3J2PB

Cryoem structure of dengue virus envelope protein heterotetramer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
SVALVPHVGMGLETATETWMSSEGAWKHAQRIETWILRHPGFTIMAAILAYTIGTTHFQRALIFILLTAVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Cryo-EM structure of the mature dengue virus at 3.5-A resolution.
pubmed doi rcsb
molecule tags Viral protein
total genus 17
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01004 Flavi_M Flavivirus envelope glycoprotein M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.970 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j2pB00
5IZ7D 3J27B 3J2PB 5H37D 5IREB
chains in the Genus database with same CATH superfamily
2FNAA 4FWHA 3C3DA 4BB9A 1NY5A 3QYEA 4AQYM 4IBEA 1TTEA 2ZTCA 4DV6M 3THGA 3VDPA 2KNZA 1IXSA 4LJ8A 1R2YA 2Y21A 1A5TA 2G3QA 3MJ5A 4G4QA 1L2BA 1L2DA 1L2CA 1N33M 1QUTA 2ZAMA 4GITA 4IBGA 3FUTA 2I7NA 2F5SA 2CP8A 2Z4RA 3NBXX 2LTUA 8CATA 2FFJA 2CHVA 3WHKA 1V33A 2O5RA 1GABA 4B3TM 1NVMA 1L1ZA 2QNJA 4QHTA 2JZ0A 2ZBKB 5C1BA 3BBZA 2JXNA 2KXEA 4PD2A 2D7GA 3GLHA 3HX3A 3SMSA 4WURA 2L7HA 3Q8GA 4KLNA 2Y20A 2VDBB 2BNKA 4RKUF 4IBCA 3L26A 4JI2M 3GQ5A 1K82A 2BJWA 3GO8A 3SHGB 4JI8M 1DGFA 5FTJA 4B3SM 1XB2B 2ZAOA 2CV1A 3VLFB 5EP1A 3T1HM 4GHAA 1MU5A 2V1UA 3E21A 2C5RA 1EE8A 2QCUA 4LF5M 3A98B 3FYDA 1S3SA 2C98A 3C3EA 2R4JA 1YLAA 4AZFA 1I4WA 2DHRA 3VDUA 2DAGA 4LJ5A 2LVNC 2F5NA 1NHGC 3TL4X 1L1TA 3BOSA 3HGIA 3HY5A 4MGHA 2MR9A 2Z8YM 4JI0M 2CHQA 1R7RA 2L4EA 1ZMVA 4X64M 2JY8A 3B89A 3J80S 2KRUA 3KOXE 2XEPA 3HHZA 2LH0A 2V1CA 2XZFA 2DZOB 4KHPM 2D7HA 3A45A 4FCTA 4LCBA 3IG5A 1IXRC 4RNAA 1WJ7A 2K47A 3ILKA 1N34M 2DENA 2KEBA 1DGBA 3ZH9B 1JR3D 3A46A 4OVZB 3HU2A 1PRBA 3GRYA 4DUYM 3KSXA 2QSFX 2DAIA 1GLNA 2I7PA 3L28A 4LGMA 3U6MA 3HHXA 3TQSA 2QZ4A 5EQTA 3PXGA 1YUBA 4DR7M 2LVAA 2XGNA 3L25A 3AV0A 3VKHA 3HU3A 3EIHA 1IFYA 3TWLA 1MN3A 4IJFA 4R3DA 2X8AA 3B74A 2KZSA 3FUXA 1D2NA 1PJSA 3U6DA 1IBKM 3SMPA 1TR8A 2VQEM 3GLIE 1Z5BA 4FVMA 2XSZD 1DV0A 1IN8A 1NY6A 3H4JA 1T6OA 2BWEA 4XBOA 3RGPA 3J7AS 1OAOC 5BR8M 1AIPC 1L8QA 2R18A 3NBIA 2CHGA 1HNXM 4KO8A 1OAIA 3V76A 3VKGA 3K92A 3U6PA 4GC9A 4GRIA 1JR3A 4L4UA 1EIJA 2WSEF 5DFLA 5L8RF 3GQ3A 4AKGA 2ZTDA 1EFUB 4JI3M 2APLA 3GLIA 1VQ1A 3SAVA 4IBKA 1N32M 4JI7M 3L29A 3SYKA 3U6LA 5FTLA 1G8PA 1H6UA 2XFSA 3W68A 2CWBA 1D0MA 3KOYE 3CF0A 1HQYE 1FJGM 2KZUA 1IM2A 3SYLA 4DUZM 1PM5A 1Q3BA 4LF9M 3LCVB 2H5XA 4X62M 2F5PA 2R44A 1YE9A 1NJFA 2DWNA 4HLQA 2KA6B 2MH8A 2V6ZM 1E9SA 2XSZA 5EP4A 2RKOA 4XK8F 4DR1M 2UUCM 2L6OA 3AOEC 4MB7A 3H4MA 1OFHA 1KSFX 2CFOA 3KOZE 1VG5A 4B7FA 1TF0B 3GRUA 3BXWA 2GNOA 2QQ8A 4ZPXA 3HU1A 4LZZA 3KS8A 2KHHA 3LVVA 2B3TA 5BPVA 4F2LA 2ERCA 5C18A 3W0FA 5KPTA 1GO5A 1TH4A 4IBIA 2W82A 3U61B 4JI6M 3E4RA 1Z5CA 4G6ZA 1IY1A 4P17A 5GKNA 4LF4M 3C58A 3MK6A 2CRUA 3UK6A 3L2AA 2KDLA 5FTMA 5KPZA 3NWLA 2M5ZA 1G3IA 2VQFM 3GLHE 2H1RA 3QAUA 3T38A 3ZQJA 1Z59A 1E9RA 3GRRA 1OKSA 3GLFE 2DVWB 2UXCM 2Y0TA 1VEJA 3GQ4A 2HKJA 4DV1M 4LG2A 3U5ZB 1LV7A 5KQ8A 2JY7A 3HHWA 5EJCA 1NHWC 4IBDA 4QNRA 4L78A 2L4FA 4JXJA 1GL7A 5FTNA 3FUVA 2VF7A 3U6QA 1Q02A 2DAEA 1K3WA 1XNRM 2JWSA 2KNAA 2LVPC 2JY5A 1QDRA 4HL4A 1N78A 2MGWA 2LVOC 4HEOA 4DV5M 3SBJA 4LY6A 4AW4A 2L2DA 2DXIA 3T15A 1Z6TA 5E6JA 3GLFA 2FH0A 4LGYA 4JI5M 2R0IA 2K9DA 2DAKA 4NXNM 3U60A 2CV2A 1G71A 3SASA 1VDDA 4AI6A 3GLGB 1TH3A 2FOIC 2BJVA 4IBBA 2Z7JA 2G8LA 3E9SA 4LZJA 4NRWA 1GJSA 2O25A 2OOAA 2JZ1A 5KPRA 1TH2A 1ZQ9A 3GPXA 4M0DA 1NV9A 1J09A 1QAMA 3VFDA 3GRVA 4PT5A 4DR5M 3FUWA 3QYBA 1GKIA 4WP2A 3MHVC 3JAMS 2DZNB 2QHOB 3DOAA 1HQCA 4FD2A 2DWMA 1MX0A 1N75A 5H37D 2YFQA 3MMPA 4MM3B 3U61A 2N35A 