3J6JA

3.6 angstrom resolution mavs filament generated from helical reconstruction
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
MAFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Imprinting as a Signal-Activation Mechanism of the Viral RNA Sensor RIG-I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Mitochondrial antiviral-signaling protein
total genus 38
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, G, I, L
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3j6jA00
1C15A 2B1WA 2N97A 3MOPA 3J63A 4IZAB 4M9ZA 3YGSC 1N3KA 4RHWE 2YGSA 3QF2A 4O7QA 2G7RA 3MOPG 2YVIA 1PN5A 2L9MA 2O71A 3LQRA 2IB1A 2LWEA 3J6JA 2KN6A 2GF5A 4M9SA 2MB9A 4F44A 2N83A 1A1ZA 1YGOA 4UZ0A 2DBFA 3CRDA 2N7ZA 3KATA 2LS7A 2VGQA 2L6AA 1ICHA 1UCPA 2DBDA 4FH0A 4ZBWA 1NGRA 2BBZA 4I16A 4QOBA 1FADA 1WXPA 2A5YB 3EZQA 2A9IA 2D96A 4LWDA 4N1LA 4O9LA 2HM2Q 4RHWA 2OF5H 1WH4A 2N1FA 4DWNA 1E3YA 1WMGA 2NAQA 4N1JA 4NQKA 2BBRA 2KM6A 4O9FA 1DGNA 4F42A 2MN4A 3MOPK 4E9MA 2MS8A 2DBHA 4IZ7B 4JUPA 2MS7A 3YGSP 2N00A 4P4HI 2DBGA 3CL3A 3LQQA 1E41A 2N80A 2F1SA 2M5VA 2LWDA 2DO9A 3T6PA 2YQFA 4M9XA 3EZQB 4D8OA 1DDFA 1D2ZB 2P1HA 4JQWA 4P4HA 1CY5A 2OF5A 2YU0A 2MPCA 4O6XA 4A2WA 1CWWA 2NZ7A 1A1WA 1Z6TA 4N1KA 4A2QA 2NSNA 1D2ZA 4EWIA 4IZ5E
chains in the Genus database with same CATH superfamily
1C15A 2B1WA 2N97A 3MOPA 3J63A 4IZAB 4M9ZA 3YGSC 1N3KA 4RHWE 2YGSA 3QF2A 4O7QA 2G7RA 3MOPG 2YVIA 1PN5A 2L9MA 2O71A 3LQRA 2IB1A 2LWEA 3J6JA 2KN6A 2GF5A 4M9SA 2MB9A 4F44A 2MJMA 2N83A 1A1ZA 1YGOA 4UZ0A 2DBFA 3CRDA 2N7ZA 3KATA 2LS7A 2VGQA 2L6AA 1ICHA 1UCPA 2DBDA 4FH0A 4ZBWA 1NGRA 2BBZA 4I16A 4QOBA 1FADA 1WXPA 2A5YB 3EZQA 2A9IA 2D96A 4LWDA 4N1LA 4O9LA 2HM2Q 4RHWA 2OF5H 1WH4A 2N1FA 4DWNA 1E3YA 1WMGA 2NAQA 4N1JA 4NQKA 2BBRA 2KM6A 4O9FA 1DGNA 4F42A 2MN4A 3MOPK 4E9MA 2MS8A 2DBHA 4IZ7B 4JUPA 2MS7A 3YGSP 2N00A 4P4HI 2DBGA 2XV9A 3CL3A 3LQQA 1E41A 2N80A 2F1SA 2M5VA 2LWDA 2DO9A 3T6PA 2YQFA 4M9XA 3EZQB 4D8OA 1DDFA 1D2ZB 2P1HA 4JQWA 4P4HA 1CY5A 2OF5A 2YU0A 2MPCA 4O6XA 4A2WA 1CWWA 2NZ7A 1A1WA 1Z6TA 4N1KA 4A2QA 2NSNA 1D2ZA 4EWIA 4IZ5E
chains in the Genus database with same CATH topology
