3J7AN

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
IALTSKNLRAIEKVCSDIMKGAKEKNLNVSGPVRLPVKTLRITTRKSPCGEGTNTWDRFELRIYKRLIDLYSQCEVVTQMTSINIDPVVEVEVIITDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3j7aN00
4DV7J 4DUYJ 4X64J 2VQFJ 2UUCJ 3R2CJ 4B3RJ 5LMNJ 4NEYA 4DR4J 5LMUJ 3W1YC 3D3CJ 4JI3J 4RJVA 2UXDJ 4KY3A 2VQEJ 3R2DJ 4JI4J 2UUAJ 1N32J 4DR3J 4NEZA 4JI7J 4B3TJ 5A2QU 4LFBJ 4GKJJ 4PWWA 2KVQE 5AJ3J 1HNZJ 4KHPJ 4LF4J 4JI0J 4HHUA 4DR2J 4LF8J 3J81U 1IBKJ 2UU9J 4LF6J 4JI2J 4AQYJ 4X65J 2E5LJ 4LFCJ 1XMOJ 1XMQJ 5IT9U 5FLXU 4JV5J 4YY3J 4GKKJ 2UXCJ 4B3SJ 2UXBJ 4X62J 5LM7E 2F4VJ 4JI8J 4V1Ak 1IBMJ 3T1HJ 4DV4J 1J5EJ 1FJGJ 4LFAJ 4YHHJ 4DR5J 1N34J 3JAMU 4DV2J 4JI5J 4JI1J 2HHHJ 4LF5J 2MTLA 2KL8A 4KYZA 4JI6J 4DR1J 4DV0J 4NXNJ 4DR6J 1N36J 1XNRJ 4DR7J 1IBLJ 4DUZJ 5BR8J 3J80U 3T1YJ 3IMQJ 4DV1J 4DV6J 2UUBJ 4X66J 1N33J 2MEWA 4LF7J 4NXMJ 3D3BJ 1I94J 1HNXJ 3J7AN 4OX9J 4K0KJ 2MQ8A 3OTOJ 4LF9J 1HR0J 1XNQJ 4B3MJ 1HNWJ 4JYAJ 5IWAJ 4DV3J 4DV5J 2ZM6J
chains in the Genus database with same CATH superfamily
1T03B 9RUBA 4EBCA 1ROFA 2WONB 2XMWA 1P1LA 1BQNB 3CE8A 3OV7A 1WJ9A 1PGZA 3BDPA 3R2CJ 2FLPA 2HBRB 4IRKA 3EDRB 2L48A 1IWGA 2ASDA 3G82A 3G82B 5LMNJ 4NEYA 5DGAA 2QRRA 3CWJA 1S9GA 3OTDA 4OX8A 2CPFA 1N5SA 3GU0A 4F67A 2IRUA 1S0NA 3HO1A 1OS5A 3ENAA 2B56A 3EUNA 3A4TA 1OY8A 2E44A 2G1DA 3HT0A 3OR2A 3S7RA 1EAYC 1AT1B 2CDRB 2E5JA 2MZJA 3DLGB 4MK8A 3MURP 2XO7A 1H2TZ 3QT8A 1X9MA 3FBBA 2Q3PA 4ZLPA 4HTIA 1OIAA 1VQSA 2OLWA 3RBZA 3DOMB 3NGTA 5E3RA 4WFYA 4X4RA 4MK7A 4KR0B 1S49A 4DV3F 3NWRA 3C14B 4DV2F 3M2UB 1V5IB 3RBEA 3HULA 1JMTA 3HLUA 2CPIA 3IBFB 4F4XA 1RT4B 4LFBF 4M5KA 4NI2B 3A8JA 4P2MA 4J9QA 3G4SS 1VI7A 1JLGA 2BQUA 3PO5A 3OUYB 3OL9A 3SDEB 1YSJA 4Q44A 4DZ6A 3V6HA 2BZ2A 2MJNA 4F26A 2DPIA 4I69A 3UDVA 3DFEA 3CJKA 2HNYB 2HQGA 2VPYB 1NB2A 1EARA 2DRDA 3QAUA 5J1EA 2HRUA 1S9EB 2UV8A 1PC5A 5F0WA 2DK2A 1RA7A 4X4UA 4GC6A 3EMTA 4ZCLA 2MKJA 4ED6A 4DU8A 1Q79A 3T5LA 1KKHA 2FTRA 3MM9B 2FUG9 2GHWA 2V9WA 2MHNA 2RU9A 3HHNB 3RW7A 1U2CA 2ILZA 2GO9A 1VLOA 3KNGA 5B09A 3D6HB 4X4PA 3IN5A 1Q8KA 3LANA 4ZIWA 2JVOA 2YKNB 4ECVA 3O3LA 3KLHA 2ZH7A 4RW8A 1WF2A 1BY9A 1SUQA 1UEUA 2PO4A 4G1PA 3IA0A 2XGPA 2QE5A 4DV4J 2HW3A 1N6QB 4HACB 4X4SA 4YHHJ 2DO4A 4WTYA 3MCSA 2MKSA 4P2XA 4DV2J 1B99A 1RT6A 1RHRB 4M5GA 3ZZUA 4YOEA 1O51A 3PX0A 5I3UA 2MTLA 2P9GA 3CD5A 3VVUA 1IM4A 1F9EB 2AYMA 3D54A 2WVBA 4OI2A 4NLDA 1F6TA 3AD8C 2ROPA 3NS6A 4U95A 1HBUB 3MUTP 3PO4A 1HYSA 3M8RA 3US5A 1ULRA 2FVCA 3IR6B 4LBPA 1F5AA 1RWMB 4DR6J 3MM6B 1RTIA 3Q0AA 2XMAA 1HHQA 3GYNA 1T0TV 2LFVA 1NJXA 3CJ4A 5F9LA 2O3DA 1TKXB 3J80U 4YEAA 1FVQA 5C2GA 2KH9A 1AZSA 4MK9A 2PFFB 3LP1A 4IR1A 1DLOB 1R0AB 1R6VA 3POTB 2UUBJ 3FMWA 2E1AA 5F0UA 2CNNB 4N41A 1DFDA 2M70A 3FZBA 5C24B 2I2YA 2C3OA 2ZWOA 4CLLA 1RCXB 2MZTA 2MQ8A 1WEZA 3GIRA 2KB2A 3DKDA 3DLJA 4UOHA 3DNCA 3R97A 4EK2A 5G0RB 3R5GA 3W9JA 4A8OA 1F9FA 1ZM9A 5C25B 1NK6A 1RTIB 3AFGA 5IWAJ 1D9AA 3G6YA 4QPXA 1FJEB 2WSCC 5B0BA 2BE9B 2BM0A 1U1OA 3PW4A 2QL5B 4PPZA 1DTTA 4QWAA 1PJ6A 1UW9A 5CQGA 2B7CB 3AXKA 4TLQA 5D0RA 4GC7A 3NCRA 3JQKA 1Y3KA 2DGQA 2GIFA 5KFYA 3OL6A 2VFUA 2RUSA 3MEDA 1BMQB 3LALA 2PA3A 2KZZA 3WBZA 2W1BA 1BQMA 3ENWA 4KO0A 2GJFA 4M5NA 5AXLA 2XI2A 3W9HA 1MN7A 3MOZA 1NM2A 1VR6A 1X8DA 2BANA 4AL6A 2AGPA 3SFUA 1X5PA 3KFWX 1K8AT 3D3CJ 2VPXB 4NA2A 4WE1A 4ZVRB 3OSPA 3MMJA 1NK7A 5A0YB 3VAMA 1HHTP 1HYSB 2R8HA 3EZ5A 3AJDA 4JV0A 3PIPQ 3W63A 1RKJA 1NJYA 5KOWA 2B8PA 3IS9A 3H98A 4KIAA 1SUQB 4JI4J 1AROP 1R27B 3GMGA 3ZTPA 2BMBA 2DY1A 2NYIA 2RKIB 2DR9A 2VB6A 2XYPB 5DQIA 1Z4UA 2F63A 2HIYA 2WVEA 2YKQA 4DV0F 3AQOA 4ELVA 1FE4A 2ACMA 2YKOA 2OUGA 3P3DA 4MIBA 4NLPA 3PACA 1B7YB 4B02A 4DMZA 1CJUA 3DDNA 1IBKF 4RBVA 3RR8A 4GKJJ 5BR8F 4PWWA 2QX0A 4JOUA 2KJWA 2EG1A 3IFEA 4OJHA 3KK1B 3K5MA 4KHPJ 1ZA1B 3G87A 2L41A 2B4PA 4S0MA 1TMMA 4NZ7A 5E33A 5ADZA 2W2NP 4DR6F 2BDPA 3H20A 2HNYA 3PY8A 3C46A 4KBIA 2QV6A 3RZAA 5LJ5Y 3R8YA 3VHQA 1FRIA 1EB0A 1UJ4A 3A3PB 5A6WA 2B51A 4HYKA 2RVJA 2GMJA 2CPHA 4ZDNA 4X65J 2RU3A 4ILRA 2HFOA 2QL7B 2CQBA 5MAOA 1WC6A 4LFCJ 1JLFB 1DBDA 1YBUA 4FKYA 3VZIA 3D2WA 2W2QP 1RT2A 4MH8A 2JFDA 2YQ3A 4QR2A 3OXLA 3BS9A 4D3HA 5H9EK 2E9ZA 5BXIA 5D8HB 3MR3A 4USWA 2DH7A 2V94A 5D4PA 1YJ9S 1IKVB 3CDBA 3B6BA 4RPFA 3WDOA 3QFWA 2OH2A 5I4MA 4X2BA 2W8KA 2ABYA 5AXMA 2KVIA 4WIIA 1X9WA 2DNKA 1RABB 5KFXA 3G86A 5E3QA 2KO1A 3M05A 2FC8A 4KRWA 4EU0A 4DCOB 4YR2A 1OYDA 3EXCX 4J5OA 3SV4A 4RWWA 2C3MA 1I5OB 5JXSA 3DMJA 5GAEI 4ZJQA 4DG1A 1S1VB 5HMZA 3TJAA 3R5DA 2RDDA 4M5LA 4YMEA 1BWEA 4G1QB 2HHQA 1JJ2R 2XCPA 2DGVA 2XNRA 2ZD1B 3H2VE 5KT6A 2VPWB 1H6KX 3MCOA 2YNHB 4MYUA 4TU9A 3PRBA 2VBWA 4K4TA 3G71S 4NPOA 2QA1A 5I3PA 4FYDA 1KD1T 3DRXA 2OPPB 2Z4PA 4C8ZA 3IMQJ 1JJHA 2K7KA 4C3MA 5H9EJ 5RUBA 2CQ1A 3PIOQ 3LO3A 2OTJS 5IT9Y 3AA9A 2VA3A 3KLGA 4LRBA 4LSLA 2XZTB 2R9LA 3TYTA 5L1JA 1C4AA 1EETA 3LWMA 4R8UB 2B4VA 1C0UA 2SXLA 1C0UB 2YWKA 4CNYA 2CQ2A 1U24A 1XK8A 2B9EA 3KHLA 3J81j 1YJNS 4LF7F 1UWBA 3J80Y 1MWYA 1O6XA 4M5MA 4ED0A 4LF9J 1KVJA 1YIJS 1U1PA 4ILMA 2WW8A 1ZZNA 1FHTA 1HNWJ 2CRLA 1UEKA 5L46A 3I9ZA 4WFBQ 2H65B 2IM0A 2CPDA 2K1RA 1B0TA 4G6VB 2V4JA 3H0PA 3NAIA 4H4OB 4KAIA 4MFBA 4A8XA 2JNJA 3VQSA 4DR1F 2NR0A 1Y5LB 2JRSA 2K2PA 3DRYA 3HSGA 4K50A 3MCMA 1FX2A 1D3WA 2BRKA 5HMWA 1AFIA 4FYWB 3MOJB 2D3OR 2QA4G 2HGMA 2RS2A 1VBYA 3IRXB 2FJVA 1R89A 3J7Z5 3CD7A 1VQ7S 3BQ0A 4IH5A 4ECYA 4Y6IA 3T3FA 2R8GA 2J7WA 3VAHA 3R3TA 5LMUJ 5AE1A 2D69A 4XK8C 3KTQA 4XDDA 1XN9A 2XS5A 4KGMA 1P6TA 2NXNA 4NYZA 4OZ1A 3CJQA 1NK8A 3MM8B 2VBZA 1K9MT 1PIEA 3BM7A 4IQMA 3DM2A 2EW9A 2NXEA 3CULA 1VBKA 2P8IA 4RZRA 4RUBA 5CAAA 4U7CA 3PHTA 3CUNA 4YB7A 2ZITA 3PCOB 4ZPVR 2VODA 4JV5F 1BQXA 3ZZPA 2OMLA 2G2ZA 1JJCB 3M2VA 4IOBA 2MGZA 5DQGA 2P9EA 1M5PC 1H38A 5CZXA 1RWNB 2IYGA 3D68A 4ZA1A 4P73A 1B70B 2EFVA 3QFHA 3OLAA 4C8NA 2ZOMA 4FN5A 4YB5A 5G0RA 4FBTA 1KNZA 4L6V3 2IM1A 4USIA 4UOCA 2IJNA 2HHHF 2IIHA 2UVUA 1RT1B 1IJFB 2YKPA 3K59A 2O01C 2CQPA 4O3PA 4JI0J 4LVNP 3Q89A 2D1CA 3OXFA 3ENQA 3EVMA 2FHMA 4UZCA 3JYTB 3AODA 4EMDA 5HQLA 4CO1A 2GVDB 4DX7A 1U0HB 3QZ8A 3H4BA 4E8UA 2B0GA 3CSKA 3LPYA 5IV3A 4PXCA 3DXSX 1SJFA 2GFFA 3MR6A 1WOOA 4OJ1A 2G1HA 5IT9U 3GG1A 3H5SA 3FEZA 2RMLA 3T5JA 3QGIA 3WX8A 2QN6B 5J2QB 1Q16B 3WZ0A 4DOZA 1OMSA 3SYZA 3IS9B 1TKZA 3LP2A 3MR2A 1F5BA 1Q5VA 1YJWS 3D7SB 1S7IA 2LXIA 4DWIA 4Z7CA 5HK4A 2GVZA 1DZ5A 1HWIA 2H48B 1LK7A 4I6AA 1UVMA 1GTHA 2EFPA 2UZAA 3H90A 4AD6A 2MSSA 1CJTB 3MEDB 4QZVB 2CQGA 4F4ZA 2IMWP 2N3OA 2ADCA 3LW5C 2VBXA 2F8HA 1MW7A 1WDDA 3BYPA 3I96A 2ACYA 1HBNB 4G65A 3RB6A 2DNOA 4Y2IA 4CQ1A 4ZHRB 4I4BA 1FESA 5KFPA 4OX7A 3TI0A 1RYRA 2AYGA 1CJVA 4OI6A 2QFIA 1B64A 2Q6BA 1H0HB 5KT5A 1NO8A 1RQ0A 2AW0A 2OEJA 1VRUB 2DJWA 1NRKA 2XSJA 2XSFA 2BJ1A 3L7OA 4DPXA 4G1IA 2CPZA 2R7WA 1FA0A 3PEJA 1RHMB 3NCPA 2AZ3A 4RL1A 4ZCKA 3TAMB 2BW7A 2YKMA 1S6QA 3DGVA 2KRBA 4QYRA 4JI3F 2HPUA 1WC3A 4DV6J 1WTBA 2ALYB 2V8DA 2RILA 3PHEA 2GHVC 1HWLA 2DT9A 2MEWA 4TVAB 5J2NA 3JS9A 4LF7J 3CDAA 4OZ5A 1DARA 2E7WA 1KBRA 4HKQA 1PBAA 1HNXJ 1KOOA 1RWXB 1NSPA 1RTJB 4F0MA 1NU4A 4NCGB 3K58A 3K0JA 5KFRA 3GE9A 1BD6A 2DHXA 5L39A 4OX9J 1UZHA 1VJWA 4IQXA 1UVLA 2B7BB 2XNQA 3FSYA 3KOAA 3ZNUA 5FIIA 2HNDA 2J0QD 1JWWA 3TVKA 3MF5A 2GV1A 2YKAA 3I6PA 1BLUA 1R0AA 2WBRA 4BC9A 1P1TA 3PYEA 4PXEA 4L75A 4CRJA 2VICA 4K4UA 3QAEA 3BH7B 4OHVA 3B4MA 4U96A 3UNYA 1RTDB 1NJIT 1TKXA 5IS2A 2HQCA 2KYXA 3IBWA 1GMWD 4NLRA 2HAIA 4ETZA 3LP2B 2DKOB 3MM6A 3ISND 1HNZF 2YX1A 4K2XA 3BEGB 4ZVUB 1X5OA 4URSA 1RT6B 5LOQA 2A1BA 2GHPA 3TQEA 1IKYB 3CB4A 1UW4A 5A8WA 3QBCA 