3J7AD

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
157
Chain Sequence
PISKKRKFINDGVFQAELNEFLARILAEDGYSGVEVRIRELTSLVQKRFFLCAMAQAESLRYKLLKGLAVRRACYGVLRHIMESGAKGCEVIVSGKLRAQRAKSMKFRDGYLISTGEPSKRFVNTATRSAQLKQGVLGIKVKIMLPTSILPDNISVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 36
structure length 157
sequence length 209
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3j7aD01
4LF8C 2HHHC 1HNWC 4DR2C 1I94C 4NXNC 1XMQC 4DV2C 4JI0C 4DR4C 4NXMC 2UUBC 4JI1C 1HNXC 1N33C 4JI6C 4LFBC 5LMNC 3J7AD 4DV3C 4X66C 3JAMD 4LF6C 4DV4C 5LMUC 4DR7C 3T1YC 3T1HC 4LF5C 2F4VC 4JYAC 2ZM6C 4JI3C 4DV6C 4DUYC 1N34C 1IBMC 1N36C 4JI5C 4KHPC 4DUZC 5IWAC 4AQYC 4DV7C 4B3SC 4JI7C 4JI2C 5IT9D 4B3MC 4LF4C 1HR0C 4X64C 2UU9C 1XMOC 1IBKC 4YY3C 5A2QD 1N32C 2VQEC 4GKJC 4DV5C 4DR3C 4LF7C 1J5EC 4B3RC 4YHHC 1FJGC 2UXBC 4OX9C 4BSZA 4K0KC 4LFCC 4JI4C 2UUCC 1IBLC 4DV0C 4GKKC 2UXCC 4JV5C 4DR6C 3OTOC 4LF9C 1XNRC 4DR5C 2UXDC 4DR1C 4JI8C 5FLXD 2E5LC 4B3TC 3J80D 1XNQC 4DV1C 2VQFC 2UUAC 3J81D 4X65C 1HNZC 4LFAC 4X62C 5BR8C
chains in the Genus database with same CATH superfamily
4LF8C 2HHHC 1HNWC 4DR2C 1I94C 4NXNC 1XMQC 4DV2C 4JI0C 4DR4C 4NXMC 2UUBC 4JI1C 1HNXC 1N33C 4JI6C 4LFBC 5LMNC 3J7AD 4DV3C 4X66C 3JAMD 4LF6C 4DV4C 5LMUC 4DR7C 3T1YC 3T1HC 4LF5C 3FM7A 2F4VC 4JYAC 2ZM6C 4JI3C 2ZTBA 4DV6C 4DUYC 1N34C 1IBMC 1N36C 4JI5C 4KHPC 4DUZC 1XDXA 5IWAC 4AQYC 4DV7C 4B3SC 4JI7C 4JI2C 5IT9D 4B3MC 4LF4C 1HR0C 4X64C 2UU9C 1XMOC 1IBKC 4YY3C 5A2QD 1N32C 2VQEC 4GKJC 4DV5C 4DR3C 4LF7C 1YGTA 1J5EC 4B3RC 4YHHC 1FJGC 2UXBC 4OX9C 4BSZA 2PG1E 4K0KC 4LFCC 4JI4C 2UUCC 1IBLC 4DV0C 4GKKC 2UXCC 4JV5C 4DR6C 3OTOC 4LF9C 1XNRC 4DR5C 2UXDC 4DR1C 4JI8C 5FLXD 2E5LC 4B3TC 3J80D 1XNQC 4DV1C 2VQFC 2UUAC 3J81D 4X65C 1HNZC 4LFAC 4X62C 5BR8C
chains in the Genus database with same CATH topology
4LF8C 2HHHC 1HNWC 4DR2C 1I94C 4NXNC 1XMQC 4DV2C 4JI0C 4DR4C 4NXMC 2UUBC 4JI1C 1HNXC 1N33C 4JI6C 4LFBC 5LMNC 3J7AD 4DV3C 4X66C 3JAMD 4LF6C 4DV4C 5LMUC 4DR7C 3T1YC 3T1HC 4LF5C 2F4VC 4JYAC 2ZM6C 4JI3C 4DV6C 4DUYC 1N34C 1IBMC 1N36C 4JI5C 4KHPC 4DUZC 5IWAC 4AQYC 4DV7C 4B3SC 4JI7C 4JI2C 5IT9D 4B3MC 4LF4C 1HR0C 4X64C 2UU9C 1XMOC 1IBKC 4YY3C 5A2QD 1N32C 2VQEC 4GKJC 4DV5C 4DR3C 4LF7C 1J5EC 4B3RC 4YHHC 1FJGC 2UXBC 4OX9C 4BSZA 4K0KC 4LFCC 4JI4C 2UUCC 1IBLC 4DV0C 4GKKC 2UXCC 4JV5C 4DR6C 3OTOC 4LF9C 1XNRC 4DR5C 2UXDC 4DR1C 4JI8C 5FLXD 2E5LC 4B3TC 3J80D 1XNQC 4DV1C 2VQFC 2UUAC 3J81D 4X65C 1HNZC 4LFAC 4X62C 5BR8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 C;  2HHH C;  1HNW C;  4DR2 C;  1I94 C;  4NXN C;  1XMQ C;  4DV2 C;  4JI0 C;  4DR4 C;  4NXM C;  2UUB C;  4JI1 C;  1HNX C;  1N33 C;  4JI6 C;  4LFB C;  5LMN C;  3J7A D;  4DV3 C;  4X66 C;  3JAM D;  4LF6 C;  4DV4 C;  5LMU C;  4DR7 C;  3T1Y C;  3T1H C;  4LF5 C;  2F4V