4FCVA 2UUBM 3U6OA 2WSCF 4NSRA 1KFVA 3HKPA 2EO2A 4I81A 4IBJA 5LMUM 1WIVA 3F92A 1D0LA 2J7NA 2F5OA 5ITYA 3LCUA 4I8OA 1NV8A 5KQDA 2QPAA 1V92A 4QHSA 4GEWA 4DV3M 1R4GA 1JR3E 4GKKM 4NL4H 5KO3A 1XMQM 3U5ZA 2L09A 2BWBA 2DZLA 5LMNM 3FKEA 2NQ8C 1QZEA 1IY0A 4B7GA 4F1IA 3M6AA 1QUSA 5EP3A 5A2QS 4L16A 1XMOM 3B7ZA 5IREB 2FE8A 4GIPA 4DV2M 3HHYA 4B7HA 2R45A 3ZC7B 3KS4A 5EP2A 3ZCBB 3UGJA 3RE8A 2UXBM 2CEAA 4A3VB 2RGHA 4X65M 1C7YA 1IXSB 1YSYA 5ITTA 4CJ6A 2R62A 4CHTB 1XWIA 1XXHB 2FS1A 4X66M 1GVNA 2C9CA 1UFZA 1E32A 2XH9A 4IJEA 1GJTA 2K6BA 4LRTA 3D8BA 2DI0A 2K0BX 4K0KM 4II7A 4G3OA 4BBAA 3SAUA 3M7GA 2CE7A 2A5YB 1WR1B 1T43A 3UJNA 5EXPA 5DNYA 1N36M 3M0EA 4NC6A 2F5QA 3IECA 4EIWA 1V34A 3CGWA 4BLCA 3SARA 4R7GA 2C96A 3LQQA 3PNVA 2L7IA 1NSFA 1J7KA 1HJPA 4LFCM 1OIZA 3FTFA 1HT1E 2D7EA 2LVQD 4NRVA 4P16A 4S12A 2XZUA 1QQWA 1TDHA 3KDSE 4CIZA 5FSWA 4ANRA 1QZMA 1ZAEA 2DHYA 2R46A 4PCZA 1R2ZA 4B3MM 4W5WA 4NOOB 3AL0C 4GKJM 1DO0A 3FRIA 3LW5F 1ORYB 4D80A 4DR4M 1R6BX 2X49A 3FUUA 4XGIA 3JR4A 1Q39A 5IZ7D 4OU7A 3HJQA 2HL7A 4OVZA 3TWKA 2Z4SA 3CF2A 4OX9M 3AOGA 4GMQA 3J2PB 3RFWA 1WGLA 3T6PA 1QAOA 1ZMUA 4Z6YA 3Q8XA 4JI4M 1HT2E 4G4NA 4DV7M 2KW0A 4LFBM 3HZJA 1WXQA 3GP1A 5EXSA 1P3QQ 2J7OA 4AKHA 2EKKA 2LBCA 1PJQA 4JYAM 3RGSA 3FD9A 2J5YA 3KFUG 2JA2A 4LF7M 3K1JA 4DR3M 3CF6E 3A42A 3IG8A 3KOWE 1D0KA 1DO2A 1WGNA 4UN2B 2KNVA 4AKIA 2XLJA 3LQRA 3FTEA 3B7NA 2EJSA 1QYRA 4GHLA 2Q2EB 3SC3A 3I4YA 2R65A 1IY2A 1J5EM 5ITQA 2JUJA 3J81S 1OTRA 4G4RA 2Z3XA 4B08A 2WZJA 4PDIA 3T1YM 1IN7A 3KVWA 1XXHA 2OOBA 2OPFA 3B7QA 3WHLA 3U6CA 2F4VM 3U6SA 4GH9A 1JQJC 5IT9S 4JI1M 1FNNA 1SXJB 1W5TA 2LWXA 1NO1A 1OQYA 2YNMD 4REZA 1WHCA 3GPYA 4QNMA 7CATA 4DBGB 1SG9A 1VEKA 1W5SA 4JN6A 4OW0A 3PVSA 3K2LA 4MGZE 4D81A 4LJ9A 1TDZA 5ITRA 3SFZA 1QANA 1X37A 4DR2M 4LFAM 1E94E 4FWDA 2VF8A 4IBFA 4M9ZA 1IQPA 1OIPA 4MH0E 3K8ZA 3GLIB 4YHHM 3UZUA 2LXEA 3OTOM 4L8RC 4DV0M 4FCWA 1G4AE 3K9PA 3EIEA 2JNHA 1NNUC 5E26A 4AG6A 4Q7JA 4LF8M 3IHPA 3D8LA 2O01F 2UU9M 2HAKA 3I4VA 2LHGA 4M0WA 4LF6M 3PNYA 1PJIA 1BVSA 1DGHB 2R4EA 4MGKE 3W67A 1HR0M 3GPPA 3SAWA 1PGYA 4G4OA 4NSOB 2E5LM 2QBYB 2OQ4A 1HNWM 2EKFA 4B3RM 1PJTA 1G41A 1RU3A 4LJ4A 2M60A 2ZANA 1OJLA 3AJIB 1PJJA 1SXJD 3K9OA 4WW0A 2CV0A 1AUAA 4LJ7A 3U6EA 3PFIA 2DKLA 3SATA 2QENA 4DV4M 1QVRA 4ITQA 1Y8GA 3FE3A 5FLXS 3QWLA 1HNZM 1DGGA 2MJ5B 2Y0QA 1XC8A 3CTWB 2HWJA 3L27A 5JI3E 4D82A 1JB0F 3GLGE 1TGUA 1C1KA 2RGOA 4YY3M 3I04M 2G5GX 3DZDA 1IBLM 4DR6M 1SXJE 4KODA 5EXXA 4AG5A 1Q3CA 5F3WA 2GQFA 1IBMM 3FRHA 3KSJA 3UMMA 4LRSA 4L15A 4LJ6A 3R8FA 3KW6A 4MGYE 3J7BA 5ITUA 4NXMM 3GPUA 3JR5A 1VDLA 1UM8A 3DFZA 2DNAA 1LTMA 2WSFF 5FTKA 3KXEC 3VK7A 1NNJA 3R9XB 2XF3A 2QP9X 3GLGA 2EA0A 1VEGA 1IXZA 2HCBA 3J27B 4MGIE 3VK8A 2JP7A 1F4IA 1MJGM 3KP0E 1CUKA 1SXJA 4CISA 3AFHA 5ITXE 2UUAM 1I94M 2YQZA 3TPZA 3SHFA 3AOEA 2R6FA 3FTCA 3GLHB 3HJ8A 2JY6B 3HJSA 4KT0F 2LNHC 4CGYB 1OFIA 2P5TA 2EUCA 4I4LA 4QOSA 5DYGA 3GLFB 4JV5M 4GC5A 3FYCA 1XNQM 4Z8XA 3W0LB 3TE6A 1IN5A 4QOZC 1XHBA 4IIWA 4TUWA 3LMMA 4M9XA 4LJAA 5EXTA 3U60B 4L6V6 5DYIA 1NJGA 2KRKA 2MROB 5ITXA 1K3XA 1IN6A 3DA1A 3B9PA 3LVWA 1QAQA 2C9OA 4I5SA 2XFTA 1T3TA 3C9PA 4R71A 1SXJC 2LHCA 2RRUA 1N77A 2HHHM 1DGHA 2ZM6M 2DWLA 1GL6A 1KYIA 2QBYA 2CUZA 3I51A 4RF1A 2UXDM 2OO9A 4M9SA 1Z5AA 2C99A 2X4AA 3KP1E 5JI2E 5IWAM 2VIIA 1R5LA 3I01M 1ZMWA 4Y28F 1IN4A 3AKZA 1G59A 4RF0A 3TWMA 2DWZB 4FW9A 2YR0A 1XXHE 1ZV1A 3FTDA 4FWGA 4PDGA 3HWSA 1QDTA 2AHMA 3E46A 2DAMA
chains in the Genus database with same CATH topology