3MFIA 2ZH1A 4MKYA 2HQFA 5D15A 2YPZA 5CYMA 3U02A 3CEDA 1OYEA 3CIMA 3OQ2A 4UUWA 2H5EA 1WC1A 1MN9A 1N0UA 4ZCIA 2YVSA 4QW9A 3CC4S 3GCXP 2KRRA 4A8YA 4DCJB 2LU2A 4Y65A 2ZHAA 5D3GB 1S0OA 2GIRA 3M6UA 2CUYA 1NK4A 1VS3A 5I42B 1X4EA 3KG1A 4DUZF 2KKHA 3RAMA 1HBMA 1Q8LA 2IHR1 2ZJRQ 3MM9A 1EHWA 4ZVFA 4C98A 2C22A 1K0VA 1KVIA 3V4IA 2OEMA 5DQHA 1Z1ZA 3TAQA 2F65A 3PFOA 1T3NA 4I67A 2HHXA 4KV8A 2COLA 3T41A 1D1UA 4NMLA 1RT4A 3FC9A 2AYEA 2EKYA 2FZGB 3T1HF 2Z2YB 3M2RB 1QAXA 4OI4A 2VDIA 4PG4A 2RHQB 2O5DA 1F2GA 2KVQE 4FP9A 4QWCA 1PCAA 1YLXA 1S12A 3ZZ0A 1LW0A 4WKRA 3O6QA 3CTRA 1T3OA 4L76A 2HK2A 4ID5A 3QQCD 4JB8B 2ZKUA 5D78A 4OHXA 3OVSA 1U7LA 5KFHA 1HD1A 3NMAA 1NKCA 1FEEA 4ED1A 2J9CA 5KFIA 7AT1B 4K4VA 2DNMA 4K2JA 2VZ9A 2UUTA 3CJ5A 4PYAA 4X4NA 3M4XA 4H4MA 4O4GA 3GILA 2LXUA 3OBIA 1KTQA 5M2UA 2O1PA 4RNHA 1BQNA 3NL0A 3U1MA 3PKMA 1Q78A 3NGRA 3MEKA 1FD8A 3EJMA 3NY0A 3P96A 3FSXA 2J7KA 3ADAC 4G1QA 4NLSA 1S9GB 3DHWC 5GVQA 2NQPA 2Y8YA 1G6BA 1SH2A 1XBWA 2G2YA 3PYGA 2X7IA 4BHQA 2YY3A 3F44A 1YGYA 3RJMB 2DITA 1UA0A 1SI9A 1PYTA 1S57A 2MJUA 1R31A 2FJBB 5D4OA 1Q8BA 4ATNA 2YNFA 2KXHA 1TMJA 5ETOA 4K59A 3ILJA 3GR1A 2X1FA 1IKVA 3NLCA 4ZVTB 1S0MA 3I4HX 3HSZA 3DLLQ 2GJ2A 1B4SA 2DGTA 4KJIA 3TUPA 4R5PA 3OXGA 3GP9A 3HJFA 1RWWB 2CJQA 3NNHA 4GO7X 4IFVB 1JLFA 3BQ1A 5E5NA 1LXJA 3R7NB 3ITHB 1RTHA 4J9UE 4DN9A 3H25A 1FTCA 4WFNQ 2AJQA 4IUFA 3THTA 1CJKA 1TU0B 4V19J 1TV6A 1RISA 4DSJA 2UXBF 2FY8A 3W60A 3Q8PB 1WWHA 3F73A 4UT4A 3VVTA 2CJKA 2Y9HA 4TU8A 3HFKA 3DMJB 3F56A 5B7WA 2B6AA 4GRSA 1Z2ZA 4IO1A 2MZ1A 3G96A 1T9XA 2MLYA 2Z56B 1YTYA 3FNNA 4I1TA 1HR0J 2VG5A 3A8IA 2AKWB 1LK5A 2KZMA 2ZKTA 1RK8A 2MQLA 2HGLA 2ZE2B 4QR0A 4RNFA 4L73A 1J5EF 1GMVA 2B8QA 1W2IA 4DV4F 4UY85 2JFKA 3DLEB 1KSPA 5G4DA 4WJBA 2ZVIA 3I82A 1ZA2B 3QIPA 3A12A 2KFYA 2MZRA 5A0YA 3Q83A 4IDKB 4MIWA 1RA6A 4HR2A 2HBYB 3C66A 4WZQA 3W1YC 1NHVA 3MPYA 3IWLA 1A6LA 2Y0BB 5B0AA 4ZLLA 3IR7B 3MD3A 2D74B 2F4VF 5DJBA 3FRZA 1UTAA 1VQOS 3AA8A 3PW2A 4IH6A 1AA1B 5KOXA 4KE5A 1F60B 2HWTA 2W2PP 3E8OA 2HFUA 4F7VA 2EXUA 2I38A 2Q79A 3HSDA 3ZFVA 3SCKE 3UPFA 4DX8H 3MTKA 3CCSS 4KGXB 3UDCA 1U47A 1RSCA 3DHXA 3LP1B 5HJYA 2BV3A 2HRTA 3BV8A 4MKAA 1MG7A 1FNXH 2NREA 4B9SA 1UVIA 3UNGC 4OZJA 5B0GA 4QWDA 1X4AA 5AJ3J 2ZDPA 1CC8A 2QLXA 3V6DB 2FJEB 2EK6A 1N54B 4HHUA 2FLOA 2NYHA 3QZ7A 3MUMP 5GAEU 2RUGA 2KT2A 2UU9J 5KG4A 2CJBA 3KUEA 2Z30B 3GR0A 3C15B 2OSRA 1VQ4S 1EP4A 3POTA 4AL5A 6FD1A 2W2MP 4F0KA 5EGYA 4N56A 4LF5F 4K0KF 4OYOA 5GADI 2XMTA 3GB0A 1N8RT 3VAJA 4JV5J 1N5YB 1SCJB 2JHEA 5HVHA 2W01A 1DTQB 3IM8A 3QRQA 2YNFB 3AD7C 4O23A 1OPIA 5LM7E 2VFSA 4JI8J 1RI7A 4IG0B 4DSLA 1SQEA 1EX8A 5IM0B 4NYPA 5CZVA 2EKNA 2DGWA 3GIJA 3BGRA 5L38A 2KM8B 2AGQA 4CCHA 2HHWA 1MMNA 3HF5A 4TLRA 3ONQA 4ZVQB 1IUJA 3MAAB 5KG1A 4WP9A 2VJUA 1FRLA 2HHHJ 5EWGA 1B0VA 1OPZA 3OHAA 2BKPA 1C4CA 3TAPA 2AQ4A 4A8FA 1M5OC 4Q8FA 4ZVHA 3K8VA 3G6VA 3Q23A 1SQFA 5DG7A 3KG4A 1RWOB 2LQBA 4QQBA 3W64A 2LECA 2AYBA 2WOMB 3A13A 3UW1A 3LWLA 4QWEA 1F5CA 2AIRB 4PZVA 4DR7F 5CYMB 5GAGI 4IG3A 4QR1A 5DG8A 4DUZJ 4ENOA 3QT6A 4NI2A 3AH6A 2ZH8A 2K3IA 1FCAA 1AZSB 5LL6d 3SXLA 2C2MB 4ID5B 2YWHA 4WP3A 4QIVA 1HQEB 1S6PA 3ET6B 4HDGA 1HI0P 1NBEB 2B9WA 2M4MA 2ZZTA 1TUWA 4OZ2A 4RW6A 1VHFA 2POKA 2YQ1A 2RRBA 3N79A 3HHEA 3DOMA 3CMQA 2HFSA 3QGGA 4K8RA 1NEEA 1N56A 3D1OA 2CQDA 3CGIA 4ZJOA 3MEEA 4EWTA 4KPYA 4QWBA 1U6BA 1L3UA 3HCXA 4KV8B 4NLWA 2HGNA 1HWJA 4J9MA 1VJQA 5U47A 3NS5A 5GAHI 1HR0F 1WG1A 2HNDB 3VQTA 3VR1A 1BXNA 2R7TA 4CH7A 1YBAA 1TQLA 4FDFA 4OYWA 5LSLA 1KQGB 4NLXA 4B9MA 2ZH6A 4PWUA 1RTJA 4DX5A 3C14A 1M5VC 3G9CA 1FTRA 2XZDB 5IFMA 1BHNA 2GCFA 4OZLA 3BSAA 4DUYJ 1T03A 3UN2A 5K8OA 1JLBB 1H73A 3AB4B 3AT1B 3GWCA 5KG7A 2XY5A 1M90T 4ZP6A 2FY1A 4ICLA 4MKVA 5F8JA 5KFOA 4ELTA 3GJTB 3NKYA 1UFLA 3HI9A 2CADA 3BGFA 5B0FA 2FVQA 4DEZA 1FJGF 4IH7A 1U48A 2Z0GA 5KFKA 1NHUA 1YKWA 3GPAA 2QLFB 1J27A 3LOUA 4NL5A 2GQCA 5HJXA 1UEVA 3LH2S 1HPZA 2CZVC 2EI5A 3RR7A 4NLVA 4QU7A 1GFWB 2JH3A 4CO4A 2WTFA 2JEFA 2QTWA 4FPIA 4YDXA 4JI4F 1QUPA 1KS2A 2XWXA 3M1VB 3MR7A 2FHJA 1C0TB 2DNZA 2GVZB 3H2UB 4K5RA 4P75A 2GMHA 4F4YA 3RU0A 4QIWD 3TP2A 3DU6A 1TKDA 2IYIA 4Y2AA 4J9OA 1UP1A 4UW2A 2DPJA 2HHUA 5HSPA 3CCRS 2RE1A 4L3KA 1GMUA 2FJWA 1FE0A 3MMBB 3PW5A 2MQPA 3BO4A 3CC7S 2LLZA 4YP3A 3FSIA 2LP4A 4B9NA 4J91A 3TAMA 3I0SA 2YPYA 4JBCA 3CCWA 2D3ZA 1HFEL 1R43A 2HFVA 2IRYA 4F2RA 2R7SA 3VGVA 1X5TA 3DCAA 4OYIA 3CJTA 4JI2J 4J9LA 3C15A 5C42B 3CCVS 3ZZRA 4Z37A 3BJYA 1JXLA 5FLXU 4ZHRA 2NSCA 4ANDA 4YY3J 2AU0A 5JUMA 4P6QA 1AYEA 3BSNA 2BX6A 2YX4A 1U8SA 5D0EA 5ITHA 1Q53A 3BQ2A 3VAFA 1L3KA 3HT3A 3MCNA 3CT9A 3Q86A 4OJGA 2R7RA 1DLOA 3CW2C 2UV8G 3UVJA 3VGUA 4EO6A 2E5IA 4F36A 3OL7A 2JVRA 1FJ7A 2H3EB 1V5VA 4LSNA 1N34J 2AJFE 3V81A 4IRCA 2KI2A 5D4NA 2HMIB 2PI4A 2HVEA 1S0VA 4QYZK 5J2MA 4LF5J 2DNQA 1CJVB 3M8YA 4WPAA 3GQCA 3RG6A 1NCLA 3OPKA 2V6AA 3PR4A 1RUSA 3MM5B 1S10A 3T19A 2BW2A 3B78A 3K5PA 3GJQB 1VQKS 4DV0J 3BKUA 1BWVA 1CEZA 4N77A 2LEBA 2VPZB 1E6VA 3D66A 1WSRA 4WU2A 5CABA 1WC4A 3MMAA 4X4QA 2NPIA 4ECQA 2VFRA 3PXGa 3I5AA 1VLYA 3MEGB 2Z57B 2ZDOA 2W8LA 4FF4A 1Z2LA 4ED5A 4Y0FA 1N33J 3TRGA 2HVDA 3SV3A 4E98A 3LGHA 3QJJA 2VH7A 2WK4A 3KDOA 1SL2A 2ZE2A 1LNQA 3D9BA 1UCNA 2I0XA 4LFAF 5H1SV 1CULB 4C9DA 2P2CB 4J7CA 5JJBA 4IFVA 3MTJA 2MKHA 4CLKA 1VQ6S 2WCXA 2YXLA 3CPWR 4WK3A 4QIFA 3WIVA 2IA0A 2HQDA 2AJ4A 5F8NA 3MEGA 2UU9F 3P4UB 2G4BA 5K8MA 4FS1A 2V2ZA 4RNOA 3TANA 2Y1RI 4M95A 1UJ6A 4CLSA 4KGVB 3TOQA 4DV5J 2BVZA 1RAJA 4KC5A 2BEFA 2HK3A 2CQ3A 3UDEA 4XPEA 4C4WA 5J1PA 1NH8A 5ETPA 1DURA 3FQLA 4DFKA 1NK0A 4WXOA 2VG6B 2CZ9A 4P2SA 5E2QA 1KHWA 2QC3A 2BE2A 2FHOB 1PAEX 2W7AA 5IC4B 4O44A 5J2MB 5K20B 5HO4A 2YX7A 3GV7B 3CC2S 1JLCB 1UZDA 1JNRB 1NXIA 1R0CB 2VD3A 2VASA 3EE3A 2IAJB 4XPCA 4DSIA 3I0RA 2CJXB 2XLKA 2DNNA 3PYDA 1Y5IB 3PM9A 3ETMA 5EX0A 2DGOA 4ZIVA 2RH3A 3JQJA 2J9EA 4FBUA 1YI2S 3MXHP 2HFNA 2R7QA 3RGIA 4BWMA 4P74A 4OHZA 1SPBP 2M3DA 2MLXA 2LA4A 4ER8A 2DHAA 3BPSP 1RT3A 3QLHA 5CA5A 4U6PA 3DRSA 4RU2A 2VG5B 3EM1A 1U1QA 4L72B 2LA6A 3GFXA 1A7GE 2OO4A 3C6UA 2EC2A 5AXNA 2W25A 3IG1A 1T9VA 2V2KA 3SCIE 3W8PA 4OIXA 1L5UA 3TX0A 1U49A 4XTTA 5J1NA 4JI1F 2DHHA 2OD4A 1FEHA 1H3DA 2KN4A 1FWKA 1HKAA 2HS0A 2Q43A 3BBCA 2GGPA 3ITHA 2XBPA 3OFEA 4DUTA 2HS3A 1MLAA 1UFKA 1IN0A 1VHIA 4KQZA 4NRTA 3R5JB 4DQPA 3QO9A 4AYBD 3M8SA 1S6PB 1NH7A 3LAMA 3DOKB 3M2RA 4CT8A 4MTPA 5KT3A 4ELUA 1XMQJ 4AUKA 1S7HA 5L9NA 2ZHBA 3JTNA 3KJQB 2OFGX 4ICLB 4AE5A 1J5OB 2W7OA 4IFYA 1VQ8S 2UUAF 2V8HA 4IG3B 4R8UA 5F8HA 5I3QA 1URRA 3MM7B 2UXBJ 3HFVA 4CO0A 1VGYA 2BBEA 1FFSB 2R4FA 2CWKA 3I4PA 4ZMMA 6FDRA 2W9CA 1NAQA 2WOMA 4IYQA 1YRUA 1KR4A 4D3GA 1CG2A 5F8IA 1XIQA 2N82B 1MU2A 1S72S 4W92B 2R7XA 2DH8A 1UPPA 3NBPA 5BYRA 5HMYA 4QU6A 3IR5B 2ROEA 2V8PA 4F02A 1YWXA 3MAAA 2DR5A 1T9UA 1WI8A 4WTOB 2MHEA 2CJAA 5IOLA 4DS4A 1WDTA 1U2RA 3P5TL 5J1EB 1XR5A 4RKUC 4DG1B 3TARA 1SJQA 1U0SA 4CO5A 4JI6J 3VGSA 3KNAA 1VCTA 3N9UC 1YBTA 4AXIA 5EN1A 1TKTB 4P9SA 1UA1A 2KHDA 3HZEA 3PKYA 1AW0A 1NDPA 3UN3A 1Y9OA 4LRAA 4DF8A 1IVZA 5KFWA 3V2UC 1NSQA 1RKIA 3SIPB 4ECRA 5CD4A 3D6TB 2ZUGA 1HWKA 3LTOA 2CPYA 2D3O1 5THWA 3MR5A 3Q8RB 3Q24A 4FYXB 2W4DA 4EYIB 4ECZA 4A46A 1ZH5A 2GGPB 1K47A 2LQJA 4DU7A 4ECTA 4NCGA 2B4UA 4FNIA 4MJKA 3TZXA 4ZVSB 2H54B 4C0OC 4EO8A 2QLJB 2E5LF 2VKZG 1YZ7A 1JJ4A 2KFZA 1XNQJ 2KFNA 2VC1A 4O44B 5KFSA 1LWXA 2GJIA 5HAOA 4USJC 3C6UB 5I42A 3FFIA 3Q8VA 1TAUA 4PG5A 2FB0A 2XULA 1XMQF 4KHMA 2XYGB 3QRRA 1SJ3P 3BO2A 2PIIA 3EVWA 3FEXB 2WONA 1G3OA 4NZ0A 3T6JA 4DV7J 2DBBA 2XI3A 3KLFB 5HVFA 2UUCJ 2DRAA 2DNGA 2MQOA 2HYIB 