1C15A 2B1WA 2N97A 3MOPA 3J63A 4IZAB 4M9ZA 3YGSC 1N3KA 4RHWE 2YGSA 3QF2A 4O7QA 2G7RA 3MOPG 2YVIA 1PN5A 2L9MA 2O71A 3LQRA 2IB1A 2LWEA 3J6JA 2KN6A 2GF5A 4M9SA 2MB9A 4F44A 2MJMA 2N83A 1A1ZA 1YGOA 4UZ0A 2DBFA 3CRDA 2N7ZA 3KATA 2LS7A 2VGQA 2L6AA 1ICHA 1UCPA 2DBDA 4FH0A 4ZBWA 1NGRA 2BBZA 4I16A 4QOBA 1FADA 1WXPA 2A5YB 3EZQA 2A9IA 2D96A 4LWDA 4N1LA 4O9LA 2HM2Q 4RHWA 2OF5H 1WH4A 2N1FA 4DWNA 1E3YA 1WMGA 2NAQA 4N1JA 4NQKA 2BBRA 2KM6A 4O9FA 1DGNA 4F42A 2MN4A 3MOPK 4E9MA 2MS8A 2DBHA 4IZ7B 4JUPA 2MS7A 3YGSP 2N00A 4P4HI 2DBGA 2XV9A 3CL3A 3LQQA 1E41A 2N80A 2F1SA 2M5VA 2LWDA 2DO9A 3T6PA 2YQFA 4M9XA 3EZQB 4D8OA 1DDFA 1D2ZB 2P1HA 4JQWA 4P4HA 1CY5A 2OF5A 2YU0A 2MPCA 4O6XA 4A2WA 1CWWA 2NZ7A 1A1WA 1Z6TA 4N1KA 4A2QA 2NSNA 1D2ZA 4EWIA 4IZ5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C15 A;  2B1W A;  2N97 A;  3MOP A;  3J63 A;  4IZA B;  4M9Z A;  3YGS C;  1N3K A;  4RHW E;  2YGS A;  3QF2 A;  4O7Q A;  2G7R A;  3MOP G;  2YVI A;  1PN5 A;  2L9M A;  2O71 A;  3LQR A;  2IB1 A;  2LWE A;  3J6J A;  2KN6 A;  2GF5 A;  4M9S A;  2MB9 A;  4F44 A;  2N83 A;  1A1Z A;  1YGO A;  4UZ0 A;  2DBF A;  3CRD A;  2N7Z A;  3KAT A;  2LS7 A;  2VGQ A;  2L6A A;  1ICH A;  1UCP A;  2DBD A;  4FH0 A;  4ZBW A;  1NGR A;  2BBZ A;  4I16 A;  4QOB A;  1FAD A;  1WXP A;  2A5Y B;  3EZQ A;  2A9I A;  2D96 A;  4LWD A;  4N1L A;  4O9L A;  2HM2 Q;  4RHW A;  2OF5 H;  1WH4 A;  2N1F A;  4DWN A;  1E3Y A;  1WMG A;  2NAQ A;  4N1J A;  4NQK A;  2BBR A;  2KM6 A;  4O9F A;  1DGN A;  4F42 A;  2MN4 A;  3MOP K;  4E9M A;  2MS8 A;  2DBH A;  4IZ7 B;  4JUP A;  2MS7 A;  3YGS P;  2N00 A;  4P4H I;  2DBG A;  3CL3 A;  3LQQ A;  1E41 A;  2N80 A;  2F1S A;  2M5V A;  2LWD A;  2DO9 A;  3T6P A;  2YQF A;  4M9X A;  3EZQ B;  4D8O A;  1DDF A;  1D2Z B;  2P1H A;  4JQW A;  4P4H A;  1CY5 A;  2OF5 A;  2YU0 A;  2MPC A;  4O6X A;  4A2W A;  1CWW A;  2NZ7 A;  1A1W A;  1Z6T A;  4N1K A;  4A2Q A;  2NSN A;  1D2Z A;  4EWI A;  4IZ5 E; 
#chains in the Genus database with same CATH topology