C;  4JYA C;  2ZM6 C;  4JI3 C;  4DV6 C;  4DUY C;  1N34 C;  1IBM C;  1N36 C;  4JI5 C;  4KHP C;  4DUZ C;  5IWA C;  4AQY C;  4DV7 C;  4B3S C;  4JI7 C;  4JI2 C;  5IT9 D;  4B3M C;  4LF4 C;  1HR0 C;  4X64 C;  2UU9 C;  1XMO C;  1IBK C;  4YY3 C;  5A2Q D;  1N32 C;  2VQE C;  4GKJ C;  4DV5 C;  4DR3 C;  4LF7 C;  1J5E C;  4B3R C;  4YHH C;  1FJG C;  2UXB C;  4OX9 C;  4BSZ A;  4K0K C;  4LFC C;  4JI4 C;  2UUC C;  1IBL C;  4DV0 C;  4GKK C;  2UXC C;  4JV5 C;  4DR6 C;  3OTO C;  4LF9 C;  1XNR C;  4DR5 C;  2UXD C;  4DR1 C;  4JI8 C;  5FLX D;  2E5L C;  4B3T C;  3J80 D;  1XNQ C;  4DV1 C;  2VQF C;  2UUA C;  3J81 D;  4X65 C;  1HNZ C;  4LFA C;  4X62 C;  5BR8 C; 
#chains in the Genus database with same CATH topology
 4LF8 C;  2HHH C;  1HNW C;  4DR2 C;  1I94 C;  4NXN C;  1XMQ C;  4DV2 C;  4JI0 C;  4DR4 C;  4NXM C;  2UUB C;  4JI1 C;  1HNX C;  1N33 C;  4JI6 C;  4LFB C;  5LMN C;  3J7A D;  4DV3 C;  4X66 C;  3JAM D;  4LF6 C;  4DV4 C;  5LMU C;  4DR7 C;  3T1Y C;  3T1H C;  4LF5 C;  3FM7 A;  2F4V C;  4JYA C;  2ZM6 C;  4JI3 C;  2ZTB A;  4DV6 C;  4DUY C;  1N34 C;  1IBM C;  1N36 C;  4JI5 C;  4KHP C;  4DUZ C;  1XDX A;  5IWA C;  4AQY C;  4DV7 C;  4B3S C;  4JI7 C;  4JI2 C;  5IT9 D;  4B3M C;  4LF4 C;  1HR0 C;  4X64 C;  2UU9 C;  1XMO C;  1IBK C;  4YY3 C;  5A2Q D;  1N32 C;  2VQE C;  4GKJ C;  4DV5 C;  4DR3 C;  4LF7 C;  1YGT A;  1J5E C;  4B3R C;  4YHH C;  1FJG C;  2UXB C;  4OX9 C;  4BSZ A;  2PG1 E;  4K0K C;  4LFC C;  4JI4 C;  2UUC C;  1IBL C;  4DV0 C;  4GKK C;  2UXC C;  4JV5 C;  4DR6 C;  3OTO C;  4LF9 C;  1XNR C;  4DR5 C;  2UXD C;  4DR1 C;  4JI8 C;  5FLX D;  2E5L C;  4B3T C;  3J80 D;  1XNQ C;  4DV1 C;  2VQF C;  2UUA C;  3J81 D;  4X65 C;  1HNZ C;  4LFA C;  4X62 C;  5BR8 C; 
#chains in the Genus database with same CATH homology
 4LF8 C;  2HHH C;  1HNW C;  4DR2 C;  1I94 C;  4NXN C;  1XMQ C;  4DV2 C;  4JI0 C;  4DR4 C;  4NXM C;  2UUB C;  4JI1 C;  1HNX C;  1N33 C;  4JI6 C;  4LFB C;  5LMN C;  3J7A D;  4DV3 C;  4X66 C;  3JAM D;  4LF6 C;  4DV4 C;  5LMU C;  4DR7 C;  3T1Y C;  3T1H C;  4LF5 C;  2F4V C;  4JYA C;  2ZM6 C;  4JI3 C;  4DV6 C;  4DUY C;  1N34 C;  1IBM C;  1N36 C;  4JI5 C;  4KHP C;  4DUZ C;  5IWA C;  4AQY C;  4DV7 C;  4B3S C;  4JI7 C;  4JI2 C;  5IT9 D;  4B3M C;  4LF4 C;  1HR0 C;  4X64 C;  2UU9 C;  1XMO C;  1IBK C;  4YY3 C;  5A2Q D;  1N32 C;  2VQE C;  4GKJ C;  4DV5 C;  4DR3 C;  4LF7 C;  1J5E C;  4B3R C;  4YHH C;  1FJG C;  2UXB C;  4OX9 C;  4BSZ A;  4K0K C;  4LFC C;  4JI4 C;  2UUC C;  1IBL C;  4DV0 C;  4GKK C;  2UXC C;  4JV5 C;  4DR6 C;  3OTO C;  4LF9 C;  1XNR C;  4DR5 C;  2UXD C;  4DR1 C;  4JI8 C;  5FLX D;  2E5L C;  4B3T C;  3J80 D;  1XNQ C;  4DV1 C;  2VQF C;  2UUA C;  3J81 D;  4X65 C;  1HNZ C;  4LFA C;  4X62 C;  5BR8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...