3J2PB

Cryoem structure of dengue virus envelope protein heterotetramer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
b'SVALVPHVGMGLETATETWMSSEGAWKHAQRIETWILRHPGFTIMAAILAYTIGTTHFQRALIFILLTAVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Cryo-EM structure of the mature dengue virus at 3.5-A resolution.
pubmed doi rcsb
molecule tags Viral protein
total genus 17
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01004 Flavi_M Flavivirus envelope glycoprotein M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.970 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j2pB00
5IZ7D 3J2PB 5H37D 5IREB 3J27B
chains in the Genus database with same CATH superfamily
1NNUC 4M9SA 1UFZA 2LXEA 1DGFA 2R44A 3K9OA 3PNYA 4PT5A 1Q3CA 1N75A 5DYIA 5H37D 1Q39A 2JUJA 3K9PA 2Y0QA 5FTMA 4L8RC 2F5OA 3TWKA 3K2LA 2V1UA 2YNMD 1SXJB 3R9XB 2DKLA 1IXRC 1OIPA 1T43A 1HQCA 4Y28F 5A2QS 1E32A 1Y8GA 2HHHM 1N78A 3QWLA 4I81A 5IWAM 4JYAM 2D7GA 4FWDA 3UZUA 1HT1E 1V33A 3RFWA 1NV8A 1SXJE 3E9SA 3FUUA 3ZC7B 1XC8A 1K82A 1BVSA 4LFCM 1TGUA 2DAEA 2UXCM 1FNNA 5E26A 2QSFX 1IY0A 4LY6A 3OTOM 3H4JA 3SHGB 4JI8M 3C3EA 4RF1A 4GEWA 4X62M 2WSFF 3HHZA 2ZAMA 2KRUA 2ZANA 5ITYA 2Z4SA 4D80A 3KW6A 3SATA 3J7AS 2DI0A 3SHFA 2EA0A 4AKHA 3SAUA 2DZLA 3FD9A 1TH3A 3I4VA 1CUKA 1WGNA 1JR3A 2C98A 2KZUA 2LBCA 3QYEA 5KPZA 3H4MA 1GL6A 2R0IA 4PDIA 4GITA 2MR9A 2L7IA 1FJGM 1XMOM 2B3TA 4L78A 2CEAA 1MU5A 2OO9A 2R65A 4R3DA 5DYGA 3WHKA 5ITTA 3D8LA 2WSEF 1S3SA 4KO8A 4G3OA 3Q8GA 2CHQA 4JXJA 4IBIA 2UU9M 2JY8A 4WURA 1TDZA 1VEKA 5C18A 3J81S 4DV6M 4LJ6A 3CF0A 2RRUA 1H6UA 2Z4RA 2F4VM 3VKHA 1E9SA 3KOXE 1WJ7A 2J7NA 4WP2A 1DGBA 1L8QA 4EIWA 3DA1A 1OAIA 3MK6A 1IQPA 5KQ8A 1IFYA 5EXXA 2C5RA 1OFHA 2HAKA 3KDSE 3LQQA 4DBGB 3U6DA 2DZNB 1YLAA 1XMQM 1N33M 3M7GA 2CV0A 1Z5BA 4F1IA 1OAOC 2FFJA 2JNHA 1F4IA 2Y0TA 2CFOA 3B7QA 4NC6A 3GPYA 1GKIA 1AIPC 1XHBA 4QHTA 3T6PA 1JR3E 3V76A 5FTNA 1MX0A 3ZH9B 4FCWA 4DR4M 2CP8A 4I8OA 2YR0A 2K0BX 4I5SA 4XGIA 4DR3M 3DFZA 1IN8A 4IBFA 1HNWM 1KSFX 1XNQM 2G3QA 3VDUA 2CV1A 1WXQA 2OQ4A 4LZZA 2EO2A 2LVOC 4PCZA 3MMPA 1NV9A 5JI3E 4LF9M 3GP1A 4JN6A 3UJNA 2CUZA 2WZJA 3FUVA 1G41A 4QNMA 3PNVA 1EFUB 4ZPXA 2DWMA 2LHGA 1IBKM 2ZAOA 4JV5M 1QANA 4AG5A 3T15A 5LMNM 4Z8XA 3B74A 4P17A 2JP7A 3L2AA 5GKNA 1GVNA 3E4RA 3FE3A 4QHSA 4IIWA 1R2ZA 1HT2E 2EKFA 5FTLA 2FE8A 2XFTA 4D82A 2O5RA 1VEJA 3L28A 3LCVB 1G71A 3U61A 2R62A 1VEGA 3E46A 3AOEC 1DV0A 2HKJA 3R8FA 3WHLA 4L16A 2WSCF 2X8AA 2DWZB 4RF0A 2P5TA 3D8BA 4DV5M 5JI2E 2V1CA 2X49A 4AG6A 4BB9A 2QPAA 3GLHA 1LV7A 4LFBM 2I7NA 3KOYE 4I4LA 1PRBA 2HCBA 3SFZA 3CF2A 1EE8A 2K6BA 1ZV1A 3NBIA 3UK6A 3W67A 1R7RA 2YFQA 3JAMS 1IM2A 2JZ1A 3B7NA 5BR8M 4NSOB 1Z5AA 1QAQA 3U61B 4D81A 5KQDA 5EP2A 1WIVA 1R4GA 2AHMA 3IHPA 2VQEM 3TL4X 3A98B 4QOSA 2L09A 1V92A 4JI0M 2F5NA 2LNHC 1PGYA 1HJPA 3GLGA 3GLIA 4HEOA 4DV4M 4MGIE 3KS8A 5ITQA 4XK8F 2K9DA 5FLXS 3KOZE 4NOOB 4B7GA 4LF6M 2R18A 4M9XA 1MJGM 4BLCA 1MN3A 3EIHA 1GL7A 4LF4M 4IBGA 4OU7A 2KW0A 3PVSA 1NHWC 4IBJA 4LCBA 3U6EA 3I4YA 2Y21A 3AFHA 5L8RF 2GNOA 3SASA 2BWEA 1IY2A 3HU3A 1QDTA 5EP1A 3JR4A 2QCUA 3VK7A 1IY1A 1QYRA 3HHYA 4B7FA 4RKUF 2ERCA 2LVQD 1NY5A 2JXNA 2DZOB 2KXEA 1Z5CA 3L27A 4LF5M 1NO1A 4Q7JA 1GLNA 1KFVA 4JI1M 2M60A 1J7KA 3KOWE 1YUBA 3MJ5A 2H5XA 2F5PA 1NHGC 2OOAA 2KHHA 1R6BX 2R4JA 2FH0A 3HHWA 3U6PA 3RGPA 3HJ8A 3HX3A 2KDLA 1PJQA 4DV1M 2QP9X 2DAKA 2J5YA 1TR8A 3VFDA 2UXBM 1X37A 2L4FA 3B9PA 3HKPA 2EKKA 3B89A 4B08A 1IN4A 4B3MM 3FYDA 3U60A 4CIZA 1AUAA 2JY5A 1K3WA 2CHGA 1TH2A 2DHYA 3FRHA 3GRVA 5EXPA 2G5GX 3FTCA 3SAWA 4OVZA 2Z3XA 3C9PA 2EJSA 2QENA 2UUAM 3FKEA 1J09A 2KNZA 