3IXSA

Ring1b c-terminal domain/rybp c-terminal domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
b'ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPMELYYAPTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RING2
molecule tags Protein binding
source organism Homo sapiens
publication title Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
pubmed doi rcsb
total genus 26
structure length 111
sequence length 111
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.430 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ixsA00
3IXSA 3H8HA 3GS2A
chains in the Genus database with same CATH superfamily
4MGZE 1TS4A 2PW9A 4OVZA 2L76A 2WXGA 4KV2A 2Y5PA 2ZNVB 2BS2B 1TZOA 3IT4B 3WIMA 2MJDA 4RMAA 3IFWB 3TBLD 2B76B 3DVGY 2KHWB 4W9GA 4JQWC 1TYGB 4NQKE 1V1PA 5BMGA 1JW9D 1Q10A 2N4FA 4B9KA 1TS5A 3M3JA 1BT0A 4ANVA 5G5HA 5HHDG 2M8SA 4ANUA 2JY6A 4BKGA 4A8XC 4ZOHC 2DAFA 2DWQA 3JYUA 2IGGA 2M19A 5D7GA 1J7AA 3VFKA 4AUQC 2M1MA 2JZPA 3DCGA 2ZVOA 3TEYA 1FRDA 1XLNA 1UGJA 1YOVB 4K3BA 4ZDVA 1N5XA 4AS1A 2KJHB 3VTVA 3AE1B 1V1OA 2M4NA 1MVKA 4HDOA 1A5RA 4M00A 1RM6C 2KC1A 2TSSA 5D6JB 2KDMA 2K1FA 4BOZB 2GRIA 2MBOA 1OQQA 4C4VB 4O1NA 5EE3A 2LHDA 4LTUA 2LGIA 3H1UA 1SGHA 3RNFC 2YLMA 3V61A 1P0RA 3PLUA 1JQ4A 1R4NI 1T6BX 2N9LA 3QQ8B 4YWGG 2BKRB 5AZFA 4W9LA 1LGRA 3FC4A 2ZW0A 2ACZB 2KVZA 4EUTA 2N7JA 1EU3A 3GB1A 2MHJA 4WJNA 5L83A 3EHVA 4DBGA 4QAYA 4HDQA 1E9MA 3AI5A 2Z8LA 4HCPB 2WQYB 3BVGA 2X38A 1JMLA 3L4PA 1VZ7A 1J0GA 4IW0A 1KFYB 3VH4B 1TY2A 5HI1A 2HTME 4C80A 2MP2B 3Q14C 3DQVA 1WE7A 3M62B 3JVZX 1XLOA 4AQ7A 1UWXA 4FLHA 3H7SA 3Q3JA 2KDBA 4DHJB 4RM9A 4MSMB 2LGXA 3P2BA 4XYCA 3ZO5B 1YN5A 1ZXIA 4WWPA 2MH7A 1MI0A 4MELA 3T9LA 1V81A 3FAHA 1WY8A 2MLBA 2SEBD 1L0YB 3P4QB 4HJKA 3ZJTA 2DZKA 1T0RC 1VCBA 2MA9B 3BVMA 4XX5A 2H89B 3UI3A 2INNE 3BK1A 4NPNA 2HD5B 4FULA 2CS4A 4P7IA 3UQBA 1NVID 2JZZA 3NVZA 1UGMA 1PGAA 4JLCA 1ET6A 1L6VA 1F52A 3AEAB 3VVWB 2MBEA 1V86A 4MSQB 1QKZA 4HPMB 4BBNF 3MHSD 3N32A 1T3QA 3QWZB 4I6NB 5HG2A 1YX5B 1QT9A 4BBNC 3A4SC 4RM8A 1J7BA 4KSLC 2R61A 2LXCA 3ZRCA 4AJWA 3WAMA 3NHEB 1EM7A 4HK2A 4CYEA 4MACA 5DPSA 3AE3B 3L10B 1V1PB 2N9PC 2MJEA 1YD8U 4XWTA 2VRRB 1ZXHA 2K25A 4HLEA 1FFUA 1LFDA 2MW5A 4YXDB 2Y5CA 3CF6E 1FEHA 2K6DB 3ML8A 4M0WA 1CMXB 3P4RB 1L0VB 2BS4B 3QX1A 3SFDB 4N58A 3UF8A 1VR9A 2J4XA 3APFA 1P1AA 3AEGB 1QZEA 5IOIA 2KX0A 2EELA 1UBIA 2QHOA 1NYQA 2OHFA 2JX5A 4GDKA 1XCQL 2RPVA 1PGXA 4N9F4 4REZA 5J2RA 3PREA 2DZJA 4W9HA 4F8CB 2WYQA 5DCNA 1ZP0B 3GZNI 3PSEB 2Y5BB 4WIPA 4NJ7A 4ZRQA 3EA6A 3A4RA 3MFGA 4GDLA 1B9RA 2INDC 2QCZA 4OHJA 4W9EA 2JXXA 2WWZA 5AZHA 1WXQA 1UH6A 2WLBA 3EFCA 5JHAA 2IDYA 1R4MB 3Q3MC 2SAKA 2AL3A 2BTEA 5C2TB 1UD7A 2CHWA 1GB4A 1AWDA 3KUDB 2KN5A 2XK5B 3CMMB 1C76A 1TIFA 3Q3NC 2J42A 3AE9B 4PS7A 1DOYA 2WNMA 2KACA 2N9KA 2LMCA 3PTFC 1UWMA 5BMHA 1TJEA 3WAPA 4KDLB 2INCC 2KOXA 4FJYA 4XWWA 1WJ4A 5CHVC 1MHXA 3M63B 3AEFB 1DYQA 1E7VA 3ZNZB 3QC8B 1EO6A 2K8BA 2KWUB 4CQNA 1C79A 1Z5SB 3LB8C 4PYZA 4BKSD 3CSFA 1YN3A 2ZPYA 1KRHA 2C60A 2IGHA 1WXVA 2K6QA 2WDVB 4DXFA 1R4MI 1VLBA 5CHWA 1TS3A 3VHTC 4YT0B 2BQQA 2KQSA 4KKJA 3AMZA 2LZ6A 3R7RA 2KMMA 3RMKC 2K0PA 2MEKA 3U7DA 4BVUC 5C3JB 3QAQA 1QQRA 2IO0B 2K3UA 2ASQA 2KDIA 1RWSA 4WJQA 3QARA 3ZGZA 2G45B 3ALBA 2GB1A 5DPTA 1E10A 3V6EB 4FHJA 2QEJC 4FJVB 4EKUA 2KZRA 4WWOA 1SIFA 4DQOC 3A9KB 1VJKA 4ACFA 3AECB 2RDGA 4URKA 3AM9A 1KF6B 4M8MA 1ZPSA 4IWPA 2JXTA 4FBJB 1WX8A 3ZKJC 1SJED 2L0FA 4LK0M 4EZJA 4PS8A 2BB6A 1P7EA 3HUIA 1OQYA 1ZGUB 2BPSA 1GPXA 2I1KA 2MQJA 3I5JC 1YJ1A 4NJCA 4W9IA 2BWFA 5G5GA 1WH3A 4IM3A 4WJPA 3URYA 4LLGM 1C77A 1KLVA 3TUOA 4IM2A 4F7ZA 3PRMB 4IWQA 4MGYE 5J18A 1WXAA 1WZ3A 2L52A 3KH0A 1NDDA 2BW2A 1RLFA 4PS3A 2IPKD 2LGDA 1BUIC 4JGHB 2JUOA 2K39A 1C78A 2DBYA 4P1BC 3N1XC 3TMPB 1TY0A 1SJHD 2WXKA 3PV1A 3BVZA 1ISNA 4XE0A 3U7ZA 4RGMA 1Q1OA 3SHQA 3WAOA 3WA0A 5EDSA 2N9EB 3Q8FA 2YEPF 1WWTA 2HJ1A 4XGAB 3AU5A 1SE9A 4NQLB 3RNAC 1M94A 4A6QA 4YTNB 4ASWC 1S1QB 2J7QB 3BINA 3ZNGC 2ZCCA 3PHXB 2KDEB 3ONSA 4LNFA 3NZUA 5L95C 2IYDB 3AE7B 5IAAC 4WJOA 3IT6B 2IY0B 3ZQ4A 2BS3B 4DXGA 1HXYD 1NBFC 4GU2A 1Z2MA 3U4EG 4RNAA 3ZDMC 2WDTB 4G11A 1KLUD 4BOSC 2BYEA 4YTMB 1CK1A 2MX2A 2PPHA 1FXAA 1TS2A 5H92C 3PZDA 3VTUA 1E0ZA 1E5WA 2UYZB 2UWQA 4WQMA 4FN2A 1E7PB 4MT5A 4KIKA 3RD2A 3VUXA 1FFVA 2FIDA 2GLSA 1I35A 2LVOA 4JWSC 2DAJA 3A9KA 2K8HA 1HA5A 2D5GA 2MBQA 4KZ0A 3MC0B 4M01A 1ZDVA 1I4GA 4NY0A 4GGQA 2PJHA 3L17A 1VD2A 2LXAA 3Q8CA 1A70A 3T8MA 4KSKC 1C4PA 3B0AA 2K8CA 3JSVB 2CHXA 2PE9A 3SFEB 3QHTA 3DBSA 4B95A 2K22A 3W5UB 2JF5A 2ZNVC 2I38A 2FAZA 2O2VA 1NEKB 3NOBA 4W9KA 3RI7C 4KZCA 1GC6A 3DBHI 1F77A 4IM0A 1AN8A 4USAA 3BIID 1WJUA 2WXNA 2JYEA 3N1YC 2WS3B 2ZVNA 4JE3B 4AP4C 3AULA 1YX6B 3W1SA 1KM7A 4B0MA 1FO4A 3NJTA 2M0AA 3ZUNA 1EWCA 4I6LB 1WSPA 3S2AA 1HTOA 3NS1A 3DBHB 3NZ3A 4ICVA 2KX3A 2KLGA 1I4XA 2LVQA 1SIJA 3QK0A 1DGJA 2ZW1A 4WWNA 5BO4B 3L0WB 4DHZB 1CJEA 2CKHB 3OWEB 3AXCA 3X23A 1GAQB 2LASA 4ZHOA 1SE3A 3J9CA 4ZYSA 3MC8A 2O6VB 4ZRJA 2PVOD 2Z0DB 1ZKHA 2DYMA 1I7HA 2XEWA 4A90A 1IGCA 3RUIB 2E6XA 4IG7B 3GE8C 2QDFA 3OG5A 4ZYNA 4MGKE 2BB5A 2PLPA 5HKHA 