2VU5A 1S1XA 2VFVA 4F3MA 2AEFA 2B4OA 2C2KB 1SKUB 3HVTA 4ZVPB 4GVBB 2AX0A 1NLKL 4LBHA 4WWSA 4I6WA 2R3VA 1TK0A 3IWXA 1WEXA 1Q7YT 1S79A 1T9YA 4CLPA 3CCUS 8ATCB 1HIYA 4LF4F 2DNRA 3V5RA 3ZZTA 3FEYB 2V67A 3BGRB 1QJHA 4KY3A 2VQEJ 1I51B 2VG6A 4IO9Q 3HK2A 2UXDJ 2QSWA 3IBCB 1QTNB 5HN0A 1HL6A 1RLDA 2NS1B 1PYOB 5FD1A 2XM3A 4A8MP 3SMZA 1X4BA 2ZH3A 1N32J 4HTJA 4QOTA 1ZETA 2AEMA 2DH9A 3GFHA 1NJWA 4QCLA 3FVYA 3ILOA 4UOFA 2MQNA 4C3KA 2AEJA 2BJ7A 2RB7A 1YJ7A 2H5JB 2JLEA 3LUYA 5ETNA 5C24A 2HURA 3NWGA 2NCKL 2R42A 3J7ZT 3E3XA 2V4QA 2CXEA 1WSVA 2ZHOA 4YN3B 3SFGA 1IR1A 1WG4A 2A10A 3I56S 4IOCQ 1RB0A 3OFGA 4RBTA 5K8NA 1G1XA 4F50A 3R9LA 1K1QA 2LDYA 2O67A 2PC6A 4USKA 3JSMA 5DLGA 4LF8J 1MROA 2DEJA 1FK9B 1TFWA 4ED3A 4YQWA 5F8GA 2KT3A 4OZNA 1RHQB 3CIZA 1U0HA 5A2QY 3L4BC 2HS4A 5KFLA 2FZKB 1XMOJ 1HARA 4F3QA 5ETQA 2BE2B 1RHKB 1WKJA 3UE2A 2G0JA 1MMDA 4DSKA 1KLMA 1WG5A 2ZFHA 1GXTA 3MPUB 1RACB 2ASJA 2EBEA 4LT6A 5MLCV 2DTJA 1IBMF 2ZBIA 4CNZA 1JLGB 2CZ4A 3V4MA 1YJRA 2IVYA 4LQ9A 4IDKA 4CYUB 2QZ8A 2N7YA 2V0NA 3VWSA 4NOHA 1FDAA 4NLTA 1VMBA 2BXJA 2WVCA 3HVAA 3M2UA 3TQ1A 2PD1A 2Z2ZA 1X0FA 1HHSA 4EEYA 1W26A 2HEKA 2NUHA 3DLEA 4DN0A 3DI6B 3GFYA 3TJ9A 3W61A 2VDHA 4J90A 4EI2A 1FDDA 4E2FB 5KFDA 2RDJA 3L9ZA 2KDOA 4DFJA 2RT3A 1QE1B 1R8CA 2WAQD 5L1IA 1FT8A 3UD4P 2E9RX 4EZ6A 3QRPA 2CQIA 4NXNJ 4FNHA 2K1RB 1Q0NA 1SB6A 4LIWA 3HHLD 4PR6A 3FCHA 3W2WA 3P8BB 4HDHA 3JSRA 3DN9A 1OQ6A 1QM9A 1SXLA 2ZNYA 3DOLA 2H1YA 3FJ2A 5IV4A 4WCEQ 4M5DA 2DXEA 3AQPA 4ECXA 2WB4A 4ZPDA 1N6QA 2QFJA 4K4ZA 1XQIA 2R8KA 1T9WA 4URGA 5LSOA 3K2YA 3ENVA 4R5PB 2F1FA 1T9TA 1VYAA 5CHCB 5E3CA 3EPGA 2ZJPQ 2FVRA 5IQQA 1YX2A 1RAFB 2OPQA 4LVOP 2V4JB 4ZVEA 1U6ZA 2W24A 5CCMA 2MGZB 2IM3A 3U27A 1E6YB 3TR5A 2MXYA 4NZ6A 4RNMA 4JI7F 4JV1A 1XNRJ 3ZTSA 4J9PA 2CFXA 4N47A 4DV3J 2MY7A 1QSSA 3CDWA 4OLOA 2OPPA 2VJVA 1QLNA 3WX4A 2DHSA 1S4FA 1V9OA 5GMDA 1GNKA 1EIYB 2DB1A 2RQ4A 2YNHA 3GIIA 1CBKA 2ZNZA 4LSLB 2CYYA 1DQ8A 3UCGA 4USUA 3CCLS 4J9SA 4C8KA 1D9FA 3ZTQA 5LXYA 3L09A 3MECA 3SSQA 4CLZA 3HHKA 2EBGA 2V63A 4FXWA 4P72A 1IKXA 2WVFA 3UD5A 3VAIA 3GIKA 1KRPA 3NRBA 4DR5F 1LWCB 1X4HA 2HKEA 2VFTA 2XMUA 4PEOA 3UI3A 5T14A 4CDIA 1RT7B 1S1WA 5DGBA 2DHGA 2ZD1A 1NJZA 3I0SB 4USVA 3TA2A 1WNEA 4LMZA 3SQGA 4C8YA 3SQGB 2MKIA 2J7UA 1XEZA 4B9LA 5F9NA 1JLBA 1SVDA 1Y7PA 3S1TA 3CD0A 2CWXA 1SV5B 2HNZA 3CCTA 5DS7A 2UUAJ 1RXOB 4NXNF 1RU1A 4NX9A 5JVGQ 1SC4B 5EWEA 4JI7J 5J2PA 4PYDA 4Q0BA 1FO1A 1Q7LB 3NP5A 5F3ZA 5ETKA 3R1HA 3VF0B 4CLFA 1HNZJ 2EFOA 2FJDB 2LEPA 1EKSA 3I87A 4HHHA 1OSDA 3M9MB 2HWHA 2V4RA 3ILIA 3MEEB 3KLGB 4NA1A 4DR2J 4I56A 4IKAA 1FD2A 1JNZB 1GTEA 2PT0A 2YQ0A 4QYZJ 1WHVA 2C2OB 1VQPS 1SKRA 3FZ2A 2Y0SD 3KK1A 5HL7Q 1C1BA 3BBBA 1M5SA 3EGNA 4C7QA 1ICEB 4OX9F 5HROA 3S8SA 3JTPA 1Y5NB 2EWHA 5A8WB 2ZH2A 3QGPA 2UXCJ 1PO6A 2N7CA 1RP5A 1F1BB 1WHXA 4PXBA 1T7PA 3V6JA 1O8BA 3A8KA 4NA3A 2G13A 3CVKA 5B0EA 3UDLA 1X7VA 3HHDA 1J5EJ 2QYCA 2PGCA 3HJVA 2XHWA 1N5YA 1RTDA 3KUHA 5D6GA 2XGQA 1N5QA 1NKEA 3L3CA 2CIMA 3QWUA 4F4WA 3T9NA 3OFFA 4NYOA 4P10A 4I6YA 5H9FK 3H8YA 2M0GB 2NUUG 4OV1A 1HWUA 3LA0A 4ITSA 4M5HA 4C11A 2XC9A 4KYZA 1U09A 3O8WA 2AJ0A 1IBCB 2C42A 2Z58B 4HHJA 3PNIA 4N5SA 4B9VA 2VOOA 3VV2B 5KG0A 4DX6A 3J81Y 3N01A 1YK9A 4WU3A 4DR7J 5J2NB 4XO0A 3NMRA 2J0SD 1VDHA 2DY9A 4LIRA 3TO8A 4Y28C 4AFFA 1MROB 1T8EA 3DRPA 2IPOB 2N4DA 3R7BB 3OTOF 1O0PA 2UVRA 1NDLA 1FX4A 2OFHX 4ZITA 1K1SA 2ASLA 3MZIA 2VBYA 1NUEA 3BPDA 3PX6A 1XERA 8AT1B 5E41A 2E7VA 1XC9A 4X84A 1RT1A 3L7PA 3Q22A 4B3OB 3GSIA 3RBXA 5C42A 2IAJA 2Y3YA 4NCBA 3F41A 3BH6B 1FERA 1OO0B 2F9DA 5C2CA 4CIOA 4PXDA 3HPOA 5GMEA 2VG7A 2K3KA 2ZEJA 4AT1B 2JC0A 3DLKA 1N36F 2BOAA 2XSJB 3BR9A 1SH3A 4RBUA 5M2RA 2QIFA 3TWZA 3M32B 1G2EA 4QIGA 1XNQF 2VQFJ 2WSEC 5E0OA 5KT2A 4M5JA 1T05A 1X9SA 2DRBA 2YWGA 1Y10A 1ELOA 2FPHX 3CO9A 3DRRB 2WHOA 4PG8A 4I2QB 1EJ7L 3VAKA 2LQ9A 4B3RJ 2C3UA 4DPWA 2CAJA 2KU7A 4DR4F 1IBLF 2FQQB 2XEXA 1NDCA 1TTHB 2MPUA 3N6MA 2JX2A 3AJ1A 2IC3B 1CSJA 3KJVB 4WBFA 1RHJB 2FGOA 3IAS9 3P6YC 3BR8A 2UUCF 2JOQA 3RB4A 4KT0C 5DO2A 4RJVA 4C3LA 1QAYA 5KFJA 1TUVA 1REVB 3ISNC 3NAHA 3DLKB 3PRVA 3AOCA 4W90B 3HSJA 5HANA 2MZQA 2FJXA 2AGOA 1H7XA 2I9SA 3E01A 3C3LA 3NS7B 1S9FA 4HH1A 1N5VA 1GQEA 1P27B 2G2OA 1S97A 3ZZOA 2GA7A 3R7SB 1HNIB 4TU7A 1NK5A 2YBVA 1S1XB 4N8OA 1XR6A 2XMVA 1WOSA 4Q5VA 2YTCA 3BSCA 2OELA 3LP0B 3KHHA 4DL0C 5KFMA 3FKBA 2LXFA 5A76A 1TZ0A 4I2PA 1UL3A 1IR2A 3D1HA 2VA2A 5F8MA 4F2SA 3J81U 3ZO7A 4NWBA 1VQLS 2V5HG 1FKPA 2GNKA 1RYSA 2ZOGA 4RW7B 5CXTA 2E9TA 4DQQA 1VQNS 3SEOA 3LPEA 4ZPWR 5CYJA 3B4DA 4OQJA 3GJRB 3W62A 4U8VA 3GLJA 4QJVA 3A8EA 3U7JA 1ZPWX 3A3OB 2FC9A 2DNYA 1DY3A 1SH0A 2KYZA 3OR2B 5I3UB 1DQAA 3SDEA 2YNGB 1D0EA 1OY6A 2CG8A 1F9HA 2LEAA 2MQMA 2V69A 3KUGA 3CCES 4G3IA 2NXCA 4MYTA 1S1VA 1FJGJ 4WF9Q 3JXOA 2JSXA 1RAEB 3K5OA 4PUOA 4ALZA 1RWVB 3KK2A 4C8LA 1WC5A 3WC2A 4CLUA 2FJAB 1KQFB 5KFUA 2DEIA 2B6AB 3MM7A 1VIOA 5LXRA 2RRNA 1MNEA 2UUWA 2QSFA 2C2DA 5DRKA 4UOGA 2ZJQQ 2ZH4A 2ZC4A 4DS5A 4ZOSA 1KOHA 4DPUA 1SKWA 1M1KT 1UVJA 4ECWA 4DL4A 1UVNA 3JQMA 3G2XA 3THPA 3BN4A 2QGFB 1NPKA 1T95A 2E66A 3R1LA 2EFQA 3BGOP 1CJKB 1YHQS 1CS4B 2OI2A 1RLCL 5IQ6A 3DLBA 4B08A 5BR8J 3EPIA 4K4WA 3DLHA 3C2PA 3OW2R 2FLNA 3BKFA 1AXQA 5K8PA 1GT8A 3GTYX 3Q2SC 2ZZMA 5CD4H 2PMZD 3CJKB 2R2RA 2J6UA 4IOAQ 1CPZA 1IR0A 1HA1A 4DJBA 3HZGA 1XTZA 3PV8A 4JYAF 3TEHB 3J7AN 4NLGA 1WKKA 3FBEA 1VISA 2V2QA 2XQCA 1DJ0A 4TNOA 4ECSA 4HH0A 1R0BG 1LV5A 1N88A 1LW0B 1TUGB 1Y11A 2ZC3A 3U1NA 4CTAA 4RW9A 2MDAA 2UP1A 5F3TA 4DHVA 1U45A 2CKWA 1PKUA 4ZVOB 4TKTA 4KKOB 3U1LA 2ALZA 3KJNB 4B3RF 2JC1A 3OVBA 5LMNF 1CC7A 3EVOA 3BB5A 1O5JA 3V4IB 2YNGA 3RYLA 2JL9A 3EGVA 5K9FA 2PE8A 2GQ2A 4TQRA 5KG2A 3T9ZA 5KFBA 4CWBA 5B0DA 2OSQA 4KPCA 4JI5F 3QT5A 1Q95G 3BGUA 3MFHA 2W2OP 1RDRA 3O2IA 4FYYB 3AXMA 3MECB 4O4GB 2LQ8A 2CNKB 4HT7A 3DGPA 2VHGA 1DRZA 4WIQA 3EGZA 4MMOA 5DDPC 2HBZB 3ZXWA 5JVHQ 2BACA 2OPRA 1K73T 1RU2A 1H98A 2KG0A 4LSZB 4ZP9A 5IT4A 1QAIA 2CNLB 2FGCA 7FD1A 3F0NA 3TW0A 4DV5F 3KLVA 1APSA 3W66A 1LEOA 4U7UK 3PZPA 1YG0A 2GMLA 2LYVA 1JX4A 1M5HA 2HHSA 3UN5A 2RRAA 3BF4A 3NXZA 1LXNA 5E7OB 3IP0A 3ETOA 3ILLA 3O44A 4DR3J 2KT5A 5B08A 1TK8A 3W3SA 1I1GA 1P8GA 4CT9A 1UMJA 2DYAA 1FXDA 3K5LA 2VQFF 3M8QA 3AJ2A 2CVEA 4JUZA 5C25A 2RKIA 1GEHA 3G6XA 2ZH5A 4OYZA 1D9DA 4F4KA 2Y1LB 3BO3A 4ZPBA 1QD1A 3I5CA 2CPXA 1YVFA 2XMMA 3H59A 3M8PA 3HVRA 1RT5B 3EWGA 4FVCA 1CJUB 3AHPA 1VQ5S 2B5JB 1M5KC 2BQRA 1N33F 1S1UA 1XJWB 2EG2A 1LOUA 2I8EA 3TUZC 1KTVA 3BGLA 1ZS6A 2GS8A 4DSEA 4DL6A 3RAXA 4R0EA 3T1AA 1X31C 2YWWA 1VIXA 3PRDA 4NRUA 1WD6A 2XCAA 5L1LA 3WHIA 3NNAA 1RTZA 2BANB 4YY3F 3R5CA 3CJ0A 2WB1D 2P5VA 4O3OA 2ADBA 4ILLA 1RAIB 1PJ5A 9ATCB 2FZCB 3D6MB 4X62J 4YFUA 1FXRA 5AE3A 1U1LA 1X0PA 2F4VJ 4JI2F 1LWFA 4V1Ak 3PG9A 1IBMJ 1W2BR 1H2VZ 3KMSA 2Y1JA 1VQMS 1F3VA 2EEYA 1U6FA 1RAHB 2G9OA 2V2VA 2DISA 3QT7A 2GIQA 1OJ4A 3I55S 1V3SA 2UXCF 2F8MA 1SJ1A 3EX7B 3GFZA 4MKBA 1VQ9S 2V50A 4Y34A 4LF1A 2A3JA 1KEKA 1FRHA 5CYQA 1S1TB 2YH1A 4CLWA 2J9DE 2IFXA 3D0IE 2DGUA 3NGSA 3ZNJ1 2LVWA 3DDIA 5IT0A 4USHA 1QAJA 1RZMA 2J8SA 5KFVA 1YQHA 4NMXA 4LF6F 4DLGA 4OYXA 2W7PA 1F2HA 5GMKa 3W7BA 2EC0A 3LGMA 3JAMY 2XTJP 3A1YG 3R27A 2VG7B 4KFBA 1JKHB 1TR0A 1TP7A 2M5YA 5D4LA 3SCJE 3L95X 3UR0A 3CXCR 4DF4A 4CLYA 2QMWA 1WC0A 4RU9A 4MT1A 1ZOTA 3T1YJ 2X3GA 3Q8YA 4YHHF 3HP6A 2I5JA 1X4FA 1Y0HA 2BABA 2HQIA 3IAM9 4RO0A 3WIUA 5HATA 1N5TA 3QATA 5AXKA 3K7RA 2OGUA 3N5FA 2OMOA 4X66J 3ISZA 5F8LA 3KLFA 4Z7YA 2JDJA 3HXMA 3K17A 2UVWA 2B43A 4ANCA 1ZAWA 2QA2A 1S1UB 2I1RA 4UF4A 3SSRA 1VOMA 5A8KA 3FUYA 