4DV0M 1Q02A 4DV2M 3L29A 4KODA 4CISA 2QBYA 4OX9M 1SG9A 1XXHA 3I51A 4DR7M 2DVWB 3FRIA 4QNRA 1WR1B 2R4EA 4JI2M 4B3RM 4DUZM 1QVRA 3GLFA 3BOSA 3U5ZA 4GIPA 3U60B 3U6CA 1R2YA 2DAGA 4GKJM 1D0LA 1IN5A 2VF7A 3U6LA 3QYBA 2LVAA 3VLFB 4F2LA 2VIIA 3KP1E 2FS1A 5KPTA 3AOEA 4NXNM 4R71A 4X65M 3GO8A 1IBMM 3FTEA 2YQZA 3FUTA 4GHAA 1E9RA 2XF3A 4GH9A 3SMSA 1J5EM 1IN6A 3QAUA 3ILKA 4A3VB 4IJFA 4IBKA 3CGWA 3HJQA 2QBYB 4LF8M 1L1ZA 2ZM6M 2J7OA 1DGHA 1QUSA 2VQFM 1OQYA 4KLNA 4P16A 3DOAA 3SYLA 1C7YA 4NL4H 2DNAA 4DV7M 2H1RA 4II7A 1I4WA 4LZJA 2MJ5B 1T3TA 3THGA 1L2BA 1ZQ9A 1OKSA 2APLA 2N35A 3J7BA 4JI6M 2Q2EB 4NSRA 3AKZA 2Z8YM 2KEBA 3SARA 2LTUA 1YE9A 3Q8XA 3K1JA 3GPUA 3LQRA 1ZMUA 3ZQJA 3FTDA 3BXWA 4X66M 1ZAEA 3HWSA 4FCVA 4IBCA 8CATA 4DUYM 4MGZE 4GMQA 3J80S 4REZA 1NSFA 3W0FA 1VG5A 4LFAM 1DO2A 1HNZM 3TQSA 1N32M 4LJ5A 1EIJA 2RGHA 3RGSA 1IXSA 1UM8A 4ANRA 3VK8A 2C9OA 3HU1A 4IBDA 3SYKA 2I7PA 3SAVA 1NJGA 4JI5M 1PM5A 1GJSA 3K8ZA 2QNJA 2UXDM 3EIEA 3M0EA 4G6ZA 1OJLA 1SXJD 3TWMA 3C3DA 2QZ4A 2F5SA 5FTJA 4YY3M 1GABA 1G4AE 4IBBA 2CV2A 1RU3A 2L4EA 2KNAA 2V6ZM 1PJSA 2LH0A 3HU2A 4B7HA 3L25A 3AOGA 4G4OA 4LRSA 4KHPM 4LJ8A 4NXMM 1XB2B 3GLHB 5IREB 3KS4A 3W68A 2DWNA 2DWLA 4IJEA 3U6QA 5ITRA 2DENA 3I04M 2ZTCA 1IXSB 3NWLA 3F92A 3HY5A 2VDBB 3KVWA 4CHTB 4JI4M 5FSWA 4ITQA 2BNKA 3GLHE 4B3TM 2FOIC 3A42A 2R45A 4NRWA 1XNRM 3K92A 3FUWA 3KP0E 1N36M 1W5TA 1DGGA 3GRRA 3GPPA 4XBOA 1NVMA 1Q3BA 3GQ3A 4M0DA 4IBEA 2CHVA 3GLGB 3GLIB 3FTFA 4BBAA 3J2PB 4FVMA 1JB0F 4G4RA 2HWJA 1SXJC 2QQ8A 4AW4A 4DV3M 3T1HM 2UUCM 1P3QQ 3AJIB 3TE6A 4K0KM 3U6SA 4MGHA 1L2DA 3GLGE 3GLIE 3T1YM 3PFIA 3FYCA 2ZBKB 3LVVA 2M5ZA 3IG5A 3FUXA 1L2CA 5EXTA 4MGKE 1Z6TA 1A5TA 3UMMA 4CGYB 4YHHM 2R6FA 1G59A 2MROB 2C99A 2X4AA 4FD2A 4MM3B 2D7HA 3U6OA 5DNYA 2L6OA 1JR3D 1YSYA 3CTWB 2CRUA 4HLQA 4L4UA 4W5WA 4LGMA 1NJFA 1NY6A 3PXGA 3AL0C 1D0KA 2XSZD 2R46A 1ZMWA 3RE8A 2DAIA 2XH9A 4AI6A 5IZ7D 4M9ZA 3SMPA 1HNXM 2F5QA 5E6JA 4LRTA 2MH8A 2XLJA 1D0MA 3VKGA 1WGLA 1ORYB 1XWIA 2VF8A 1TH4A 4AKIA 4AKGA 2XSZA 4G4NA 1OTRA 2FNAA 3L26A 4LG2A 4LJAA 4CJ6A 2LVPC 5ITXA 3B7ZA 2LWXA 4LJ4A 5EP3A 5ITUA 1TTEA 1OFIA 1QZMA 2XGNA 4B3SM 3GPXA 2L2DA 1T6OA 2O25A 2D7EA 2GQFA 4FCTA 1N34M 3HJSA 3HZJA 4FWHA 2JA2A 3SBJA 2RGOA 4HL4A 4JI7M 5EXSA 3J27B 2BJWA 2OOBA 4GC9A 5F3WA 1L1TA 2CE7A 2OPFA 2UUBM 3E21A 4QOZC 1WHCA 4NRVA 3UGJA 2LHCA 4OVZB 5IT9S 1NNJA 2A5YB 1TF0B 1I94M 1VDLA 4LGYA 1V34A 1G8PA 2K47A 1LTMA 2KNVA 2W82A 3LCUA 5FTKA 3U6MA 2XZFA 1PJIA 4RNAA 1XXHB 1ZMVA 2JZ0A 2LVNC 3LVWA 2G8LA 3GRUA 3HGIA 4MH0E 3IECA 4MB7A 2DXIA 2C96A 4FWGA 1D2NA 3GLFB 1C1KA 5EJCA 3U5ZB 3DZDA 1QZEA 4JI3M 1XXHE 4LJ9A 2MGWA 2XFSA 3TPZA 5ITXE 3TWLA 4GKKM 4X64M 1PJTA 3KXEC 3LMMA 4OW0A 3ZCBB 2Y20A 3BBZA 5LMUM 2ZTDA 3GLFE 3AV0A 2JY6B 4M0WA 5EQTA 1QAOA 3T38A 1G3IA 3KSXA 1KYIA 1VDDA 2XEPA 3A45A 5C1BA 2BJVA 4AZFA 5KO3A 4DR6M 1QUTA 1E94E 3MHVC 3C58A 1OIZA 1HQYE 1K3XA 4DR2M 2O01F 1DGHB 2KA6B 2QHOB 4LJ7A 2BWBA 4KT0F 2JWSA 3NBXX 3A46A 2KZSA 4DR5M 4GHLA 2HL7A 2DAMA 2JY7A 1VQ1A 4S12A 1HR0M 4DR1M 1TDHA 3SC3A 2C9CA 3KSJA 1PJJA 4WW0A 4PDGA 4R7GA 4LF7M 2EUCA 7CATA 1IBLM 4TUWA 2E5LM 4MGYE 5KPRA 4GRIA 2RKOA 2Z7JA 3IG8A 3HHXA 4FW9A 1W5SA 1SXJA 5EP4A 3GRYA 4G4QA 3M6AA 1IXZA 3GQ4A 3GQ5A 2L7HA 1DO0A 1GO5A 4UN2B 3JR5A 2DHRA 3KFUG 2KRKA 3LW5F 1IN7A 1QQWA 4GC5A 1Z59A 1GJTA 4Z6YA 5BPVA 1JQJC 1N77A 2CWBA 4L6V6 1QAMA 2NQ8C 3CF6E 3I01M 1R5LA 3W0LB 4AQYM 4L15A 3VDPA 5DFLA 1QDRA 4PD2A 2XZUA
chains in the Genus database with same CATH topology