1SBBB 5FKAC 4XDCA 3IHPC 4L23A 2EMTA 4HKZE 3QJZA 3W1SC 2KMCA 1TTNA 1AARA 2BBCA 2VH2A 5BYQA 4WAFA 3V05A 3DBLB 2NBWB 3LYYA 4B0EA 2RPQA 3R2TA 1VZ6A 3TEZA 1YQBA 3IAM1 4G0NB 3E56A 3DPDA 1V6EA 3I63C 1F0ZA 1UUPA 1ACCA 3TJPA 3AE2B 2J52A 2R2QA 4ZRKA 5FK9C 1N63A 2AWTA 2WDQB 4HJGE 1ZW7A 1K53A 2PIAA 3ZW3A 5LNK1 3A33B 1KOTA 3AV8A 4DDID 2NTSA 3FILB 4HPLB 2PTLA 1Y56A 3B2GA 3UINB 3Q3FA 3T3NA 4WH4A 1D5MC 2W54A 4G50A 2YEPB 2MSED 5LXHA 3DWMA 3VUWA 1WGYA 2C5LC 1T0YA 5GMVA 2CJOA 2ICIA 1OFFA 2W55A 2LGYA 4RCOA 4FHKA 3ZTDA 5D3IB 1EU4A 3X0WA 4KDIC 2W82A 2MBHA 3MJ5A 4KGSA 5DPWA 4F1SA 2I1JA 2PE6B 2XBBC 2KFKB 3Q8AA 1K8RB 2WP9B 3GE3C 1J8CA 1V5TA 3ENEA 2IO1B 3L08A 2KLCA 1L2NA 1ET9A 1YIWA 4PYUA 1XQQA 3RCZA 4US9A 3OJ4B 3NRZA 1Y8RC 1TKYA 5AEKB 1I4PA 2KFKA 1WM3A 1XLQA 1QOFA 2I2YA 4NAWA 1LQBA 5FR3A 2MCNB 3DBRI 2Q5WD 2BYTA 4HVBA 3CSTA 3L16A 2IO2B 2LI5A 3Q8BA 4W9JA 3VRBB 3W5VB 2KC2A 3WANA 2AEHA 2BVCA 1FXTB 2QJLA 3MP9A 3NVVA 4RGTA 2KAJA 2V3NA 4LNNA 1ZOYB 4YSZB 3BZDB 2L7RA 2G1EA 1WRIA 5JHBA 4CHKA 2WXMA 1SF0A 2BYFA 1J7CA 4BZAA 1N5WA 2DNFA 2QMTA 2KTRA 1FNWA 3TIXA 2KANA 4FJZA 4MH8A 4PT5A 4XC2A 4G3XB 4S0RA 5G55A 1OGWA 4ZHPA 2LUEA 2GMIC 2HDEA 4C7YA 1FIQA 3HK0A 5IN7A 2M17A 3DBLI 1I4RA 4OZCA 1K51A 1RYJA 1C4CA 3RYTA 1SE4A 2ZZPB 2WX0A 2FUHB 5T8IA 3APCA 4FA6A 4TSSA 4II3B 4LNKA 4AWJA 3DHIC 1QOBA 4JIOU 5E6OA 3UIOB 3AEEB 2DX5B 1MG8A 4MJSA 3E9SA 4EFOA 1WXMA 5IKCM 2W3SA 4MM3A 1TGZB 4KKIA 1NI3A 2EKEC 4LNIA 2N7DA 1G6JA 1E8YA 1JCKB 3KWVA 2WXOA 1FMAD 2OJWA 4RH6A 3A1QA 4E3CA 1FPYA 3ZJVA 2D2QA 2WXPA 2KXJA 4UDUC 1UZXB 2LRWA 1QOAA 3V3XA 3ZXRA 3I57A 4M8NA 3KW5B 3WALA 3BY4B 3KUCB 3TCAA 4JX1C 4DXAB 3KUZA 3ZXVA 4KGRA 3H8HA 4WQOB 4XZ4A 1P9DU 2K9XA 3HHMA 3VH3B 2QC8A 3ZNHB 4X57B 2KJRA 3FKYA 4NNJB 4LNOA 2GBKA 1NI2A 1IGDA 2RGFA 3MJWA 2J53A 1P7FA 2KWDA 1WIAA 1ZUD2 3AE5B 4IC7B 4M0WB 1KTKA 3R7QA 2M56B 1HE8A 2M0XA 2ON8A 5GXGB 4MGIE 4EZLA 2PVGC 1M4VA 1IBXB 2FCMA 1SEBD 5CX3A 4MDKE 4R3DA 3AU4A 1WGDA 4TKNA 5MPOA 3ECIA 2FE8A 4ANWA 2LJIA 2FCNA 2X8XX 1Q5WB 3H7PB 2BF8B 2KYWA 2QSDA 2A5UA 2DZIA 2Z0EB 3IVFA 2E3TA 2MWSB 1E8ZA 3OJ3A 2BGFA 3DOWA 3A9JB 1EWYC 3RZFA 2KO3A 1RFAA 2FNJB 3W2DA 3KYCD 5I4DA 1E8WA 4DHJD 1FD6A 3H7PA 3PLVA 2DYBA 5KHQA 4L2YA 3VDZA 2L3ZA 2J0KA 3ZYYX 2IGDA 1EF1A 3QIJA 3AEBB 3ZJUA 3LJ3A 4K7SA 3VTWA 4BKSA 3KQ4A 3VXWA 1T0QC 5BYSA 2EMSA 3RNEC 4IKGA 1UF0A 2JYTA 3KWLA 4S17A 4AOFA 1I4QA 1JALA 3D32A 1JWSD 1V8CA 1I4HA 2A4ZA 4K3CA 3AE8B 4B6WA 2UU7A 4RF0A 3PRPB 1SXTA 3PS6A 3SD5A 2D10A 4W9CA 4ZRPA 3AE6B 2ZEQA 1OEYA 1WMHB 2Y3AA 2RDBC 1QOGA 3HM6X 4MM3B 2KWCA 2JT4B 2KFJA 4PK1A 1YJIA 3TL5A 1EF5A 3N30A 4IUMB 1F2RC 3C8YA 4WAAA 3L54A 2IBIB 5AZGA 3V6CB 1VZ8A 4RGOS 1NYRA 2O6VA 4HROA 1D5XC 4GSWA 4RGNA 2L8JA 2HE7A 3DVNV 3A1QB 3ML9A 3AB5A 1SE2A 2ZPNA 1GG3A 2XNAC 2WHIA 4OW0A 1E8XA 4MJSB 1R7SA 2DENB 1GB1A 2AL6A 1BXTA 4RF1A 1GUAB 3ZRFA 3UGBB 1PUTA 1XCTL 2V1YA 3OAWA 3Q69A 1Q0WB 4HRSA 1N6ZA 2AQ3B 3I3TB 2KK8A 1YJJA 2G3QB 3ZIMA 4GN1A 4OZBA 2CU1A 4C4VA 4YSYB 2D3BA 4C00A 1L7YA 4WURA 4JWUC 3NZSA 1ESFA 1FCLA 2KWVB 3H6NA 3EECA 4ANXA 2REXA 3KYDD 3DBRB 2AX5A 4IOIE 1T5XD 4ZRIA 4HPPA 2BYVE 5BYRA 1YMHE 2RMMA 4ARIA 2KVRA 3HVZA 1H4RA 2L0TA 1V97A 3PRZA 5EE9A 2N0SB 3Q2AC 2G9HD 1IBXA 3EUB2 3NVYA 1FM0D 4L1BA 1CQVA 2IJ0A 4A3OA 2NBUA 1WI0A 4GB9A 5JH5C 4N59A 2XN9C 3RNCC 1YNTE 3NY5A 1HZ6A 4BFRA 2RR9A 1VDVA 2JRIB 4NAWB 1WM2A 3AN1A 5CTRC 1XEEA 2BT6A 2NVUI 3WCQA 1WFYA 1IYFA 3HVDA 2D3CA 5DPRA 1PDXA 1QLBB 1YN4A 2KJ6A 3BK2A 5FR6A 1JWUD 2NS5A 2N1WA 3EGRA 5IP4D 2CHZA 1FNVA 2GOWA 3RPFC 1TKGA 1WF9A 1XD3B 4XDDA 1ROEA 1EUVB 1LXDA 2IY1B 2JRHA 1RFKA 3NG0A 3R8BA 2ONQA 2HJ8A 2EKIA 2LUMA 3IAS1 1IUEA 1PGBA 1GC7A 3SR6A 4GXBA 1MJDA 1OEYJ 2DZMA 5C1ZA 1GNUA 4NJ6A 5TSSA 2L32A 3DVNU 1LO5D 2JWUA 1VRAB 3N3KB 4TQ0A 4Q2JA 3IBEA 4LDTD 3ZVVA 4US8A 2C7MB 2PEAA 1C1YB 4N6EB 1D6EC 1GOZA 2OOBB 1TZ1A 2V3SA 3C0RB 2RD0A 1OQRA 2WU2B 1U4AA 1PYWD 2DYOA 3Q6BA 4KGTA 2HTHA 3FILA 2W9NA 3ZTCA 3NVWA 1WGGA 4K81A 2JWZA 2KTFA 4K7UA 1F1HA 2ZJDA 3DDCB 2WX1A 4CO7A 4H2AA 4ARCA 3RN9C 4W9FA 2JZ3B 1WR1A 2KT7A 4P6VF 2GBMA 2R2OA 2FCQA 4LJPB 3JW0X 5AUIA 4A3PA 1B1ZA 2C9WB 2JPHA 1L5PA 1P3QU 1WE6A 2BKFA 1JRPA 2WXHA 1V49A 4KVGB 2NPTA 4TV3A 3LDZE 1V2YA 3H9DA 2CU3A 1RAXA 4GLSC 2J0MA 1T0SC 2INPE 3DVGX 1JWBD 4EEWA 3MHZA 3GOEA 2GBJA 3P4SB 2FCSA 4AJYB 1UNSA 5J17A 2MP2A 3B9JA 2IZVB 3VUYA 4HKQA 2N1VA 4J3OD 2NTTA 4NAMA 2VZKB 3HM3A 1RRBA 2NPTB 4DK5A 2CR5A 2V0GA 1KLGD 2CJNA 2WXLA 1MHHE 1CZPA 4KX6B 2WU5B 1TKEA 3VRAB 1BMLC 1MG4A 2D11A 1J19A 2RSUA 5CHFA 2LFIA 2V9HA 4HCNB 2KN4A 1YQ4B 5H8YE 4J6IA 4HXDA 3QCAA 5E6NA 1S3SG 2MBBB 2FIFA 2KTRB 1JWMD 1TBEA 3SU8X 3B08A 2GBNA 2G4DB 5IO9A 4ICUA 2N7EA 3BYYB 4C56C 4DWFA 2VH1A 3EFUA 3N9YC 1WR6E 3AE4B 4JPSA 3P4PB 4K7WA 3CIRB 3CWIA 3PVLA 3K9OB 2WXIA 3IG3A 4A9AA 1L6UA 2AQ1B 1UBQA 4HWIB 1DOIA 3P42A 3ZDTA 3V62A 2KDFB 3ZNID 3MC9A 2OEDA 4GOCA 3PGEA 4KIKB 2L83A 3B1LX 3MTNB 1TT5B 4MEMA 3OLMD 1WXSA 2K5PA 1V5OA 1C9FA 1UELA 2DHZA 2KNBA 4YSXB 5LXIB 1R4NB 3ABVB 2WXJA 2YVCA 1FRRA 2JSVX 4TUUA 4WWMA 3N1ZC 4EOYA 5D3DA 2D3GA 4W9DA 1D5ZC 3TSSA 3O13A 2WXRA 4MH0E 1MPEA 5LLIA 