3J6JA

3.6 angstrom resolution mavs filament generated from helical reconstruction
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
MAFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Imprinting as a Signal-Activation Mechanism of the Viral RNA Sensor RIG-I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Mitochondrial antiviral-signaling protein
total genus 38
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, G, I, L
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3j6jA00
4A2QA 1DDFA 1N3KA 2F1SA 3QF2A 4O9FA 4UZ0A 2DO9A 1A1ZA 2DBDA 2VGQA 2N7ZA 4A2WA 2MN4A 2MS8A 4LWDA 4ZBWA 2A9IA 4QOBA 3J6JA 2NSNA 4N1KA 1CY5A 2YVIA 2DBGA 2OF5A 4N1LA 4JQWA 3T6PA 1YGOA 4F42A 3MOPK 1WH4A 3CRDA 2M5VA 1Z6TA 3YGSP 2MPCA 1C15A 1FADA 3J63A 4DWNA 2LS7A 1E41A 2D96A 4RHWA 4FH0A 3LQQA 2MS7A 3MOPA 3LQRA 1D2ZA 2DBFA 2NZ7A 2YQFA 1A1WA 2N80A 3EZQB 4M9XA 2BBZA 2N00A 2N83A 3YGSC 2DBHA 2YGSA 2L6AA 2MB9A 4M9ZA 2G7RA 4E9MA 1PN5A 2OF5H 2HM2Q 2BBRA 4O9LA 2O71A 4JUPA 4I16A 4O6XA 2L9MA 2P1HA 4EWIA 2KN6A 2A5YB 1ICHA 3KATA 1CWWA 4IZ5E 2LWDA 4P4HA 4O7QA 4F44A 3MOPG 4N1JA 1E3YA 3CL3A 4IZ7B 1WXPA 2KM6A 4RHWE 4NQKA 4IZAB 4M9SA 4P4HI 1DGNA 1NGRA 2LWEA 2IB1A 4D8OA 3EZQA 2YU0A 2NAQA 2N1FA 1WMGA 1UCPA 2GF5A 2N97A 2B1WA 1D2ZB
chains in the Genus database with same CATH superfamily
4A2QA 1DDFA 1N3KA 2F1SA 3QF2A 4O9FA 4UZ0A 2DO9A 1A1ZA 2DBDA 2VGQA 2N7ZA 4A2WA 2MN4A 2MS8A 4LWDA 4ZBWA 2A9IA 4QOBA 3J6JA 2NSNA 4N1KA 1CY5A 2YVIA 2DBGA 2OF5A 4N1LA 4JQWA 3T6PA 1YGOA 4F42A 3MOPK 1WH4A 3CRDA 2M5VA 1Z6TA 3YGSP 2MPCA 1C15A 1FADA 3J63A 4DWNA 2LS7A 1E41A 2D96A 4RHWA 4FH0A 2XV9A 3LQQA 2MS7A 3MOPA 3LQRA 1D2ZA 2DBFA 2NZ7A 2YQFA 1A1WA 2N80A 3EZQB 4M9XA 2BBZA 2N00A 2N83A 3YGSC 2DBHA 2YGSA 2L6AA 2MB9A 4M9ZA 2G7RA 4E9MA 1PN5A 2OF5H 2HM2Q 2BBRA 4O9LA 2O71A 4JUPA 4I16A 4O6XA 2L9MA 2P1HA 4EWIA 2KN6A 2A5YB 1ICHA 3KATA 1CWWA 4IZ5E 2LWDA 4P4HA 4O7QA 4F44A 3MOPG 4N1JA 1E3YA 3CL3A 4IZ7B 1WXPA 2KM6A 4RHWE 4NQKA 4IZAB 4M9SA 4P4HI 2MJMA 1DGNA 1NGRA 2LWEA 2IB1A 4D8OA 3EZQA 2YU0A 2NAQA 2N1FA 1WMGA 1UCPA 2GF5A 2N97A 2B1WA 1D2ZB
chains in the Genus database with same CATH topology