1NNUC 4M9SA 2LXEA 4PT5A 1DGFA 2UXCM 3PNYA 5DYIA 1Q3CA 1N75A 5H37D 1Q39A 2Y0QA 5FTMA 4L8RC 2F5OA 3TWKA 3K2LA 2V1UA 2YNMD 1SXJB 3R9XB 1IXRC 1HQCA 5A2QS 1E32A 2HHHM 1N78A 3QWLA 4I81A 5IWAM 4JYAM 2D7GA 4FWDA 3UZUA 1HT1E 3RFWA 1SXJE 3E9SA 3FUUA 3ZC7B 1XC8A 1K82A 4LFCM 1TGUA 1FNNA 5E26A 1IY0A 4LY6A 3OTOM 3SHGB 4JI8M 4RF1A 4X62M 3HHZA 2ZAMA 2KRUA 2ZANA 5ITYA 2Z4SA 4D80A 3KW6A 3SATA 3J7AS 3SHFA 2EA0A 4AKHA 3SAUA 3FD9A 1TH3A 3I4VA 1JR3A 2C98A 2KZUA 5KPZA 3H4MA 1GL6A 4PDIA 4GITA 2L7IA 1FJGM 1XMOM 4L78A 2CEAA 1MU5A 5ITTA 2R65A 4R3DA 5DYGA 3WHKA 3D8LA 4KO8A 1S3SA 2CHQA 4JXJA 4IBIA 2UU9M 4WURA 1TDZA 5C18A 3J81S 4DV6M 4LJ6A 3CF0A 2F4VM 1H6UA 2Z4RA 3VKHA 1E9SA 3KOXE 2J7NA 4EIWA 1DGBA 1L8QA 3DA1A 3MK6A 5KQ8A 1IQPA 5EXXA 2C5RA 1OFHA 3KDSE 3LQQA 3U6DA 2DZNB 1XMQM 1N33M 3M7GA 1Z5BA 2FFJA 2Y0TA 2CFOA 3GPYA 1GKIA 1XHBA 4QHTA 5FTNA 1MX0A 3ZH9B 4FCWA 4DR4M 4I8OA 2YR0A 4I5SA 4XGIA 4DR3M 3DFZA 1IN8A 4IBFA 1HNWM 1KSFX 1XNQM 3VDUA 2CV1A 1WXQA 2OQ4A 4LZZA 2EO2A 4PCZA 5JI3E 4LF9M 3GP1A 4JN6A 3UJNA 2CUZA 3FUVA 1G41A 4QNMA 3PNVA 4ZPXA 2DWMA 1IBKM 2ZAOA 4JV5M 1QANA 4AG5A 3T15A 5LMNM 4Z8XA 3L2AA 5GKNA 1GVNA 3E4RA 4QHSA 4IIWA 1R2ZA 1HT2E 5FTLA 2FE8A 2XFTA 4D82A 2O5RA 3L28A 3U61A 2R62A 3AOEC 2HKJA 3R8FA 3WHLA 4L16A 4RF0A 2X8AA 2DWZB 2P5TA 3D8BA 4DV5M 5JI2E 2V1CA 2X49A 4AG6A 4BB9A 2QPAA 3GLHA 1LV7A 4LFBM 2I7NA 3KOYE 4I4LA 2HCBA 3SFZA 3CF2A 1EE8A 3NBIA 2CV0A 3UK6A 1R7RA 2YFQA 3JAMS 1IM2A 5BR8M 4NSOB 1Z5AA 1QAQA 3U61B 4D81A 5KQDA 5EP2A 2AHMA 2VQEM 3TL4X 3A98B 4QOSA 2L09A 4JI0M 2F5NA 2LNHC 3GLGA 3GLIA 4DV4M 4MGIE 3KS8A 5ITQA 5FLXS 3KOZE 4NOOB 4B7GA 4LF6M 2R18A 4M9XA 4BLCA 3EIHA 1GL7A 4LF4M 4IBGA 4OU7A 2KW0A 3PVSA 1NHWC 4IBJA 4LCBA 3U6EA 3I4YA 2Y21A 3AFHA 3SASA 1IY2A 3HU3A 3JR4A 5EP1A 2QCUA 3VK7A 1IY1A 1QYRA 3HHYA 4B7FA 2ERCA 1NY5A 2DZOB 2KXEA 1Z5CA 3L27A 4LF5M 1GLNA 1KFVA 4JI1M 2M60A 1J7KA 3KOWE 1YUBA 3MJ5A 2F5PA 1NHGC 2R4JA 1R6BX 3HHWA 3U6PA 3RGPA 3HJ8A 4DV1M 2QP9X 3VFDA 2UXBM 1X37A 3HKPA 3B9PA 4B08A 1IN4A 4B3MM 3FYDA 3U60A 1K3WA 2CHGA 1TH2A 5EXPA 3GRVA 2G5GX 3FTCA 3SAWA 4OVZA 2Z3XA 2QENA 2UUAM 3FKEA 1J09A 4DV0M 4DV2M 3L29A 4KODA 4CISA 2QBYA 4OX9M 1XXHA 3I51A 4DR7M 2DVWB 4QNRA 2R4EA 4JI2M 4B3RM 4DUZM 1QVRA 3GLFA 3BOSA 3U5ZA 4GIPA 3U60B 3U6CA 1R2YA 4GKJM 1IN5A 3U6LA 3VLFB 2VIIA 3KP1E 5KPTA 3AOEA 4NXNM 3GO8A 4X65M 1IBMM 3FTEA 2YQZA 3FUTA 4GHAA 1E9RA 2XF3A 4GH9A 3SMSA 1J5EM 1IN6A 3QAUA 3ILKA 4A3VB 4IJFA 4IBKA 3HJQA 2QBYB 4LF8M 1L1ZA 2ZM6M 2J7OA 1DGHA 2VQFM 4KLNA 4P16A 3DOAA 3SYLA 4NL4H 4DV7M 2H1RA 4II7A 1I4WA 4LZJA 1T3TA 3THGA 1L2BA 1ZQ9A 3J7BA 4JI6M 2Q2EB 4NSRA 3AKZA 2KEBA 3SARA 1YE9A 3Q8XA 3K1JA 3GPUA 3LQRA 3FTDA 4X66M 1ZAEA 3HWSA 4FCVA 4IBCA 8CATA 4DUYM 4MGZE 4GMQA 3J80S 4REZA 1NSFA 3W0FA 4LFAM 1HNZM 1DO2A 1N32M 3TQSA 4LJ5A 2RGHA 3RGSA 1UM8A 3VK8A 2C9OA 3HU1A 4IBDA 3SYKA 2I7PA 3SAVA 1NJGA 4JI5M 1PM5A 3K8ZA 2UXDM 3EIEA 3M0EA 4G6ZA 1OJLA 1SXJD 3TWMA 2QZ4A 2F5SA 5FTJA 4YY3M 1G4AE 4IBBA 2CV2A 2V6ZM 2LH0A 3HU2A 4B7HA 3L25A 3AOGA 4G4OA 4LRSA 4KHPM 4LJ8A 4NXMM 5IREB 3GLHB 2DWNA 3KS4A 2DWLA 4IJEA 3U6QA 5ITRA 1IXSB 3NWLA 3KVWA 4CHTB 4JI4M 5FSWA 4ITQA 2BNKA 4B3TM 2FOIC 3A42A 2R45A 4NRWA 1XNRM 3K92A 3FUWA 3KP0E 1N36M 1W5TA 1DGGA 3GRRA 3GPPA 4XBOA 1NVMA 1Q3BA 3GQ3A 4M0DA 4IBEA 2CHVA 3GLGB 3GLIB 3FTFA 4BBAA 3J2PB 4FVMA 4G4RA 4AW4A 1SXJC 4DV3M 3T1HM 2UUCM 3AJIB 3TE6A 4K0KM 3U6SA 4MGHA 1L2DA 3T1YM 3PFIA 3FYCA 2ZBKB 3LVVA 2M5ZA 3IG5A 3FUXA 1L2CA 5EXTA 4MGKE 1Z6TA 3UMMA 4CGYB 4YHHM 1G59A 4FD2A 2C99A 2X4AA 4MM3B 2D7HA 3U6OA 5DNYA 2L6OA 1JR3D 1YSYA 3CTWB 4HLQA 4L4UA 4W5WA 3PXGA 4LGMA 1NJFA 1NY6A 3AL0C 2XSZD 2R46A 4AI6A 3RE8A 2XH9A 5IZ7D 4M9ZA 3SMPA 1HNXM 2F5QA 5E6JA 4LRTA 2XLJA 3VKGA 1ORYB 1XWIA 1TH4A 4AKIA 