1WF1A 5EX3A 4C11B 2VQEF 4A8QA 2VKRA 3MM8A 4TY9A 3ZTOA 6AT1B 4RUCA 3MAQA 4C8OA 2U1AA 1X4GA 5EHHA 2CNOB 1VC0A 2L9WA 4H4KC 3RRKA 1HW8A 3OUYA 3O1LA 2GO8A 3QWPA 1CLFA 4B3SF 3UCZP 5C5JA 3AOBA 3C19A 2FHJD 1YZ6A 2CQHA 1OSCA 1Q4RA 1RAGB 1JIHA 3FK4A 3HD2A 4URQU 4ZKAA 2E7XA 3M9NB 3RBDA 1MWQA 4HL9A 4CLTA 2FDNA 3SSSA 3QSYB 1V3ZA 4C0HA 4YR3A 2OHDA 1JQGA 2VV5A 4WXWA 4TQSA 2F3JA 2YKNA 4F0HA 4A4JA 2C2EA 2XB2D 3WQPA 4L3NA 2JLGA 2F4FA 1WEYA 3LQVA 5EUHA 1YITS 2WBMA 1I94F 3MAHA 4Q2LA 4LFCF 4M94A 2X51A 4Q7AA 2QJ3A 5HP1A 4F8RA 4JI6F 2C2NA 3SCLE 1S9EA 3MGJA 1U25A 4HI1A 4NE9C 4DPTA 5L1KA 3SI8A 4O3QA 4EFAC 3BREA 4FF3A 2HIQA 3QNWB 1PYSB 1ZM4A 3FRYA 2D41A 2RQMA 3KJFB 5HROB 2XG8A 4C97A 1ACMB 1C1CB 3QGHA 3VALA 2A2CA 1NHKL 2ZOFA 5HLFA 3JTOA 3HHLC 1LWEB 2EFNA 1HNWF 4LFBJ 1TELA 1U1RA 5KTQA 1NZAA 3W5XA 2KTQA 2J9DA 2PSZA 5HI7A 1WUUA 2CJ9A 4USMA 1JLAA 3GJSB 1UPMB 1UWBB 1TL1B 2QA4S 2OPQB 2P9CA 1KP6A 1LW2A 4WP8A 5KG6A 2F9JA 4N7TA 4RR5A 5D77A 5DETA 1KN6A 3PYFA 2IDEA 2J76E 3H42A 2Z2MA 5H9FJ 4OYPA 3RTVA 1VC6A 1QTMA 1JXVA 4ZN1A 2FVPA 1ZTTA 2PMHA 1SBRA 1EP4B 1UVKA 3LAKA 5ETMA 5HBMB 4DQSA 2BR0A 3DGPB 1RT3B 1QDUB 2YNIA 3QLHB 4OZ0A 1AUSL 4ANEA 4PUOB 3CMES 1TFYA 4GKKF 3GV5B 2DCLA 2ATLA 4ZS6A 1XWLA 4GO5X 1CS4A 4B3SJ 3IRXA 2DVIA 3W2WB 3CO0P 3DLGA 5KFZA 3I0RB 3HVWA 2ATCB 2DIVA 3I32A 5HQMA 5DM7Q 2ZBCA 2ZM6F 4ZK7M 1IKXB 1W7WA 2APOA 3OLBA 2HZVA 2L3MA 4JI1J 4AXJA 1ZAXA 2HAFA 1FI4A 2DGSA 2YNIB 4WK1A 5ETTA 2IVFB 4B9UA 2IY5B 2DR7A 4RW4A 5KT7A 1A9NB 4IG0A 4C0BA 1FKPB 2KL8A 4DDFA 1QVGR 4CTAB 4CYUA 5A8RA 1A0OB 2GQQA 1ZM3A 2MYFA 3KLEB 4M1KA 1XNRF 3H2LA 5ETLA 1KQSR 4YB1P 4HT5A 3PJWA 4P71A 2AV5A 4USTA 3DOLB 4OI1A 3W2VA 4CI0B 5IXUA 3IXQA 1GX5A 2BJ8A 2XMJA 1U4BA 2JLFA 1RGVA 2K8GA 1VRTB 3PJXA 1SC6A 2E5GA 2OEKA 4UQTA 1S77D 3N5BA 3QIDA 4KH1B 4LRCA 3M6XA 3PW7A 3M6VA 1K44A 1REVA 4F4AA 5J2QA 3FGVA 4DCPB 1BE4A 4O3RA 4I64A 4ID8A 3IG1B 2NSBA 3PR5B 1RAAB 2QO3A 4W4MA 1PILA 3H4DA 1UETA 1S6OA 3OL8A 1SKSA 4WE1B 1UJ5A 2GAHC 1LKZA 3KWMA 3S6EA 3LP0A 1RJJA 1YJVA 3UCUP 2A0FB 2PA8D 2EK1A 3TVYA 1HNIA 2VOPA 2PI5A 2L9DA 1SC3B 2HRYA 1KHVA 3MMAB 3DRRA 2XY6A 3OD2A 4LJMA 1NPRA 5LJ3Y 3E01B 4M8LA 5D0HA 1CQNA 1RBAA 2KG1A 5GAHU 3M6WA 3WC0A 3P5BP 2Y1IA 3A3NB 1SJ4P 1HQUA 1S5ZA 2Q6CA 3ZC4A 1RT2B 3M8QB 3G6ES 2ZVSA 3TA0A 2HMIA 4DV1F 4J9VA 3ELHA 4N8NA 3M30B 2RAQA 2XMKA 5AE2A 4EYHB 1Q81T 1Q5YA 1YDLA 2KHCA 4P2FA 2RQCA 3OTBA 4N76A 4V19X 5M2PA 4ES2A 1UFWA 1IXKA 3V81B 2MB0B 2HFZA 3MI7X 3D5MA 3PEHA 4OJ3A 4JI3J 5IZHA 1PJ7A 5T7LA 3CJ3A 4WFZA 1S59A 1U02A 1HW9A 2EFGA 2MLZA 3FBFA 3UVJB 5GADU 1TK5A 2W9BA 5GAGU 3JSYA 3B82A 3CCJS 3IM9A 2M9KA 4X62F 1YJTA 3PVXA 3CD6S 2RF2A 1N34F 2MKYA 2QEXS 4HLBA 3DRPB 3CF5Q 3OR1A 4LRFA 3HDSA 3N0VA 2D9PA 4ZN3A 3G8SA 2DGXA 1H74A 3DU5A 1VRUA 4DV7F 1HLWA 1RHUB 4OHWA 3EZUA 4O4RA 2QLWA 1AFJA 3G8QA 4ES1A 1B3TA 2HVHA 1R7IA 1WHYA 4JP8A 4JI0F 2LU1A 4DL3A 1EKRA 4LR7A 2AZ1A 4ZLJA 4XIUA 3V6KA 4JV2A 2M7SA 1R8PA 3KDNA 1W25A 1FDNA 1UKUA 2IMOA 2XZWA 5C7PA 4ED8A 3AOAA 4UTGA 3NG8A 3RB3A 2RJZA 1IQZA 1T02A 2OD6A 2HBQB 4FKXA 3Q8QB 2E5LJ 2L9NA 1U2FA 2Q1LA 4OYAA 2FYXA 1FRMA 4GVBA 4DI6A 3TZYA 5IC6B 3TZWA 4GKKJ 3R5AA 4BS2A 2GW8A 1LW2B 3NGDA 2VF3A 4WFAQ 2F8EX 2R2UA 1PAUB 1OY9A 5KFQA 1FNMA 4I68A 3AD9C 4I7FA 4QW8A 4DPOA 1FRXA 1L3TA 2MKCA 2V68A 1TAQA 1HPZB 3D1QA 3IWNC 1TL3B 2GC8A 2G0IA 2XWYA 3OHBA 1QY7A 3FFIB 1YRTA 2AD9A 3JAMU 3TEGA 5DZ6A 2X1AA 4JI5J 1BUXA 4GVLA 4X4VA 1C1CA 1ZZFA 4HEA9 4AQYF 4UY8T 1PSDA 4O3NA 5DDOC 2GVDA 2DR6A 1WOPA 2HVIA 2B5JA 1WKLA 1VRQC 1HD0A 1JB0C 4DR1J 1U1MA 3QSIA 4PRFA 1FDBA 2RS8A 1NZ8A 2RSQA 1S99A 2XLIA 4A8SA 5CCLA 2J6TA 2R2SA 1X4DA 4AL7A 4NXMF 2C1EB 2N3LA 4IR9A 5KFCA 2ROGA 1AB8A 1X5SA 4ED4A 1IKYA 3X3UA 2LKZA 4DV1J 3P49B 2X1BA 3D67A 4KSEB 4NASA 3M2VB 4PCQA 3Q8SB 2RQKA 1WTFA 5ETSA 2GAGC 1FKOB 4WZMA 2WSFC 2QLBB 4F04B 2ZZNA 1I94J 4UZBA 2QMUB 4ETXA 4NLQA 2B9XA 2AP6A 2U2FA 2C2RA 3GZ7A 3OFHA 2DNHA 4P7TA 3CJRA 3UFCX 4RUAA 2ERRA 2VONA 5E3PA 3KMQA 4RW6B 2P6SA 4YR0A 3J7YU 4B3MJ 1K0TA 2NZCA 3Q2TC 4JYAJ 3D0HE 4E0DA 1F3FA 3FDSA 1D09B 2JZ5A 3EXYA 4MAKA 2DIUA 2MMYA 4EZ9A 4CM0A 1XMBA 2W9CB 1WELA 4DPYA 1TKTA 3D6FB 3PJ9A 5KFNA 3W5ZA 2DNLA 2K7JA 3BZQA 1U8WA 4RW8B 5SZTA 3MPVA 1OQ3A 2PN6A 3C16B 4DL5A 1PBUA 3S01A 3RB0A 1EZZB 2JEGA 4DR2F 4WFXA 2OAUA 1JLCA 3IGNA 1FWPA 4C8MA 2FVSA 2NXUA 4KHPF 2VC0A 3M8ZA 3OTEA 4WYLA 1HBMB 1E6YA 4LF2A 2NXJA 1B7FA 5ETVA 1U1NA 2ZBRA 2NPFA 1Q82T 3H5YA 1HNVA 3FQKA 2HQ3A 1Q1KA 4OV6A 4LF8F 1KC8T 4OYBA 4L74A 2CQ0A 1SL0A 4EGLA 1H2UX 3DOKA 3J7A1 2DCUB 4BWJA 1S1TA 1ZAVA 3KJVA 3H40A 2IJFA 2J5AA 1DTQA 1EQMA 2ZWPA 4X65F 4IFYB 4UQGA 3RW6A 3KHGA 3FBCA 3EZOA 4A47A 4B3TJ 1KQKA 1ITPA 4LBIA 2CJYB 2KXFA 3LGNA 8RUCA 3CNQP 4DUYF 2M2BA 3DRSB 2DD8S 1I3OB 2Z2LA 1KFDA 5LT5A 1CULA 1DTTB 3K5NA 2J0XA 5F41A 2IJRA 5A6PA 3CJSA 2KXNB 1FRJA 1IBKJ 2BOPA 3OR1B 4OHYA 3DI6A 2FD2A 3H5UA 5DLFA 1M1GA 1WF0A 2H51B 2FIUA 5DDQC 4IRDA 2WRMA 2OP5A 3BDEA 4YS2A 4Q2MA 4BBYA 3HHLA 3I31A 3HFZB 4CH1A 3UO0A 1DAXA 1CQMA 3VZHA 1SL1A 4O0IA 3DYAB 3GSDA 1NPPA 4WKYA 2M52A 4BDPA 2JJ4D 2D7SA 1TL7A 5CYQB 3MPDA 3G8TA 2OPSB 3KHRA 2A18A 2YKMB 2I5JB 5T7LB 1FKAF 1U26A 5BYQA 1KLNA 3H5XA 1AUDA 2HWIA 2BKOA 4KH0B 2XO6A 1T11A 1R6YA 5IM0A 2BJEA 4F3OA 1TKZB 1JKHA 4BCAA 4Z2XA 3CDUA 1L3SA 1NNDA 3C6TB 4KTQA 1TVRB 1D8ZA 1HBNA 2MSTA 2YH0A 2OJ3A 3JSMB 4M63A 1TL7B 2D9OA 2H5IB 1JLQA 4TYBA 1N36J 5L8RC 4NCAA 1RAOA 1CJTA 5FDLB 3DYAA 1GMWA 4LR8A 1MSWD 3I5BA 4OI3A 3IRWP 4PWDB 2F5GA 3MWBA 2QL9B 4CZCA 1TL4A 4W98A 3W65A 2MKKA 4HACA 1CVJA 1NDKA 2E1MC 2R7VA 1BGXT 1H7WA 1WACA 2XY7A 3M8PB 2AX1A 3QMQA 1LWFB 3J7YI 1WHWA 4P52A 1FK9A 4RUHA 1B0PA 3BSOA 5LMUF 1HI8A 4B17A 4FS2A 1HBOA 1HBOB 1N4LA 2AF6A 1H72C 3MMBA 1TVRA 3N4WA 3GIMA 5HVGA 2KJVA 4H4KA 2BJ3A 5KFGA 5B0CA 3OTOJ 4A8WA 2C2ZB 1JK9B 4KHRA 1YJUA 5D3GA 4ZP8A 3E2EA 4U7UD 2EPIA 3KLEA 4TXSA 5KFFA 3B54A 3KLIB 4C2MA 1V6HA 4LSNB 2W9BB 1VBXA 2J6SA 1S76D 4I2QA 1N32F 2FHKA 1C0TA 3N28A 2KM8C 1EETB 1XMOF 2IBKA 4J37A 2E1CA 3CCZA 1Y00A 2MY8A 1JLQB 2HHTA 2RDIA 3M32A 3ZZYA 5BJRA 1URNA 3NEKA 3FCWA 1IKWA 3GONA 5DZ7A 1KFSA 2CPJA 2E29A 2P6TA 1QSYA 3IGVA 1IM6A 3VCDA 1S4EA 3TA1A 4WYWA 3JSBA 3CDEA 3EICA 5D0GA 1R3NA 1SIWB 5HQ8A 4B3MF 2HZAA 2B3TB 2WVDA 2HNZB 2HVZA 5FLXY 1REGX 2C3PA 3SZ2A 2AMCB 1UWAA 2QG9B 4GMKA 3C16A 5E3AA 3HD1A 4H4OA 4MFBB 5SUHA 3AAWB 2J0WA 1RT7A 3FMBA 3NGUA 2MQQA 4DFMA 4ZVGA 3QPIA 4FYVB 1FVSA 1QVFR 4PABA 5BYSA 2AJ1A 3GV8B 1FFWB 2V8GA 2F40A 2L08A 2O66A 4NEZA 2ZH9A 5K14A 3P45B 3M7VA 5A2QU 1P9QC 3GYXB 1OWXA 2X3DA 3THVA 4B3TF 1LFWA 1VFJA 3OVAA 4K5SA 4FF2A 1HI1A 4LF4J 1BC6A 1JLAB 2E1RA 2HLUA 3EDQB 4FXVA 4KB7A 2N4CA 3ZZZA 4EBDA 1R8HA 3RAQA 2BYCA 3PW0A 2FLLA 3MMCB 2ZBPA 1PC4A 3C8YA 4DLEA 2HG4A 1XR7A 3QYYA 1MMLA 3NOGA 3MPWA 3TJ8A 3UQSA 4BC7A 3CCQS 4K4XA 4ECUA 5HLFB 4J9NA 4Y2CA 5HBMA 2A6MA 1MWZA 2H4WB 4R0JA 4RW7A 3OJUA 4AQYJ 3RRHA 1JLEB 3H7HB 3EGWB 4XDCA 3AY0A 3KK3B 4X4TA 4PAAA 3IO1A 4RX6A 4U8YA 1MU2B 3CCMS 1Q86T 4OMFG 4YUDA 1HQ2A 1HNVB 2E1PA 1TL1A 1HMVB 2BJ9A 4PKDB 5DDRC 1R8AA 4JI8F 4ES3A 2R8IA 3T1HJ 3QJPA 4M5DB 1UAWA 2Z8QA 3FCVA 4DR5J 1J5OA 1LWEA 1NSAA 2XHCA 4FVMA 4CP5A 2DXDA 2A2DA 2PFDA 2QT7A 2RD5C 1JLEA 1M0SA 5HP1B 4LUBA 2OIHA 2DXFA 5LSRA 4A8KA 3D28A 4QIEA 3MDFA 3TUJC 3UWTA 1X4CA 4Y2MA 5K5MA 3TX8A 3MHYA 3PFEA 3N6NA 5KT4A 4GKJF 4DBQA 4PQUA 3Q8UA 3NNCA 1QE1A 1RWPB 4KGKA 3OJSA 3HM9A 1TL3A 4M5IA 3NOCA 4NLYA 3EYZA 1QUVA 2VUGA 1NKBA 2GZOA 3L7UA 2CG4A 4H4MB 4K4YA 1U1KA 3QJLA 1HMVA 3TZZA 3SQOP 3KK2B 3O5TB 1Y3JA 4MIAA 4TYAA 4PQAA 1KDNA 3N6LA 3B8HA 