3NS8A 3AH7A 4II2B 1FXIA 4LCDE 3L13A 4IWOA 1K52A 3RNGC 1X1MA 2C7NB 1KJTA 5KHOA 1WRDB 1WYGA 2V4LA 3SEBA 3BWUD 1IPGA 2LGSA 3KVFB 1E90A 3W9CB 2NR2A 1IP9A 4HEA1 3VAWA 5E6PA 4E71A 3P1MA 2V3PA 3NUHB 1FCCC 1FNUA 2DLBA 2QIEB 1XLPA 4ITKA 3A9JA 3V60A 2LEKA 4A20A 1WJ6A 3K9PB 5JZEB 2LVPA 4IDIA 2BWES 3AEDB 3U52E 4BKTA 2KQ7A 5D94A 1NENB 1QF6A 1AYFA 2AYOB 5D2MB 2L1AA 1WX7A 5E6JA 2LD9A 1XT9B 2WDRB 2NBVB 2VZKD 1SB3C 3N20C 2B3AA 3PPAA 1L0XB 4FXCA 1HEZE 2FUG1 1F9JA 4YL8A 1WX9A 1KH0A 1JRUA 1XXGA 2WXFA 3DHHC 4OZAA 1HZ5A 1E6EB 2MJ3A 1C3TA 3APDA 2LWPA 1N61A 2KD0A 3RFZB 2WXQA 1D4BA 1HQRD 1L4ZB 4RFBA 3GP7A 2RDHA 2NMQA 4GDKB 5AUKA 1E7UA 3HRDD 3RT3B 2JQRB 1PQSA 4A55A 1WGHA 3VR9B 4P16A 4YTPB 2PKOA 2J0JA 2G4SA 3M95A 3W1YA 4TMAB 5HFYA 5C23A 1XO3A 1I42A 3UIPB 3GS2A 1WMHA 3P63A 3PZ7A 2W3RA 4E74A 3Q3OC 4I6PA 1C4AA 2L05A 1V80A 3U30A 2KKCA 3DWGC 5G2NA 4OVVA 5TR5A 2LJ5A 2NCNA 4K1RB 1HTQA 4FADA 2V4IB 5EE0A 2OJRA 3IXSA 1LM8B 4LDTB 1DOXA 4C7ZA 4P1CC 2KMAA 4JL9A 4D2KA 1MFWA 5EE1A 2L00B 3R3MA 3U2SC 2N9XA 4GMVA 3KLSX 4BAXA 3SDLC 1SSNA 1P98A 2LHEA 2D3AA 1WZ0A 4NZLB 1WJNA 4EZKA 4LJOB 4DDGD 1YQ3B 1ENFA 3LXFA 2MRPA 1D3ZA 1JROA 3R66C 1OTRB 1QILA 3RZWC 2KQ4X 1WGRA 1F2RI 3R2IA 1WYWB 2LRUA 3RNBC 2GBRA 3TEXA 3TEWA 2XK5A 1JWAD 1N62A 3Q8EA 2Z59B 3VQIA 1ZDXA 1GJZA 3C19A 1N60A 4GIVA 3UQAA 2GI9A 2IO3B 1ZE3D 1PFDA 4EE2A 3VR8B 2ZCBA 4DHZE 3EC8A 3T3OA 5JXVA 1AW7A 1K50A 1XF5L 4TQ1A 4OVUA 2C7HA 2O2VB 4GDLB 5BMIA 2WGSA 1STEA 2AQ2B 3RULA 1L4DB 2JVCA 5IA7A 3ETRA 3DHGC 3U8ZA 3O65B 3I9V1 3B2FA 2H88B 2PMVA 3JSVA 1WGKA 3PHWB 3HIZA 2QILA 4M02A 1H8CA 2JU6X 2FBWB 3QA8A 3BYTB 3GZNB 3PT2B 3PZ8A 3ZLZA 1V9JA 2O6VD 3PO0A 2D07B
chains in the Genus database with same CATH topology
3NVWA 1TS4A 2PW9A 4MH8A 2WXGA 4OVZA 4PT5A 2Y5PA 2BB6A 1P7EA 2BS2B 3HUIA 1GPXA 1TZOA 3IT4B 2MJDA 4H2AA 4ARCA 4NJCA 4ZHPA 5G5GA 4P6VF 2HDEA 4C7YA 1FIQA 3URYA 4LLGM 1C77A 2B76B 5AUIA 1I4RA 4OZCA 3TUOA 1K51A 1B1ZA 1C4CA 1RYJA 1L5PA 1TYGB 1SE4A 1JRPA 5T8IA 2WXHA 1V1PA 4TSSA 5BMGA 1JW9D 2L52A 1QOBA 2BW2A 1Q10A 2CU3A 3AEEB 4GLSC 2IPKD 1BUIC 1TS5A 5G5HA 5HHDG 2INPE 1C78A 3E9SA 1JWBD 2W3SA 2DBYA 4A8XC 4ZOHC 4KKIA 1NI3A 2DWQA 3MHZA 1JCKB 3KWVA 2WXOA 1FMAD 1TY0A 1SJHD 2IGGA 2WXKA 2M19A 5D7GA 1J7AA 3BVZA 4RH6A 4XE0A 3U7ZA 4RGMA 3P4SB 2JZPA 3ZJVA 2WXPA 1UNSA 4UDUC 3B9JA 3TEYA 1QOAA 1FRDA 3Q8FA 2YEPF 3V3XA 1WWTA 1XLNA 4HKQA 1UGJA 3I57A 4J3OD 2NTTA 4NAMA 2VZKB 1N5XA 4AS1A 4JX1C 3AE1B 1V1OA 1MVKA 2V0GA 4KGRA 4YTNB 4A6QA 3H8HA 1KLGD 2CJNA 1RM6C 1MHHE 2WXLA 1CZPA 4KX6B 2TSSA 2WU5B 1TKEA 3VRAB 2KDMA 1BMLC 2K9XA 3ZQ4A 3AE7B 3IT6B 2GRIA 2BS3B 1OQQA 4DXGA 1HXYD 4O1NA 5EE3A 2LHDA 2LFIA 4LTUA 2KN4A 2LGIA 1IGDA 2J53A 1P7FA 2KWDA 1YQ4B 5H8YE 3U4EG 1JQ4A 1ZUD2 4RNAA 1KLUD 3AE5B 1T6BX 2N9LA 4YWGG 1KTKA 4YTMB 1CK1A 3FC4A 1JWMD 2M56B 2ZW0A 2ACZB 1FXAA 1TS2A 5H92C 2ON8A 2N7JA 1EU3A 3GB1A 5GXGB 1E0ZA 3BYYB 2PVGC 4C56C 1M4VA 1IBXB 1SEBD 4WQMA 1E7PB 4R3DA 4MT5A 5MPOA 3N9YC 1FFVA 3AE4B 1E9MA 2FE8A 4JWSC 4JPSA 3P4PB 2Z8LA 3CIRB 2LJIA 3CWIA 1HA5A 2WQYB 2D5GA 2WXIA 3BVGA 2X38A 1JMLA 3L4PA 1VZ7A 4A9AA 1KFYB 1L6UA 1TY2A 2AQ1B 5HI1A 2QSDA 1DOIA 2HTME 3P42A 4C80A 3MC0B 1ZDVA 1I4GA 2E3TA 2OEDA 1XLOA 4AQ7A 1EWYC 1A70A 1UWXA 2L83A 3Q8CA 1C4PA 3W2DA 2K5PA 5I4DA 1C9FA 3SFEB 1YN5A 2K22A 1ZXIA 4YSXB 3W5UB 3ABVB 1FD6A 2WXJA 2MH7A 2I38A 1FRRA 2JSVX 4L2YA 1NEKB 4WWMA 5D3DA 1MI0A 3ZYYX 1D5ZC 2IGDA 3TSSA 3O13A 1F77A 1AN8A 4USAA 3FAHA 3BIID 2WXRA 2WXNA 2SEBD 2JYEA 1L0YB 2WS3B 3AEBB 3P4QB 4JE3B 3ZJUA 3W1SA 1MPEA 3ZJTA 3KQ4A 3AH7A 5BYSA 3BVMA 4B0MA 1FO4A 1FXIA 4IKGA 2M0AA 2H89B 1EWCA 3UI3A 1WSPA 2JYTA 1K52A 2INNE 3KWLA 1I4QA 1WYGA 1JALA 3SEBA 3BK1A 3BWUD 3NS1A 1JWSD 1V8CA 1I4HA 3NZ3A 3W9CB 1NVID 1I4XA 1SIJA 1DGJA 3NVZA 2ZW1A 3AE8B 4HEA1 4RF0A 1PGAA 1SXTA 1CJEA 3OWEB 1ET6A 1L6VA 3AEAB 3P1MA 4ZRPA 2V3PA 3NUHB 1FCCC 1FNUA 1QKZA 2DLBA 2QIEB 1GAQB 1XLPA 3AE6B 4ITKA 1T3QA 4ZHOA 2Y3AA 1SE3A 2LEKA 1QOGA 3J9CA 5HG2A 4ZYSA 1QT9A 4MM3B 1J7BA 2R61A 2PVOD 1YJIA 4IDIA 1F2RC 3C8YA 3AEDB 2DYMA 1I7HA 3U52E 1NENB 1QF6A 4A90A 1AYFA 1VZ8A 1EM7A 1IGCA 4RGOS 4MACA 1NYRA 3AE3B 4HROA 2L1AA 2E6XA 1D5XC 4RGNA 1V1PB 5E6JA 2MJEA 3AB5A 2WDRB 4XWTA 1SE2A 1ZXHA 2VZKD 1SB3C 2BB5A 2PLPA 1SBBB 1FFUA 1L0XB 5FKAC 4XDCA 4FXCA 1HEZE 4L23A 4HKZE 2XNAC 4OW0A 2FUG1 4YXDB 1R7SA 1GB1A 2BBCA 5BYQA 1BXTA 2Y5CA 1KH0A 4RF1A 4WAFA 3V05A 1FEHA 1XXGA 1PUTA 1XCTL 2WXFA 4M0WA 4OZAA 1HZ5A 3LYYA 3Q69A 3P4RB 4HRSA 1E6EB 1L0VB 2BS4B 2MJ3A 4B0EA 3SFDB 2AQ3B 4N58A 1VR9A 3R2TA 2J4XA 1N61A 1VZ6A 3AEGB 3RFZB 2WXQA 1YJJA 3TEZA 1D4BA 1HQRD 1L4ZB 2EELA 3IAM1 4RFBA 4OZBA 3E56A 1NYQA 3GP7A 2RDHA 2OHFA 4YSYB 2JX5A 1XCQL 1F0ZA 2RPVA 2NMQA 4GDKB 4WURA 5AUKA 1PGXA 1UUPA 1ACCA 3HRDD 4JWUC 1ESFA 3AE2B 1FCLA 2J52A 4REZA 5FK9C 1N63A 2JQRB 2WDQB 4HJGE 4A55A 1K53A 2PIAA 1ZP0B 5LNK1 3VR9B 4P16A 4WIPA 4YTPB 3AV8A 2PKOA 2AX5A 1T5XD 2NTSA 3EA6A 3FILB 4IOIE 3MFGA 4ZRQA 1B9RA 4OHJA 5BYRA 4TMAB 5HFYA 1YMHE 2PTLA 1Y56A 3B2GA 2RMMA 3T3NA 4ARIA 1XO3A 3HVZA 4WH4A 1WXQA 1D5MC 1V97A 2W54A 3GS2A 2WLBA 3P63A 2IDYA 2YEPB 3PZ7A 2W3RA 5EE9A 2N0SB 