4AKGA 2XSZA 4G4NA 2FNAA 3L26A 4LG2A 4LJAA 5ITXA 2LWXA 4LJ4A 5EP3A 5ITUA 1OFIA 1QZMA 2XGNA 4B3SM 3GPXA 2D7EA 4FCTA 1N34M 3HJSA 4FWHA 2JA2A 3SBJA 2RGOA 4HL4A 4JI7M 5EXSA 3J27B 2BJWA 4GC9A 5F3WA 1L1TA 2CE7A 2OPFA 2UUBM 4QOZC 4NRVA 3UGJA 4OVZB 5IT9S 1NNJA 2A5YB 1I94M 4LGYA 1G8PA 2K47A 2W82A 1PJIA 5FTKA 3U6MA 2XZFA 4RNAA 1XXHB 3LVWA 2G8LA 3GRUA 3HGIA 4MH0E 4MB7A 2DXIA 2C96A 4FWGA 1D2NA 3GLFB 1C1KA 5EJCA 3U5ZB 3DZDA 4JI3M 5ITXE 4LJ9A 3TPZA 4GKKM 2XFSA 3TWLA 4X64M 3KXEC 3LMMA 4OW0A 3ZCBB 2Y20A 5LMUM 3AV0A 5EQTA 4M0WA 3T38A 1QAOA 1G3IA 3KSXA 1KYIA 1VDDA 2XEPA 3A45A 5C1BA 2BJVA 4AZFA 5KO3A 4DR6M 1E94E 3MHVC 3C58A 1HQYE 1K3XA 4DR2M 1DGHB 2KA6B 4LJ7A 3A46A 2KZSA 4DR5M 4GHLA 2HL7A 4S12A 1HR0M 4DR1M 1TDHA 3SC3A 2C9CA 3KSJA 1PJJA 4WW0A 4PDGA 4R7GA 4LF7M 2EUCA 7CATA 1IBLM 4TUWA 2E5LM 4MGYE 5KPRA 4GRIA 2RKOA 2Z7JA 3IG8A 3HHXA 4FW9A 1W5SA 1SXJA 5EP4A 3GRYA 4G4QA 3M6AA 1IXZA 3GQ4A 3GQ5A 2L7HA 1DO0A 3JR5A 2DHRA 3KFUG 2KRKA 1IN7A 1QQWA 4GC5A 1Z59A 4Z6YA 5BPVA 1JQJC 1N77A 1QAMA 2NQ8C 3CF6E 4AQYM 3W0LB 4L15A 3VDPA 4PD2A 2XZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ7 D;  3J2P B;  5H37 D;  5IRE B;  3J27 B; 
#chains in the Genus database with same CATH topology
 1NNU C;  4M9S A;  1UFZ A;  2LXE A;  1DGF A;  2R44 A;  3K9O A;  3PNY A;  4PT5 A;  1Q3C A;  1N75 A;  5DYI A;  5H37 D;  1Q39 A;  2JUJ A;  3K9P A;  2Y0Q A;  5FTM A;  4L8R C;  2F5O A;  3TWK A;  3K2L A;  2V1U A;  2YNM D;  1SXJ B;  3R9X B;  2DKL A;  1IXR C;  1OIP A;  1T43 A;  1HQC A;  4Y28 F;  5A2Q S;  1E32 A;  1Y8G A;  2HHH M;  1N78 A;  3QWL A;  4I81 A;  5IWA M;  4JYA M;  2D7G A;  4FWD A;  3UZU A;  1HT1 E;  1V33 A;  3RFW A;  1NV8 A;  1SXJ E;  3E9S A;  3FUU A;  3ZC7 B;  1XC8 A;  1K82 A;  1BVS A;  4LFC M;  1TGU A;  2DAE A;  2UXC M;  1FNN A;  5E26 A;  2QSF X;  1IY0 A;  4LY6 A;  3OTO M;  3H4J A;  3SHG B;  4JI8 M;  3C3E A;  4RF1 A;  4GEW A;  4X62 M;  2WSF F;  3HHZ A;  2ZAM A;  2KRU A;  2ZAN A;  5ITY A;  2Z4S A;  4D80 A;  3KW6 A;  3SAT A;  3J7A S;  2DI0 A;  3SHF A;  2EA0 A;  4AKH A;  3SAU A;  2DZL A;  3FD9 A;  1TH3 A;  3I4V A;  1CUK A;  1WGN A;  1JR3 A;  2C98 A;  2KZU A;  2LBC A;  3QYE A;  5KPZ A;  3H4M A;  1GL6 A;  2R0I A;  4PDI A;  4GIT A;  2MR9 A;  2L7I A;  1FJG M;  1XMO M;  2B3T A;  4L78 A;  2CEA A;  1MU5 A;  2OO9 A;  2R65 A;  4R3D A;  5DYG A;  3WHK A;  5ITT A;  3D8L A;  2WSE F;  1S3S A;  4KO8 A;  4G3O A;  3Q8G A;  2CHQ A;  4JXJ A;  4IBI A;  2UU9 M;  2JY8 A;  4WUR A;  1TDZ A;  1VEK A;  5C18 A;  3J81 S;  4DV6 M;  4LJ6 A;  3CF0 A;  2RRU A;  1H6U A;  2Z4R A;  2F4V M;  3VKH A;  1E9S A;  3KOX E;  1WJ7 A;  2J7N A;  4WP2 A;  1DGB A;  1L8Q A;  4EIW A;  3DA1 A;  1OAI A;  3MK6 A;  1IQP A;  5KQ8 A;  1IFY A;  5EXX A;  2C5R A;  1OFH A;  2HAK A;  3KDS E;  3LQQ A;  4DBG B;  3U6D A;  2DZN B;  1YLA A;  1XMQ M;  1N33 M;  3M7G A;  2CV0 A;  1Z5B A;  4F1I A;  1OAO C;  2FFJ A;  2JNH A;  1F4I A;  2Y0T A;  2CFO A;  3B7Q A;  4NC6 A;  3GPY A;  1GKI A;  1AIP C;  1XHB A;  4QHT A;  3T6P A;  1JR3 E;  3V76 A;  5FTN A;  1MX0 A;  3ZH9 B;  4FCW A;  4DR4 M;  2CP8 A;  4I8O A;  2YR0 A;  2K0B X;  4I5S A;  4XGI A;  4DR3 M;  3DFZ A;  1IN8 A;  4IBF A;  1HNW M;  1KSF X;  1XNQ M;  2G3Q A;  3VDU A;  2CV1 A;  1WXQ A;  2OQ4 A;  4LZZ A;  2EO2 A;  2LVO C;  4PCZ A;  3MMP A;  1NV9 A;  5JI3 E;  4LF9 M;  3GP1 A;  4JN6 A;  3UJN A;  2CUZ A;  2WZJ A;  3FUV A;  1G41 A;  4QNM A;  3PNV A;  1EFU B;  4ZPX A;  2DWM A;  2LHG A;  1IBK M;  2ZAO A;  4JV5 M;  1QAN A;  4AG5 A;  3T15 A;  5LMN M;  4Z8X A;  3B74 A;  4P17 A;  2JP7 A;  3L2A A;  5GKN A;  1GVN A;  3E4R A;  3FE3 