3J7AD

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
157
Chain Sequence
PISKKRKFINDGVFQAELNEFLARILAEDGYSGVEVRIRELTSLVQKRFFLCAMAQAESLRYKLLKGLAVRRACYGVLRHIMESGAKGCEVIVSGKLRAQRAKSMKFRDGYLISTGEPSKRFVNTATRSAQLKQGVLGIKVKIMLPTSILPDNISVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 36
structure length 157
sequence length 209
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j7aD01
4B3SC 4NXMC 4DR3C 4LF8C 4OX9C 4JI2C 4LFCC 2UXBC 4DUYC 4KHPC 4B3TC 4JI0C 4JI4C 4DR4C 4JI6C 4NXNC 4GKKC 2E5LC 4DV0C 1XNQC 3J7AD 2UUAC 4JI5C 4DR5C 1XMQC 4LF9C 1XNRC 4JYAC 4AQYC 4X66C 1HNZC 1IBLC 4LF4C 5A2QD 5LMNC 4X65C 4B3RC 4DV5C 1N32C 2UXDC 4JI8C 4DR1C 5BR8C 4DR7C 2UXCC 4LF5C 4DV3C 4JI1C 2UUCC 4DV1C 1N33C 2ZM6C 2HHHC 4JI3C 1N36C 1IBMC 1HR0C 4YHHC 4X62C 2UUBC 4JI7C 4LF7C 3T1YC 4BSZA 4LFAC 4DV2C 2VQEC 3J80D 4LF6C 4DV7C 3T1HC 2UU9C 1FJGC 4K0KC 5FLXD 4DV6C 4B3MC 4GKJC 1HNXC 4LFBC 4X64C 1IBKC 4YY3C 1N34C 4JV5C 5LMUC 1J5EC 3JAMD 4DV4C 5IT9D 5IWAC 3OTOC 2F4VC 1XMOC 3J81D 1I94C 4DUZC 4DR6C 4DR2C 2VQFC 1HNWC
chains in the Genus database with same CATH superfamily
4B3SC 4NXMC 4DR3C 4LF8C 4OX9C 4JI2C 4LFCC 2UXBC 4DUYC 4KHPC 4B3TC 4JI4C 4JI0C 4DR4C 4JI6C 4NXNC 4GKKC 2E5LC 4DV0C 1XNQC 3J7AD 2UUAC 4JI5C 4DR5C 1XMQC 4LF9C 1XNRC 4JYAC 4AQYC 4X66C 1HNZC 1IBLC 3FM7A 4LF4C 5A2QD 5LMNC 4X65C 4B3RC 4DV5C 1N32C 2UXDC 4JI8C 4DR1C 5BR8C 4DR7C 2UXCC 4LF5C 4DV3C 4JI1C 1YGTA 2UUCC 4DV1C 1N33C 2ZM6C 2HHHC 4JI3C 1N36C 1IBMC 1HR0C 4YHHC 4X62C 2UUBC 4JI7C 4LF7C 3T1YC 4BSZA 4LFAC 4DV2C 2VQEC 3J80D 4LF6C 2PG1E 2ZTBA 4DV7C 3T1HC 2UU9C 1FJGC 1XDXA 4K0KC 5FLXD 4DV6C 4B3MC 4GKJC 1HNXC 4LFBC 4X64C 1IBKC 4YY3C 1N34C 4JV5C 5LMUC 1J5EC 3JAMD 4DV4C 5IT9D 5IWAC 3OTOC 2F4VC 1XMOC 3J81D 1I94C 4DUZC 4DR6C 4DR2C 2VQFC 1HNWC
chains in the Genus database with same CATH topology
4B3SC 4NXMC 4DR3C 4LF8C 4OX9C 4JI2C 4LFCC 2UXBC 4DUYC 4KHPC 4B3TC 4JI0C 4JI4C 4DR4C 4JI6C 4NXNC 4GKKC 2E5LC 4DV0C 1XNQC 3J7AD 2UUAC 4JI5C 4DR5C 1XMQC 4LF9C 1XNRC 4JYAC 4AQYC 4X66C 1HNZC 1IBLC 4LF4C 5A2QD 5LMNC 4X65C 4B3RC 4DV5C 1N32C 2UXDC 4JI8C 4DR1C 5BR8C 4DR7C 2UXCC 4LF5C 4DV3C 4JI1C 2UUCC 4DV1C 1N33C 2ZM6C 2HHHC 4JI3C 1N36C 1IBMC 1HR0C 4YHHC 4X62C 2UUBC 4JI7C 4LF7C 3T1YC 4BSZA 4LFAC 4DV2C 2VQEC 3J80D 4LF6C 4DV7C 3T1HC 2UU9C 1FJGC 4K0KC 5FLXD 4DV6C 4B3MC 4GKJC 1HNXC 4LFBC 4X64C 1IBKC 4YY3C 1N34C 4JV5C 5LMUC 1J5EC 3JAMD 4DV4C 5IT9D 5IWAC 3OTOC 2F4VC 1XMOC 3J81D 1I94C 4DUZC 4DR6C 4DR2C 2VQFC 1HNWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S C;  4NXM C;  4DR3 C;  4LF8 C;  4OX9 C;  4JI2 C;  4LFC C;  2UXB C;  4DUY C;  4KHP C;  4B3T C;  4JI0 C;  4JI4 C;  4DR4 C;  4JI6 C;  4NXN C;  4GKK C;  2E5L C;  4DV0 C;  1XNQ C;  3J7A D;  2UUA C;  4JI5 C;  4DR5 C;  1XMQ C;  4LF9 C;  1XNR C;  4JYA C;  4AQY C;  4X66 