3DWMA 2SAKA 2BTEA 2G9HD 5C2TB 1IBXA 2CJOA 3EUB2 1C4AA 1GB4A 1AWDA 2ICIA 1OFFA 2W55A 3NVYA 1FM0D 4L1BA 1CQVA 3DWGC 2IJ0A 4RCOA 2V4IB 5D3IB 5EE0A 1C76A 4N59A 2XN9C 2J42A 3AE9B 1DOYA 1EU4A 1YNTE 3IXSA 2WNMA 2W82A 2KACA 2N9KA 2LMCA 1UWMA 3MJ5A 1HZ6A 5BMHA 4KGSA 1DOXA 1TJEA 1VDVA 4C7ZA 4NAWB 4D2KA 3AN1A 1XEEA 2BT6A 5EE1A 3WCQA 4XWWA 3U2SC 3Q8AA 3HVDA 3KLSX 2WP9B 1MHXA 1SSNA 2LHEA 3AEFB 4NZLB 1DYQA 1YQ3B 1PDXA 1QLBB 1YN4A 3BK2A 1ENFA 3LXFA 1JWUD 3EGRA 4CQNA 1C79A 1ET9A 1JROA 1QILA 3LB8C 2KQ4X 1YN3A 4US9A 1F2RI 1FNVA 3NRZA 3R2IA 3RPFC 1KRHA 1TKYA 3TEXA 1TKGA 3TEWA 2IGHA 1JWAD 4XDDA 1ROEA 1N62A 3Q8EA 2WDVB 1I4PA 1ZDXA 3VQIA 4DXFA 1VLBA 1RFKA 3R8BA 1TS3A 1N60A 2ONQA 4YT0B 1XLQA 2GI9A 3AMZA 4KKJA 1ZE3D 1PFDA 1QOFA 4EE2A 2EKIA 2KMMA 3VR8B 2K0PA 2I2YA 2MEKA 2LUMA 3IAS1 5C3JB 3T3OA 5FR3A 1IUEA 1PGBA 1QQRA 3SR6A 5JXVA 2Q5WD 2BYTA 2K3UA 1AW7A 1K50A 1XF5L 4TQ1A 1RWSA 3Q8BA 4GDLB 5TSSA 5BMIA 3VRBB 2L32A 1STEA 2AQ2B 3ZGZA 2GB1A 1LO5D 2JWUA 1VRAB 1L4DB 3W5VB 4Q2JA 4TQ0A 1E10A 2QEJC 2QJLA 3ETRA 3MP9A 3NVVA 4RGTA 2KAJA 4DQOC 4US8A 2V3NA 3I9V1 3B2FA 2H88B 1VJKA 2PMVA 1WGKA 1ZOYB 4YSZB 3BZDB 4N6EB 2QILA 1D6EC 3AECB 2RDGA 1GOZA 2JU6X 3AM9A 1KF6B 2FBWB 2G1EA 3BYTB 1WRIA 1ZPSA 2JXTA 1OQRA 2WXMA 3PZ8A 2WU2B 1PYWD 1SF0A 2DYOA 4KGTA 1J7CA 3PO0A 1SJED 1N5WA 3FILA 4LK0M 2QMTA 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXS A;  3H8H A;  3GS2 A; 
#chains in the Genus database with same CATH topology
 4MGZ E;  1TS4 A;  2PW9 A;  4OVZ A;  2L76 A;  2WXG A;  4KV2 A;  2Y5P A;  2ZNV B;  2BS2 B;  1TZO A;  3IT4 B;  3WIM A;  2MJD A;  4RMA A;  3IFW B;  3TBL D;  2B76 B;  3DVG Y;  2KHW B;  4W9G A;  4JQW C;  1TYG B;  4NQK E;  1V1P A;  5BMG A;  1JW9 D;  1Q10 A;  2N4F A;  4B9K A;  1TS5 A;  3M3J A;  1BT0 A;  4ANV A;  5G5H A;  5HHD G;  2M8S A;  4ANU A;  2JY6 A;  4BKG A;  4A8X C;  4ZOH C;  2DAF A;  2DWQ A;  3JYU A;  2IGG A;  2M19 A;  5D7G A;  1J7A A;  3VFK A;  4AUQ C;  2M1M A;  2JZP A;  3DCG A;  2ZVO A;  3TEY A;  1FRD A;  1XLN A;  1UGJ A;  1YOV B;  4K3B A;  4ZDV A;  1N5X A;  4AS1 A;  2KJH B;  3VTV A;  3AE1 B;  1V1O A;  2M4N A;  1MVK A;  4HDO A;  1A5R A;  4M00 A;  1RM6 C;  2KC1 A;  2TSS A;  5D6J B;  2KDM A;  2K1F A;  4BOZ B;  2GRI A;  2MBO A;  1OQQ A;  4C4V B;  4O1N A;  5EE3 A;  2LHD A;  4LTU A;  2LGI A;  3H1U A;  1SGH A;  3RNF C;  2YLM A;  3V61 A;  1P0R A;  3PLU A;  1JQ4 A;  1R4N I;  1T6B X;  2N9L A;  3QQ8 B;  4YWG G;  2BKR B;  5AZF A;  4W9L A;  1LGR A;  3FC4 A;  2ZW0 A;  2ACZ B;  2KVZ A;  4EUT A;  2N7J A;  1EU3 A;  3GB1 A;  2MHJ A;  4WJN A;  5L83 A;  3EHV A;  4DBG A;  4QAY A;  4HDQ A;  1E9M A;  3AI5 A;  2Z8L A;  4HCP B;  2WQY B;  3BVG A;  2X38 A;  1JML A;  3L4P A;  1VZ7 A;  1J0G A;  4IW0 A;  1KFY B;  3VH4 B;  1TY2 A;  5HI1 A;  2HTM E;  4C80 A;  2MP2 B;  3Q14 C;  3DQV A;  1WE7 A;  3M62 B;  3JVZ X;  1XLO A;  4AQ7 A;  1UWX A;  4FLH A;  3H7S A;  3Q3J A;  2KDB A;  4DHJ B;  4RM9 A;  4MSM B;  2LGX A;  3P2B A;  4XYC A;  3ZO5 B;  1YN5 A;  1ZXI A;  4WWP A;  2MH7 A;  1MI0 A;  4MEL A;  3T9L A;  1V81 A;  3FAH A;  1WY8 A;  2MLB A;  2SEB D;  1L0Y B;  3P4Q B;  4HJK A;  3ZJT A;  2DZK A;  1T0R C;  1VCB A;  2MA9 B;  3BVM A;  4XX5 A;  2H89 B;  3UI3 A;  2INN E;  3BK1 A;  4NPN A;  2HD5 B;  4FUL A;  2CS4 A;  4P7I A;  3UQB A;  1NVI D;  2JZZ A;  3NVZ A;  1UGM A;  1PGA A;  4JLC A;  1ET6 A;  1L6V A;  1F52 A;  3AEA B;  3VVW B;  2MBE A;  1V86 A;  4MSQ B;  1QKZ A;  4HPM B;  4BBN F;  3MHS D;  3N32 A;  1T3Q A;  3QWZ B;  4I6N B;  5HG2 A;  1YX5 B;  1QT9 A;  4BBN C;  3A4S C;  4RM8 A;  1J7B A;  4KSL C;  2R61 A;  2LXC A;  3ZRC A;  4AJW A;  3WAM A;  3NHE B;  1EM7 A;  4HK2 A;  4CYE A;  4MAC A;  5DPS A;  3AE3 B;  3L10 B;  1V1P B;  2N9P C;  2MJE A;  1YD8 U;  4XWT A;  2VRR B;  1ZXH A;  2K25 A;  4HLE A;  1FFU A;  1LFD A;  2MW5 A;  4YXD B;  2Y5C A;  3CF6 E;  1FEH A;  2K6D B;  3ML8 A;  4M0W A;  1CMX B;  3P4R B;  1L0V B;  2BS4 B;  3QX1 A;  3SFD B;  4N58 A;  3UF8 A;  1VR9 A;  2J4X A;  3APF A;  1P1A A;  3AEG B;  1QZE A;  5IOI A;  2KX0 A;  2EEL A;  1UBI A;  2QHO A;  1NYQ A;  2OHF A;  2JX5 A;  4GDK A;  1XCQ L;  2RPV A;  1PGX A;  4N9F 4;  4REZ A;  5J2R A;  3PRE A;  2DZJ A;  4W9H A;  4F8C B;  2WYQ A;  5DCN A;  1ZP0 B;  3GZN I;  3PSE B;  2Y5B B;  4WIP A;  4NJ7 A;  4ZRQ A;  3EA6 A;  3A4R A;  3MFG A;  4GDL A;  1B9R A;  2IND C;  2QCZ A;  4OHJ A;  4W9E A;  2JXX A;  2WWZ A;  5AZH A;  1WXQ A;  1UH6 A;  2WLB A;  3EFC A;  5JHA A;  2IDY A;  1R4M B;  3Q3M C;  2SAK A;  2AL3 A;  2BTE A;  5C2T B;  1UD7 A;  2CHW A;  1GB4 A;  1AWD A;  3KUD B;  2KN5 A;  2XK5 B;  3CMM B;  1C76 A;  1TIF A;  3Q3N C;  2J42 A;  3AE9 B;  4PS7 A;  1DOY A;  2WNM A;  2KAC A;  2N9K A;  2LMC A;  3PTF C;  1UWM A;  5BMH A;  1TJE A;  3WAP A;  4KDL B;  2INC C;  2KOX A;  4FJY A;  4XWW A;  1WJ4 A;  5CHV C;  1MHX A;  3M63 B;  3AEF B;  1DYQ A;  1E7V A;  3ZNZ B;  3QC8 B;  1EO6 A;  2K8B A;  2KWU B;  4CQN A;  1C79 A;  1Z5S B;  3LB8 C;  4PYZ A;  4BKS D;  3CSF A;  1YN3 A;  2ZPY A;  1KRH A;  2C60 A;  2IGH A;  1WXV A;  2K6Q A;  2WDV B;  4DXF A;  1R4M