A;  4QHS A;  4IIW A;  1R2Z A;  1HT2 E;  2EKF A;  5FTL A;  2FE8 A;  2XFT A;  4D82 A;  2O5R A;  1VEJ A;  3L28 A;  3LCV B;  1G71 A;  3U61 A;  2R62 A;  1VEG A;  3E46 A;  3AOE C;  1DV0 A;  2HKJ A;  3R8F A;  3WHL A;  4L16 A;  2WSC F;  2X8A A;  2DWZ B;  4RF0 A;  2P5T A;  3D8B A;  4DV5 M;  5JI2 E;  2V1C A;  2X49 A;  4AG6 A;  4BB9 A;  2QPA A;  3GLH A;  1LV7 A;  4LFB M;  2I7N A;  3KOY E;  4I4L A;  1PRB A;  2HCB A;  3SFZ A;  3CF2 A;  1EE8 A;  2K6B A;  1ZV1 A;  3NBI A;  3UK6 A;  3W67 A;  1R7R A;  2YFQ A;  3JAM S;  1IM2 A;  2JZ1 A;  3B7N A;  5BR8 M;  4NSO B;  1Z5A A;  1QAQ A;  3U61 B;  4D81 A;  5KQD A;  5EP2 A;  1WIV A;  1R4G A;  2AHM A;  3IHP A;  2VQE M;  3TL4 X;  3A98 B;  4QOS A;  2L09 A;  1V92 A;  4JI0 M;  2F5N A;  2LNH C;  1PGY A;  1HJP A;  3GLG A;  3GLI A;  4HEO A;  4DV4 M;  4MGI E;  3KS8 A;  5ITQ A;  4XK8 F;  2K9D A;  5FLX S;  3KOZ E;  4NOO B;  4B7G A;  4LF6 M;  2R18 A;  4M9X A;  1MJG M;  4BLC A;  1MN3 A;  3EIH A;  1GL7 A;  4LF4 M;  4IBG A;  4OU7 A;  2KW0 A;  3PVS A;  1NHW C;  4IBJ A;  4LCB A;  3U6E A;  3I4Y A;  2Y21 A;  3AFH A;  5L8R F;  2GNO A;  3SAS A;  2BWE A;  1IY2 A;  3HU3 A;  1QDT A;  5EP1 A;  3JR4 A;  2QCU A;  3VK7 A;  1IY1 A;  1QYR A;  3HHY A;  4B7F A;  4RKU F;  2ERC A;  2LVQ D;  1NY5 A;  2JXN A;  2DZO B;  2KXE A;  1Z5C A;  3L27 A;  4LF5 M;  1NO1 A;  4Q7J A;  1GLN A;  1KFV A;  4JI1 M;  2M60 A;  1J7K A;  3KOW E;  1YUB A;  3MJ5 A;  2H5X A;  2F5P A;  1NHG C;  2OOA A;  2KHH A;  1R6B X;  2R4J A;  2FH0 A;  3HHW A;  3U6P A;  3RGP A;  3HJ8 A;  3HX3 A;  2KDL A;  1PJQ A;  4DV1 M;  2QP9 X;  2DAK A;  2J5Y A;  1TR8 A;  3VFD A;  2UXB M;  1X37 A;  2L4F A;  3B9P A;  3HKP A;  2EKK A;  3B89 A;  4B08 A;  1IN4 A;  4B3M M;  3FYD A;  3U60 A;  4CIZ A;  1AUA A;  2JY5 A;  1K3W A;  2CHG A;  1TH2 A;  2DHY A;  3FRH A;  3GRV A;  5EXP A;  2G5G X;  3FTC A;  3SAW A;  4OVZ A;  2Z3X A;  3C9P A;  2EJS A;  2QEN A;  2UUA M;  3FKE A;  1J09 A;  2KNZ A;  4DV0 M;  1Q02 A;  4DV2 M;  3L29 A;  4KOD A;  4CIS A;  2QBY A;  4OX9 M;  1SG9 A;  1XXH A;  3I51 A;  4DR7 M;  2DVW B;  3FRI A;  4QNR A;  1WR1 B;  2R4E A;  4JI2 M;  4B3R M;  4DUZ M;  1QVR A;  3GLF A;  3BOS A;  3U5Z A;  4GIP A;  3U60 B;  3U6C A;  1R2Y A;  2DAG A;  4GKJ M;  1D0L A;  1IN5 A;  2VF7 A;  3U6L A;  3QYB A;  2LVA A;  3VLF B;  4F2L A;  2VII A;  3KP1 E;  2FS1 A;  5KPT A;  3AOE A;  4NXN M;  4R71 A;  4X65 M;  3GO8 A;  1IBM M;  3FTE A;  2YQZ A;  3FUT A;  4GHA A;  1E9R A;  2XF3 A;  4GH9 A;  3SMS A;  1J5E M;  1IN6 A;  3QAU A;  3ILK A;  4A3V B;  4IJF A;  4IBK A;  3CGW A;  3HJQ A;  2QBY B;  4LF8 M;  1L1Z A;  2ZM6 M;  2J7O A;  1DGH A;  1QUS A;  2VQF M;  1OQY A;  4KLN A;  4P16 A;  3DOA A;  3SYL A;  1C7Y A;  4NL4 H;  2DNA A;  4DV7 M;  2H1R A;  4II7 A;  1I4W A;  4LZJ A;  2MJ5 B;  1T3T A;  3THG A;  1L2B A;  1ZQ9 A;  1OKS A;  2APL A;  2N35 A;  3J7B A;  4JI6 M;  2Q2E B;  4NSR A;  3AKZ A;  2Z8Y M;  2KEB A;  3SAR A;  2LTU A;  1YE9 A;  3Q8X A;  3K1J A;  3GPU A;  3LQR A;  1ZMU A;  3ZQJ A;  3FTD A;  3BXW A;  4X66 M;  1ZAE A;  3HWS A;  4FCV A;  4IBC A;  8CAT A;  4DUY M;  4MGZ E;  4GMQ A;  3J80 S;  4REZ A;  1NSF A;  3W0F A;  1VG5 A;  4LFA M;  1DO2 A;  1HNZ M;  3TQS A;  1N32 M;  4LJ5 A;  1EIJ A;  2RGH A;  3RGS A;  1IXS A;  1UM8 A;  4ANR A;  3VK8 A;  2C9O A;  3HU1 A;  4IBD A;  3SYK A;  2I7P A;  3SAV A;  1NJG A;  4JI5 M;  1PM5 A;  1GJS A;  3K8Z A;  2QNJ A;  2UXD M;  3EIE A;  3M0E A;  4G6Z A;  1OJL A;  1SXJ D;  3TWM A;  3C3D A;  2QZ4 A;  2F5S A;  5FTJ A;  4YY3 M;  1GAB A;  1G4A E;  4IBB A;  2CV2 A;  1RU3 A;  2L4E A;  2KNA A;  2V6Z M;  1PJS A;  2LH0 