4J9KA 1Y4ZB 4HVZA 4CO2A 2E5HA 3OSNA 3KK3A 2JEIA 4I0WA 4DXLA 3JB9k 1FF2A 4OLPA 5KG3A 4CM2A 4I2PB 3QO9B 4DSFA 3W8GA 3AB2B 5FJ4A 5CH7B 2WW4A 1C2PA 1S48A 1IWAA 1SV5A 4NLOA 4QPTA 1FKOA 7FDRA 4NXMJ 2BJDA 5HMXA 4DQRA 1KLMB 1RE1B 1HQEA 3CJ2A 3ET6A 2EVZA 2CDQA 2HZCA 4P7VA 4U9RA 5A8KB 1IQTA 2I6WA 1DQ9A 2LMIA 3V6DA 2HHPA 3T6BA 3HKZD 1N48A 1RBOB 4K0KJ 4H54A 1S1WB 4PG6A 1TL5A 3NGKA 2QYGA 1GH8A 1FRKA 5KFEA 4UUXA 1S6QB 2H9ZA 4C48A 3M8WA 1ZYQA 4K7QA 3NBPB 4DQIA 5K14B 3D0GE 1FNOA 1FFGB 1F0XA 4LREA 2C28A 2XS7A 4CO3A 5JMNA 2RF2B 2CQCA 2JWNA 5AJ3F 1T94A 1KVKA 2JEJA 2OKQA 1SQGA 4X64J 3R6GB 3MD1A 2IC3A 3KKFA 2BE7D 1RADB 1JXEA 4U67Q 3M9OB 2W4CA 2XS2A 2W4PA 2LCWA 2RNEA 4FXDA 4OZ3A 4Y2KA 1VK3A 3HX9A 3BYRA 3KLIA 1P9YA 4DR4J 3HKWA 2HSEB 5KFAA 4O0NA 2AWZA 1KONA 4QBUA 3T5KA 1VQYA 1T05B 1FJCA 4OX6A 4I7FB 2IRXA 2R7UA 1ZM2A 2DR8A 3K8WA 4HI2A 1SC1B 4K4SA 4TY8A 4TY8B 4EBEA 3K89A 1IKWB 1GK8A 4Q45A 2H4YB 3R2DJ 1GX6A 2GX8A 3D4JA 4ZCMA 2G0CA 3ICLA 2XLJA 2RIJA 1GAOA 2PMWA 3W5YA 4ERDA 2IBOA 4YDDB 1RBLA 5IWAF 3BN7A 4DV6F 4J9RA 1RCOB 4LRDA 2UXDF 3KXDA 5L9XA 2R8JA 3OT9A 3RRGA 3UR3C 2AHOB 2CA9A 4ZPTR 1BQMB 2K06A 4KO0B 3TNVA 1WI6A 4XAKA 3T1YF 4ZLNA 3PTWA 5FDLA 5KFTA 3TUIC 3TVZA 1ZBTA 2V34A 5KAKA 3UD3P 1I6JA 4NLUA 4ZJLA 2W9AA 1RWUA 3MM5A 1Q8IA 2UUBF 1LQ9A 4PPDA 3R6LB 3DC2A 4RWXA 2IDLA 1NK9A 2PEHA 2YWFA 4LF6J 1G7CB 2DNPA 2BQ3A 4EUVA 1C1BB 4OFZA 2CVIA 4A48A 4RLEA 4RNNA 1VC5A 2BA9A 4CH0S 3I9V9 3SBMA 2V9KA 4B3OA 2HHVA 1RTHB 2R7OA 2ILYA 4KFBB 3T5HA 2PDAA 1LFPA 4DFPA 2XYHB 3CJ8A 5EDWA 3GG0A 1PG5B 1HNXF 2M8DB 2ASYA 3BKTA 4B9TA 1HQUB 2R2TA 1L3VA 2ZUAA 4LQ3A 4LR9A 1FXLA 4BLGA 1GXUA 2QMXA 4X66F 2BKNA 3DDKA 3ZTRA 2D3UA 2HLTA 3DM2B 3M30A 4LFAJ 1NB7A 2NLWA 3OTCA 2YWEA 2Y8WA 3HHLB 3PX4A 2OPRB 3QIPB 4DZDA 1N0VC 1ZPVA 2BM1A 4OYMA 4RW4B 3VAGA 3ULHA 2OTLS 3MUVP 1SJRA 4ED7A 3W9IA 3HMJG 1X60A 3KLHB 2J8AA 4ZPCA 2A6OA 1HBUA 5DM6Q 2AT1B 1SIZA 2B9YA 2LDIA 3R5BA 4PWDA 2OPSA 4X64F 4PQUB 1YRXA 2VL1A 2F7VA 2ZBQA 2CQ4A 2BUNA 3VGTA 3X1LB 2LQ5A 4O3SA 4ED2A 3RUBL 1EQ0A 3VTIA 1KWMA 1LWCA 1R8BA 2IM2A 2DO0A 2M8HA 3NCQA 4PG7A 1IBLJ 1M1HA 2IA6A 4Q8EA 4F25A 2MZSA 3W2VB 3E51A 3JYTA 4DL7A 1QSLA 5T41A 4OI0A 1RWKB 2IVMA 4KGZB 2UVVA 4ZP7A 1J2VA 1RT5A 1S6UA 1E6VB 2C3YA 1N52B 3CMAS 4YB6A 4DR3F 2V8VA 4FZVA 1TV6B 4RW9B 2VIHA 3IC1A 1VK8A 3D3BJ 2Q66A 4OL8A 5ETRA 3GYGA 5KG5A 1G4CA 1GXLA 3GCWP 2M88A 3PDNA 1WORA 4R25A 4Q43A 2NZ4A 3DXBA 4KKOA 3C6TA 4Y3CA 4ZPAA 5J2PB 3K57A 4Q0BB 5DG9A 1FWLA 3LF0A 1NMEB 1VBZA 1V3RA 1VRTA 2WZ1A 3KG0A 4X4OA 1IJEB 4LF9F 4FF1A 2X1GA 1DHMA 1NSKL 2CPEA 4TN2A 2AJ2A 2BRLA 2PEBA 2RHSB 4FPRA 4DL2A 3HVTB 3MMCA 1D8YA 3BBFA 4Y00A 3KYLA 5AT1B 1ZTWA 5A8RB 4C6AA 3M1VA 2ZM6J 5EWFA
chains in the Genus database with same CATH topology
4DV7J 4DUYJ 4X64J 2VQFJ 2UUCJ 3R2CJ 4B3RJ 5LMNJ 4NEYA 4DR4J 5LMUJ 3W1YC 3D3CJ 4JI3J 4RJVA 2UXDJ 4KY3A 2VQEJ 3R2DJ 4JI4J 2UUAJ 1N32J 4DR3J 4NEZA 4JI7J 4B3TJ 5A2QU 4LFBJ 4GKJJ 4PWWA 2KVQE 5AJ3J 1HNZJ 4KHPJ 4LF4J 4JI0J 4HHUA 4DR2J 4LF8J 3J81U 1IBKJ 2UU9J 4LF6J 4JI2J 4AQYJ 4X65J 2E5LJ 4LFCJ 1XMOJ 1XMQJ 5IT9U 5FLXU 4JV5J 4YY3J 4GKKJ 2UXCJ 4B3SJ 2UXBJ 4X62J 5LM7E 2F4VJ 4JI8J 4V1Ak 1IBMJ 3T1HJ 4DV4J 1J5EJ 1FJGJ 4LFAJ 4YHHJ 4DR5J 1N34J 3JAMU 4DV2J 4JI5J 4JI1J 2HHHJ 4LF5J 2MTLA 2KL8A 4KYZA 4JI6J 4DR1J 4DV0J 4NXNJ 4DR6J 1N36J 1XNRJ 4DR7J 1IBLJ 4DUZJ 5BR8J 3J80U 3T1YJ 3IMQJ 4DV1J 4DV6J 2UUBJ 4X66J 1N33J 2MEWA 4LF7J 4NXMJ 3D3BJ 1I94J 1HNXJ 3J7AN 4OX9J 4K0KJ 2MQ8A 3OTOJ 4LF9J 1HR0J 1XNQJ 4B3MJ 1HNWJ 4JYAJ 5IWAJ 4DV3J 4DV5J 2ZM6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 J;  4DUY J;  4X64 J;  2VQF J;  2UUC J;  3R2C J;  4B3R J;  5LMN J;  4NEY A;  4DR4 J;  5LMU J;  3W1Y C;  3D3C J;  4JI3 J;  4RJV A;  2UXD J;  4KY3 A;  2VQE J;  3R2D J;  4JI4 J;  2UUA J;  1N32 J;  4DR3 J;  4NEZ A;  4JI7 J;  4B3T J;  5A2Q U;  4LFB J;  4GKJ J;  4PWW A;  2KVQ E;  5AJ3 J;  1HNZ J;  4KHP J;  4LF4 J;  4JI0 J;  4HHU A;  4DR2 J;  4LF8 J;  3J81 U;  1IBK J;  2UU9 J;  4LF6 J;  4JI2 J;  4AQY J;  4X65 J;  2E5L J;  4LFC J;  1XMO J;  1XMQ J;  5IT9 U;  5FLX U;  4JV5 J;  4YY3 J;  4GKK J;  2UXC J;  4B3S J;  2UXB J;  4X62 J;  5LM7 E;  2F4V J;  4JI8 J;  4V1A k;  1IBM J;  3T1H J;  4DV4 J;  1J5E J;  1FJG J;  4LFA J;  4YHH J;  4DR5 J;  1N34 J;  3JAM U;  4DV2 J;  4JI5 J;  4JI1 J;  2HHH J;  4LF5 J;  2MTL A;  2KL8 A;  4KYZ A;  4JI6 J;  4DR1 J;  4DV0 J;  4NXN J;  4DR6 J;  1N36 J;  1XNR J;  4DR7 J;  1IBL J;  4DUZ J;  5BR8 J;  3J80 U;  3T1Y J;  3IMQ J;  4DV1 J;  4DV6 J;  2UUB J;  4X66 J;  1N33 J;  2MEW A;  4LF7 J;  4NXM J;  3D3B J;  1I94 J;  1HNX J;  3J7A N;  4OX9 J;  4K0K J;  2MQ8 A;  3OTO J;  4LF9 J;  1HR0 J;  1XNQ J;  4B3M J;  1HNW J;  4JYA J;  5IWA J;  4DV3 J;  4DV5 J;  2ZM6 J; 
#chains in the Genus database with same CATH topology
 1T03 B;  9RUB A;  4EBC A;  1ROF A;  2WON B;  2XMW A;  1P1L A;  1BQN B;  3CE8 A;  3OV7 A;  1WJ9 A;  1PGZ A;  3BDP A;  3R2C J;  2FLP A;  2HBR B;  4IRK A;  3EDR B;  2L48 A;  1IWG A;  2ASD A;  3G82 A;  3G82 B;  5LMN J;  4NEY A;  5DGA A;  2QRR A;  3CWJ A;  1S9G A;  3OTD A;  4OX8 A;  2CPF A;  1N5S A;  3GU0 A;  4F67 A;  2IRU A;  1S0N A;  3HO1 A;  1OS5 A;  3ENA A;  2B56 A;  3EUN A;  3A4T A;  1OY8 A;  2E44 A;  2G1D A;  3HT0 A;  3OR2 A;  3S7R A;  1EAY C;  1AT1 B;  2CDR B;  2E5J A;  2MZJ A;  3DLG B;  4MK8 A;  3MUR P;  2XO7 A;  1H2T Z;  3QT8 A;  1X9M A;  3FBB A;  2Q3P A;  4ZLP A;  4HTI A;  1OIA A;  1VQS A;  2OLW A;  3RBZ A;  3DOM B;  3NGT A;  5E3R A;  4WFY A;  4X4R A;  4MK7 A;  4KR0 B;  1S49 A;  4DV3 F;  3NWR A;  3C14 B;  4DV2 F;  3M2U B;  1V5I B;  3RBE A;  3HUL A;  1JMT A;  3HLU A;  2CPI A;  3IBF B;  4F4X A;  1RT4 B;  4LFB F;  4M5K A;  4NI2 B;  3A8J A;  4P2M A;  4J9Q A;  3G4S S;  1VI7 A;  1JLG A;  2BQU A;  3PO5 A;  3OUY B;  3OL9 A;  3SDE B;  1YSJ A;  4Q44 A;  4DZ6 A;  3V6H A;  2BZ2 A;  2MJN A;  4F26 A;  2DPI A;  4I69 A;  3UDV A;  3DFE A;  3CJK A;  2HNY B;  2HQG A;  2VPY B;  1NB2 A;  1EAR A;  2DRD A;  3QAU A;  5J1E A;  2HRU A;  1S9E B;  2UV8 A;  1PC5 A;  5F0W A;  2DK2 A;  1RA7 A;  4X4U A;  4GC6 A;  3EMT A;  4ZCL A;  2MKJ A;  4ED6 A;  4DU8 A;  1Q79 A;  3T5L A;  1KKH A;  2FTR A;  3MM9 B;  2FUG 9;  2GHW A;  2V9W A;  2MHN A;  2RU9 A;  3HHN B;  3RW7 A;  1U2C A;  2ILZ A;  2GO9 A;  1VLO A;  3KNG A;  5B09 A;  3D6H B;  4X4P A;  3IN5 A;  1Q8K A;  3LAN A;  4ZIW A;  2JVO A;  2YKN B;  4ECV A;  3O3L A;  3KLH A;  2ZH7 A;  4RW8 A;  1WF2 A;  1BY9 A;  1SUQ A;  1UEU A;  2PO4 A;  4G1P A;  3IA0 A;  2XGP A;  2QE5 A;  4DV4 J;  2HW3 A;  1N6Q B;  4HAC B;  4X4S A;  4YHH J;  2DO4 A;  4WTY A;  3MCS A;  2MKS A;  4P2X A;  4DV2 J;  1B99 A;  1RT6 A;  1RHR B;  4M5G A;  3ZZU A;  4YOE A;  1O51 A;  3PX0 A;  5I3U A;  2MTL A;  2P9G A;  3CD5 A;  3VVU A;  1IM4 A;  1F9E B;  2AYM A;  3D54 A;  2WVB A;  4OI2 A;  4NLD A;  1F6T A;  3AD8 C;  2ROP A;  3NS6 A;  4U95 A;  1HBU B;  3MUT P;  3PO4 A;  1HYS A;  3M8R A;  3US5 A;  1ULR A;  2FVC A;  3IR6 B;  4LBP A;  1F5A A;  1RWM B;  4DR6 J;  3MM6 B;  1RTI A;  3Q0A A;  2XMA A;  1HHQ A;  3GYN A;  1T0T V;  2LFV A;  1NJX A;  3CJ4 A;  5F9L A;  2O3D A;  1TKX B;  3J80 U;  4YEA A;  1FVQ A;  5C2G A;  2KH9 A;  1AZS A;  4MK9 A;  2PFF B;  3LP1 A;  4IR1 A;  1DLO B;  1R0A B;  1R6V A;  3POT B;  2UUB J;  3FMW A;  2E1A A;  5F0U A;  2CNN B;  4N41 A;  1DFD A;  2M70 A;  3FZB A;  5C24 B;  2I2Y A;  2C3O A;  2ZWO A;  4CLL A;  1RCX B;  2MZT A;  2MQ8 A;  1WEZ A;  3GIR A;  2KB2 A;  3DKD A;  3DLJ A;  4UOH A;  3DNC A;  3R97 A;  