4A2QA 1DDFA 1N3KA 2F1SA 3QF2A 4O9FA 4UZ0A 2DO9A 1A1ZA 2DBDA 2VGQA 2N7ZA 4A2WA 2MN4A 2MS8A 4LWDA 4ZBWA 2A9IA 4QOBA 3J6JA 2NSNA 4N1KA 1CY5A 2YVIA 2DBGA 2OF5A 4N1LA 4JQWA 3T6PA 1YGOA 4F42A 3MOPK 1WH4A 3CRDA 2M5VA 1Z6TA 3YGSP 2MPCA 1C15A 1FADA 3J63A 4DWNA 2LS7A 1E41A 2D96A 4RHWA 4FH0A 2XV9A 3LQQA 2MS7A 3MOPA 3LQRA 1D2ZA 2DBFA 2NZ7A 2YQFA 1A1WA 2N80A 3EZQB 4M9XA 2BBZA 2N00A 2N83A 3YGSC 2DBHA 2YGSA 2L6AA 2MB9A 4M9ZA 2G7RA 4E9MA 1PN5A 2OF5H 2HM2Q 2BBRA 4O9LA 2O71A 4JUPA 4I16A 4O6XA 2L9MA 2P1HA 4EWIA 2KN6A 2A5YB 1ICHA 3KATA 1CWWA 4IZ5E 2LWDA 4P4HA 4O7QA 4F44A 3MOPG 4N1JA 1E3YA 3CL3A 4IZ7B 1WXPA 2KM6A 4RHWE 4NQKA 4IZAB 4M9SA 4P4HI 2MJMA 1DGNA 1NGRA 2LWEA 2IB1A 4D8OA 3EZQA 2YU0A 2NAQA 2N1FA 1WMGA 1UCPA 2GF5A 2N97A 2B1WA 1D2ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Q A;  1DDF A;  1N3K A;  2F1S A;  3QF2 A;  4O9F A;  4UZ0 A;  2DO9 A;  1A1Z A;  2DBD A;  2VGQ A;  2N7Z A;  4A2W A;  2MN4 A;  2MS8 A;  4LWD A;  4ZBW A;  2A9I A;  4QOB A;  3J6J A;  2NSN A;  4N1K A;  1CY5 A;  2YVI A;  2DBG A;  2OF5 A;  4N1L A;  4JQW A;  3T6P A;  1YGO A;  4F42 A;  3MOP K;  1WH4 A;  3CRD A;  2M5V A;  1Z6T A;  3YGS P;  2MPC A;  1C15 A;  1FAD A;  3J63 A;  4DWN A;  2LS7 A;  1E41 A;  2D96 A;  4RHW A;  4FH0 A;  3LQQ A;  2MS7 A;  3MOP A;  3LQR A;  1D2Z A;  2DBF A;  2NZ7 A;  2YQF A;  1A1W A;  2N80 A;  3EZQ B;  4M9X A;  2BBZ A;  2N00 A;  2N83 A;  3YGS C;  2DBH A;  2YGS A;  2L6A A;  2MB9 A;  4M9Z A;  2G7R A;  4E9M A;  1PN5 A;  2OF5 H;  2HM2 Q;  2BBR A;  4O9L A;  2O71 A;  4JUP A;  4I16 A;  4O6X A;  2L9M A;  2P1H A;  4EWI A;  2KN6 A;  2A5Y B;  1ICH A;  3KAT A;  1CWW A;  4IZ5 E;  2LWD A;  4P4H A;  4O7Q A;  4F44 A;  3MOP G;  4N1J A;  1E3Y A;  3CL3 A;  4IZ7 B;  1WXP A;  2KM6 A;  4RHW E;  4NQK A;  4IZA B;  4M9S A;  4P4H I;  1DGN A;  1NGR A;  2LWE A;  2IB1 A;  4D8O A;  3EZQ A;  2YU0 A;  2NAQ A;  2N1F A;  1WMG A;  1UCP A;  2GF5 A;  2N97 A;  2B1W A;  1D2Z B; 
#chains in the Genus database with same CATH topology