2FNAA 4FWHA 4BB9A 1NY5A 4AQYM 4IBEA 4DV6M 3THGA 3VDPA 4LJ8A 1R2YA 2Y21A 3MJ5A 4G4QA 1L2BA 1L2DA 1L2CA 1N33M 2ZAMA 4GITA 4IBGA 3FUTA 2I7NA 2F5SA 2Z4RA 8CATA 2FFJA 2CHVA 3WHKA 2O5RA 4B3TM 1NVMA 1L1ZA 4QHTA 2ZBKB 5C1BA 4PD2A 2KXEA 2D7GA 3GLHA 3SMSA 4WURA 2L7HA 4KLNA 2Y20A 2BNKA 4IBCA 3L26A 4JI2M 3GQ5A 1K82A 2BJWA 3GO8A 3SHGB 4JI8M 1DGFA 5FTJA 2ZAOA 2CV1A 3VLFB 5EP1A 3T1HM 4GHAA 1MU5A 2V1UA 2C5RA 1EE8A 2QCUA 4LF5M 3A98B 3FYDA 1S3SA 2C98A 2R4JA 4AZFA 1I4WA 2DHRA 3VDUA 4LJ5A 2F5NA 1NHGC 3TL4X 1L1TA 3BOSA 3HGIA 4MGHA 4JI0M 2CHQA 1R7RA 4B3SM 4X64M 3J80S 2KRUA 3KOXE 2XEPA 3HHZA 2LH0A 2V1CA 2XZFA 2DZOB 4KHPM 2D7HA 3A45A 4FCTA 4LCBA 3IG5A 1IXRC 4RNAA 2K47A 3ILKA 1N34M 2KEBA 1DGBA 3ZH9B 1JR3D 3A46A 4OVZB 3HU2A 3GRYA 4DUYM 3KSXA 1GLNA 2I7PA 3L28A 4LGMA 3U6MA 3HHXA 3TQSA 2QZ4A 5EQTA 3PXGA 1YUBA 4DR7M 2XGNA 3L25A 3AV0A 3VKHA 3HU3A 3EIHA 3TWLA 4IJFA 4R3DA 2X8AA 2KZSA 3FUXA 1D2NA 3U6DA 1IBKM 3SMPA 2VQEM 1Z5BA 4FVMA 2XSZD 1IN8A 1NY6A 4XBOA 3RGPA 3J7AS 5BR8M 2R18A 1L8QA 3NBIA 2CHGA 1HNXM 4KO8A 3VKGA 3K92A 3U6PA 4GC9A 4GRIA 1JR3A 4L4UA 3GQ3A 4AKGA 4JI3M 3GLIA 3SAVA 4IBKA 1N32M 4JI7M 3L29A 3SYKA 3U6LA 5FTLA 1G8PA 1H6UA 2XFSA 3KOYE 3CF0A 1HQYE 1FJGM 2KZUA 1IM2A 3SYLA 4DUZM 1PM5A 1Q3BA 4LF9M 4X62M 2F5PA 1YE9A 1NJFA 2DWNA 4HLQA 2KA6B 2V6ZM 2XSZA 1E9SA 5EP4A 4DR1M 2RKOA 2UUCM 2L6OA 3AOEC 4MB7A 3H4MA 1OFHA 1KSFX 2CFOA 3KOZE 4B7FA 3GRUA 4ZPXA 3HU1A 4LZZA 3KS8A 3LVVA 5BPVA 2ERCA 5C18A 3W0FA 5KPTA 1TH4A 4IBIA 2W82A 3U61B 4JI6M 3E4RA 1Z5CA 4G6ZA 1IY1A 5GKNA 4LF4M 3C58A 3MK6A 3UK6A 3L2AA 5FTMA 5KPZA 3NWLA 2M5ZA 1G3IA 2VQFM 2H1RA 3QAUA 3T38A 1Z59A 1E9RA 3GRRA 2DVWB 2UXCM 2Y0TA 3GQ4A 2HKJA 4DV1M 4LG2A 3U5ZB 1LV7A 5KQ8A 3HHWA 5EJCA 1NHWC 4IBDA 4QNRA 4L78A 4JXJA 1GL7A 5FTNA 3FUVA 3U6QA 1K3WA 1XNRM 4HL4A 1N78A 4DV5M 3SBJA 4LY6A 4AW4A 2DXIA 3T15A 1Z6TA 5E6JA 3GLFA 4LGYA 4JI5M 4NXNM 3U60A 2CV2A 3SASA 1VDDA 4AI6A 3GLGB 1TH3A 2FOIC 2BJVA 4IBBA 2Z7JA 2G8LA 3E9SA 4LZJA 4NRWA 5KPRA 1TH2A 1ZQ9A 3GPXA 4M0DA 1J09A 1QAMA 3VFDA 3GRVA 4PT5A 4DR5M 3FUWA 1GKIA 3MHVC 3JAMS 2DZNB 3DOAA 1HQCA 4FD2A 2DWMA 1MX0A 1N75A 5H37D 2YFQA 4MM3B 3U61A 4FCVA 2UUBM 3U6OA 4NSRA 1KFVA 3HKPA 2EO2A 4I81A 4IBJA 5LMUM 2J7NA 2F5OA 5ITYA 4I8OA 5KQDA 2QPAA 4QHSA 4DV3M 4GKKM 4NL4H 5KO3A 1XMQM 3U5ZA 2L09A 5LMNM 3FKEA 2NQ8C 4B7GA 1IY0A 3M6AA 5EP3A 5A2QS 4L16A 1XMOM 5IREB 2FE8A 4GIPA 4DV2M 3HHYA 4B7HA 2R45A 3ZC7B 3KS4A 5EP2A 3ZCBB 3UGJA 3RE8A 2UXBM 2CEAA 4A3VB 2RGHA 4X65M 1IXSB 1YSYA 5ITTA 2R62A 4CHTB 1XWIA 1XXHB 4X66M 1GVNA 2C9CA 1E32A 2XH9A 4IJEA 4LRTA 3D8BA 4K0KM 4II7A 4BBAA 3SAUA 3M7GA 2CE7A 2A5YB 5DNYA 2F5QA 3UJNA 5EXPA 1N36M 3M0EA 4EIWA 3SARA 4BLCA 4R7GA 2C96A 3LQQA 3PNVA 2L7IA 1NSFA 1J7KA 4LFCM 3FTFA 1HT1E 2D7EA 4S12A 4NRVA 4P16A 2XZUA 1QQWA 3KDSE 1TDHA 5FSWA 4PCZA 1QZMA 1ZAEA 2R46A 4B3MM 1R2ZA 3AL0C 4W5WA 4NOOB 4GKJM 1DO0A 1ORYB 4D80A 4DR4M 1R6BX 2X49A 3FUUA 4XGIA 3JR4A 1Q39A 5IZ7D 4OU7A 3HJQA 2HL7A 4OVZA 3TWKA 2Z4SA 3CF2A 4OX9M 3AOGA 4GMQA 3J2PB 3RFWA 1QAOA 4Z6YA 3Q8XA 4JI4M 1HT2E 4G4NA 4DV7M 2KW0A 4LFBM 1WXQA 3GP1A 5EXSA 2J7OA 4AKHA 4JYAM 3RGSA 3FD9A 3KFUG 2JA2A 4LF7M 3K1JA 4DR3M 3CF6E 3A42A 3IG8A 3KOWE 1DO2A 4AKIA 2XLJA 3LQRA 3FTEA 1QYRA 4GHLA 2Q2EB 3SC3A 3I4YA 2R65A 1IY2A 1J5EM 5ITQA 3J81S 4G4RA 2Z3XA 4B08A 4PDIA 3T1YM 1IN7A 3KVWA 1XXHA 2OPFA 3WHLA 3U6CA 2F4VM 3U6SA 4GH9A 1JQJC 5IT9S 4JI1M 1FNNA 1SXJB 1W5TA 2LWXA 4REZA 2YNMD 3GPYA 4QNMA 7CATA 4JN6A 1W5SA 4OW0A 3PVSA 3K2LA 4MGZE 4D81A 4LJ9A 1TDZA 5ITRA 3SFZA 1QANA 1X37A 4DR2M 4LFAM 1E94E 4FWDA 4IBFA 4M9ZA 1IQPA 4MH0E 3K8ZA 3GLIB 4YHHM 3UZUA 2LXEA 3OTOM 4L8RC 4DV0M 4FCWA 1G4AE 3EIEA 5E26A 1NNUC 4AG6A 4LF8M 3D8LA 2UU9M 3I4VA 4M0WA 3PNYA 1PJIA 1DGHB 2R4EA 4MGKE 1HR0M 3GPPA 