FCQ A;  3ZNI D;  4ZRJ A;  3SD5 A;  3VUY A;  2SEB D;  3HHM A;  3M3J A;  3QC8 B;  1EWY C;  1RRB A;  2IGH A;  4YTP B;  4M01 A;  2KWV B;  1N62 A;  1N63 A;  1P1A A;  3ZGZ A;  4CYE A;  5C3J B;  2QMT A;  1L5P A;  4MM3 A;  5TR5 A;  3A4S C;  1WMH B;  1XLQ A;  4N6E B;  1XLO A;  4D2K A;  3X23 A;  1UH6 A;  5KHO A;  2GI9 A;  1LFD A;  2OED A;  2CU1 A;  1AN8 A;  2WXP A;  2Z59 B;  4USA A;  4KZC A;  2CHZ A;  1MG8 A;  4W9J A;  4AOF A;  1IGC A;  3TIX A;  2Y5P A;  4XWW A;  4YSY B;  4LTU A;  3GP7 A;  2QIE B;  2YVC A;  1WX9 A;  1YX5 B;  2C7H A;  2NTT A;  1I4X A;  4HXD A;  3MTN B;  2PMV A;  3NVV A;  3EEC A;  1YJJ A;  1QOA A;  3AED B;  3EGR A;  1TKY A;  5D7G A;  4BKS A;  2IO1 B;  4M8M A;  3E56 A;  3FIL A;  1P7F A;  2X8X X;  3AE6 B;  1B1Z A;  4E71 A;  2NS5 A;  1C76 A;  2L8J A;  1TBE A;  3KUC B;  2KMC A;  4OVZ A;  5JHA A;  4AJW A;  2X38 A;  2LWP A;  2R61 A;  2M56 B;  2E6X A;  4JPS A;  5GMV A;  4FHJ A;  2WU5 B;  4MGI E;  4RGM A;  1N60 A;  2ZZP B;  3APD A;  3VUW A;  1WIA A;  4B6W A;  2ZEQ A;  1EM7 A;  1XQQ A;  1YMH E;  5LNK 1;  3UGB B;  1WGR A;  1I7H A;  5AUI A;  1GB1 A;  3NZU A;  3I5J C;  4AJY B;  1HXY D;  2Z0E B;  4WQO B;  4H2A A;  1MFW A;  4BKG A;  2EKI A;  3SDL C;  4WJO A;  5HHD G;  3R2I A;  2CHX A;  4ANV A;  1SJH D;  2WS3 B;  5DPS A;  1E7P B;  4IKG A;  4RCO A;  3IT4 B;  1RYJ A;  1PDX A;  1FIQ A;  2Z8L A;  1I4Q A;  4S0R A;  2RR9 A;  3Q8A A;  3BYY B;  2BWF A;  4URK A;  1C77 A;  1NEN B;  2MJE A;  2D3G A;  4EZK A;  3IXS A;  4LJO B;  2GBJ A;  3V60 A;  2GMI C;  1LO5 D;  1L0Y B;  2JXX A;  3A1Q A;  4HDQ A;  1D5X C;  1SJE D;  3U2S C;  2KQ4 X;  1Z2M A;  1KJT A;  1YJI A;  2LGI A;  4W9I A;  3HM3 A;  1XLN A;  4MDK E;  3PTF C;  4IM2 A;  3AI5 A;  2IGD A;  1P7E A;  4HCN B;  1GUA B;  2FID A;  1EO6 A;  5EE0 A;  3I9V 1;  3RUI B;  3RMK C;  1E90 A;  1EF1 A;  4AS1 A;  1YQ3 B;  1EU3 A;  4DHZ E;  3H8H A;  3RFZ B;  2MBQ A;  3AEA B;  5BYQ A;  3RNC C;  1N61 A;  4ASW C;  3N1X C;  4YXD B;  1WGG A;  3AU4 A;  2JU6 X;  4NJC A;  