3J63A

Unified assembly mechanism of asc-dependent inflammasomes
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unified Polymerization Mechanism for the Assembly of ASC-Dependent Inflammasomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Apoptosis-associated speck-like protein containing a CARD
total genus 20
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3j63A00
2DBFA 4O9FA 2NAQA 4N1LA 4O7QA 4E9MA 1E3YA 2LWEA 2D96A 2MPCA 3EZQB 4F44A 3YGSP 1NGRA 2N97A 2BBRA 4UZ0A 1CY5A 2L6AA 2N00A 2M5VA 1A1WA 2DO9A 1DDFA 3YGSC 4F42A 4M9XA 2MS7A 1C15A 3J63A 1WXPA 3T6PA 3QF2A 1D2ZB 2F1SA 4IZ5E 1PN5A 2VGQA 4P4HA 2KM6A 4P4HI 1UCPA 1DGNA 2N7ZA 4M9SA 3EZQA 3KATA 2MS8A 4N1KA 1FADA 2MB9A 3MOPG 2NZ7A 2YQFA 2G7RA 2YU0A 2KN6A 2MN4A 2YVIA 4JUPA 4D8OA 2O71A 4FH0A 4M9ZA 2NSNA 1N3KA 4IZAB 2BBZA 4N1JA 4A2QA 4EWIA 2B1WA 2DBGA 3CL3A 2DBDA 2IB1A 3LQQA 2LWDA 4O9LA 4ZBWA 2L9MA 2HM2Q 2DBHA 4O6XA 2N1FA 4IZ7B 4LWDA 1YGOA 4NQKA 2A9IA 2OF5A 3CRDA 4A2WA 1E41A 3MOPK 4QOBA 2LS7A 3LQRA 2N83A 1Z6TA 4JQWA 1A1ZA 2YGSA 2OF5H 4DWNA 2N80A 1WH4A 1WMGA 3MOPA 1CWWA 3J6JA 4I16A 2A5YB 4RHWE 4RHWA 2P1HA 1D2ZA 1ICHA 2GF5A
chains in the Genus database with same CATH superfamily
2DBFA 4O9FA 2NAQA 4N1LA 4O7QA 4E9MA 1E3YA 2LWEA 2D96A 2MPCA 3EZQB 4F44A 3YGSP 2XV9A 1NGRA 2N97A 2BBRA 4UZ0A 1CY5A 2L6AA 2N00A 2M5VA 1A1WA 2DO9A 1DDFA 3YGSC 4F42A 4M9XA 2MS7A 1C15A 3J63A 1WXPA 3T6PA 3QF2A 1D2ZB 2F1SA 4IZ5E 1PN5A 2VGQA 4P4HA 2KM6A 4P4HI 1UCPA 1DGNA 2N7ZA 4M9SA 3EZQA 3KATA 2MS8A 4N1KA 1FADA 2MB9A 3MOPG 2NZ7A 2YQFA 2G7RA 2YU0A 2KN6A 2MN4A 2YVIA 4JUPA 4D8OA 2O71A 4FH0A 4M9ZA 2NSNA 1N3KA 4IZAB 2BBZA 4N1JA 4A2QA 4EWIA 2B1WA 2DBGA 3CL3A 2DBDA 2IB1A 3LQQA 2LWDA 4O9LA 4ZBWA 2L9MA 2HM2Q 2DBHA 4O6XA 2N1FA 4IZ7B 4LWDA 1YGOA 4NQKA 2A9IA 2OF5A 3CRDA 4A2WA 1E41A 3MOPK 4QOBA 2LS7A 3LQRA 2N83A 1Z6TA 4JQWA 1A1ZA 2YGSA 2OF5H 4DWNA 2N80A 1WH4A 1WMGA 3MOPA 1CWWA 3J6JA 4I16A 2A5YB 4RHWE 4RHWA 2P1HA 1D2ZA 2MJMA 1ICHA 2GF5A
chains in the Genus database with same CATH topology