3SAWA 4G4OA 2E5LM 4NSOB 1HNWM 2QBYB 2OQ4A 4B3RM 1G41A 4LJ4A 1PJJA 2M60A 2ZANA 1OJLA 3AJIB 2CV0A 1SXJD 4WW0A 4LF6M 4LJ7A 3U6EA 3PFIA 3SATA 2QENA 4DV4M 1QVRA 4ITQA 5FLXS 3QWLA 1HNZM 1DGGA 2Y0QA 1XC8A 3CTWB 3L27A 5JI3E 4D82A 1TGUA 1C1KA 2RGOA 4YY3M 1IBLM 2G5GX 3DZDA 4DR6M 1SXJE 4KODA 5EXXA 4AG5A 1Q3CA 5F3WA 1IBMM 3KSJA 3UMMA 4LRSA 4L15A 4LJ6A 3R8FA 3KW6A 4MGYE 3J7BA 5ITUA 4NXMM 3GPUA 3JR5A 1UM8A 3DFZA 5FTKA 3KXEC 3VK7A 1NNJA 3R9XB 2XF3A 2QP9X 3GLGA 2EA0A 1IXZA 2HCBA 3J27B 4MGIE 3VK8A 3KP0E 1SXJA 4CISA 3AFHA 5ITXE 2UUAM 1I94M 2YQZA 3TPZA 3SHFA 3AOEA 3FTCA 3GLHB 3HJ8A 3HJSA 2LNHC 4CGYB 1OFIA 2P5TA 2EUCA 4I4LA 4QOSA 5DYGA 3GLFB 4JV5M 4GC5A 3FYCA 1XNQM 4Z8XA 3W0LB 3TE6A 1IN5A 4QOZC 1XHBA 4IIWA 4TUWA 3LMMA 4M9XA 4LJAA 5EXTA 3U60B 5DYIA 1NJGA 2KRKA 5ITXA 1K3XA 1IN6A 3DA1A 3B9PA 3LVWA 1QAQA 2C9OA 4I5SA 2XFTA 1T3TA 1SXJC 1N77A 2HHHM 1DGHA 2ZM6M 2DWLA 1GL6A 1KYIA 2QBYA 2CUZA 3I51A 4RF1A 2UXDM 4M9SA 1Z5AA 2C99A 2X4AA 3KP1E 5JI2E 5IWAM 2VIIA 3AKZA 1IN4A 1G59A 4RF0A 3TWMA 2DWZB 4FW9A 2YR0A 3FTDA 4FWGA 4PDGA 3HWSA 2AHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ7 D;  3J27 B;  3J2P B;  5H37 D;  5IRE B; 
#chains in the Genus database with same CATH topology
 2FNA A;  4FWH A;  3C3D A;  4BB9 A;  1NY5 A;  3QYE A;  4AQY M;  4IBE A;  1TTE A;  2ZTC A;  4DV6 M;  3THG A;  3VDP A;  2KNZ A;  1IXS A;  4LJ8 A;  1R2Y A;  2Y21 A;  1A5T A;  2G3Q A;  3MJ5 A;  4G4Q A;  1L2B A;  1L2D A;  1L2C A;  1N33 M;  1QUT A;  2ZAM A;  4GIT A;  4IBG A;  3FUT A;  2I7N A;  2F5S A;  2CP8 A;  2Z4R A;  3NBX X;  2LTU A;  8CAT A;  2FFJ A;  2CHV A;  3WHK A;  1V33 A;  2O5R A;  1GAB A;  4B3T M;  1NVM A;  1L1Z A;  2QNJ A;  4QHT A;  2JZ0 A;  2ZBK B;  5C1B A;  3BBZ A;  2JXN A;  2KXE A;  4PD2 A;  2D7G A;  3GLH A;  3HX3 A;  3SMS A;  4WUR A;  2L7H A;  3Q8G A;  4KLN A;  2Y20 A;  2VDB B;  2BNK A;  4RKU F;  4IBC A;  3L26 A;  4JI2 M;  3GQ5 A;  1K82 A;  2BJW A;  3GO8 A;  3SHG B;  4JI8 M;  1DGF A;  5FTJ A;  4B3S M;  1XB2 B;  2ZAO A;  2CV1 A;  3VLF B;  5EP1 A;  3T1H M;  4GHA A;  1MU5 A;  2V1U A;  3E21 A;  2C5R A;  1EE8 A;  2QCU A;  4LF5 M;  3A98 B;  3FYD A;  1S3S A;  2C98 A;  3C3E A;  2R4J A;  1YLA A;  4AZF A;  1I4W A;  2DHR A;  3VDU A;  2DAG A;  4LJ5 A;  2LVN C;  2F5N A;  1NHG C;  3TL4 X;  1L1T A;  3BOS A;  3HGI A;  3HY5 A;  4MGH A;  2MR9 A;  2Z8Y M;  4JI0 M;  2CHQ A;  1R7R A;  2L4E A;  1ZMV A;  4X64 M;  2JY8 A;  3B89 A;  3J80 S;  2KRU A;  3KOX E;  2XEP A;  3HHZ A;  2LH0 A;  2V1C A;  2XZF A;  2DZO B;  4KHP M;  2D7H A;  3A45 A;  4FCT A;  4LCB A;  3IG5 A;  1IXR C;  4RNA A;  1WJ7 A;  2K47 A;  3ILK A;  1N34 M;  2DEN A;  2KEB A;  1DGB A;  3ZH9 B;  1JR3 D;  3A46 A;  4OVZ B;  3HU2 A;  1PRB A;  3GRY A;  4DUY M;  3KSX A;  2QSF X;  2DAI A;  1GLN A;  2I7P A;  3L28 A;  4LGM A;  3U6M A;  3HHX A;  3TQS A;  2QZ4 A;  5EQT A;  3PXG A;  1YUB A;  4DR7 M;  2LVA A;  2XGN A;  3L25 A;  3AV0 A;  3VKH A;  3HU3 A;  3EIH A;  1IFY A;  3TWL A;  1MN3 A;  4IJF A;  4R3D A;  2X8A A;  3B74 A;  2KZS A;  3FUX A;  1D2N A;  1PJS A;  3U6D A;  1IBK M;  3SMP A;  1TR8 A;  2VQE M;  3GLI E;  1Z5B A;  4FVM A;  2XSZ D;  1DV0 A;  1IN8 A;  1NY6 A;  3H4J A;  1T6O A;  2BWE A;  4XBO A;  3RGP A;  3J7A S;  1OAO C;  5BR8 M;  1AIP C;  1L8Q A;  2R18 A;  3NBI A;  2CHG A;  1HNX M;  4KO8 A;  1OAI A;  3V76 A;  3VKG A;  3K92 A;  3U6P A;  4GC9 A;  4GRI A;  1JR3 A;  4L4U A;  1EIJ A;  2WSE F;  5DFL A;  5L8R F;  3GQ3 A;  4AKG A;  2ZTD A;  1EFU B;  4JI3 M;  2APL A;  3GLI A;  1VQ1 A;  3SAV A;  4IBK A;  1N32 M;  4JI7 M;  3L29 A;  3SYK A;  3U6L A;  5FTL A;  1G8P A;  1H6U