1HZ6 A;  3N20 C;  2W54 A;  2DAJ A;  3AEC B;  2N9E B;  1WZ3 A;  3APF A;  4RF1 A;  3OG5 A;  4EE2 A;  3DDC B;  4CHK A;  5D6J B;  1WX8 A;  2K6D B;  5AUK A;  4WWM A;  1PQS A;  2KJR A;  3BYT B;  4EZL A;  5EE3 A;  1T3Q A;  1C4C A;  1WJN A;  3A9J A;  3DVG Y;  3APC A;  3NG0 A;  1OGW A;  2ZPY A;  4PYZ A;  3VR9 B;  3VRB B;  3NY5 A;  4WJQ A;  1SE3 A;  3AEF B;  4KSL C;  3ZNZ B;  2MBO A;  1R4M I;  3QX1 A;  4KKJ A;  3N3K B;  2INN E;  3T8M A;  1KFY B;  1D5Z C;  4LLG M;  3VAW A;  2D2Q A;  1UBI A;  3BK1 A;  1JML A;  2JWZ A;  4J6I A;  3ML9 A;  2V3N A;  2MQJ A;  4W9K A;  2I1K A;  1JWU D;  4KV2 A;  3BVM A;  2VZK D;  5DPT A;  1BXT A;  4IG7 B;  4NAM A;  1VJK A;  1DGJ A;  3V6E B;  2WXO A;  4G11 A;  2N9L A;  1NI2 A;  3IFW B;  1GB4 A;  2WHI A;  4NJ7 A;  3UQA A;  4A3O A;  2KK8 A;  1PYW D;  2J0M A;  5CX3 A;  2VH2 A;  1QLB B;  1EWC A;  4AP4 C;  2HE7 A;  5DPR A;  2QJL A;  3WAP A;  4BZA A; 
#chains in the Genus database with same CATH homology
 1L0X B;  3B9J A;  2PIA A;  4WUR A;  3CIR B;  1OFF A;  4NZL B;  5HFY A;  2K3U A;  4JX1 C;  5BMI A;  2LMC A;  4ZOH C;  4HEA 1;  1WSP A;  2RDG A;  2VZK B;  3ETR A;  1XEE A;  2BTE A;  2JSV X;  1CJE A;  2L52 A;  1QOF A;  3MC0 B;  1F2R I;  1K51 A;  2W55 A;  2W3R A;  2K22 A;  3C8Y A;  3P42 A;  4XDD A;  3T3O A;  1TS5 A;  3BK2 A;  1HA5 A;  2LEK A;  1TKE A;  3TUO A;  3E9S A;  2L1A A;  3TEY A;  3U7Z A;  1FRD A;  1BML C;  4MH8 A;  3AE2 B;  2V0G A;  1ZXI A;  1XF5 L;  1E6E B;  2J42 A;  1OQR A;  4RGO S;  4US8 A;  4C7Z A;  1FRR A;  2N9K A;  2WXF A;  1KF6 B;  1TKG A;  2JX5 A;  1FFU A;  3EUB 2;  1PGB A;  1YN5 A;  1WYG A;  1FCC C;  3PZ7 A;  3Q8F A;  5E6J A;  2AQ3 B;  5FK9 C;  4WH4 A;  5EE9 A;  4ZHO A;  1NYQ A;  2J53 A;  3LB8 C;  2BS2 B;  4A9A A;  1GPX A;  2CJO A;  3URY A;  1QT9 A;  2WXL A;  4R3D A;  1K50 A;  1JAL A;  2DLB A;  4P16 A;  4NAW B;  3DWM A;  2KAC A;  2BB5 A;  2HTM E;  1I4P A;  5TSS A;  1RWS A;  2I2Y A;  3ABV B;  2PVO D;  3AB5 A;  3AEE B;  1JRP A;  3AE7 B;  1TZO A;  1JWA