4EK2 A;  5G0R B;  3R5G A;  3W9J A;  4A8O A;  1F9F A;  1ZM9 A;  5C25 B;  1NK6 A;  1RTI B;  3AFG A;  5IWA J;  1D9A A;  3G6Y A;  4QPX A;  1FJE B;  2WSC C;  5B0B A;  2BE9 B;  2BM0 A;  1U1O A;  3PW4 A;  2QL5 B;  4PPZ A;  1DTT A;  4QWA A;  1PJ6 A;  1UW9 A;  5CQG A;  2B7C B;  3AXK A;  4TLQ A;  5D0R A;  4GC7 A;  3NCR A;  3JQK A;  1Y3K A;  2DGQ A;  2GIF A;  5KFY A;  3OL6 A;  2VFU A;  2RUS A;  3MED A;  1BMQ B;  3LAL A;  2PA3 A;  2KZZ A;  3WBZ A;  2W1B A;  1BQM A;  3ENW A;  4KO0 A;  2GJF A;  4M5N A;  5AXL A;  2XI2 A;  3W9H A;  1MN7 A;  3MOZ A;  1NM2 A;  1VR6 A;  1X8D A;  2BAN A;  4AL6 A;  2AGP A;  3SFU A;  1X5P A;  3KFW X;  1K8A T;  3D3C J;  2VPX B;  4NA2 A;  4WE1 A;  4ZVR B;  3OSP A;  3MMJ A;  1NK7 A;  5A0Y B;  3VAM A;  1HHT P;  1HYS B;  2R8H A;  3EZ5 A;  3AJD A;  4JV0 A;  3PIP Q;  3W63 A;  1RKJ A;  1NJY A;  5KOW A;  2B8P A;  3IS9 A;  3H98 A;  4KIA A;  1SUQ B;  4JI4 J;  1ARO P;  1R27 B;  3GMG A;  3ZTP A;  2BMB A;  2DY1 A;  2NYI A;  2RKI B;  2DR9 A;  2VB6 A;  2XYP B;  5DQI A;  1Z4U A;  2F63 A;  2HIY A;  2WVE A;  2YKQ A;  4DV0 F;  3AQO A;  4ELV A;  1FE4 A;  2ACM A;  2YKO A;  2OUG A;  3P3D A;  4MIB A;  4NLP A;  3PAC A;  1B7Y B;  4B02 A;  4DMZ A;  1CJU A;  3DDN A;  1IBK F;  4RBV A;  3RR8 A;  4GKJ J;  5BR8 F;  4PWW A;  2QX0 A;  4JOU A;  2KJW A;  2EG1 A;  3IFE A;  4OJH A;  3KK1 B;  3K5M A;  4KHP J;  1ZA1 B;  3G87 A;  2L41 A;  2B4P A;  4S0M A;  1TMM A;  4NZ7 A;  5E33 A;  5ADZ A;  2W2N P;  4DR6 F;  2BDP A;  3H20 A;  2HNY A;  3PY8 A;  3C46 A;  4KBI A;  2QV6 A;  3RZA A;  5LJ5 Y;  3R8Y A;  3VHQ A;  1FRI A;  1EB0 A;  1UJ4 A;  3A3P B;  5A6W A;  2B51 A;  4HYK A;  2RVJ A;  2GMJ A;  2CPH A;  4ZDN A;  4X65 J;  2RU3 A;  4ILR A;  2HFO A;  2QL7 B;  2CQB A;  5MAO A;  1WC6 A;  4LFC J;  1JLF B;  1DBD A;  1YBU A;  4FKY A;  3VZI A;  3D2W A;  2W2Q P;  1RT2 A;  4MH8 A;  2JFD A;  2YQ3 A;  4QR2 A;  3OXL A;  3BS9 A;  4D3H A;  5H9E K;  2E9Z A;  5BXI A;  5D8H B;  3MR3 A;  4USW A;  2DH7 A;  2V94 A;  5D4P A;  1YJ9 S;  1IKV B;  3CDB A;  3B6B A;  4RPF A;  3WDO A;  3QFW A;  2OH2 A;  5I4M A;  4X2B A;  2W8K A;  2ABY A;  5AXM A;  2KVI A;  4WII A;  1X9W A;  2DNK A;  1RAB B;  5KFX A;  3G86 A;  5E3Q A;  2KO1 A;  3M05 A;  2FC8 A;  4KRW A;  4EU0 A;  4DCO B;  4YR2 A;  1OYD A;  3EXC X;  4J5O A;  3SV4 A;  4RWW A;  2C3M A;  1I5O B;  5JXS A;  3DMJ A;  5GAE I;  4ZJQ A;  4DG1 A;  1S1V B;  5HMZ A;  3TJA A;  3R5D A;  2RDD A;  4M5L A;  4YME A;  1BWE A;  4G1Q B;  2HHQ A;  1JJ2 R;  2XCP A;  2DGV A;  2XNR A;  2ZD1 B;  3H2V E;  5KT6 A;  2VPW B;  1H6K X;  3MCO A;  2YNH B;  4MYU A;  4TU9 A;  3PRB A;  2VBW A;  4K4T A;  3G71 S;  4NPO A;  2QA1 A;  5I3P A;  4FYD A;  1KD1 T;  3DRX A;  2OPP B;  2Z4P A;  4C8Z A;  3IMQ J;  1JJH A;  2K7K A;  4C3M A;  5H9E J;  5RUB A;  2CQ1 A;  3PIO Q;  3LO3 A;  2OTJ S;  5IT9 Y;  3AA9 A;  2VA3 A;  3KLG A;  4LRB A;  4LSL A;  2XZT B;  2R9L A;  3TYT A;  5L1J A;  1C4A A;  1EET A;  3LWM A;  4R8U B;  2B4V A;  1C0U A;  2SXL A;  1C0U B;  2YWK A;  4CNY A;  2CQ2 A;  1U24 A;  1XK8 A;  2B9E A;  3KHL A;  3J81 j;  1YJN S;  4LF7 F;  1UWB A;  3J80 Y;  1MWY A;  1O6X A;  4M5M A;  4ED0 A;  4LF9 J;  1KVJ A;  1YIJ S;  1U1P A;  4ILM A;  2WW8 A;  1ZZN A;  1FHT A;  1HNW J;  2CRL A;  1UEK A;  5L46 A;  3I9Z A;  4WFB Q;  2H65 B;  2IM0 A;  2CPD A;  2K1R A;  1B0T A;  4G6V B;  2V4J A;  3H0P A;  3NAI A;  4H4O B;  4KAI A;  4MFB A;  4A8X A;  2JNJ A;  3VQS A;  4DR1 F;  2NR0 A;  1Y5L B;  2JRS A;  2K2P A;  3DRY A;  3HSG A;  4K50 A;  3MCM A;  1FX2 A;  1D3W A;  2BRK A;  5HMW A;  1AFI A;  4FYW B;  3MOJ B;  2D3O R;  2QA4 G;  2HGM A;  2RS2 A;  1VBY A;  3IRX B;  2FJV A;  1R89 A;  3J7Z 5;  3CD7 A;  1VQ7 S;  3BQ0 A;  4IH5 A;  4ECY A;  4Y6I A;  3T3F A;  2R8G A;  2J7W A;  3VAH A;  3R3T A;  5LMU J;  5AE1 A;  2D69 A;  4XK8 C;  3KTQ A;  4XDD A;  1XN9 A;  2XS5 A;  4KGM A;  1P6T A;  2NXN A;  4NYZ A;  4OZ1 A;  3CJQ A;  1NK8 A;  3MM8 B;  2VBZ A;  1K9M T;  1PIE A;  3BM7 A;  4IQM A;  3DM2 A;  2EW9 A;  2NXE A;  3CUL A;  1VBK A;  2P8I A;  4RZR A;  4RUB A;  5CAA A;  4U7C A;  3PHT A;  3CUN A;  4YB7 A;  2ZIT A;  3PCO B;  4ZPV R;  2VOD A;  4JV5 F;  1BQX A;  3ZZP A;  2OML A;  2G2Z A;  1JJC B;  3M2V A;  4IOB A;  2MGZ A;  5DQG A;  2P9E A;  1M5P C;  1H38 A;  5CZX A;  1RWN B;  2IYG A;  3D68 A;  4ZA1 A;  4P73 A;  1B70 B;  2EFV A;  3QFH A;  3OLA A;  4C8N A;  2ZOM A;  4FN5 A;  4YB5 A;  5G0R A;  4FBT A;  1KNZ A;  4L6V 3;  2IM1 A;  4USI A;  4UOC A;  2IJN A;  2HHH F;  2IIH A;  2UVU A;  1RT1 B;  1IJF B;  2YKP A;  3K59 A;  2O01 C;  2CQP A;  4O3P A;  4JI0 J;  4LVN P;  3Q89 A;  2D1C A;  3OXF A;  3ENQ A;  3EVM A;  2FHM A;  4UZC A;  3JYT B;  3AOD A;  4EMD A;  5HQL A;  4CO1 A;  2GVD B;  4DX7 A;  1U0H B;  3QZ8 A;  3H4B A;  4E8U A;  2B0G A;  3CSK A;  3LPY A;  5IV3 A;  4PXC A;  3DXS X;  1SJF A;  2GFF A;  3MR6 A;  1WOO A;  4OJ1 A;  2G1H A;  5IT9 U;  3GG1 A;  3H5S A;  3FEZ A;  2RML A;  3T5J A;  3QGI A;  3WX8 A;  2QN6 B;  5J2Q B;  1Q16 B;  3WZ0 A;  4DOZ A;  1OMS A;  3SYZ A;  3IS9 B;  1TKZ A;  3LP2 A;  3MR2 A;  1F5B A;  1Q5V A;  1YJW S;  3D7S B;  1S7I A;  2LXI A;  4DWI A;  4Z7C A;  5HK4 A;  2GVZ A;  1DZ5 A;  1HWI A;  2H48 B;  1LK7 A;  4I6A A;  1UVM A;  1GTH A;  2EFP A;  2UZA A;  3H90 A;  4AD6 A;  2MSS A;  1CJT B;  3MED B;  4QZV B;  2CQG A;  4F4Z A;  2IMW P;  2N3O A;  2ADC A;  3LW5 C;  2VBX A;  2F8H A;  1MW7 A;  1WDD A;  3BYP A;  3I96 A;  2ACY A;  1HBN B;  4G65 A;  3RB6 A;  2DNO A;  4Y2I A;  4CQ1 A;  4ZHR B;  4I4B A;  1FES A;  5KFP A;  4OX7 A;  3TI0 A;  1RYR A;  2AYG A;  1CJV A;  4OI6 A;  2QFI A;  1B64 A;  2Q6B A;  1H0H B;  5KT5 A;  1NO8 A;  1RQ0 A;  2AW0 A;  2OEJ A;  1VRU B;  2DJW A;  1NRK A;  2XSJ A;  2XSF A;  2BJ1 A;  3L7O A;  4DPX A;  4G1I A;  2CPZ A;  2R7W A;  1FA0 A;  3PEJ A;  1RHM B;  3NCP A;  2AZ3 A;  4RL1 A;  4ZCK A;  3TAM B;  2BW7 A;  2YKM A;  1S6Q A;  3DGV A;  2KRB A;  4QYR A;  4JI3 F;  2HPU A;  1WC3 A;  4DV6 J;  1WTB A;  2ALY B;  2V8D A;  2RIL A;  3PHE A;  2GHV C;  1HWL A;  2DT9 A;  2MEW A;  4TVA B;  5J2N A;  3JS9 A;  4LF7 J;  3CDA A;  4OZ5 A;  1DAR A;  2E7W A;  1KBR A;  4HKQ A;  1PBA A;  1HNX J;  1KOO A;  1RWX B;  1NSP A;  1RTJ B;  4F0M A;  1NU4 A;  4NCG B;  3K58 A;  3K0J A;  5KFR A;  3GE9 A;  1BD6 A;  2DHX A;  5L39 A;  4OX9 J;  1UZH A;  1VJW A;  4IQX A;  1UVL A;  2B7B B;  2XNQ A;  3FSY A;  3KOA A;  3ZNU A;  5FII A;  2HND A;  2J0Q D;  1JWW A;  3TVK A;  3MF5 A;  2GV1 A;  2YKA A;  3I6P A;  1BLU A;  1R0A A;  2WBR A;  4BC9 A;  1P1T A;  3PYE A;  4PXE A;  4L75 A;  4CRJ A;  2VIC A;  4K4U A;  3QAE A;  3BH7 B;  4OHV A;  3B4M A;  4U96 A;  3UNY A;  1RTD B;  1NJI T;  1TKX A;  5IS2 A;  2HQC A;  2KYX A;  3IBW A;  1GMW D;  4NLR A;  2HAI A;  4ETZ A;  3LP2 B;  2DKO B;  3MM6 A;  3ISN D;  1HNZ F;  2YX1 A;  4K2X A;  3BEG B;  4ZVU B;  1X5O A;  4URS A;  1RT6 B;  5LOQ A;  2A1B A;  2GHP A;  3TQE A;  1IKY B;  3CB4 A;  1UW4 A;  5A8W A;  3QBC A;  3MFI A;  2ZH1 A;  4MKY A;  2HQF A;  5D15 A;  2YPZ A;  5CYM A;  3U02 A;  3CED A;  1OYE A;  3CIM A;  3OQ2 A;  4UUW A;  2H5E A;  1WC1 A;  1MN9 A;  1N0U A;  4ZCI A;  2YVS A;  4QW9 A;  3CC4 S;  3GCX P;  2KRR A;  4A8Y A;  4DCJ B;  2LU2 A;  4Y65 A;  2ZHA A;  5D3G B;  1S0O A;  2GIR A;  3M6U A;  2CUY A;  1NK4 A;  1VS3 A;  5I42 B;  1X4E A;  3KG1 A;  4DUZ F;  2KKH A;  3RAM A;  1HBM A;  1Q8L A;  2IHR 1;  2ZJR Q;  3MM9 A;  1EHW A;  4ZVF A;  4C98 A;  2C22 A;  1K0V A;  1KVI A;  3V4I A;  2OEM A;  5DQH A;  1Z1Z A;  3TAQ A;  