A;  2XFS A;  3W68 A;  2CWB A;  1D0M A;  3KOY E;  3CF0 A;  1HQY E;  1FJG M;  2KZU A;  1IM2 A;  3SYL A;  4DUZ M;  1PM5 A;  1Q3B A;  4LF9 M;  3LCV B;  2H5X A;  4X62 M;  2F5P A;  2R44 A;  1YE9 A;  1NJF A;  2DWN A;  4HLQ A;  2KA6 B;  2MH8 A;  2V6Z M;  1E9S A;  2XSZ A;  5EP4 A;  2RKO A;  4XK8 F;  4DR1 M;  2UUC M;  2L6O A;  3AOE C;  4MB7 A;  3H4M A;  1OFH A;  1KSF X;  2CFO A;  3KOZ E;  1VG5 A;  4B7F A;  1TF0 B;  3GRU A;  3BXW A;  2GNO A;  2QQ8 A;  4ZPX A;  3HU1 A;  4LZZ A;  3KS8 A;  2KHH A;  3LVV A;  2B3T A;  5BPV A;  4F2L A;  2ERC A;  5C18 A;  3W0F A;  5KPT A;  1GO5 A;  1TH4 A;  4IBI A;  2W82 A;  3U61 B;  4JI6 M;  3E4R A;  1Z5C A;  4G6Z A;  1IY1 A;  4P17 A;  5GKN A;  4LF4 M;  3C58 A;  3MK6 A;  2CRU A;  3UK6 A;  3L2A A;  2KDL A;  5FTM A;  5KPZ A;  3NWL A;  2M5Z A;  1G3I A;  2VQF M;  3GLH E;  2H1R A;  3QAU A;  3T38 A;  3ZQJ A;  1Z59 A;  1E9R A;  3GRR A;  1OKS A;  3GLF E;  2DVW B;  2UXC M;  2Y0T A;  1VEJ A;  3GQ4 A;  2HKJ A;  4DV1 M;  4LG2 A;  3U5Z B;  1LV7 A;  5KQ8 A;  2JY7 A;  3HHW A;  5EJC A;  1NHW C;  4IBD A;  4QNR A;  4L78 A;  2L4F A;  4JXJ A;  1GL7 A;  5FTN A;  3FUV A;  2VF7 A;  3U6Q A;  1Q02 A;  2DAE A;  1K3W A;  1XNR M;  2JWS A;  2KNA A;  2LVP C;  2JY5 A;  1QDR A;  4HL4 A;  1N78 A;  2MGW A;  2LVO C;  4HEO A;  4DV5 M;  3SBJ A;  4LY6 A;  4AW4 A;  2L2D A;  2DXI A;  3T15 A;  1Z6T A;  5E6J A;  3GLF A;  2FH0 A;  4LGY A;  4JI5 M;  2R0I A;  2K9D A;  2DAK A;  4NXN M;  3U60 A;  2CV2 A;  1G71 A;  3SAS A;  1VDD A;  4AI6 A;  3GLG B;  1TH3 A;  2FOI C;  2BJV A;  4IBB A;  2Z7J A;  2G8L A;  3E9S A;  4LZJ A;  4NRW A;  1GJS A;  2O25 A;  2OOA A;  2JZ1 A;  5KPR A;  1TH2 A;  1ZQ9 A;  3GPX A;  4M0D A;  1NV9 A;  1J09 A;  1QAM A;  3VFD A;  3GRV A;  4PT5 A;  4DR5 M;  3FUW A;  3QYB A;  1GKI A;  4WP2 A;  3MHV C;  3JAM S;  2DZN B;  2QHO B;  3DOA A;  1HQC A;  4FD2 A;  2DWM A;  1MX0 A;  1N75 A;  5H37 D;  2YFQ A;  3MMP A;  4MM3 B;  3U61 A;  2N35 A;  4FCV A;  2UUB M;  3U6O A;  2WSC F;  4NSR A;  1KFV A;  3HKP A;  2EO2 A;  4I81 A;  4IBJ A;  5LMU M;  1WIV A;  3F92 A;  1D0L A;  2J7N A;  2F5O A;  5ITY A;  3LCU A;  4I8O A;  1NV8 A;  5KQD A;  2QPA A;  1V92 A;  4QHS A;  4GEW A;  4DV3 M;  1R4G A;  1JR3 E;  4GKK M;  4NL4 H;  5KO3 A;  1XMQ M;  3U5Z A;  2L09 A;  2BWB A;  2DZL A;  5LMN M;  3FKE A;  2NQ8 C;  1QZE A;  1IY0 A;  4B7G A;  4F1I A;  3M6A A;  1QUS A;  5EP3 A;  5A2Q S;  4L16 A;  1XMO M;  3B7Z A;  5IRE B;  2FE8 A;  4GIP A;  4DV2 M;  3HHY A;  4B7H A;  2R45 A;  3ZC7 B;  3KS4 A;  5EP2 A;  3ZCB B;  3UGJ A;  3RE8 A;  2UXB M;  2CEA A;  4A3V B;  2RGH A;  4X65 M;  1C7Y A;  1IXS B;  1YSY A;  5ITT A;  4CJ6 A;  2R62 A;  4CHT B;  1XWI A;  1XXH B;  2FS1 A;  4X66 M;  1GVN A;  2C9C A;  1UFZ A;  1E32 A;  2XH9 A;  4IJE A;  1GJT A;  2K6B A;  4LRT A;  3D8B A;  2DI0 A;  2K0B X;  4K0K M;  4II7 A;  4G3O A;  4BBA A;  3SAU A;  3M7G A;  2CE7 A;  2A5Y B;  1WR1 B;  1T43 A;  3UJN A;  5EXP A;  5DNY A;  1N36 M;  3M0E A;  4NC6 A;  2F5Q A;  3IEC A;  4EIW A;  1V34 A;  3CGW A;  4BLC A;  3SAR A;  4R7G A;  2C96 A;  3LQQ A;  3PNV A;  2L7I A;  1NSF A;  1J7K A;  1HJP A;  4LFC M;  1OIZ A;  3FTF A;  1HT1 E;  2D7E A;  2LVQ D;  4NRV A;  4P16 A;  4S12 A;  2XZU A;  1QQW A;  1TDH A;  3KDS E;  4CIZ A;  5FSW A;  4ANR A;  1QZM A;  1ZAE A;  2DHY A;  2R46 A;  4PCZ A;  1R2Z A;  4B3M M;  4W5W A;  4NOO B;  3AL0 C;  4GKJ M;  1DO0 A;  3FRI A;  3LW5 F;  1ORY B;  4D80 A;  4DR4 M;  1R6B X;  2X49 A;  3FUU A;  4XGI A;  3JR4 A;  1Q39 A;  5IZ7 D;  4OU7 A;  3HJQ A;  2HL7 A;  4OVZ A;  3TWK A;  2Z4S A;  3CF2 A;  4OX9 M;  3AOG A;  4GMQ A;  3J2P