A;  3HU2 A;  4B7H A;  3L25 A;  3AOG A;  4G4O A;  4LRS A;  4KHP M;  4LJ8 A;  4NXM M;  1XB2 B;  3GLH B;  5IRE B;  3KS4 A;  3W68 A;  2DWN A;  2DWL A;  4IJE A;  3U6Q A;  5ITR A;  2DEN A;  3I04 M;  2ZTC A;  1IXS B;  3NWL A;  3F92 A;  3HY5 A;  2VDB B;  3KVW A;  4CHT B;  4JI4 M;  5FSW A;  4ITQ A;  2BNK A;  3GLH E;  4B3T M;  2FOI C;  3A42 A;  2R45 A;  4NRW A;  1XNR M;  3K92 A;  3FUW A;  3KP0 E;  1N36 M;  1W5T A;  1DGG A;  3GRR A;  3GPP A;  4XBO A;  1NVM A;  1Q3B A;  3GQ3 A;  4M0D A;  4IBE A;  2CHV A;  3GLG B;  3GLI B;  3FTF A;  4BBA A;  3J2P B;  4FVM A;  1JB0 F;  4G4R A;  2HWJ A;  1SXJ C;  2QQ8 A;  4AW4 A;  4DV3 M;  3T1H M;  2UUC M;  1P3Q Q;  3AJI B;  3TE6 A;  4K0K M;  3U6S A;  4MGH A;  1L2D A;  3GLG E;  3GLI E;  3T1Y M;  3PFI A;  3FYC A;  2ZBK B;  3LVV A;  2M5Z A;  3IG5 A;  3FUX A;  1L2C A;  5EXT A;  4MGK E;  1Z6T A;  1A5T A;  3UMM A;  4CGY B;  4YHH M;  2R6F A;  1G59 A;  2MRO B;  2C99 A;  2X4A A;  4FD2 A;  4MM3 B;  2D7H A;  3U6O A;  5DNY A;  2L6O A;  1JR3 D;  1YSY A;  3CTW B;  2CRU A;  4HLQ A;  4L4U A;  4W5W A;  4LGM A;  1NJF A;  1NY6 A;  3PXG A;  3AL0 C;  1D0K A;  2XSZ D;  2R46 A;  1ZMW A;  3RE8 A;  2DAI A;  2XH9 A;  4AI6 A;  5IZ7 D;  4M9Z A;  3SMP A;  1HNX M;  2F5Q A;  5E6J A;  4LRT A;  2MH8 A;  2XLJ A;  1D0M A;  3VKG A;  1WGL A;  1ORY B;  1XWI A;  2VF8 A;  1TH4 A;  4AKI A;  4AKG A;  2XSZ A;  4G4N A;  1OTR A;  2FNA A;  3L26 A;  4LG2 A;  4LJA A;  4CJ6 A;  2LVP C;  5ITX A;  3B7Z A;  2LWX A;  4LJ4 A;  5EP3 A;  5ITU A;  1TTE A;  1OFI A;  1QZM A;  2XGN A;  4B3S M;  3GPX A;  2L2D A;  1T6O A;  2O25 A;  2D7E A;  2GQF A;  4FCT A;  1N34 M;  3HJS A;  3HZJ A;  4FWH A;  2JA2 A;  3SBJ A;  2RGO A;  4HL4 A;  4JI7 M;  5EXS A;  3J27 B;  2BJW A;  2OOB A;  4GC9 A;  5F3W A;  1L1T A;  2CE7 A;  2OPF A;  2UUB M;  3E21 A;  4QOZ C;  1WHC A;  4NRV A;  3UGJ A;  2LHC A;  4OVZ B;  5IT9 S;  1NNJ A;  2A5Y B;  1TF0 B;  1I94 M;  1VDL A;  4LGY A;  1V34 A;  1G8P A;  2K47 A;  1LTM A;  2KNV A;  2W82 A;  3LCU A;  5FTK A;  3U6M A;  2XZF A;  1PJI A;  4RNA A;  1XXH B;  1ZMV A;  2JZ0 A;  2LVN C;  3LVW A;  2G8L A;  3GRU A;  3HGI A;  4MH0 E;  3IEC A;  4MB7 A;  2DXI A;  2C96 A;  4FWG A;  1D2N A;  3GLF B;  1C1K A;  5EJC A;  3U5Z B;  3DZD A;  1QZE A;  4JI3 M;  1XXH E;  4LJ9 A;  2MGW A;  2XFS A;  3TPZ A;  5ITX E;  3TWL A;  4GKK M;  4X64 M;  1PJT A;  3KXE C;  3LMM A;  4OW0 A;  3ZCB B;  2Y20 A;  3BBZ A;  5LMU M;  2ZTD A;  3GLF E;  3AV0 A;  2JY6 B;  4M0W A;  5EQT A;  1QAO A;  3T38 A;  1G3I A;  3KSX A;  1KYI A;  1VDD A;  2XEP A;  3A45 A;  5C1B A;  2BJV A;  4AZF A;  5KO3 A;  4DR6 M;  1QUT A;  1E94 E;  3MHV C;  3C58 A;  1OIZ A;  1HQY E;  1K3X A;  4DR2 M;  2O01 F;  1DGH B;  2KA6 B;  2QHO B;  4LJ7 A;  2BWB A;  4KT0 F;  2JWS A;  3NBX X;  3A46 A;  2KZS A;  4DR5 M;  4GHL A;  2HL7 A;  2DAM A;  2JY7 A;  1VQ1 A;  4S12 A;  1HR0 M;  4DR1 M;  1TDH A;  3SC3 A;  2C9C A;  3KSJ A;  1PJJ A;  4WW0 A;  4PDG A;  4R7G A;  4LF7 M;  2EUC A;  7CAT A;  1IBL M;  4TUW A;  2E5L M;  4MGY E;  5KPR A;  4GRI A;  2RKO A;  2Z7J A;  3IG8 A;  3HHX A;  4FW9 A;  1W5S A;  1SXJ A;  5EP4 A;  3GRY A;  4G4Q A;  3M6A A;  1IXZ A;  3GQ4 A;  3GQ5 A;  2L7H A;  1DO0 A;  1GO5 A;  4UN2 B;  3JR5 A;  2DHR A;  3KFU G;  2KRK A;  3LW5 F;  1IN7 A;  1QQW A;  4GC5 A;  1Z59 A;  1GJT A;  4Z6Y A;  5BPV A;  1JQJ C;  1N77 A;  2CWB A;  4L6V 6;  1QAM A;  2NQ8 C;  3CF6 E;  3I01 M;  1R5L A;  3W0L B;  4AQY M;  4L15 A;  3VDP A;  5DFL A;  1QDR A;  4PD2 A;  2XZU A; 
#chains in the Genus database with same CATH homology