2DBFA 4O9FA 2NAQA 4N1LA 4O7QA 4E9MA 1E3YA 2LWEA 2D96A 2MPCA 3EZQB 4F44A 3YGSP 2XV9A 1NGRA 2N97A 2BBRA 4UZ0A 1CY5A 2L6AA 2N00A 2M5VA 1A1WA 2DO9A 1DDFA 3YGSC 4F42A 4M9XA 2MS7A 1C15A 3J63A 1WXPA 3T6PA 3QF2A 1D2ZB 2F1SA 4IZ5E 1PN5A 2VGQA 4P4HA 2KM6A 4P4HI 1UCPA 1DGNA 2N7ZA 4M9SA 3EZQA 3KATA 2MS8A 4N1KA 1FADA 2MB9A 3MOPG 2NZ7A 2YQFA 2G7RA 2YU0A 2KN6A 2MN4A 2YVIA 4JUPA 4D8OA 2O71A 4FH0A 4M9ZA 2NSNA 1N3KA 4IZAB 2BBZA 4N1JA 4A2QA 4EWIA 2B1WA 2DBGA 3CL3A 2DBDA 2IB1A 3LQQA 2LWDA 4O9LA 4ZBWA 2L9MA 2HM2Q 2DBHA 4O6XA 2N1FA 4IZ7B 4LWDA 1YGOA 4NQKA 2A9IA 2OF5A 3CRDA 4A2WA 1E41A 3MOPK 4QOBA 2LS7A 3LQRA 2N83A 1Z6TA 4JQWA 1A1ZA 2YGSA 2OF5H 4DWNA 2N80A 1WH4A 1WMGA 3MOPA 1CWWA 3J6JA 4I16A 2A5YB 4RHWE 4RHWA 2P1HA 1D2ZA 2MJMA 1ICHA 2GF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBF A;  4O9F A;  2NAQ A;  4N1L A;  4O7Q A;  4E9M A;  1E3Y A;  2LWE A;  2D96 A;  2MPC A;  3EZQ B;  4F44 A;  3YGS P;  1NGR A;  2N97 A;  2BBR A;  4UZ0 A;  1CY5 A;  2L6A A;  2N00 A;  2M5V A;  1A1W A;  2DO9 A;  1DDF A;  3YGS C;  4F42 A;  4M9X A;  2MS7 A;  1C15 A;  3J63 A;  1WXP A;  3T6P A;  3QF2 A;  1D2Z B;  2F1S A;  4IZ5 E;  1PN5 A;  2VGQ A;  4P4H A;  2KM6 A;  4P4H I;  1UCP A;  1DGN A;  2N7Z A;  4M9S A;  3EZQ A;  3KAT A;  2MS8 A;  4N1K A;  1FAD A;  2MB9 A;  3MOP G;  2NZ7 A;  2YQF A;  2G7R A;  2YU0 A;  2KN6 A;  2MN4 A;  2YVI A;  4JUP A;  4D8O A;  2O71 A;  4FH0 A;  4M9Z A;  2NSN A;  1N3K A;  4IZA B;  2BBZ A;  4N1J A;  4A2Q A;  4EWI A;  2B1W A;  2DBG A;  3CL3 A;  2DBD A;  2IB1 A;  3LQQ A;  2LWD A;  4O9L A;  4ZBW A;  2L9M A;  2HM2 Q;  2DBH A;  4O6X A;  2N1F A;  4IZ7 B;  4LWD A;  1YGO A;  4NQK A;  2A9I A;  2OF5 A;  3CRD A;  4A2W A;  1E41 A;  3MOP K;  4QOB A;  2LS7 A;  3LQR A;  2N83 A;  1Z6T A;  4JQW A;  1A1Z A;  2YGS A;  2OF5 H;  4DWN A;  2N80 A;  1WH4 A;  1WMG A;  3MOP A;  1CWW A;  3J6J A;  4I16 A;  2A5Y B;  4RHW E;  4RHW A;  2P1H A;  1D2Z A;  1ICH A;  2GF5 A; 
#chains in the Genus database with same CATH topology