I;  1VLB A;  5CHW A;  1TS3 A;  3VHT C;  4YT0 B;  2BQQ A;  2KQS A;  4KKJ A;  3AMZ A;  2LZ6 A;  3R7R A;  2KMM A;  3RMK C;  2K0P A;  2MEK A;  3U7D A;  4BVU C;  5C3J B;  3QAQ A;  1QQR A;  2IO0 B;  2K3U A;  2ASQ A;  2KDI A;  1RWS A;  4WJQ A;  3QAR A;  3ZGZ A;  2G45 B;  3ALB A;  2GB1 A;  5DPT A;  1E10 A;  3V6E B;  4FHJ A;  2QEJ C;  4FJV B;  4EKU A;  2KZR A;  4WWO A;  1SIF A;  4DQO C;  3A9K B;  1VJK A;  4ACF A;  3AEC B;  2RDG A;  4URK A;  3AM9 A;  1KF6 B;  4M8M A;  1ZPS A;  4IWP A;  2JXT A;  4FBJ B;  1WX8 A;  3ZKJ C;  1SJE D;  2L0F A;  4LK0 M;  4EZJ A;  4PS8 A;  2BB6 A;  1P7E A;  3HUI A;  1OQY A;  1ZGU B;  2BPS A;  1GPX A;  2I1K A;  2MQJ A;  3I5J C;  1YJ1 A;  4NJC A;  4W9I A;  2BWF A;  5G5G A;  1WH3 A;  4IM3 A;  4WJP A;  3URY A;  4LLG M;  1C77 A;  1KLV A;  3TUO A;  4IM2 A;  4F7Z A;  3PRM B;  4IWQ A;  4MGY E;  5J18 A;  1WXA A;  1WZ3 A;  2L52 A;  3KH0 A;  1NDD A;  2BW2 A;  1RLF A;  4PS3 A;  2IPK D;  2LGD A;  1BUI C;  4JGH B;  2JUO A;  2K39 A;  1C78 A;  2DBY A;  4P1B C;  3N1X C;  3TMP B;  1TY0 A;  1SJH D;  2WXK A;  3PV1 A;  3BVZ A;  1ISN A;  4XE0 A;  3U7Z A;  4RGM A;  1Q1O A;  3SHQ A;  3WAO A;  3WA0 A;  5EDS A;  2N9E B;  3Q8F A;  2YEP F;  1WWT A;  2HJ1 A;  4XGA B;  3AU5 A;  1SE9 A;  4NQL B;  3RNA C;  1M94 A;  4A6Q A;  4YTN B;  4ASW C;  1S1Q B;  2J7Q B;  3BIN A;  3ZNG C;  2ZCC A;  3PHX B;  2KDE B;  3ONS A;  4LNF A;  3NZU A;  5L95 C;  2IYD B;  3AE7 B;  5IAA C;  4WJO A;  3IT6 B;  2IY0 B;  3ZQ4 A;  2BS3 B;  4DXG A;  1HXY D;  1NBF C;  4GU2 A;  1Z2M A;  3U4E G;  4RNA A;  3ZDM C;  2WDT B;  4G11 A;  1KLU D;  4BOS C;  2BYE A;  4YTM B;  1CK1 A;  2MX2 A;  2PPH A;  1FXA A;  1TS2 A;  5H92 C;  3PZD A;  3VTU A;  1E0Z A;  1E5W A;  2UYZ B;  2UWQ A;  4WQM A;  4FN2 A;  1E7P B;  4MT5 A;  4KIK A;  3RD2 A;  3VUX A;  1FFV A;  2FID A;  2GLS A;  1I35 A;  2LVO A;  4JWS C;  2DAJ A;  3A9K A;  2K8H A;  1HA5 A;  2D5G A;  2MBQ A;  4KZ0 A;  3MC0 B;  4M01 A;  1ZDV A;  1I4G A;  4NY0 A;  4GGQ A;  2PJH A;  3L17 A;  1VD2 A;  2LXA A;  3Q8C A;  1A70 A;  3T8M A;  4KSK C;  1C4P A;  3B0A A;  2K8C A;  3JSV B;  2CHX A;  2PE9 A;  3SFE B;  3QHT A;  3DBS A;  4B95 A;  2K22 A;  3W5U B;  2JF5 A;  2ZNV C;  2I38 A;  2FAZ A;  2O2V A;  1NEK B;  3NOB A;  4W9K A;  3RI7 C;  4KZC A;  1GC6 A;  3DBH I;  1F77 A;  4IM0 A;  1AN8 A;  4USA A;  3BII D;  1WJU A;  2WXN A;  2JYE A;  3N1Y C;  2WS3 B;  2ZVN A;  4JE3 B;  4AP4 C;  3AUL A;  1YX6 B;  3W1S A;  1KM7 A;  4B0M A;  1FO4 A;  3NJT A;  2M0A A;  3ZUN A;  1EWC A;  4I6L B;  1WSP A;  3S2A A;  1HTO A;  3NS1 A;  3DBH B;  3NZ3 A;  4ICV A;  2KX3 A;  2KLG A;  1I4X A;  2LVQ A;  1SIJ A;  3QK0 A;  1DGJ A;  2ZW1 A;  4WWN A;  5BO4 B;  3L0W B;  4DHZ B;  1CJE A;  2CKH B;  3OWE B;  3AXC A;  3X23 A;  1GAQ B;  2LAS A;  4ZHO A;  1SE3 A;  3J9C A;  4ZYS A;  3MC8 A;  2O6V B;  4ZRJ A;  2PVO D;  2Z0D B;  1ZKH A;  2DYM A;  1I7H A;  2XEW A;  4A90 A;  1IGC A;  3RUI B;  2E6X A;  4IG7 B;  3GE8 C;  2QDF A;  3OG5 A;  4ZYN A;  4MGK E;  2BB5 A;  2PLP A;  5HKH A;  1SBB B;  5FKA C;  4XDC A;  3IHP C;  4L23 A;  2EMT A;  4HKZ E;  3QJZ A;  3W1S C;  2KMC A;  1TTN A;  1AAR A;  2BBC A;  2VH2 A;  5BYQ A;  4WAF A;  3V05 A;  3DBL B;  2NBW B;  3LYY A;  4B0E A;  2RPQ A;  3R2T A;  1VZ6 A;  3TEZ A;  1YQB A;  3IAM 1;  4G0N B;  3E56 A;  3DPD A;  1V6E A;  3I63 C;  1F0Z A;  1UUP A;  1ACC A;  3TJP A;  3AE2 B;  2J52 A;  2R2Q A;  4ZRK A;  5FK9 C;  1N63 A;  2AWT A;  2WDQ B;  4HJG E;  1ZW7 A;  1K53 A;  2PIA A;  3ZW3 A;  5LNK 1;  3A33 B;  1KOT A;  3AV8 A;  4DDI D;  2NTS A;  3FIL B;  4HPL B;  2PTL A;  1Y56 A;  3B2G A;  3UIN B;  3Q3F A;  3T3N A;  4WH4 A;  1D5M C;  2W54 A;  4G50 A;  2YEP B;  2MSE D;  5LXH A;  3DWM A;  3VUW A;  1WGY A;  2C5L C;  1T0Y A;  5GMV A;  2CJO A;  2ICI A;  1OFF A;  2W55 A;  2LGY A;  4RCO A;  4FHK A;  3ZTD A;  5D3I B;  1EU4 A;  3X0W A;  4KDI C;  2W82 A;  2MBH A;  3MJ5 A;  4KGS A;  5DPW A;  4F1S A;  2I1J A;  2PE6 B;  2XBB C;  2KFK B;  3Q8A A;  1K8R B;  2WP9 B;  3GE3 C;  1J8C A;  1V5T A;  3ENE A;  2IO1 B;  3L08 A;  2KLC A;  1L2N A;  1ET9 A;  1YIW A;  4PYU A;  1XQQ A;  3RCZ A;  4US9 A;  3OJ4 B;  3NRZ A;  1Y8R C;  1TKY A;  5AEK B;  1I4P A;  2KFK A;  1WM3 A;  1XLQ A;  1QOF A;  2I2Y A;  4NAW A;  1LQB A;  5FR3 A;  2MCN B;  3DBR I;  2Q5W D;  2BYT A;  4HVB A;  3CST A;  3L16 A;  2IO2 B;  2LI5 A;  3Q8B A;  4W9J A;  3VRB B;  3W5V B;  2KC2 A;  3WAN A;  2AEH A;  2BVC A;  1FXT B;  2QJL A;  3MP9 A;  3NVV A;  4RGT A;  2KAJ A;  2V3N A;  4LNN A;  1ZOY B;  4YSZ B;  3BZD B;  2L7R A;  2G1E A;  1WRI A;  5JHB A;  4CHK A;  2WXM A;  1SF0 A;  2BYF A;  1J7C A;  4BZA A;  1N5W A;  2DNF A;  2QMT A;  2KTR A;  1FNW A;  3TIX A;  2KAN A;  4FJZ A;  4MH8 A;  4PT5 A;  4XC2 A;  4G3X B;  4S0R A;  5G55 A;  1OGW A;  4ZHP A;  2LUE A;  2GMI C;  2HDE A;  4C7Y A;  1FIQ A;  3HK0 A;  5IN7 A;  2M17 A;  3DBL I;  1I4R A;  4OZC A;  1K51 A;  1RYJ A;  1C4C A;  3RYT A;  1SE4 A;  2ZZP B;  2WX0 A;  2FUH B;  5T8I A;  3APC A;  4FA6 A;  4TSS A;  4II3 B;  4LNK A;  4AWJ A;  3DHI C;  1QOB A;  4JIO U;  5E6O A;  3UIO B;  