D;  2ACZ B;  2WDV B;  4PT5 A;  2BT6 A;  4B0E A;  2RPV A;  4JWU C;  4RGN A;  3L4P A;  1YNT E;  3SFD B;  1FO4 A;  1FCL A;  1MHH E;  1DOY A;  1ZUD 2;  1FXI A;  1N5W A;  1UWX A;  1Y56 A;  3Q8B A;  3P63 A;  2ZW1 A;  4XE0 A;  3V3X A;  1C78 A;  2LHD A;  3BVZ A;  4JWS C;  4ZRP A;  2GB1 A;  3U52 E;  4M0W A;  1L6V A;  2IGG A;  2IJ0 A;  1TS4 A;  3AE8 B;  2YEP F;  1IGD A;  3MP9 A;  2MJ3 A;  1BUI C;  2N7J A;  3KQ4 A;  1NEK B;  1ZOY B;  4ZHP A;  3AE5 B;  1XLP A;  3DWG C;  3TEW A;  1B9R A;  4OW0 A;  1UNS A;  1C4P A;  4MT5 A;  3NUH B;  1VDV A;  3W1S A;  4AQ7 A;  1XCT L;  3SR6 A;  1HQR D;  4GDK B;  1V1O A;  4C7Y A;  4KGS A;  1ZDX A;  1I4R A;  2H88 B;  1HEZ E;  3MFG A;  4N58 A;  5JXV A;  4UDU C;  1ET6 A;  1N5X A;  1J7B A;  2E3T A;  4YSX B;  1VZ7 A;  5G5H A;  3NS1 A;  1M4V A;  2V4I B;  1JWM D;  1CK1 A;  1FNW A;  2FBW B;  2RDH A;  4B0M A;  1VRA B;  1SBB B;  1K53 A;  5BYS A;  2LUM A;  3EA6 A;  2SEB D;  2WXR A;  4WQM A;  1EWY C;  3U4E G;  1T6B X;  4HRS A;  2IGH A;  2MJD A;  2W82 A;  4YTP B;  1SF0 A;  1PGX A;  1AYF A;  1N62 A;  2JQR B;  1N63 A;  4TSS A;  2BB6 A;  3VQI A;  3ZGZ A;  5C3J B;  1GOZ A;  2QMT A;  1D5M C;  1SSN A;  1L5P A;  1TYG B;  4DQO C;  2NTS A;  3SFE B;  3P4R B;  1XLQ A;  4N6E B;  1XLO A;  2LJI A;  3AMZ A;  4D2K A;  1I4H A;  1V1P A;  3IT6 B;  1KLG D;  1D6E C;  2GI9 A;  1WRI A;  2OED A;  1AN8 A;  2K0P A;  2WXP A;  1E10 A;  4USA A;  2M0A A;  1WXQ A;  3KLS X;  2QIL A;  1IGC A;  3LXF A;  3R2T A;  4GDL B;  2B76 B;  4ARI A;  2Y5P A;  3RPF C;  3ZJV A;  3HVZ A;  4XWW A;  1VZ8 A;  4LTU A;  4YSY B;  3GP7 A;  1TY0 A;  2QIE B;  3AE4 B;  3N9Y C;  1PGA A;  1TS2 A;  2NTT A;  1I4X A;  1AW7 A;  2PMV A;  3BWU D;  3PZ8 A;  3AV8 A;  4OZA A;  4OHJ A;  1KRH A;  3NVV A;  4YTN B;  2INP E;  1YJJ A;  1QOA A;  3AED B;  3EGR A;  3LYY A;  1QOB A;  1TKY A;  3P4S B;  1KH0 A;  1JWB D;  5D7G A;  1KLU D;  4DXF A;  1QOG A;  1RM6 C;  2MH7 A;  3E56 A;  3FIL A;  4L1B A;  1FNV A;  5BYR A;  4A90 A;  1P7F A;  4HKQ A;  