B;  3RFW A;  1WGL A;  3T6P A;  1QAO A;  1ZMU A;  4Z6Y A;  3Q8X A;  4JI4 M;  1HT2 E;  4G4N A;  4DV7 M;  2KW0 A;  4LFB M;  3HZJ A;  1WXQ A;  3GP1 A;  5EXS A;  1P3Q Q;  2J7O A;  4AKH A;  2EKK A;  2LBC A;  1PJQ A;  4JYA M;  3RGS A;  3FD9 A;  2J5Y A;  3KFU G;  2JA2 A;  4LF7 M;  3K1J A;  4DR3 M;  3CF6 E;  3A42 A;  3IG8 A;  3KOW E;  1D0K A;  1DO2 A;  1WGN A;  4UN2 B;  2KNV A;  4AKI A;  2XLJ A;  3LQR A;  3FTE A;  3B7N A;  2EJS A;  1QYR A;  4GHL A;  2Q2E B;  3SC3 A;  3I4Y A;  2R65 A;  1IY2 A;  1J5E M;  5ITQ A;  2JUJ A;  3J81 S;  1OTR A;  4G4R A;  2Z3X A;  4B08 A;  2WZJ A;  4PDI A;  3T1Y M;  1IN7 A;  3KVW A;  1XXH A;  2OOB A;  2OPF A;  3B7Q A;  3WHL A;  3U6C A;  2F4V M;  3U6S A;  4GH9 A;  1JQJ C;  5IT9 S;  4JI1 M;  1FNN A;  1SXJ B;  1W5T A;  2LWX A;  1NO1 A;  1OQY A;  2YNM D;  4REZ A;  1WHC A;  3GPY A;  4QNM A;  7CAT A;  4DBG B;  1SG9 A;  1VEK A;  1W5S A;  4JN6 A;  4OW0 A;  3PVS A;  3K2L A;  4MGZ E;  4D81 A;  4LJ9 A;  1TDZ A;  5ITR A;  3SFZ A;  1QAN A;  1X37 A;  4DR2 M;  4LFA M;  1E94 E;  4FWD A;  2VF8 A;  4IBF A;  4M9Z A;  1IQP A;  1OIP A;  4MH0 E;  3K8Z A;  3GLI B;  4YHH M;  3UZU A;  2LXE A;  3OTO M;  4L8R C;  4DV0 M;  4FCW A;  1G4A E;  3K9P A;  3EIE A;  2JNH A;  1NNU C;  5E26 A;  4AG6 A;  4Q7J A;  4LF8 M;  3IHP A;  3D8L A;  2O01 F;  2UU9 M;  2HAK A;  3I4V A;  2LHG A;  4M0W A;  4LF6 M;  3PNY A;  1PJI A;  1BVS A;  1DGH B;  2R4E A;  4MGK E;  3W67 A;  1HR0 M;  3GPP A;  3SAW A;  1PGY A;  4G4O A;  4NSO B;  2E5L M;  2QBY B;  2OQ4 A;  1HNW M;  2EKF A;  4B3R M;  1PJT A;  1G41 A;  1RU3 A;  4LJ4 A;  2M60 A;  2ZAN A;  1OJL A;  3AJI B;  1PJJ A;  1SXJ D;  3K9O A;  4WW0 A;  2CV0 A;  1AUA A;  4LJ7 A;  3U6E A;  3PFI A;  2DKL A;  3SAT A;  2QEN A;  4DV4 M;  1QVR A;  4ITQ A;  1Y8G A;  3FE3 A;  5FLX S;  3QWL A;  1HNZ M;  1DGG A;  2MJ5 B;  2Y0Q A;  1XC8 A;  3CTW B;  2HWJ A;  3L27 A;  5JI3 E;  4D82 A;  1JB0 F;  3GLG E;  1TGU A;  1C1K A;  2RGO A;  4YY3 M;  3I04 M;  2G5G X;  3DZD A;  1IBL M;  4DR6 M;  1SXJ E;  4KOD A;  5EXX A;  4AG5 A;  1Q3C A;  5F3W A;  2GQF A;  1IBM M;  3FRH A;  3KSJ A;  3UMM A;  4LRS A;  4L15 A;  4LJ6 A;  3R8F A;  3KW6 A;  4MGY E;  3J7B A;  5ITU A;  4NXM M;  3GPU A;  3JR5 A;  1VDL A;  1UM8 A;  3DFZ A;  2DNA A;  1LTM A;  2WSF F;  5FTK A;  3KXE C;  3VK7 A;  1NNJ A;  3R9X B;  2XF3 A;  2QP9 X;  3GLG A;  2EA0 A;  1VEG A;  1IXZ A;  2HCB A;  3J27 B;  4MGI E;  3VK8 A;  2JP7 A;  1F4I A;  1MJG M;  3KP0 E;  1CUK A;  1SXJ A;  4CIS A;  3AFH A;  5ITX E;  2UUA M;  1I94 M;  2YQZ A;  3TPZ A;  3SHF A;  3AOE A;  2R6F A;  3FTC A;  3GLH B;  3HJ8 A;  2JY6 B;  3HJS A;  4KT0 F;  2LNH C;  4CGY B;  1OFI A;  2P5T A;  2EUC A;  4I4L A;  4QOS A;  5DYG A;  3GLF B;  4JV5 M;  4GC5 A;  3FYC A;  1XNQ M;  4Z8X A;  3W0L B;  3TE6 A;  1IN5 A;  4QOZ C;  1XHB A;  4IIW A;  4TUW A;  3LMM A;  4M9X A;  4LJA A;  5EXT A;  3U60 B;  4L6V 6;  5DYI A;  1NJG A;  2KRK A;  2MRO B;  5ITX A;  1K3X A;  1IN6 A;  3DA1 A;  3B9P A;  3LVW A;  1QAQ A;  2C9O A;  4I5S A;  2XFT A;  1T3T A;  3C9P A;  4R71 A;  1SXJ C;  2LHC A;  2RRU A;  1N77 A;  2HHH M;  1DGH A;  2ZM6 M;  2DWL A;  1GL6 A;  1KYI A;  2QBY A;  2CUZ A;  3I51 A;  4RF1 A;  2UXD M;  2OO9 A;  4M9S A;  1Z5A A;  2C99 A;  2X4A A;  3KP1 E;  5JI2 E;  5IWA M;  2VII A;  1R5L A;  3I01 M;  1ZMW A;  4Y28 F;  1IN4 A;  3AKZ A;  1G59 A;  4RF0 A;  3TWM A;  2DWZ B;  4FW9 A;  2YR0 A;  1XXH E;  1ZV1 A;  3FTD A;  4FWG A;  4PDG A;  3HWS A;  1QDT A;  2AHM A;  3E46 A;  2DAM A; 
#chains in the Genus database with same CATH homology