3AEE B;  2DX5 B;  1MG8 A;  4MJS A;  3E9S A;  4EFO A;  1WXM A;  5IKC M;  2W3S A;  4MM3 A;  1TGZ B;  4KKI A;  1NI3 A;  2EKE C;  4LNI A;  2N7D A;  1G6J A;  1E8Y A;  1JCK B;  3KWV A;  2WXO A;  1FMA D;  2OJW A;  4RH6 A;  3A1Q A;  4E3C A;  1FPY A;  3ZJV A;  2D2Q A;  2WXP A;  2KXJ A;  4UDU C;  1UZX B;  2LRW A;  1QOA A;  3V3X A;  3ZXR A;  3I57 A;  4M8N A;  3KW5 B;  3WAL A;  3BY4 B;  3KUC B;  3TCA A;  4JX1 C;  4DXA B;  3KUZ A;  3ZXV A;  4KGR A;  3H8H A;  4WQO B;  4XZ4 A;  1P9D U;  2K9X A;  3HHM A;  3VH3 B;  2QC8 A;  3ZNH B;  4X57 B;  2KJR A;  3FKY A;  4NNJ B;  4LNO A;  2GBK A;  1NI2 A;  1IGD A;  2RGF A;  3MJW A;  2J53 A;  1P7F A;  2KWD A;  1WIA A;  1ZUD 2;  3AE5 B;  4IC7 B;  4M0W B;  1KTK A;  3R7Q A;  2M56 B;  1HE8 A;  2M0X A;  2ON8 A;  5GXG B;  4MGI E;  4EZL A;  2PVG C;  1M4V A;  1IBX B;  2FCM A;  1SEB D;  5CX3 A;  4MDK E;  4R3D A;  3AU4 A;  1WGD A;  4TKN A;  5MPO A;  3ECI A;  2FE8 A;  4ANW A;  2LJI A;  2FCN A;  2X8X X;  1Q5W B;  3H7P B;  2BF8 B;  2KYW A;  2QSD A;  2A5U A;  2DZI A;  2Z0E B;  3IVF A;  2E3T A;  2MWS B;  1E8Z A;  3OJ3 A;  2BGF A;  3DOW A;  3A9J B;  1EWY C;  3RZF A;  2KO3 A;  1RFA A;  2FNJ B;  3W2D A;  3KYC D;  5I4D A;  1E8W A;  4DHJ D;  1FD6 A;  3H7P A;  3PLV A;  2DYB A;  5KHQ A;  4L2Y A;  3VDZ A;  2L3Z A;  2J0K A;  3ZYY X;  2IGD A;  1EF1 A;  3QIJ A;  3AEB B;  3ZJU A;  3LJ3 A;  4K7S A;  3VTW A;  4BKS A;  3KQ4 A;  3VXW A;  1T0Q C;  5BYS A;  2EMS A;  3RNE C;  4IKG A;  1UF0 A;  2JYT A;  3KWL A;  4S17 A;  4AOF A;  1I4Q A;  1JAL A;  3D32 A;  1JWS D;  1V8C A;  1I4H A;  2A4Z A;  4K3C A;  3AE8 B;  4B6W A;  2UU7 A;  4RF0 A;  3PRP B;  1SXT A;  3PS6 A;  3SD5 A;  2D10 A;  4W9C A;  4ZRP A;  3AE6 B;  2ZEQ A;  1OEY A;  1WMH B;  2Y3A A;  2RDB C;  1QOG A;  3HM6 X;  4MM3 B;  2KWC A;  2JT4 B;  2KFJ A;  4PK1 A;  1YJI A;  3TL5 A;  1EF5 A;  3N30 A;  4IUM B;  1F2R C;  3C8Y A;  4WAA A;  3L54 A;  2IBI B;  5AZG A;  3V6C B;  1VZ8 A;  4RGO S;  1NYR A;  2O6V A;  4HRO A;  1D5X C;  4GSW A;  4RGN A;  2L8J A;  2HE7 A;  3DVN V;  3A1Q B;  3ML9 A;  3AB5 A;  1SE2 A;  2ZPN A;  1GG3 A;  2XNA C;  2WHI A;  4OW0 A;  1E8X A;  4MJS B;  1R7S A;  2DEN B;  1GB1 A;  2AL6 A;  1BXT A;  4RF1 A;  1GUA B;  3ZRF A;  3UGB B;  1PUT A;  1XCT L;  2V1Y A;  3OAW A;  3Q69 A;  1Q0W B;  4HRS A;  1N6Z A;  2AQ3 B;  3I3T B;  2KK8 A;  1YJJ A;  2G3Q B;  3ZIM A;  4GN1 A;  4OZB A;  2CU1 A;  4C4V A;  4YSY B;  2D3B A;  4C00 A;  1L7Y A;  4WUR A;  4JWU C;  3NZS A;  1ESF A;  1FCL A;  2KWV B;  3H6N A;  3EEC A;  4ANX A;  2REX A;  3KYD D;  3DBR B;  2AX5 A;  4IOI E;  1T5X D;  4ZRI A;  4HPP A;  2BYV E;  5BYR A;  1YMH E;  2RMM A;  4ARI A;  2KVR A;  3HVZ A;  1H4R A;  2L0T A;  1V97 A;  3PRZ A;  5EE9 A;  2N0S B;  3Q2A C;  2G9H D;  1IBX A;  3EUB 2;  3NVY A;  1FM0 D;  4L1B A;  1CQV A;  2IJ0 A;  4A3O A;  2NBU A;  1WI0 A;  4GB9 A;  5JH5 C;  4N59 A;  2XN9 C;  3RNC C;  1YNT E;  3NY5 A;  1HZ6 A;  4BFR A;  2RR9 A;  1VDV A;  2JRI B;  4NAW B;  1WM2 A;  3AN1 A;  5CTR C;  1XEE A;  2BT6 A;  2NVU I;  3WCQ A;  1WFY A;  1IYF A;  3HVD A;  2D3C A;  5DPR A;  1PDX A;  1QLB B;  1YN4 A;  2KJ6 A;  3BK2 A;  5FR6 A;  1JWU D;  2NS5 A;  2N1W A;  3EGR A;  5IP4 D;  2CHZ A;  1FNV A;  2GOW A;  3RPF C;  1TKG A;  1WF9 A;  1XD3 B;  4XDD A;  1ROE A;  1EUV B;  1LXD A;  2IY1 B;  2JRH A;  1RFK A;  3NG0 A;  3R8B A;  2ONQ A;  2HJ8 A;  2EKI A;  2LUM A;  3IAS 1;  1IUE A;  1PGB A;  1GC7 A;  3SR6 A;  4GXB A;  1MJD A;  1OEY J;  2DZM A;  5C1Z A;  1GNU A;  4NJ6 A;  5TSS A;  2L32 A;  3DVN U;  1LO5 D;  2JWU A;  1VRA B;  3N3K B;  4TQ0 A;  4Q2J A;  3IBE A;  4LDT D;  3ZVV A;  4US8 A;  2C7M B;  2PEA A;  1C1Y B;  4N6E B;  1D6E C;  1GOZ A;  2OOB B;  1TZ1 A;  2V3S A;  3C0R B;  2RD0 A;  1OQR A;  2WU2 B;  1U4A A;  1PYW D;  2DYO A;  3Q6B A;  4KGT A;  2HTH A;  3FIL A;  2W9N A;  3ZTC A;  3NVW A;  1WGG A;  4K81 A;  2JWZ A;  2KTF A;  4K7U A;  1F1H A;  2ZJD A;  3DDC B;  2WX1 A;  4CO7 A;  4H2A A;  4ARC A;  3RN9 C;  4W9F A;  2JZ3 B;  1WR1 A;  2KT7 A;  4P6V F;  2GBM A;  2R2O A;  2FCQ A;  4LJP B;  3JW0 X;  5AUI A;  4A3P A;  1B1Z A;  2C9W B;  2JPH A;  1L5P A;  1P3Q U;  1WE6 A;  2BKF A;  1JRP A;  2WXH A;  1V49 A;  4KVG B;  2NPT A;  4TV3 A;  3LDZ E;  1V2Y A;  3H9D A;  2CU3 A;  1RAX A;  4GLS C;  2J0M A;  1T0S C;  2INP E;  3DVG X;  1JWB D;  4EEW A;  3MHZ A;  3GOE A;  2GBJ A;  3P4S B;  2FCS A;  4AJY B;  1UNS A;  5J17 A;  2MP2 A;  3B9J A;  2IZV B;  3VUY A;  4HKQ A;  2N1V A;  4J3O D;  2NTT A;  4NAM A;  2VZK B;  3HM3 A;  1RRB A;  2NPT B;  4DK5 A;  2CR5 A;  2V0G A;  1KLG D;  2CJN A;  2WXL A;  1MHH E;  1CZP A;  4KX6 B;  2WU5 B;  1TKE A;  3VRA B;  1BML C;  1MG4 A;  2D11 A;  1J19 A;  2RSU A;  5CHF A;  2LFI A;  2V9H A;  4HCN B;  2KN4 A;  1YQ4 B;  5H8Y E;  4J6I A;  4HXD A;  3QCA A;  5E6N A;  1S3S G;  2MBB B;  2FIF A;  2KTR B;  1JWM D;  1TBE A;  3SU8 X;  3B08 A;  2GBN A;  2G4D B;  5IO9 A;  4ICU A;  2N7E A;  3BYY B;  4C56 C;  4DWF A;  2VH1 A;  3EFU A;  3N9Y C;  1WR6 E;  3AE4 B;  4JPS A;  3P4P B;  4K7W A;  3CIR B;  3CWI A;  3PVL A;  3K9O B;  2WXI A;  3IG3 