3AE6 B;  1B1Z A;  5MPO A;  1SIJ A;  1C76 A;  2IDY A;  3AE9 B;  1YN4 A;  2DBY A;  2Y5C A;  3P4Q B;  1YN3 A;  2AQ2 B;  3UI3 A;  2KAJ A;  4ITK A;  2N0S B;  4OVZ A;  2DYO A;  5T8I A;  3TSS A;  2X38 A;  3R8B A;  4GLS C;  1FM0 D;  2QSD A;  2R61 A;  1NYR A;  2PKO A;  2M56 B;  3OWE B;  2E6X A;  4JPS A;  1D4B A;  2HDE A;  4RGM A;  2WU5 B;  2ZW0 A;  4KGR A;  5I4D A;  1N60 A;  4J3O D;  2XNA C;  4OZC A;  4MM3 B;  1ESF A;  5GXG B;  1JWS D;  4RFB A;  3ZJT A;  1FMA D;  2GRI A;  1EM7 A;  1ZDV A;  2FE8 A;  2JZP A;  1HZ5 A;  1Q10 A;  1C4A A;  2L83 A;  1YMH E;  1ZE3 D;  1V1P B;  3W5U B;  1ZPS A;  2Y3A A;  1F2R C;  5LNK 1;  1AWD A;  1JW9 D;  1QQR A;  4C80 A;  1I7H A;  4MAC A;  2MEK A;  5AUI A;  2AX5 A;  1L4D B;  1GB1 A;  1IUE A;  1J7C A;  3NVZ A;  1IBX A;  1VLB A;  1ZP0 B;  4RGT A;  2JYE A;  3WCQ A;  1FNU A;  4WAF A;  1HXY D;  2EEL A;  2PLP A;  2WQY B;  4H2A A;  4P6V F;  2EKI A;  2WP9 B;  4HRO A;  2G9H D;  2AQ1 B;  4REZ A;  1XCQ L;  5HHD G;  3R2I A;  2BBC A;  5D3D A;  1SJH D;  2WXK A;  5HI1 A;  2WS3 B;  3AN1 A;  1T5X D;  1CQV A;  4A6Q A;  1E7P B;  4IKG A;  4RCO A;  5BMG A;  2J52 A;  2ICI A;  3IT4 B;  1RYJ A;  4A55 A;  2WXQ A;  1DOI A;  3T3N A;  2WU2 B;  1PDX A;  4XWT A;  3AM9 A;  3ZYY X;  1FIQ A;  3IAS 1;  2Z8L A;  1I4Q A;  3J9C A;  4US9 A;  3Q8A A;  1VZ6 A;  3B2G A;  3BYY B;  1SE4 A;  2KDM A;  5G5G A;  2PW9 A;  1L0V B;  1V8C A;  2YEP B;  2L32 A;  1YQ4 B;  3FIL B;  3MHZ A;  3P4P B;  4YT0 B;  4ARC A;  1C77 A;  5H92 C;  1NEN B;  2MJE A;  3NVW A;  3IXS A;  1XXG A;  2M19 A;  4IDI A;  1LO5 D;  2WXN A;  4ZRQ A;  1L0Y B;  1D5X C;  1CZP A;  1SJE D;  3BZD B;  1JRO A;  1KTK A;  2WXG A;  3U2S C;  5FKA C;  3W2D A;  2KQ4 X;  1J7A A;  2H89 B;  1K52 A;  1TS3 A;  4KX6 B;  1YJI A;  4RF0 A;  2LGI A;  2JYT A;  2WXH A;  2ONQ A;  1OQQ A;  4KGT A;  1A70 A;  4O1N A;  1XLN A;  1R7S A;  5HG2 A;  3KWV A;  2OHF A;  1ACC A;  2QEJ C;  2WXI A;  1QF6 A;  4A8X C;  3CWI A;  2IGD A;  1P7E A;  2WXM A;  3Q8C A;  4OZB A;  3GS2 A;  