 1C15 A;  2B1W A;  2N97 A;  3MOP A;  3J63 A;  4IZA B;  4M9Z A;  3YGS C;  1N3K A;  4RHW E;  2YGS A;  3QF2 A;  4O7Q A;  2G7R A;  3MOP G;  2YVI A;  1PN5 A;  2L9M A;  2O71 A;  3LQR A;  2IB1 A;  2LWE A;  3J6J A;  2KN6 A;  2GF5 A;  4M9S A;  2MB9 A;  4F44 A;  2MJM A;  2N83 A;  1A1Z A;  1YGO A;  4UZ0 A;  2DBF A;  3CRD A;  2N7Z A;  3KAT A;  2LS7 A;  2VGQ A;  2L6A A;  1ICH A;  1UCP A;  2DBD A;  4FH0 A;  4ZBW A;  1NGR A;  2BBZ A;  4I16 A;  4QOB A;  1FAD A;  1WXP A;  2A5Y B;  3EZQ A;  2A9I A;  2D96 A;  4LWD A;  4N1L A;  4O9L A;  2HM2 Q;  4RHW A;  2OF5 H;  1WH4 A;  2N1F A;  4DWN A;  1E3Y A;  1WMG A;  2NAQ A;  4N1J A;  4NQK A;  2BBR A;  2KM6 A;  4O9F A;  1DGN A;  4F42 A;  2MN4 A;  3MOP K;  4E9M A;  2MS8 A;  2DBH A;  4IZ7 B;  4JUP A;  2MS7 A;  3YGS P;  2N00 A;  4P4H I;  2DBG A;  2XV9 A;  3CL3 A;  3LQQ A;  1E41 A;  2N80 A;  2F1S A;  2M5V A;  2LWD A;  2DO9 A;  3T6P A;  2YQF A;  4M9X A;  3EZQ B;  4D8O A;  1DDF A;  1D2Z B;  2P1H A;  4JQW A;  4P4H A;  1CY5 A;  2OF5 A;  2YU0 A;  2MPC A;  4O6X A;  4A2W A;  1CWW A;  2NZ7 A;  1A1W A;  1Z6T A;  4N1K A;  4A2Q A;  2NSN A;  1D2Z A;  4EWI A;  4IZ5 E; 
#chains in the Genus database with same CATH homology
 1C15 A;  2B1W A;  2N97 A;  3MOP A;  3J63 A;  4IZA B;  4M9Z A;  3YGS C;  1N3K A;  4RHW E;  2YGS A;  3QF2 A;  4O7Q A;  2G7R A;  3MOP G;  2YVI A;  1PN5 A;  2L9M A;  2O71 A;  3LQR A;  2IB1 A;  2LWE A;  3J6J A;  2KN6 A;  2GF5 A;  4M9S A;  2MB9 A;  4F44 A;  2MJM A;  2N83 A;  1A1Z A;  1YGO A;  4UZ0 A;  2DBF A;  3CRD A;  2N7Z A;  3KAT A;  2LS7 A;  2VGQ A;  2L6A A;  1ICH A;  1UCP A;  2DBD A;  4FH0 A;  4ZBW A;  1NGR A;  2BBZ A;  4I16 A;  4QOB A;  1FAD A;  1WXP A;  2A5Y B;  3EZQ A;  2A9I A;  2D96 A;  4LWD A;  4N1L A;  4O9L A;  2HM2 Q;  4RHW A;  2OF5 H;  1WH4 A;  2N1F A;  4DWN A;  1E3Y A;  1WMG A;  2NAQ A;  4N1J A;  4NQK A;  2BBR A;  2KM6 A;  4O9F A;  1DGN A;  4F42 A;  2MN4 A;  3MOP K;  4E9M A;  2MS8 A;  2DBH A;  4IZ7 B;  4JUP A;  2MS7 A;  3YGS P;  2N00 A;  4P4H I;  2DBG A;  2XV9 A;  3CL3 A;  3LQQ A;  1E41 A;  2N80 A;  2F1S A;  2M5V A;  2LWD A;  2DO9 A;  3T6P A;  2YQF A;  4M9X A;  3EZQ B;  4D8O A;  1DDF A;  1D2Z B;  2P1H A;  4JQW A;  4P4H A;  1CY5 A;  2OF5 A;  2YU0 A;  2MPC A;  4O6X A;  4A2W A;  1CWW A;  2NZ7 A;  1A1W A;  1Z6T A;  4N1K A;  4A2Q A;  2NSN A;  1D2Z A;  4EWI A;  4IZ5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...