A;  4A9A A;  1L6U A;  2AQ1 B;  1UBQ A;  4HWI B;  1DOI A;  3P42 A;  3ZDT A;  3V62 A;  2KDF B;  3ZNI D;  3MC9 A;  2OED A;  4GOC A;  3PGE A;  4KIK B;  2L83 A;  3B1L X;  3MTN B;  1TT5 B;  4MEM A;  3OLM D;  1WXS A;  2K5P A;  1V5O A;  1C9F A;  1UEL A;  2DHZ A;  2KNB A;  4YSX B;  5LXI B;  1R4N B;  3ABV B;  2WXJ A;  2YVC A;  1FRR A;  2JSV X;  4TUU A;  4WWM A;  3N1Z C;  4EOY A;  5D3D A;  2D3G A;  4W9D A;  1D5Z C;  3TSS A;  3O13 A;  2WXR A;  4MH0 E;  1MPE A;  5LLI A;  3NS8 A;  3AH7 A;  4II2 B;  1FXI A;  4LCD E;  3L13 A;  4IWO A;  1K52 A;  3RNG C;  1X1M A;  2C7N B;  1KJT A;  5KHO A;  1WRD B;  1WYG A;  2V4L A;  3SEB A;  3BWU D;  1IPG A;  2LGS A;  3KVF B;  1E90 A;  3W9C B;  2NR2 A;  1IP9 A;  4HEA 1;  3VAW A;  5E6P A;  4E71 A;  3P1M A;  2V3P A;  3NUH B;  1FCC C;  1FNU A;  2DLB A;  2QIE B;  1XLP A;  4ITK A;  3A9J A;  3V60 A;  2LEK A;  4A20 A;  1WJ6 A;  3K9P B;  5JZE B;  2LVP A;  4IDI A;  2BWE S;  3AED B;  3U52 E;  4BKT A;  2KQ7 A;  5D94 A;  1NEN B;  1QF6 A;  1AYF A;  2AYO B;  5D2M B;  2L1A A;  1WX7 A;  5E6J A;  2LD9 A;  1XT9 B;  2WDR B;  2NBV B;  2VZK D;  1SB3 C;  3N20 C;  2B3A A;  3PPA A;  1L0X B;  4FXC A;  1HEZ E;  2FUG 1;  1F9J A;  4YL8 A;  1WX9 A;  1KH0 A;  1JRU A;  1XXG A;  2WXF A;  3DHH C;  4OZA A;  1HZ5 A;  1E6E B;  2MJ3 A;  1C3T A;  3APD A;  2LWP A;  1N61 A;  2KD0 A;  3RFZ B;  2WXQ A;  1D4B A;  1HQR D;  1L4Z B;  4RFB A;  3GP7 A;  2RDH A;  2NMQ A;  4GDK B;  5AUK A;  1E7U A;  3HRD D;  3RT3 B;  2JQR B;  1PQS A;  4A55 A;  1WGH A;  3VR9 B;  4P16 A;  4YTP B;  2PKO A;  2J0J A;  2G4S A;  3M95 A;  3W1Y A;  4TMA B;  5HFY A;  5C23 A;  1XO3 A;  1I42 A;  3UIP B;  3GS2 A;  1WMH A;  3P63 A;  3PZ7 A;  2W3R A;  4E74 A;  3Q3O C;  4I6P A;  1C4A A;  2L05 A;  1V80 A;  3U30 A;  2KKC A;  3DWG C;  5G2N A;  4OVV A;  5TR5 A;  2LJ5 A;  2NCN A;  4K1R B;  1HTQ A;  4FAD A;  2V4I B;  5EE0 A;  2OJR A;  3IXS A;  1LM8 B;  4LDT B;  1DOX A;  4C7Z A;  4P1C C;  2KMA A;  4JL9 A;  4D2K A;  1MFW A;  5EE1 A;  2L00 B;  3R3M A;  3U2S C;  2N9X A;  4GMV A;  3KLS X;  4BAX A;  3SDL C;  1SSN A;  1P98 A;  2LHE A;  2D3A A;  1WZ0 A;  4NZL B;  1WJN A;  4EZK A;  4LJO B;  4DDG D;  1YQ3 B;  1ENF A;  3LXF A;  2MRP A;  1D3Z A;  1JRO A;  3R66 C;  1OTR B;  1QIL A;  3RZW C;  2KQ4 X;  1WGR A;  1F2R I;  3R2I A;  1WYW B;  2LRU A;  3RNB C;  2GBR A;  3TEX A;  3TEW A;  2XK5 A;  1JWA D;  1N62 A;  3Q8E A;  2Z59 B;  3VQI A;  1ZDX A;  1GJZ A;  3C19 A;  1N60 A;  4GIV A;  3UQA A;  2GI9 A;  2IO3 B;  1ZE3 D;  1PFD A;  4EE2 A;  3VR8 B;  2ZCB A;  4DHZ E;  3EC8 A;  3T3O A;  5JXV A;  1AW7 A;  1K50 A;  1XF5 L;  4TQ1 A;  4OVU A;  2C7H A;  2O2V B;  4GDL B;  5BMI A;  2WGS A;  1STE A;  2AQ2 B;  3RUL A;  1L4D B;  2JVC A;  5IA7 A;  3ETR A;  3DHG C;  3U8Z A;  3O65 B;  3I9V 1;  3B2F A;  2H88 B;  2PMV A;  3JSV A;  1WGK A;  3PHW B;  3HIZ A;  2QIL A;  4M02 A;  1H8C A;  2JU6 X;  2FBW B;  3QA8 A;  3BYT B;  3GZN B;  3PT2 B;  3PZ8 A;  3ZLZ A;  1V9J A;  2O6V D;  3PO0 A;  2D07 B; 
#chains in the Genus database with same CATH homology
 3NVW A;  1TS4 A;  2PW9 A;  4MH8 A;  2WXG A;  4OVZ A;  4PT5 A;  2Y5P A;  2BB6 A;  1P7E A;  2BS2 B;  3HUI A;  1GPX A;  1TZO A;  3IT4 B;  2MJD A;  4H2A A;  4ARC A;  4NJC A;  4ZHP A;  5G5G A;  4P6V F;  2HDE A;  4C7Y A;  1FIQ A;  3URY A;  4LLG M;  1C77 A;  2B76 B;  5AUI A;  1I4R A;  4OZC A;  3TUO A;  1K51 A;  1B1Z A;  1C4C A;  1RYJ A;  1L5P A;  1TYG B;  1SE4 A;  1JRP A;  5T8I A;  2WXH A;  1V1P A;  4TSS A;  5BMG A;  1JW9 D;  2L52 A;  1QOB A;  2BW2 A;  1Q10 A;  2CU3 A;  3AEE B;  4GLS C;  2IPK D;  1BUI C;  1TS5 A;  5G5H A;  5HHD G;  2INP E;  1C78 A;  3E9S A;  1JWB D;  2W3S A;  2DBY A;  4A8X C;  4ZOH C;  4KKI A;  1NI3 A;  2DWQ A;  3MHZ A;  1JCK B;  3KWV A;  2WXO A;  1FMA D;  1TY0 A;  1SJH D;  2IGG A;  2WXK A;  2M19 A;  5D7G A;  1J7A A;  3BVZ A;  4RH6 A;  4XE0 A;  3U7Z A;  4RGM A;  3P4S B;  2JZP A;  3ZJV A;  2WXP A;  1UNS A;  4UDU C;  3B9J A;  3TEY A;  1QOA A;  1FRD A;  3Q8F A;  2YEP F;  3V3X A;  1WWT A;  1XLN A;  4HKQ A;  1UGJ A;  3I57 A;  4J3O D;  2NTT A;  4NAM A;  2VZK B;  1N5X A;  4AS1 A;  4JX1 C;  3AE1 B;  1V1O A;  1MVK A;  2V0G A;  4KGR A;  4YTN B;  4A6Q A;  3H8H A;  1KLG D;  2CJN A;  1RM6 C;  1MHH E;  2WXL A;  1CZP A;  4KX6 B;  2TSS A;  2WU5 B;  1TKE A;  3VRA B;  2KDM A;  1BML C;  2K9X A;  3ZQ4 A;  3AE7 B;  3IT6 B;  2GRI A;  2BS3 B;  1OQQ A;  4DXG A;  1HXY D;  4O1N A;  5EE3 A;  2LHD A;  2LFI A;  4LTU A;  2KN4 A;  2LGI A;  1IGD A;  2J53 A;  1P7F A;  2KWD A;  1YQ4 B;  5H8Y E;  3U4E G;  1JQ4 A;  1ZUD 2;  4RNA A;  1KLU D;  3AE5 B;  1T6B X;  2N9L A;  4YWG G;  1KTK A;  4YTM B;  1CK1 A;  3FC4 A;  1JWM D;  2M56 B;  2ZW0 A;  2ACZ B;  1FXA A;  1TS2 A;  5H92 C;  2ON8 A;  2N7J A;  1EU3 A;  3GB1 A;  5GXG B;  1E0Z A;  3BYY B;  2PVG C;  4C56 C;  1M4V A;  1IBX B;  1SEB D;  4WQM A;  1E7P B;  4R3D A;  4MT5 A;  5MPO A;  3N9Y C;  1FFV A;  3AE4 B;  1E9M A;  2FE8 A;  4JWS C;  4JPS A;  3P4P B;  2Z8L A;  3CIR B;  2LJI A;  3CWI A;  1HA5 A;  2WQY B;  2D5G A;  2WXI A;  3BVG A;  2X38 A;  1JML A;  3L4P