1JQ4 A;  2PTL A;  3NRZ A;  2FUG 1;  4RH6 A;  1DOX A;  1F77 A;  3P1M A;  2J4X A;  5EE0 A;  1ROE A;  3VR8 B;  3I9V 1;  4RNA A;  4HJG E;  4KKI A;  4TQ1 A;  5FR3 A;  4AS1 A;  1YQ3 B;  2WLB A;  3IAM 1;  1EU3 A;  2Q5W D;  3GB1 A;  3ZJU A;  2D5G A;  3H8H A;  1RFK A;  3RFZ B;  1IBX B;  3AEA B;  3B2F A;  4XDC A;  5BYQ A;  2G1E A;  3BVG A;  1MVK A;  2IPK D;  1FD6 A;  4ZYS A;  1N61 A;  1WWT A;  1ET9 A;  4YXD B;  1SXT A;  2JU6 X;  4NJC A;  1HZ6 A;  2W54 A;  3AEC B;  2CJN A;  3SEB A;  3Q69 A;  2K9X A;  4RF1 A;  2BW2 A;  3O13 A;  2SAK A;  4EE2 A;  1E0Z A;  3HVD A;  1TY2 A;  1FEH A;  5AUK A;  4WWM A;  3BYT B;  2I38 A;  3FAH A;  2W3S A;  5EE3 A;  1T3Q A;  1C4C A;  1XO3 A;  3FC4 A;  2BS4 B;  1ENF A;  1UWM A;  1WGK A;  1SE2 A;  3TEX A;  3PO0 A;  3AEB B;  3VRB B;  1DYQ A;  2NMQ A;  3VR9 B;  1C9F A;  1SE3 A;  1FFV A;  2RMM A;  1NI3 A;  2WDQ B;  3AEF B;  1V97 A;  2WNM A;  1QKZ A;  1GAQ B;  1QIL A;  1MHX A;  2WXJ A;  3MJ5 A;  4KKJ A;  2WDR B;  1MPE A;  4IOI E;  2INN E;  1KFY B;  1STE A;  1D5Z C;  3BII D;  1I4G A;  4LLG M;  4DXG A;  5C2T B;  4JE3 B;  3HRD D;  4L2Y A;  4YWG G;  1PUT A;  1PFD A;  3NZ3 A;  1EU4 A;  3BK1 A;  3W5V B;  4HKZ E;  1L6U A;  3TEZ A;  1JML A;  3AEG B;  3VRA B;  1NVI D;  4LK0 M;  2DWQ A;  1UGJ A;  2V3N A;  2BYT A;  1F0Z A;  1E9M A;  1VR9 A;  5H8Y E;  1JWU D;  1UUP A;  2JWU A;  4YTM B;  3AE1 B;  3HUI A;  3BVM A;  5BMH A;  4WIP A;  2VZK D;  1ZXH A;  1SEB D;  4TMA B;  1BXT A;  3AH7 A;  2V3P A;  3AE3 B;  2XN9 C;  2LFI A;  4NAM A;  2TSS A;  2ON8 A;  4L23 A;  1C79 A;  3W9C B;  4C56 C;  4Q2J A;  1VJK A;  2BS3 B;  1DGJ A;  3Q8E A;  2JXT A;  5EE1 A;  2WXO A;  2N9L A;  4CQN A;  1MI0 A;  1GB4 A;  2KN4 A;  3V05 A;  2LHE A;  2PVG C;  1L4Z B;  3ZQ4 A;  1TJE A;  2DYM A;  4FXC A;  1SB3 C;  4YSZ B;  2CU3 A;  3I57 A;  1JCK B;  5D3I B;  3KWL A;  2KMM A;  1PYW D;  2KWD A;  4TQ0 A;  4N59 A;  2K5P A;  1QLB B;  1EWC A;  1FXA A;  3NVY A;  2QJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...