 2FNA A;  4FWH A;  4BB9 A;  1NY5 A;  4AQY M;  4IBE A;  4DV6 M;  3THG A;  3VDP A;  4LJ8 A;  1R2Y A;  2Y21 A;  3MJ5 A;  4G4Q A;  1L2B A;  1L2D A;  1L2C A;  1N33 M;  2ZAM A;  4GIT A;  4IBG A;  3FUT A;  2I7N A;  2F5S A;  2Z4R A;  8CAT A;  2FFJ A;  2CHV A;  3WHK A;  2O5R A;  4B3T M;  1NVM A;  1L1Z A;  4QHT A;  2ZBK B;  5C1B A;  4PD2 A;  2KXE A;  2D7G A;  3GLH A;  3SMS A;  4WUR A;  2L7H A;  4KLN A;  2Y20 A;  2BNK A;  4IBC A;  3L26 A;  4JI2 M;  3GQ5 A;  1K82 A;  2BJW A;  3GO8 A;  3SHG B;  4JI8 M;  1DGF A;  5FTJ A;  2ZAO A;  2CV1 A;  3VLF B;  5EP1 A;  3T1H M;  4GHA A;  1MU5 A;  2V1U A;  2C5R A;  1EE8 A;  2QCU A;  4LF5 M;  3A98 B;  3FYD A;  1S3S A;  2C98 A;  2R4J A;  4AZF A;  1I4W A;  2DHR A;  3VDU A;  4LJ5 A;  2F5N A;  1NHG C;  3TL4 X;  1L1T A;  3BOS A;  3HGI A;  4MGH A;  4JI0 M;  2CHQ A;  1R7R A;  4B3S M;  4X64 M;  3J80 S;  2KRU A;  3KOX E;  2XEP A;  3HHZ A;  2LH0 A;  2V1C A;  2XZF A;  2DZO B;  4KHP M;  2D7H A;  3A45 A;  4FCT A;  4LCB A;  3IG5 A;  1IXR C;  4RNA A;  2K47 A;  3ILK A;  1N34 M;  2KEB A;  1DGB A;  3ZH9 B;  1JR3 D;  3A46 A;  4OVZ B;  3HU2 A;  3GRY A;  4DUY M;  3KSX A;  1GLN A;  2I7P A;  3L28 A;  4LGM A;  3U6M A;  3HHX A;  3TQS A;  2QZ4 A;  5EQT A;  3PXG A;  1YUB A;  4DR7 M;  2XGN A;  3L25 A;  3AV0 A;  3VKH A;  3HU3 A;  3EIH A;  3TWL A;  4IJF A;  4R3D A;  2X8A A;  2KZS A;  3FUX A;  1D2N A;  3U6D A;  1IBK M;  3SMP A;  2VQE M;  1Z5B A;  4FVM A;  2XSZ D;  1IN8 A;  1NY6 A;  4XBO A;  3RGP A;  3J7A S;  5BR8 M;  2R18 A;  1L8Q A;  3NBI A;  2CHG A;  1HNX M;  4KO8 A;  3VKG A;  3K92 A;  3U6P A;  4GC9 A;  4GRI A;  1JR3 A;  4L4U A;  3GQ3 A;  4AKG A;  4JI3 M;  3GLI A;  3SAV A;  4IBK A;  1N32 M;  4JI7 M;  3L29 A;  3SYK A;  3U6L A;  5FTL A;  1G8P A;  1H6U A;  2XFS A;  3KOY E;  3CF0 A;  1HQY E;  1FJG M;  2KZU A;  1IM2 A;  3SYL A;  4DUZ M;  1PM5 A;  1Q3B A;  4LF9 M;  4X62 M;  2F5P A;  1YE9 A;  1NJF A;  2DWN A;  4HLQ A;  2KA6 B;  2V6Z M;  2XSZ A;  1E9S A;  5EP4 A;  4DR1 M;  2RKO A;  2UUC M;  2L6O A;  3AOE C;  4MB7 A;  3H4M A;  1OFH A;  1KSF X;  2CFO A;  3KOZ E;  4B7F A;  3GRU A;  4ZPX A;  3HU1 A;  4LZZ A;  3KS8 A;  3LVV A;  5BPV A;  2ERC A;  5C18 A;  3W0F A;  5KPT A;  1TH4 A;  4IBI A;  2W82 A;  3U61 B;  4JI6 M;  3E4R A;  1Z5C A;  4G6Z A;  1IY1 A;  5GKN A;  4LF4 M;  3C58 A;  3MK6 A;  3UK6 A;  3L2A A;  5FTM A;  5KPZ A;  3NWL A;  2M5Z A;  1G3I A;  2VQF M;  2H1R A;  3QAU A;  3T38 A;  1Z59 A;  1E9R A;  3GRR A;  2DVW B;  2UXC M;  2Y0T A;  3GQ4 A;  2HKJ A;  4DV1 M;  4LG2 A;  3U5Z B;  1LV7 A;  5KQ8 A;  3HHW A;  5EJC A;  1NHW C;  4IBD A;  4QNR A;  4L78 A;  4JXJ A;  1GL7 A;  5FTN A;  3FUV A;  3U6Q A;  1K3W A;  1XNR M;  4HL4 A;  1N78 A;  4DV5 M;  3SBJ A;  4LY6 A;  4AW4 A;  2DXI A;  3T15 A;  1Z6T A;  5E6J A;  3GLF A;  4LGY A;  4JI5 M;  4NXN M;  3U60 A;  2CV2 A;  3SAS A;  1VDD A;  4AI6 A;  3GLG B;  1TH3 A;  2FOI C;  2BJV A;  4IBB A;  2Z7J A;  2G8L A;  3E9S A;  4LZJ A;  4NRW A;  5KPR A;  1TH2 A;  1ZQ9 A;  3GPX A;  4M0D A;  1J09 A;  1QAM A;  3VFD A;  3GRV A;  4PT5 A;  4DR5 M;  3FUW A;  1GKI A;  3MHV C;  3JAM S;  2DZN B;  3DOA A;  1HQC A;  4FD2 A;  2DWM A;  1MX0 A;  1N75 A;  5H37 D;  2YFQ A;  4MM3 B;  3U61 A;  4FCV A;  2UUB M;  3U6O A;  4NSR A;  1KFV A;  3HKP A;  2EO2 A;  4I81 A;  4IBJ A;  5LMU M;  2J7N A;  2F5O A;  5ITY A;  4I8O A;  5KQD A;  2QPA A;  4QHS A;  4DV3 M;  4GKK M;  4NL4 H;  5KO3 A;  1XMQ M;  3U5Z A;  2L09 A;  5LMN M;  3FKE A;  2NQ8 C;  4B7G A;  1IY0 A;  3M6A A;  5EP3 A;  5A2Q S;  4L16 A;  1XMO M;  5IRE B;  2FE8 A;  4GIP A;  4DV2 M;  3HHY A;  4B7H A;  2R45 A;  3ZC7 B;  3KS4 A;  5EP2 A;  3ZCB B;  3UGJ A;  3RE8 