 1NNU C;  4M9S A;  2LXE A;  4PT5 A;  1DGF A;  2UXC M;  3PNY A;  5DYI A;  1Q3C A;  1N75 A;  5H37 D;  1Q39 A;  2Y0Q A;  5FTM A;  4L8R C;  2F5O A;  3TWK A;  3K2L A;  2V1U A;  2YNM D;  1SXJ B;  3R9X B;  1IXR C;  1HQC A;  5A2Q S;  1E32 A;  2HHH M;  1N78 A;  3QWL A;  4I81 A;  5IWA M;  4JYA M;  2D7G A;  4FWD A;  3UZU A;  1HT1 E;  3RFW A;  1SXJ E;  3E9S A;  3FUU A;  3ZC7 B;  1XC8 A;  1K82 A;  4LFC M;  1TGU A;  1FNN A;  5E26 A;  1IY0 A;  4LY6 A;  3OTO M;  3SHG B;  4JI8 M;  4RF1 A;  4X62 M;  3HHZ A;  2ZAM A;  2KRU A;  2ZAN A;  5ITY A;  2Z4S A;  4D80 A;  3KW6 A;  3SAT A;  3J7A S;  3SHF A;  2EA0 A;  4AKH A;  3SAU A;  3FD9 A;  1TH3 A;  3I4V A;  1JR3 A;  2C98 A;  2KZU A;  5KPZ A;  3H4M A;  1GL6 A;  4PDI A;  4GIT A;  2L7I A;  1FJG M;  1XMO M;  4L78 A;  2CEA A;  1MU5 A;  5ITT A;  2R65 A;  4R3D A;  5DYG A;  3WHK A;  3D8L A;  4KO8 A;  1S3S A;  2CHQ A;  4JXJ A;  4IBI A;  2UU9 M;  4WUR A;  1TDZ A;  5C18 A;  3J81 S;  4DV6 M;  4LJ6 A;  3CF0 A;  2F4V M;  1H6U A;  2Z4R A;  3VKH A;  1E9S A;  3KOX E;  2J7N A;  4EIW A;  1DGB A;  1L8Q A;  3DA1 A;  3MK6 A;  5KQ8 A;  1IQP A;  5EXX A;  2C5R A;  1OFH A;  3KDS E;  3LQQ A;  3U6D A;  2DZN B;  1XMQ M;  1N33 M;  3M7G A;  1Z5B A;  2FFJ A;  2Y0T A;  2CFO A;  3GPY A;  1GKI A;  1XHB A;  4QHT A;  5FTN A;  1MX0 A;  3ZH9 B;  4FCW A;  4DR4 M;  4I8O A;  2YR0 A;  4I5S A;  4XGI A;  4DR3 M;  3DFZ A;  1IN8 A;  4IBF A;  1HNW M;  1KSF X;  1XNQ M;  3VDU A;  2CV1 A;  1WXQ A;  2OQ4 A;  4LZZ A;  2EO2 A;  4PCZ A;  5JI3 E;  4LF9 M;  3GP1 A;  4JN6 A;  3UJN A;  2CUZ A;  3FUV A;  1G41 A;  4QNM A;  3PNV A;  4ZPX A;  2DWM A;  1IBK M;  2ZAO A;  4JV5 M;  1QAN A;  4AG5 A;  3T15 A;  5LMN M;  4Z8X A;  3L2A A;  5GKN A;  1GVN A;  3E4R A;  4QHS A;  4IIW A;  1R2Z A;  1HT2 E;  5FTL A;  2FE8 A;  2XFT A;  4D82 A;  2O5R A;  3L28 A;  3U61 A;  2R62 A;  3AOE C;  2HKJ A;  3R8F A;  3WHL A;  4L16 A;  4RF0 A;  2X8A A;  2DWZ B;  2P5T A;  3D8B A;  4DV5 M;  5JI2 E;  2V1C A;  2X49 A;  4AG6 A;  4BB9 A;  2QPA A;  3GLH A;  1LV7 A;  4LFB M;  2I7N A;  3KOY E;  4I4L A;  2HCB A;  3SFZ A;  3CF2 A;  1EE8 A;  3NBI A;  2CV0 A;  3UK6 A;  1R7R A;  2YFQ A;  3JAM S;  1IM2 A;  5BR8 M;  4NSO B;  1Z5A A;  1QAQ A;  3U61 B;  4D81 A;  5KQD A;  5EP2 A;  2AHM A;  2VQE M;  3TL4 X;  3A98 B;  4QOS A;  2L09 A;  4JI0 M;  2F5N A;  2LNH C;  3GLG A;  3GLI A;  4DV4 M;  4MGI E;  3KS8 A;  5ITQ A;  5FLX S;  3KOZ E;  4NOO B;  4B7G A;  4LF6 M;  2R18 A;  4M9X A;  4BLC A;  3EIH A;  1GL7 A;  4LF4 M;  4IBG A;  4OU7 A;  2KW0 A;  3PVS A;  1NHW C;  4IBJ A;  4LCB A;  3U6E A;  3I4Y A;  2Y21 A;  3AFH A;  3SAS A;  1IY2 A;  3HU3 A;  3JR4 A;  5EP1 A;  2QCU A;  3VK7 A;  1IY1 A;  1QYR A;  3HHY A;  4B7F A;  2ERC A;  1NY5 A;  2DZO B;  2KXE A;  1Z5C A;  3L27 A;  4LF5 M;  1GLN A;  1KFV A;  4JI1 M;  2M60 A;  1J7K A;  3KOW E;  1YUB A;  3MJ5 A;  2F5P A;  1NHG C;  2R4J A;  1R6B X;  3HHW A;  3U6P A;  3RGP A;  3HJ8 A;  4DV1 M;  2QP9 X;  3VFD A;  2UXB M;  1X37 A;  3HKP A;  3B9P A;  4B08 A;  1IN4 A;  4B3M M;  3FYD A;  3U60 A;  1K3W A;  2CHG A;  1TH2 A;  5EXP A;  3GRV A;  2G5G X;  3FTC A;  3SAW A;  4OVZ A;  2Z3X A;  2QEN A;  2UUA M;  3FKE A;  1J09 A;  4DV0 M;  4DV2 M;  3L29 A;  4KOD A;  4CIS A;  2QBY A;  4OX9 M;  1XXH A;  3I51 A;  4DR7 M;  2DVW B;  4QNR A;  2R4E A;  4JI2 M;  4B3R M;  4DUZ M;  1QVR A;  3GLF A;  3BOS A;  3U5Z A;  4GIP A;  3U60 B;  3U6C A;  1R2Y A;  4GKJ M;  1IN5 A;  3U6L A;  3VLF B;  2VII A;  3KP1 E;  5KPT A;  3AOE A;  4NXN M;  3GO8 A;  4X65 M;  1IBM M;  3FTE A;  2YQZ A;  3FUT A;  4GHA A;  1E9R A;  2XF3 A;  4GH9 A;  3SMS A;  1J5E M;  1IN6 A;  3QAU A;  3ILK A;  4A3V B;  4IJF