A;  1VZ7 A;  4A9A A;  1KFY B;  1L6U A;  1TY2 A;  2AQ1 B;  5HI1 A;  2QSD A;  1DOI A;  2HTM E;  3P42 A;  4C80 A;  3MC0 B;  1ZDV A;  1I4G A;  2E3T A;  2OED A;  1XLO A;  4AQ7 A;  1EWY C;  1A70 A;  1UWX A;  2L83 A;  3Q8C A;  1C4P A;  3W2D A;  2K5P A;  5I4D A;  1C9F A;  3SFE B;  1YN5 A;  2K22 A;  1ZXI A;  4YSX B;  3W5U B;  3ABV B;  1FD6 A;  2WXJ A;  2MH7 A;  2I38 A;  1FRR A;  2JSV X;  4L2Y A;  1NEK B;  4WWM A;  5D3D A;  1MI0 A;  3ZYY X;  1D5Z C;  2IGD A;  3TSS A;  3O13 A;  1F77 A;  1AN8 A;  4USA A;  3FAH A;  3BII D;  2WXR A;  2WXN A;  2SEB D;  2JYE A;  1L0Y B;  2WS3 B;  3AEB B;  3P4Q B;  4JE3 B;  3ZJU A;  3W1S A;  1MPE A;  3ZJT A;  3KQ4 A;  3AH7 A;  5BYS A;  3BVM A;  4B0M A;  1FO4 A;  1FXI A;  4IKG A;  2M0A A;  2H89 B;  1EWC A;  3UI3 A;  1WSP A;  2JYT A;  1K52 A;  2INN E;  3KWL A;  1I4Q A;  1WYG A;  1JAL A;  3SEB A;  3BK1 A;  3BWU D;  3NS1 A;  1JWS D;  1V8C A;  1I4H A;  3NZ3 A;  3W9C B;  1NVI D;  1I4X A;  1SIJ A;  1DGJ A;  3NVZ A;  2ZW1 A;  3AE8 B;  4HEA 1;  4RF0 A;  1PGA A;  1SXT A;  1CJE A;  3OWE B;  1ET6 A;  1L6V A;  3AEA B;  3P1M A;  4ZRP A;  2V3P A;  3NUH B;  1FCC C;  1FNU A;  1QKZ A;  2DLB A;  2QIE B;  1GAQ B;  1XLP A;  3AE6 B;  4ITK A;  1T3Q A;  4ZHO A;  2Y3A A;  1SE3 A;  2LEK A;  1QOG A;  3J9C A;  5HG2 A;  4ZYS A;  1QT9 A;  4MM3 B;  1J7B A;  2R61 A;  2PVO D;  1YJI A;  4IDI A;  1F2R C;  3C8Y A;  3AED B;  2DYM A;  1I7H A;  3U52 E;  1NEN B;  1QF6 A;  4A90 A;  1AYF A;  1VZ8 A;  1EM7 A;  1IGC A;  4RGO S;  4MAC A;  1NYR A;  3AE3 B;  4HRO A;  2L1A A;  2E6X A;  1D5X C;  4RGN A;  1V1P B;  5E6J A;  2MJE A;  3AB5 A;  2WDR B;  4XWT A;  1SE2 A;  1ZXH A;  2VZK D;  1SB3 C;  2BB5 A;  2PLP A;  1SBB B;  1FFU A;  1L0X B;  5FKA C;  4XDC A;  4FXC A;  1HEZ E;  4L23 A;  4HKZ E;  2XNA C;  4OW0 A;  2FUG 1;  4YXD B;  1R7S A;  1GB1 A;  2BBC A;  5BYQ A;  1BXT A;  2Y5C A;  1KH0 A;  4RF1 A;  4WAF A;  3V05 A;  1FEH A;  1XXG A;  1PUT A;  1XCT L;  2WXF A;  4M0W A;  4OZA A;  1HZ5 A;  3LYY A;  3Q69 A;  3P4R B;  4HRS A;  1E6E B;  1L0V B;  2BS4 B;  2MJ3 A;  4B0E A;  3SFD B;  2AQ3 B;  4N58 A;  1VR9 A;  3R2T A;  2J4X A;  1N61 A;  1VZ6 A;  3AEG B;  3RFZ B;  2WXQ A;  1YJJ A;  3TEZ A;  1D4B A;  1HQR D;  1L4Z B;  2EEL A;  3IAM 1;  4RFB A;  4OZB A;  3E56 A;  1NYQ A;  3GP7 A;  2RDH A;  2OHF A;  4YSY B;  2JX5 A;  1XCQ L;  1F0Z A;  2RPV A;  2NMQ A;  4GDK B;  4WUR A;  5AUK A;  1PGX A;  1UUP A;  1ACC A;  3HRD D;  4JWU C;  1ESF A;  3AE2 B;  1FCL A;  2J52 A;  4REZ A;  5FK9 C;  1N63 A;  2JQR B;  2WDQ B;  4HJG E;  4A55 A;  1K53 A;  2PIA A;  1ZP0 B;  5LNK 1;  3VR9 B;  4P16 A;  4WIP A;  4YTP B;  3AV8 A;  2PKO A;  2AX5 A;  1T5X D;  2NTS A;  3EA6 A;  3FIL B;  4IOI E;  3MFG A;  4ZRQ A;  1B9R A;  4OHJ A;  5BYR A;  4TMA B;  5HFY A;  1YMH E;  2PTL A;  1Y56 A;  3B2G A;  2RMM A;  3T3N A;  4ARI A;  1XO3 A;  3HVZ A;  4WH4 A;  1WXQ A;  1D5M C;  1V97 A;  2W54 A;  3GS2 A;  2WLB A;  3P63 A;  2IDY A;  2YEP B;  3PZ7 A;  2W3R A;  5EE9 A;  2N0S B;  3DWM A;  2SAK A;  2BTE A;  2G9H D;  5C2T B;  1IBX A;  2CJO A;  3EUB 2;  1C4A A;  1GB4 A;  1AWD A;  2ICI A;  1OFF A;  2W55 A;  3NVY A;  1FM0 D;  4L1B A;  1CQV A;  3DWG C;  2IJ0 A;  4RCO A;  2V4I B;  5D3I B;  5EE0 A;  1C76 A;  4N59 A;  2XN9 C;  2J42 A;  3AE9 B;  1DOY A;  1EU4 A;  1YNT E;  3IXS A;  2WNM A;  2W82 A;  2KAC A;  2N9K A;  2LMC A;  1UWM A;  3MJ5 A;  1HZ6 A;  5BMH A;  4KGS A;  1DOX A;  1TJE A;  1VDV A;  4C7Z A;  4NAW B;  4D2K A;  3AN1 A;  1XEE A;  2BT6 A;  5EE1 A;  3WCQ A;  4XWW A;  3U2S C;  3Q8A A;  3HVD A;  3KLS X;  2WP9 B;  1MHX A;  1SSN A;  2LHE A;  3AEF B;  4NZL B;  1DYQ A;  1YQ3 B;  1PDX A;  1QLB B;  1YN4 A;  3BK2 A;  1ENF A;  3LXF A;  1JWU D;  3EGR A;  4CQN A;  1C79 A;  1ET9 A;  1JRO A;  1QIL A;  3LB8 C;  2KQ4 X;  1YN3 A;  4US9 A;  1F2R I;  1FNV A;  3NRZ A;  3R2I A;  3RPF C;  1KRH A;  1TKY A;  3TEX A;  1TKG A;  3TEW A;  2IGH A;  1JWA D;  4XDD A;  1ROE A;  1N62 A;  3Q8E A;  2WDV B;  1I4P A;  1ZDX A;  3VQI A;  4DXF A;  1VLB A;  1RFK A;  3R8B A;  1TS3 A;  1N60 A;  2ONQ A;  4YT0 B;  1XLQ A;  2GI9 A;  3AMZ A;  4KKJ A;  1ZE3 D;  1PFD A;  1QOF A;  4EE2 A;  2EKI A;  2KMM A;  3VR8 B;  2K0P A;  2I2Y A;  2MEK A;  2LUM A;  3IAS 1;  5C3J B;  3T3O A;  5FR3 A;  1IUE A;  1PGB A;  1QQR A;  3SR6 A;  5JXV A;  2Q5W D;  2BYT A;  2K3U A;  1AW7 A;  1K50 A;  1XF5 L;  4TQ1 A;  1RWS A;  3Q8B A;  4GDL B;  5TSS A;  5BMI A;  3VRB B;  2L32 A;  1STE A;  2AQ2 B;  3ZGZ A;  2GB1 A;  1LO5 D;  2JWU A;  1VRA B;  1L4D B;  3W5V B;  4Q2J A;  4TQ0 A;  1E10 A;  2QEJ C;  2QJL A;  3ETR A;  3MP9 A;  3NVV A;  4RGT A;  2KAJ A;  4DQO C;  4US8 A;  2V3N A;  3I9V 1;  3B2F A;  2H88 B;  1VJK A;  2PMV A;  1WGK A;  1ZOY B;  4YSZ B;  3BZD B;  4N6E B;  2QIL A;  1D6E C;  3AEC B;  2RDG A;  1GOZ A;  2JU6 X;  3AM9 A;  1KF6 B;  2FBW B;  2G1E A;  3BYT B;  1WRI A;  1ZPS A;  2JXT A;  1OQR A;  2WXM A;  3PZ8 A;  2WU2 B;  1PYW D;  1SF0 A;  2DYO A;  4KGT A;  1J7C A;  3PO0 A;  1SJE D;  1N5W A;  3FIL A;  4LK0 M;  2QMT A;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...