 4A2Q A;  1DDF A;  1N3K A;  2F1S A;  3QF2 A;  4O9F A;  4UZ0 A;  2DO9 A;  1A1Z A;  2DBD A;  2VGQ A;  2N7Z A;  4A2W A;  2MN4 A;  2MS8 A;  4LWD A;  4ZBW A;  2A9I A;  4QOB A;  3J6J A;  2NSN A;  4N1K A;  1CY5 A;  2YVI A;  2DBG A;  2OF5 A;  4N1L A;  4JQW A;  3T6P A;  1YGO A;  4F42 A;  3MOP K;  1WH4 A;  3CRD A;  2M5V A;  1Z6T A;  3YGS P;  2MPC A;  1C15 A;  1FAD A;  3J63 A;  4DWN A;  2LS7 A;  1E41 A;  2D96 A;  4RHW A;  4FH0 A;  2XV9 A;  3LQQ A;  2MS7 A;  3MOP A;  3LQR A;  1D2Z A;  2DBF A;  2NZ7 A;  2YQF A;  1A1W A;  2N80 A;  3EZQ B;  4M9X A;  2BBZ A;  2N00 A;  2N83 A;  3YGS C;  2DBH A;  2YGS A;  2L6A A;  2MB9 A;  4M9Z A;  2G7R A;  4E9M A;  1PN5 A;  2OF5 H;  2HM2 Q;  2BBR A;  4O9L A;  2O71 A;  4JUP A;  4I16 A;  4O6X A;  2L9M A;  2P1H A;  4EWI A;  2KN6 A;  2A5Y B;  1ICH A;  3KAT A;  1CWW A;  4IZ5 E;  2LWD A;  4P4H A;  4O7Q A;  4F44 A;  3MOP G;  4N1J A;  1E3Y A;  3CL3 A;  4IZ7 B;  1WXP A;  2KM6 A;  4RHW E;  4NQK A;  4IZA B;  4M9S A;  4P4H I;  2MJM A;  1DGN A;  1NGR A;  2LWE A;  2IB1 A;  4D8O A;  3EZQ A;  2YU0 A;  2NAQ A;  2N1F A;  1WMG A;  1UCP A;  2GF5 A;  2N97 A;  2B1W A;  1D2Z B; 
#chains in the Genus database with same CATH homology
 4A2Q A;  1DDF A;  1N3K A;  2F1S A;  3QF2 A;  4O9F A;  4UZ0 A;  2DO9 A;  1A1Z A;  2DBD A;  2VGQ A;  2N7Z A;  4A2W A;  2MN4 A;  2MS8 A;  4LWD A;  4ZBW A;  2A9I A;  4QOB A;  3J6J A;  2NSN A;  4N1K A;  1CY5 A;  2YVI A;  2DBG A;  2OF5 A;  4N1L A;  4JQW A;  3T6P A;  1YGO A;  4F42 A;  3MOP K;  1WH4 A;  3CRD A;  2M5V A;  1Z6T A;  3YGS P;  2MPC A;  1C15 A;  1FAD A;  3J63 A;  4DWN A;  2LS7 A;  1E41 A;  2D96 A;  4RHW A;  4FH0 A;  2XV9 A;  3LQQ A;  2MS7 A;  3MOP A;  3LQR A;  1D2Z A;  2DBF A;  2NZ7 A;  2YQF A;  1A1W A;  2N80 A;  3EZQ B;  4M9X A;  2BBZ A;  2N00 A;  2N83 A;  3YGS C;  2DBH A;  2YGS A;  2L6A A;  2MB9 A;  4M9Z A;  2G7R A;  4E9M A;  1PN5 A;  2OF5 H;  2HM2 Q;  2BBR A;  4O9L A;  2O71 A;  4JUP A;  4I16 A;  4O6X A;  2L9M A;  2P1H A;  4EWI A;  2KN6 A;  2A5Y B;  1ICH A;  3KAT A;  1CWW A;  4IZ5 E;  2LWD A;  4P4H A;  4O7Q A;  4F44 A;  3MOP G;  4N1J A;  1E3Y A;  3CL3 A;  4IZ7 B;  1WXP A;  2KM6 A;  4RHW E;  4NQK A;  4IZA B;  4M9S A;  4P4H I;  2MJM A;  1DGN A;  1NGR A;  2LWE A;  2IB1 A;  4D8O A;  3EZQ A;  2YU0 A;  2NAQ A;  2N1F A;  1WMG A;  1UCP A;  2GF5 A;  2N97 A;  2B1W A;  1D2Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...