A;  2UXB M;  2CEA A;  4A3V B;  2RGH A;  4X65 M;  1IXS B;  1YSY A;  5ITT A;  2R62 A;  4CHT B;  1XWI A;  1XXH B;  4X66 M;  1GVN A;  2C9C A;  1E32 A;  2XH9 A;  4IJE A;  4LRT A;  3D8B A;  4K0K M;  4II7 A;  4BBA A;  3SAU A;  3M7G A;  2CE7 A;  2A5Y B;  5DNY A;  2F5Q A;  3UJN A;  5EXP A;  1N36 M;  3M0E A;  4EIW A;  3SAR A;  4BLC A;  4R7G A;  2C96 A;  3LQQ A;  3PNV A;  2L7I A;  1NSF A;  1J7K A;  4LFC M;  3FTF A;  1HT1 E;  2D7E A;  4S12 A;  4NRV A;  4P16 A;  2XZU A;  1QQW A;  3KDS E;  1TDH A;  5FSW A;  4PCZ A;  1QZM A;  1ZAE A;  2R46 A;  4B3M M;  1R2Z A;  3AL0 C;  4W5W A;  4NOO B;  4GKJ M;  1DO0 A;  1ORY B;  4D80 A;  4DR4 M;  1R6B X;  2X49 A;  3FUU A;  4XGI A;  3JR4 A;  1Q39 A;  5IZ7 D;  4OU7 A;  3HJQ A;  2HL7 A;  4OVZ A;  3TWK A;  2Z4S A;  3CF2 A;  4OX9 M;  3AOG A;  4GMQ A;  3J2P B;  3RFW A;  1QAO A;  4Z6Y A;  3Q8X A;  4JI4 M;  1HT2 E;  4G4N A;  4DV7 M;  2KW0 A;  4LFB M;  1WXQ A;  3GP1 A;  5EXS A;  2J7O A;  4AKH A;  4JYA M;  3RGS A;  3FD9 A;  3KFU G;  2JA2 A;  4LF7 M;  3K1J A;  4DR3 M;  3CF6 E;  3A42 A;  3IG8 A;  3KOW E;  1DO2 A;  4AKI A;  2XLJ A;  3LQR A;  3FTE A;  1QYR A;  4GHL A;  2Q2E B;  3SC3 A;  3I4Y A;  2R65 A;  1IY2 A;  1J5E M;  5ITQ A;  3J81 S;  4G4R A;  2Z3X A;  4B08 A;  4PDI A;  3T1Y M;  1IN7 A;  3KVW A;  1XXH A;  2OPF A;  3WHL A;  3U6C A;  2F4V M;  3U6S A;  4GH9 A;  1JQJ C;  5IT9 S;  4JI1 M;  1FNN A;  1SXJ B;  1W5T A;  2LWX A;  4REZ A;  2YNM D;  3GPY A;  4QNM A;  7CAT A;  4JN6 A;  1W5S A;  4OW0 A;  3PVS A;  3K2L A;  4MGZ E;  4D81 A;  4LJ9 A;  1TDZ A;  5ITR A;  3SFZ A;  1QAN A;  1X37 A;  4DR2 M;  4LFA M;  1E94 E;  4FWD A;  4IBF A;  4M9Z A;  1IQP A;  4MH0 E;  3K8Z A;  3GLI B;  4YHH M;  3UZU A;  2LXE A;  3OTO M;  4L8R C;  4DV0 M;  4FCW A;  1G4A E;  3EIE A;  5E26 A;  1NNU C;  4AG6 A;  4LF8 M;  3D8L A;  2UU9 M;  3I4V A;  4M0W A;  3PNY A;  1PJI A;  1DGH B;  2R4E A;  4MGK E;  1HR0 M;  3GPP A;  3SAW A;  4G4O A;  2E5L M;  4NSO B;  1HNW M;  2QBY B;  2OQ4 A;  4B3R M;  1G41 A;  4LJ4 A;  1PJJ A;  2M60 A;  2ZAN A;  1OJL A;  3AJI B;  2CV0 A;  1SXJ D;  4WW0 A;  4LF6 M;  4LJ7 A;  3U6E A;  3PFI A;  3SAT A;  2QEN A;  4DV4 M;  1QVR A;  4ITQ A;  5FLX S;  3QWL A;  1HNZ M;  1DGG A;  2Y0Q A;  1XC8 A;  3CTW B;  3L27 A;  5JI3 E;  4D82 A;  1TGU A;  1C1K A;  2RGO A;  4YY3 M;  1IBL M;  2G5G X;  3DZD A;  4DR6 M;  1SXJ E;  4KOD A;  5EXX A;  4AG5 A;  1Q3C A;  5F3W A;  1IBM M;  3KSJ A;  3UMM A;  4LRS A;  4L15 A;  4LJ6 A;  3R8F A;  3KW6 A;  4MGY E;  3J7B A;  5ITU A;  4NXM M;  3GPU A;  3JR5 A;  1UM8 A;  3DFZ A;  5FTK A;  3KXE C;  3VK7 A;  1NNJ A;  3R9X B;  2XF3 A;  2QP9 X;  3GLG A;  2EA0 A;  1IXZ A;  2HCB A;  3J27 B;  4MGI E;  3VK8 A;  3KP0 E;  1SXJ A;  4CIS A;  3AFH A;  5ITX E;  2UUA M;  1I94 M;  2YQZ A;  3TPZ A;  3SHF A;  3AOE A;  3FTC A;  3GLH B;  3HJ8 A;  3HJS A;  2LNH C;  4CGY B;  1OFI A;  2P5T A;  2EUC A;  4I4L A;  4QOS A;  5DYG A;  3GLF B;  4JV5 M;  4GC5 A;  3FYC A;  1XNQ M;  4Z8X A;  3W0L B;  3TE6 A;  1IN5 A;  4QOZ C;  1XHB A;  4IIW A;  4TUW A;  3LMM A;  4M9X A;  4LJA A;  5EXT A;  3U60 B;  5DYI A;  1NJG A;  2KRK A;  5ITX A;  1K3X A;  1IN6 A;  3DA1 A;  3B9P A;  3LVW A;  1QAQ A;  2C9O A;  4I5S A;  2XFT A;  1T3T A;  1SXJ C;  1N77 A;  2HHH M;  1DGH A;  2ZM6 M;  2DWL A;  1GL6 A;  1KYI A;  2QBY A;  2CUZ A;  3I51 A;  4RF1 A;  2UXD M;  4M9S A;  1Z5A A;  2C99 A;  2X4A A;  3KP1 E;  5JI2 E;  5IWA M;  2VII A;  3AKZ A;  1IN4 A;  1G59 A;  4RF0 A;  3TWM A;  2DWZ B;  4FW9 A;  2YR0 A;  3FTD A;  4FWG A;  4PDG A;  3HWS A;  2AHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...