2F65 A;  3PFO A;  1T3N A;  4I67 A;  2HHX A;  4KV8 A;  2COL A;  3T41 A;  1D1U A;  4NML A;  1RT4 A;  3FC9 A;  2AYE A;  2EKY A;  2FZG B;  3T1H F;  2Z2Y B;  3M2R B;  1QAX A;  4OI4 A;  2VDI A;  4PG4 A;  2RHQ B;  2O5D A;  1F2G A;  2KVQ E;  4FP9 A;  4QWC A;  1PCA A;  1YLX A;  1S12 A;  3ZZ0 A;  1LW0 A;  4WKR A;  3O6Q A;  3CTR A;  1T3O A;  4L76 A;  2HK2 A;  4ID5 A;  3QQC D;  4JB8 B;  2ZKU A;  5D78 A;  4OHX A;  3OVS A;  1U7L A;  5KFH A;  1HD1 A;  3NMA A;  1NKC A;  1FEE A;  4ED1 A;  2J9C A;  5KFI A;  7AT1 B;  4K4V A;  2DNM A;  4K2J A;  2VZ9 A;  2UUT A;  3CJ5 A;  4PYA A;  4X4N A;  3M4X A;  4H4M A;  4O4G A;  3GIL A;  2LXU A;  3OBI A;  1KTQ A;  5M2U A;  2O1P A;  4RNH A;  1BQN A;  3NL0 A;  3U1M A;  3PKM A;  1Q78 A;  3NGR A;  3MEK A;  1FD8 A;  3EJM A;  3NY0 A;  3P96 A;  3FSX A;  2J7K A;  3ADA C;  4G1Q A;  4NLS A;  1S9G B;  3DHW C;  5GVQ A;  2NQP A;  2Y8Y A;  1G6B A;  1SH2 A;  1XBW A;  2G2Y A;  3PYG A;  2X7I A;  4BHQ A;  2YY3 A;  3F44 A;  1YGY A;  3RJM B;  2DIT A;  1UA0 A;  1SI9 A;  1PYT A;  1S57 A;  2MJU A;  1R31 A;  2FJB B;  5D4O A;  1Q8B A;  4ATN A;  2YNF A;  2KXH A;  1TMJ A;  5ETO A;  4K59 A;  3ILJ A;  3GR1 A;  2X1F A;  1IKV A;  3NLC A;  4ZVT B;  1S0M A;  3I4H X;  3HSZ A;  3DLL Q;  2GJ2 A;  1B4S A;  2DGT A;  4KJI A;  3TUP A;  4R5P A;  3OXG A;  3GP9 A;  3HJF A;  1RWW B;  2CJQ A;  3NNH A;  4GO7 X;  4IFV B;  1JLF A;  3BQ1 A;  5E5N A;  1LXJ A;  3R7N B;  3ITH B;  1RTH A;  4J9U E;  4DN9 A;  3H25 A;  1FTC A;  4WFN Q;  2AJQ A;  4IUF A;  3THT A;  1CJK A;  1TU0 B;  4V19 J;  1TV6 A;  1RIS A;  4DSJ A;  2UXB F;  2FY8 A;  3W60 A;  3Q8P B;  1WWH A;  3F73 A;  4UT4 A;  3VVT A;  2CJK A;  2Y9H A;  4TU8 A;  3HFK A;  3DMJ B;  3F56 A;  5B7W A;  2B6A A;  4GRS A;  1Z2Z A;  4IO1 A;  2MZ1 A;  3G96 A;  1T9X A;  2MLY A;  2Z56 B;  1YTY A;  3FNN A;  4I1T A;  1HR0 J;  2VG5 A;  3A8I A;  2AKW B;  1LK5 A;  2KZM A;  2ZKT A;  1RK8 A;  2MQL A;  2HGL A;  2ZE2 B;  4QR0 A;  4RNF A;  4L73 A;  1J5E F;  1GMV A;  2B8Q A;  1W2I A;  4DV4 F;  4UY8 5;  2JFK A;  3DLE B;  1KSP A;  5G4D A;  4WJB A;  2ZVI A;  3I82 A;  1ZA2 B;  3QIP A;  3A12 A;  2KFY A;  2MZR A;  5A0Y A;  3Q83 A;  4IDK B;  4MIW A;  1RA6 A;  4HR2 A;  2HBY B;  3C66 A;  4WZQ A;  3W1Y C;  1NHV A;  3MPY A;  3IWL A;  1A6L A;  2Y0B B;  5B0A A;  4ZLL A;  3IR7 B;  3MD3 A;  2D74 B;  2F4V F;  5DJB A;  3FRZ A;  1UTA A;  1VQO S;  3AA8 A;  3PW2 A;  4IH6 A;  1AA1 B;  5KOX A;  4KE5 A;  1F60 B;  2HWT A;  2W2P P;  3E8O A;  2HFU A;  4F7V A;  2EXU A;  2I38 A;  2Q79 A;  3HSD A;  3ZFV A;  3SCK E;  3UPF A;  4DX8 H;  3MTK A;  3CCS S;  4KGX B;  3UDC A;  1U47 A;  1RSC A;  3DHX A;  3LP1 B;  5HJY A;  2BV3 A;  2HRT A;  3BV8 A;  4MKA A;  1MG7 A;  1FNX H;  2NRE A;  4B9S A;  1UVI A;  3UNG C;  4OZJ A;  5B0G A;  4QWD A;  1X4A A;  5AJ3 J;  2ZDP A;  1CC8 A;  2QLX A;  3V6D B;  2FJE B;  2EK6 A;  1N54 B;  4HHU A;  2FLO A;  2NYH A;  3QZ7 A;  3MUM P;  5GAE U;  2RUG A;  2KT2 A;  2UU9 J;  5KG4 A;  2CJB A;  3KUE A;  2Z30 B;  3GR0 A;  3C15 B;  2OSR A;  1VQ4 S;  1EP4 A;  3POT A;  4AL5 A;  6FD1 A;  2W2M P;  4F0K A;  5EGY A;  4N56 A;  4LF5 F;  4K0K F;  4OYO A;  5GAD I;  2XMT A;  3GB0 A;  1N8R T;  3VAJ A;  4JV5 J;  1N5Y B;  1SCJ B;  2JHE A;  5HVH A;  2W01 A;  1DTQ B;  3IM8 A;  3QRQ A;  2YNF B;  3AD7 C;  4O23 A;  1OPI A;  5LM7 E;  2VFS A;  4JI8 J;  1RI7 A;  4IG0 B;  4DSL A;  1SQE A;  1EX8 A;  5IM0 B;  4NYP A;  5CZV A;  2EKN A;  2DGW A;  3GIJ A;  3BGR A;  5L38 A;  2KM8 B;  2AGQ A;  4CCH A;  2HHW A;  1MMN A;  3HF5 A;  4TLR A;  3ONQ A;  4ZVQ B;  1IUJ A;  3MAA B;  5KG1 A;  4WP9 A;  2VJU A;  1FRL A;  2HHH J;  5EWG A;  1B0V A;  1OPZ A;  3OHA A;  2BKP A;  1C4C A;  3TAP A;  2AQ4 A;  4A8F A;  1M5O C;  4Q8F A;  4ZVH A;  3K8V A;  3G6V A;  3Q23 A;  1SQF A;  5DG7 A;  3KG4 A;  1RWO B;  2LQB A;  4QQB A;  3W64 A;  2LEC A;  2AYB A;  2WOM B;  3A13 A;  3UW1 A;  3LWL A;  4QWE A;  1F5C A;  2AIR B;  4PZV A;  4DR7 F;  5CYM B;  5GAG I;  4IG3 A;  4QR1 A;  5DG8 A;  4DUZ J;  4ENO A;  3QT6 A;  4NI2 A;  3AH6 A;  2ZH8 A;  2K3I A;  1FCA A;  1AZS B;  5LL6 d;  3SXL A;  2C2M B;  4ID5 B;  2YWH A;  4WP3 A;  4QIV A;  1HQE B;  1S6P A;  3ET6 B;  4HDG A;  1HI0 P;  1NBE B;  2B9W A;  2M4M A;  2ZZT A;  1TUW A;  4OZ2 A;  4RW6 A;  1VHF A;  2POK A;  2YQ1 A;  2RRB A;  3N79 A;  3HHE A;  3DOM A;  3CMQ A;  2HFS A;  3QGG A;  4K8R A;  1NEE A;  1N56 A;  3D1O A;  2CQD A;  3CGI A;  4ZJO A;  3MEE A;  4EWT A;  4KPY A;  4QWB A;  1U6B A;  1L3U A;  3HCX A;  4KV8 B;  4NLW A;  2HGN A;  1HWJ A;  4J9M A;  1VJQ A;  5U47 A;  3NS5 A;  5GAH I;  1HR0 F;  1WG1 A;  2HND B;  3VQT A;  3VR1 A;  1BXN A;  2R7T A;  4CH7 A;  1YBA A;  1TQL A;  4FDF A;  4OYW A;  5LSL A;  1KQG B;  4NLX A;  4B9M A;  2ZH6 A;  4PWU A;  1RTJ A;  4DX5 A;  3C14 A;  1M5V C;  3G9C A;  1FTR A;  2XZD B;  5IFM A;  1BHN A;  2GCF A;  4OZL A;  3BSA A;  4DUY J;  1T03 A;  3UN2 A;  5K8O A;  1JLB B;  1H73 A;  3AB4 B;  3AT1 B;  3GWC A;  5KG7 A;  2XY5 A;  1M90 T;  4ZP6 A;  2FY1 A;  4ICL A;  4MKV A;  5F8J A;  5KFO A;  4ELT A;  3GJT B;  3NKY A;  1UFL A;  3HI9 A;  2CAD A;  3BGF A;  5B0F A;  2FVQ A;  4DEZ A;  1FJG F;  4IH7 A;  1U48 A;  2Z0G A;  5KFK A;  1NHU A;  1YKW A;  3GPA A;  2QLF B;  1J27 A;  3LOU A;  4NL5 A;  2GQC A;  5HJX A;  1UEV A;  3LH2 S;  1HPZ A;  2CZV C;  2EI5 A;  3RR7 A;  4NLV A;  4QU7 A;  1GFW B;  2JH3 A;  4CO4 A;  2WTF A;  2JEF A;  2QTW A;  4FPI A;  4YDX A;  4JI4 F;  1QUP A;  1KS2 A;  2XWX A;  3M1V B;  3MR7 A;  2FHJ A;  1C0T B;  2DNZ A;  2GVZ B;  3H2U B;  4K5R A;  4P75 A;  2GMH A;  4F4Y A;  3RU0 A;  4QIW D;  3TP2 A;  3DU6 A;  1TKD A;  2IYI A;  4Y2A A;  4J9O A;  1UP1 A;  4UW2 A;  2DPJ A;  2HHU A;  5HSP A;  3CCR S;  2RE1 A;  4L3K A;  1GMU A;  2FJW A;  1FE0 A;  3MMB B;  3PW5 A;  2MQP A;  3BO4 A;  3CC7 S;  2LLZ A;  4YP3 A;  3FSI A;  2LP4 A;  4B9N A;  4J91 A;  3TAM A;  3I0S A;  2YPY A;  4JBC A;  3CCW A;  2D3Z A;  1HFE L;  1R43 A;  2HFV A;  2IRY A;  4F2R A;  2R7S A;  3VGV A;  1X5T A;  3DCA A;  4OYI A;  3CJT A;  4JI2 J;  4J9L A;  3C15 A;  5C42 B;  3CCV S;  3ZZR A;  4Z37 A;  3BJY A;  1JXL A;  5FLX U;  4ZHR A;  2NSC A;  4AND A;  4YY3 J;  2AU0 A;  5JUM A;  4P6Q A;  1AYE A;  3BSN A;  2BX6 A;  2YX4 A;  1U8S A;  5D0E A;  5ITH A;  1Q53 A;  3BQ2 A;  3VAF A;  1L3K A;  3HT3 A;  3MCN A;  3CT9 A;  3Q86 A;  4OJG A;  2R7R A;  1DLO A;  3CW2 C;  2UV8 G;  3UVJ A;  3VGU A;  4EO6 A;  2E5I A;  4F36 A;  3OL7 A;  2JVR A;  1FJ7 A;  2H3E B;  1V5V A;  4LSN A;  1N34 J;  2AJF E;  3V81 A;  4IRC A;  2KI2 A;  5D4N A;  2HMI B;  2PI4 A;  2HVE A;  1S0V A;  4QYZ K;  5J2M A;  4LF5 J;  2DNQ A;  1CJV B;  3M8Y A;  4WPA A;  3GQC A;  3RG6 A;  1NCL A;  3OPK A;  2V6A A;  3PR4 A;  1RUS A;  3MM5 B;  1S10 A;  3T19 A;  2BW2 A;  3B78 A;  3K5P A;  3GJQ B;  1VQK S;  4DV0 J;  3BKU A;  1BWV A;  1CEZ A;  4N77 A;  2LEB A;  2VPZ B;  1E6V A;  3D66 A;  1WSR A;  4WU2 A;  5CAB A;  1WC4 A;  3MMA A;  4X4Q A;  2NPI A;  4ECQ A;  2VFR A;  3PXG a;  3I5A A;  1VLY A;  3MEG B;  2Z57 B;  2ZDO A;  2W8L A;  4FF4 A;  1Z2L A;  4ED5 A;  4Y0F A;  1N33 J;  3TRG A;  2HVD A;  3SV3 A;  4E98 A;  3LGH A;  3QJJ A;  2VH7 A;  2WK4 A;  3KDO A;  1SL2 A;  2ZE2 A;  1LNQ A;  3D9B A;  1UCN A;  2I0X A;  4LFA F;  5H1S V;  1CUL B;  4C9D A;  2P2C B;  4J7C A;  5JJB A;  4IFV A;  3MTJ A;  2MKH A;  4CLK A;  1VQ6 S;  2WCX A;  2YXL A;  3CPW R;  4WK3 A;  4QIF A;  3WIV A;  2IA0 A;  2HQD A;  2AJ4 A;  5F8N A;  3MEG A;  2UU9 F;  3P4U B;  2G4B A;  5K8M A;  4FS1 A;  2V2Z