C;  1HNZ C;  1IBL C;  4LF4 C;  5A2Q D;  5LMN C;  4X65 C;  4B3R C;  4DV5 C;  1N32 C;  2UXD C;  4JI8 C;  4DR1 C;  5BR8 C;  4DR7 C;  2UXC C;  4LF5 C;  4DV3 C;  4JI1 C;  2UUC C;  4DV1 C;  1N33 C;  2ZM6 C;  2HHH C;  4JI3 C;  1N36 C;  1IBM C;  1HR0 C;  4YHH C;  4X62 C;  2UUB C;  4JI7 C;  4LF7 C;  3T1Y C;  4BSZ A;  4LFA C;  4DV2 C;  2VQE C;  3J80 D;  4LF6 C;  4DV7 C;  3T1H C;  2UU9 C;  1FJG C;  4K0K C;  5FLX D;  4DV6 C;  4B3M C;  4GKJ C;  1HNX C;  4LFB C;  4X64 C;  1IBK C;  4YY3 C;  1N34 C;  4JV5 C;  5LMU C;  1J5E C;  3JAM D;  4DV4 C;  5IT9 D;  5IWA C;  3OTO C;  2F4V C;  1XMO C;  3J81 D;  1I94 C;  4DUZ C;  4DR6 C;  4DR2 C;  2VQF C;  1HNW C; 
#chains in the Genus database with same CATH topology
 4B3S C;  4NXM C;  4DR3 C;  4LF8 C;  4OX9 C;  4JI2 C;  4LFC C;  2UXB C;  4DUY C;  4KHP C;  4B3T C;  4JI4 C;  4JI0 C;  4DR4 C;  4JI6 C;  4NXN C;  4GKK C;  2E5L C;  4DV0 C;  1XNQ C;  3J7A D;  2UUA C;  4JI5 C;  4DR5 C;  1XMQ C;  4LF9 C;  1XNR C;  4JYA C;  4AQY C;  4X66 C;  1HNZ C;  1IBL C;  3FM7 A;  4LF4 C;  5A2Q D;  5LMN C;  4X65 C;  4B3R C;  4DV5 C;  1N32 C;  2UXD C;  4JI8 C;  4DR1 C;  5BR8 C;  4DR7 C;  2UXC C;  4LF5 C;  4DV3 C;  4JI1 C;  1YGT A;  2UUC C;  4DV1 C;  1N33 C;  2ZM6 C;  2HHH C;  4JI3 C;  1N36 C;  1IBM C;  1HR0 C;  4YHH C;  4X62 C;  2UUB C;  4JI7 C;  4LF7 C;  3T1Y C;  4BSZ A;  4LFA C;  4DV2 C;  2VQE C;  3J80 D;  4LF6 C;  2PG1 E;  2ZTB A;  4DV7 C;  3T1H C;  2UU9 C;  1FJG C;  1XDX A;  4K0K C;  5FLX D;  4DV6 C;  4B3M C;  4GKJ C;  1HNX C;  4LFB C;  4X64 C;  1IBK C;  4YY3 C;  1N34 C;  4JV5 C;  5LMU C;  1J5E C;  3JAM D;  4DV4 C;  5IT9 D;  5IWA C;  3OTO C;  2F4V C;  1XMO C;  3J81 D;  1I94 C;  4DUZ C;  4DR6 C;  4DR2 C;  2VQF C;  1HNW C; 
#chains in the Genus database with same CATH homology
 4B3S C;  4NXM C;  4DR3 C;  4LF8 C;  4OX9 C;  4JI2 C;  4LFC C;  2UXB C;  4DUY C;  4KHP C;  4B3T C;  4JI0 C;  4JI4 C;  4DR4 C;  4JI6 C;  4NXN C;  4GKK C;  2E5L C;  4DV0 C;  1XNQ C;  3J7A D;  2UUA C;  4JI5 C;  4DR5 C;  1XMQ C;  4LF9 C;  1XNR C;  4JYA C;  4AQY C;  4X66 C;  1HNZ C;  1IBL C;  4LF4 C;  5A2Q D;  5LMN C;  4X65 C;  4B3R C;  4DV5 C;  1N32 C;  2UXD C;  4JI8 C;  4DR1 C;  5BR8 C;  4DR7 C;  2UXC C;  4LF5 C;  4DV3 C;  4JI1 C;  2UUC C;  4DV1 C;  1N33 C;  2ZM6 C;  2HHH C;  4JI3 C;  1N36 C;  1IBM C;  1HR0 C;  4YHH C;  4X62 C;  2UUB C;  4JI7 C;  4LF7 C;  3T1Y C;  4BSZ A;  4LFA C;  4DV2 C;  2VQE C;  3J80 D;  4LF6 C;  4DV7 C;  3T1H C;  2UU9 C;  1FJG C;  4K0K C;  5FLX D;  4DV6 C;  4B3M C;  4GKJ C;  1HNX C;  4LFB C;  4X64 C;  1IBK C;  4YY3 C;  1N34 C;  4JV5 C;  5LMU C;  1J5E C;  3JAM D;  4DV4 C;  5IT9 D;  5IWA C;  3OTO C;  2F4V C;  1XMO C;  3J81 D;  1I94 C;  4DUZ C;  4DR6 C;  4DR2 C;  2VQF C;  1HNW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...