 2DBF A;  4O9F A;  2NAQ A;  4N1L A;  4O7Q A;  4E9M A;  1E3Y A;  2LWE A;  2D96 A;  2MPC A;  3EZQ B;  4F44 A;  3YGS P;  2XV9 A;  1NGR A;  2N97 A;  2BBR A;  4UZ0 A;  1CY5 A;  2L6A A;  2N00 A;  2M5V A;  1A1W A;  2DO9 A;  1DDF A;  3YGS C;  4F42 A;  4M9X A;  2MS7 A;  1C15 A;  3J63 A;  1WXP A;  3T6P A;  3QF2 A;  1D2Z B;  2F1S A;  4IZ5 E;  1PN5 A;  2VGQ A;  4P4H A;  2KM6 A;  4P4H I;  1UCP A;  1DGN A;  2N7Z A;  4M9S A;  3EZQ A;  3KAT A;  2MS8 A;  4N1K A;  1FAD A;  2MB9 A;  3MOP G;  2NZ7 A;  2YQF A;  2G7R A;  2YU0 A;  2KN6 A;  2MN4 A;  2YVI A;  4JUP A;  4D8O A;  2O71 A;  4FH0 A;  4M9Z A;  2NSN A;  1N3K A;  4IZA B;  2BBZ A;  4N1J A;  4A2Q A;  4EWI A;  2B1W A;  2DBG A;  3CL3 A;  2DBD A;  2IB1 A;  3LQQ A;  2LWD A;  4O9L A;  4ZBW A;  2L9M A;  2HM2 Q;  2DBH A;  4O6X A;  2N1F A;  4IZ7 B;  4LWD A;  1YGO A;  4NQK A;  2A9I A;  2OF5 A;  3CRD A;  4A2W A;  1E41 A;  3MOP K;  4QOB A;  2LS7 A;  3LQR A;  2N83 A;  1Z6T A;  4JQW A;  1A1Z A;  2YGS A;  2OF5 H;  4DWN A;  2N80 A;  1WH4 A;  1WMG A;  3MOP A;  1CWW A;  3J6J A;  4I16 A;  2A5Y B;  4RHW E;  4RHW A;  2P1H A;  1D2Z A;  2MJM A;  1ICH A;  2GF5 A; 
#chains in the Genus database with same CATH homology
 2DBF A;  4O9F A;  2NAQ A;  4N1L A;  4O7Q A;  4E9M A;  1E3Y A;  2LWE A;  2D96 A;  2MPC A;  3EZQ B;  4F44 A;  3YGS P;  2XV9 A;  1NGR A;  2N97 A;  2BBR A;  4UZ0 A;  1CY5 A;  2L6A A;  2N00 A;  2M5V A;  1A1W A;  2DO9 A;  1DDF A;  3YGS C;  4F42 A;  4M9X A;  2MS7 A;  1C15 A;  3J63 A;  1WXP A;  3T6P A;  3QF2 A;  1D2Z B;  2F1S A;  4IZ5 E;  1PN5 A;  2VGQ A;  4P4H A;  2KM6 A;  4P4H I;  1UCP A;  1DGN A;  2N7Z A;  4M9S A;  3EZQ A;  3KAT A;  2MS8 A;  4N1K A;  1FAD A;  2MB9 A;  3MOP G;  2NZ7 A;  2YQF A;  2G7R A;  2YU0 A;  2KN6 A;  2MN4 A;  2YVI A;  4JUP A;  4D8O A;  2O71 A;  4FH0 A;  4M9Z A;  2NSN A;  1N3K A;  4IZA B;  2BBZ A;  4N1J A;  4A2Q A;  4EWI A;  2B1W A;  2DBG A;  3CL3 A;  2DBD A;  2IB1 A;  3LQQ A;  2LWD A;  4O9L A;  4ZBW A;  2L9M A;  2HM2 Q;  2DBH A;  4O6X A;  2N1F A;  4IZ7 B;  4LWD A;  1YGO A;  4NQK A;  2A9I A;  2OF5 A;  3CRD A;  4A2W A;  1E41 A;  3MOP K;  4QOB A;  2LS7 A;  3LQR A;  2N83 A;  1Z6T A;  4JQW A;  1A1Z A;  2YGS A;  2OF5 H;  4DWN A;  2N80 A;  1WH4 A;  1WMG A;  3MOP A;  1CWW A;  3J6J A;  4I16 A;  2A5Y B;  4RHW E;  4RHW A;  2P1H A;  1D2Z A;  2MJM A;  1ICH A;  2GF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...