A;  4IBK A;  3HJQ A;  2QBY B;  4LF8 M;  1L1Z A;  2ZM6 M;  2J7O A;  1DGH A;  2VQF M;  4KLN A;  4P16 A;  3DOA A;  3SYL A;  4NL4 H;  4DV7 M;  2H1R A;  4II7 A;  1I4W A;  4LZJ A;  1T3T A;  3THG A;  1L2B A;  1ZQ9 A;  3J7B A;  4JI6 M;  2Q2E B;  4NSR A;  3AKZ A;  2KEB A;  3SAR A;  1YE9 A;  3Q8X A;  3K1J A;  3GPU A;  3LQR A;  3FTD A;  4X66 M;  1ZAE A;  3HWS A;  4FCV A;  4IBC A;  8CAT A;  4DUY M;  4MGZ E;  4GMQ A;  3J80 S;  4REZ A;  1NSF A;  3W0F A;  4LFA M;  1HNZ M;  1DO2 A;  1N32 M;  3TQS A;  4LJ5 A;  2RGH A;  3RGS A;  1UM8 A;  3VK8 A;  2C9O A;  3HU1 A;  4IBD A;  3SYK A;  2I7P A;  3SAV A;  1NJG A;  4JI5 M;  1PM5 A;  3K8Z A;  2UXD M;  3EIE A;  3M0E A;  4G6Z A;  1OJL A;  1SXJ D;  3TWM A;  2QZ4 A;  2F5S A;  5FTJ A;  4YY3 M;  1G4A E;  4IBB A;  2CV2 A;  2V6Z M;  2LH0 A;  3HU2 A;  4B7H A;  3L25 A;  3AOG A;  4G4O A;  4LRS A;  4KHP M;  4LJ8 A;  4NXM M;  5IRE B;  3GLH B;  2DWN A;  3KS4 A;  2DWL A;  4IJE A;  3U6Q A;  5ITR A;  1IXS B;  3NWL A;  3KVW A;  4CHT B;  4JI4 M;  5FSW A;  4ITQ A;  2BNK A;  4B3T M;  2FOI C;  3A42 A;  2R45 A;  4NRW A;  1XNR M;  3K92 A;  3FUW A;  3KP0 E;  1N36 M;  1W5T A;  1DGG A;  3GRR A;  3GPP A;  4XBO A;  1NVM A;  1Q3B A;  3GQ3 A;  4M0D A;  4IBE A;  2CHV A;  3GLG B;  3GLI B;  3FTF A;  4BBA A;  3J2P B;  4FVM A;  4G4R A;  4AW4 A;  1SXJ C;  4DV3 M;  3T1H M;  2UUC M;  3AJI B;  3TE6 A;  4K0K M;  3U6S A;  4MGH A;  1L2D A;  3T1Y M;  3PFI A;  3FYC A;  2ZBK B;  3LVV A;  2M5Z A;  3IG5 A;  3FUX A;  1L2C A;  5EXT A;  4MGK E;  1Z6T A;  3UMM A;  4CGY B;  4YHH M;  1G59 A;  4FD2 A;  2C99 A;  2X4A A;  4MM3 B;  2D7H A;  3U6O A;  5DNY A;  2L6O A;  1JR3 D;  1YSY A;  3CTW B;  4HLQ A;  4L4U A;  4W5W A;  3PXG A;  4LGM A;  1NJF A;  1NY6 A;  3AL0 C;  2XSZ D;  2R46 A;  4AI6 A;  3RE8 A;  2XH9 A;  5IZ7 D;  4M9Z A;  3SMP A;  1HNX M;  2F5Q A;  5E6J A;  4LRT A;  2XLJ A;  3VKG A;  1ORY B;  1XWI A;  1TH4 A;  4AKI A;  4AKG A;  2XSZ A;  4G4N A;  2FNA A;  3L26 A;  4LG2 A;  4LJA A;  5ITX A;  2LWX A;  4LJ4 A;  5EP3 A;  5ITU A;  1OFI A;  1QZM A;  2XGN A;  4B3S M;  3GPX A;  2D7E A;  4FCT A;  1N34 M;  3HJS A;  4FWH A;  2JA2 A;  3SBJ A;  2RGO A;  4HL4 A;  4JI7 M;  5EXS A;  3J27 B;  2BJW A;  4GC9 A;  5F3W A;  1L1T A;  2CE7 A;  2OPF A;  2UUB M;  4QOZ C;  4NRV A;  3UGJ A;  4OVZ B;  5IT9 S;  1NNJ A;  2A5Y B;  1I94 M;  4LGY A;  1G8P A;  2K47 A;  2W82 A;  1PJI A;  5FTK A;  3U6M A;  2XZF A;  4RNA A;  1XXH B;  3LVW A;  2G8L A;  3GRU A;  3HGI A;  4MH0 E;  4MB7 A;  2DXI A;  2C96 A;  4FWG A;  1D2N A;  3GLF B;  1C1K A;  5EJC A;  3U5Z B;  3DZD A;  4JI3 M;  5ITX E;  4LJ9 A;  3TPZ A;  4GKK M;  2XFS A;  3TWL A;  4X64 M;  3KXE C;  3LMM A;  4OW0 A;  3ZCB B;  2Y20 A;  5LMU M;  3AV0 A;  5EQT A;  4M0W A;  3T38 A;  1QAO A;  1G3I A;  3KSX A;  1KYI A;  1VDD A;  2XEP A;  3A45 A;  5C1B A;  2BJV A;  4AZF A;  5KO3 A;  4DR6 M;  1E94 E;  3MHV C;  3C58 A;  1HQY E;  1K3X A;  4DR2 M;  1DGH B;  2KA6 B;  4LJ7 A;  3A46 A;  2KZS A;  4DR5 M;  4GHL A;  2HL7 A;  4S12 A;  1HR0 M;  4DR1 M;  1TDH A;  3SC3 A;  2C9C A;  3KSJ A;  1PJJ A;  4WW0 A;  4PDG A;  4R7G A;  4LF7 M;  2EUC A;  7CAT A;  1IBL M;  4TUW A;  2E5L M;  4MGY E;  5KPR A;  4GRI A;  2RKO A;  2Z7J A;  3IG8 A;  3HHX A;  4FW9 A;  1W5S A;  1SXJ A;  5EP4 A;  3GRY A;  4G4Q A;  3M6A A;  1IXZ A;  3GQ4 A;  3GQ5 A;  2L7H A;  1DO0 A;  3JR5 A;  2DHR A;  3KFU G;  2KRK A;  1IN7 A;  1QQW A;  4GC5 A;  1Z59 A;  4Z6Y A;  5BPV A;  1JQJ C;  1N77 A;  1QAM A;  2NQ8 C;  3CF6 E;  4AQY M;  3W0L B;  4L15 A;  3VDP A;  4PD2 A;  2XZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...