A;  4RNO A;  3TAN A;  2Y1R I;  4M95 A;  1UJ6 A;  4CLS A;  4KGV B;  3TOQ A;  4DV5 J;  2BVZ A;  1RAJ A;  4KC5 A;  2BEF A;  2HK3 A;  2CQ3 A;  3UDE A;  4XPE A;  4C4W A;  5J1P A;  1NH8 A;  5ETP A;  1DUR A;  3FQL A;  4DFK A;  1NK0 A;  4WXO A;  2VG6 B;  2CZ9 A;  4P2S A;  5E2Q A;  1KHW A;  2QC3 A;  2BE2 A;  2FHO B;  1PAE X;  2W7A A;  5IC4 B;  4O44 A;  5J2M B;  5K20 B;  5HO4 A;  2YX7 A;  3GV7 B;  3CC2 S;  1JLC B;  1UZD A;  1JNR B;  1NXI A;  1R0C B;  2VD3 A;  2VAS A;  3EE3 A;  2IAJ B;  4XPC A;  4DSI A;  3I0R A;  2CJX B;  2XLK A;  2DNN A;  3PYD A;  1Y5I B;  3PM9 A;  3ETM A;  5EX0 A;  2DGO A;  4ZIV A;  2RH3 A;  3JQJ A;  2J9E A;  4FBU A;  1YI2 S;  3MXH P;  2HFN A;  2R7Q A;  3RGI A;  4BWM A;  4P74 A;  4OHZ A;  1SPB P;  2M3D A;  2MLX A;  2LA4 A;  4ER8 A;  2DHA A;  3BPS P;  1RT3 A;  3QLH A;  5CA5 A;  4U6P A;  3DRS A;  4RU2 A;  2VG5 B;  3EM1 A;  1U1Q A;  4L72 B;  2LA6 A;  3GFX A;  1A7G E;  2OO4 A;  3C6U A;  2EC2 A;  5AXN A;  2W25 A;  3IG1 A;  1T9V A;  2V2K A;  3SCI E;  3W8P A;  4OIX A;  1L5U A;  3TX0 A;  1U49 A;  4XTT A;  5J1N A;  4JI1 F;  2DHH A;  2OD4 A;  1FEH A;  1H3D A;  2KN4 A;  1FWK A;  1HKA A;  2HS0 A;  2Q43 A;  3BBC A;  2GGP A;  3ITH A;  2XBP A;  3OFE A;  4DUT A;  2HS3 A;  1MLA A;  1UFK A;  1IN0 A;  1VHI A;  4KQZ A;  4NRT A;  3R5J B;  4DQP A;  3QO9 A;  4AYB D;  3M8S A;  1S6P B;  1NH7 A;  3LAM A;  3DOK B;  3M2R A;  4CT8 A;  4MTP A;  5KT3 A;  4ELU A;  1XMQ J;  4AUK A;  1S7H A;  5L9N A;  2ZHB A;  3JTN A;  3KJQ B;  2OFG X;  4ICL B;  4AE5 A;  1J5O B;  2W7O A;  4IFY A;  1VQ8 S;  2UUA F;  2V8H A;  4IG3 B;  4R8U A;  5F8H A;  5I3Q A;  1URR A;  3MM7 B;  2UXB J;  3HFV A;  4CO0 A;  1VGY A;  2BBE A;  1FFS B;  2R4F A;  2CWK A;  3I4P A;  4ZMM A;  6FDR A;  2W9C A;  1NAQ A;  2WOM A;  4IYQ A;  1YRU A;  1KR4 A;  4D3G A;  1CG2 A;  5F8I A;  1XIQ A;  2N82 B;  1MU2 A;  1S72 S;  4W92 B;  2R7X A;  2DH8 A;  1UPP A;  3NBP A;  5BYR A;  5HMY A;  4QU6 A;  3IR5 B;  2ROE A;  2V8P A;  4F02 A;  1YWX A;  3MAA A;  2DR5 A;  1T9U A;  1WI8 A;  4WTO B;  2MHE A;  2CJA A;  5IOL A;  4DS4 A;  1WDT A;  1U2R A;  3P5T L;  5J1E B;  1XR5 A;  4RKU C;  4DG1 B;  3TAR A;  1SJQ A;  1U0S A;  4CO5 A;  4JI6 J;  3VGS A;  3KNA A;  1VCT A;  3N9U C;  1YBT A;  4AXI A;  5EN1 A;  1TKT B;  4P9S A;  1UA1 A;  2KHD A;  3HZE A;  3PKY A;  1AW0 A;  1NDP A;  3UN3 A;  1Y9O A;  4LRA A;  4DF8 A;  1IVZ A;  5KFW A;  3V2U C;  1NSQ A;  1RKI A;  3SIP B;  4ECR A;  5CD4 A;  3D6T B;  2ZUG A;  1HWK A;  3LTO A;  2CPY A;  2D3O 1;  5THW A;  3MR5 A;  3Q8R B;  3Q24 A;  4FYX B;  2W4D A;  4EYI B;  4ECZ A;  4A46 A;  1ZH5 A;  2GGP B;  1K47 A;  2LQJ A;  4DU7 A;  4ECT A;  4NCG A;  2B4U A;  4FNI A;  4MJK A;  3TZX A;  4ZVS B;  2H54 B;  4C0O C;  4EO8 A;  2QLJ B;  2E5L F;  2VKZ G;  1YZ7 A;  1JJ4 A;  2KFZ A;  1XNQ J;  2KFN A;  2VC1 A;  4O44 B;  5KFS A;  1LWX A;  2GJI A;  5HAO A;  4USJ C;  3C6U B;  5I42 A;  3FFI A;  3Q8V A;  1TAU A;  4PG5 A;  2FB0 A;  2XUL A;  1XMQ F;  4KHM A;  2XYG B;  3QRR A;  1SJ3 P;  3BO2 A;  2PII A;  3EVW A;  3FEX B;  2WON A;  1G3O A;  4NZ0 A;  3T6J A;  4DV7 J;  2DBB A;  2XI3 A;  3KLF B;  5HVF A;  2UUC J;  2DRA A;  2DNG A;  2MQO A;  2HYI B;  2VU5 A;  1S1X A;  2VFV A;  4F3M A;  2AEF A;  2B4O A;  2C2K B;  1SKU B;  3HVT A;  4ZVP B;  4GVB B;  2AX0 A;  1NLK L;  4LBH A;  4WWS A;  4I6W A;  2R3V A;  1TK0 A;  3IWX A;  1WEX A;  1Q7Y T;  1S79 A;  1T9Y A;  4CLP A;  3CCU S;  8ATC B;  1HIY A;  4LF4 F;  2DNR A;  3V5R A;  3ZZT A;  3FEY B;  2V67 A;  3BGR B;  1QJH A;  4KY3 A;  2VQE J;  1I51 B;  2VG6 A;  4IO9 Q;  3HK2 A;  2UXD J;  2QSW A;  3IBC B;  1QTN B;  5HN0 A;  1HL6 A;  1RLD A;  2NS1 B;  1PYO B;  5FD1 A;  2XM3 A;  4A8M P;  3SMZ A;  1X4B A;  2ZH3 A;  1N32 J;  4HTJ A;  4QOT A;  1ZET A;  2AEM A;  2DH9 A;  3GFH A;  1NJW A;  4QCL A;  3FVY A;  3ILO A;  4UOF A;  2MQN A;  4C3K A;  2AEJ A;  2BJ7 A;  2RB7 A;  1YJ7 A;  2H5J B;  2JLE A;  3LUY A;  5ETN A;  5C24 A;  2HUR A;  3NWG A;  2NCK L;  2R42 A;  3J7Z T;  3E3X A;  2V4Q A;  2CXE A;  1WSV A;  2ZHO A;  4YN3 B;  3SFG A;  1IR1 A;  1WG4 A;  2A10 A;  3I56 S;  4IOC Q;  1RB0 A;  3OFG A;  4RBT A;  5K8N A;  1G1X A;  4F50 A;  3R9L A;  1K1Q A;  2LDY A;  2O67 A;  2PC6 A;  4USK A;  3JSM A;  5DLG A;  4LF8 J;  1MRO A;  2DEJ A;  1FK9 B;  1TFW A;  4ED3 A;  4YQW A;  5F8G A;  2KT3 A;  4OZN A;  1RHQ B;  3CIZ A;  1U0H A;  5A2Q Y;  3L4B C;  2HS4 A;  5KFL A;  2FZK B;  1XMO J;  1HAR A;  4F3Q A;  5ETQ A;  2BE2 B;  1RHK B;  1WKJ A;  3UE2 A;  2G0J A;  1MMD A;  4DSK A;  1KLM A;  1WG5 A;  2ZFH A;  1GXT A;  3MPU B;  1RAC B;  2ASJ A;  2EBE A;  4LT6 A;  5MLC V;  2DTJ A;  1IBM F;  2ZBI A;  4CNZ A;  1JLG B;  2CZ4 A;  3V4M A;  1YJR A;  2IVY A;  4LQ9 A;  4IDK A;  4CYU B;  2QZ8 A;  2N7Y A;  2V0N A;  3VWS A;  4NOH A;  1FDA A;  4NLT A;  1VMB A;  2BXJ A;  2WVC A;  3HVA A;  3M2U A;  3TQ1 A;  2PD1 A;  2Z2Z A;  1X0F A;  1HHS A;  4EEY A;  1W26 A;  2HEK A;  2NUH A;  3DLE A;  4DN0 A;  3DI6 B;  3GFY A;  3TJ9 A;  3W61 A;  2VDH A;  4J90 A;  4EI2 A;  1FDD A;  4E2F B;  5KFD A;  2RDJ A;  3L9Z A;  2KDO A;  4DFJ A;  2RT3 A;  1QE1 B;  1R8C A;  2WAQ D;  5L1I A;  1FT8 A;  3UD4 P;  2E9R X;  4EZ6 A;  3QRP A;  2CQI A;  4NXN J;  4FNH A;  2K1R B;  1Q0N A;  1SB6 A;  4LIW A;  3HHL D;  4PR6 A;  3FCH A;  3W2W A;  3P8B B;  4HDH A;  3JSR A;  3DN9 A;  1OQ6 A;  1QM9 A;  1SXL A;  2ZNY A;  3DOL A;  2H1Y A;  3FJ2 A;  5IV4 A;  4WCE Q;  4M5D A;  2DXE A;  3AQP A;  4ECX A;  2WB4 A;  4ZPD A;  1N6Q A;  2QFJ A;  4K4Z A;  1XQI A;  2R8K A;  1T9W A;  4URG A;  5LSO A;  3K2Y A;  3ENV A;  4R5P B;  2F1F A;  1T9T A;  1VYA A;  5CHC B;  5E3C A;  3EPG A;  2ZJP Q;  2FVR A;  5IQQ A;  1YX2 A;  1RAF B;  2OPQ A;  4LVO P;  2V4J B;  4ZVE A;  1U6Z A;  2W24 A;  5CCM A;  2MGZ B;  2IM3 A;  3U27 A;  1E6Y B;  3TR5 A;  2MXY A;  4NZ6 A;  4RNM A;  4JI7 F;  4JV1 A;  1XNR J;  3ZTS A;  4J9P A;  2CFX A;  4N47 A;  4DV3 J;  2MY7 A;  1QSS A;  3CDW A;  4OLO A;  2OPP A;  2VJV A;  1QLN A;  3WX4 A;  2DHS A;  1S4F A;  1V9O A;  5GMD A;  1GNK A;  1EIY B;  2DB1 A;  2RQ4 A;  2YNH A;  3GII A;  1CBK A;  2ZNZ A;  4LSL B;  2CYY A;  1DQ8 A;  3UCG A;  4USU A;  3CCL S;  4J9S A;  4C8K A;  1D9F A;  3ZTQ A;  5LXY A;  3L09 A;  3MEC A;  3SSQ A;  4CLZ A;  3HHK A;  2EBG A;  2V63 A;  4FXW A;  4P72 A;  1IKX A;  2WVF A;  3UD5 A;  3VAI A;  3GIK A;  1KRP A;  3NRB A;  4DR5 F;  1LWC B;  1X4H A;  2HKE A;  2VFT A;  2XMU A;  4PEO A;  3UI3 A;  5T14 A;  4CDI A;  1RT7 B;  1S1W A;  5DGB A;  2DHG A;  2ZD1 A;  1NJZ A;  3I0S B;  4USV A;  3TA2 A;  1WNE A;  4LMZ A;  3SQG A;  4C8Y A;  3SQG B;  2MKI A;  2J7U A;  1XEZ A;  4B9L A;  5F9N A;  1JLB A;  1SVD A;  1Y7P A;  3S1T A;  3CD0 A;  2CWX A;  1SV5 B;  2HNZ A;  3CCT A;  5DS7 A;  2UUA J;  1RXO B;  4NXN F;  1RU1 A;  4NX9 A;  5JVG Q;  1SC4 B;  5EWE A;  4JI7 J;  5J2P A;  4PYD A;  4Q0B A;  1FO1 A;  1Q7L B;  3NP5 A;  5F3Z A;  5ETK A;  3R1H A;  3VF0 B;  4CLF A;  1HNZ J;  2EFO A;  2FJD B;  2LEP A;  1EKS A;  3I87 A;  4HHH A;  1OSD A;  3M9M B;  2HWH A;  2V4R A;  3ILI A;  3MEE B;  3KLG B;  4NA1 A;  4DR2 J;  4I56 A;  4IKA A;  1FD2 A;  1JNZ B;  1GTE A;  2PT0 A;  2YQ0 A;  4QYZ J;  1WHV A;  2C2O B;  1VQP S;  1SKR A;  3FZ2 A;  2Y0S D;  3KK1 A;  5HL7 Q;  1C1B A;  3BBB A;  1M5S A;  3EGN A;  4C7Q A;  1ICE B;  4OX9 F;  5HRO A;  3S8S A;  3JTP A;  1Y5N B;  2EWH A;  5A8W B;  2ZH2 A;  3QGP A;  2UXC J;  1PO6 A;  2N7C A;  1RP5 A;  1F1B B;  1WHX A;  4PXB A;  1T7P A;  3V6J A;  1O8B A;  3A8K A;  4NA3 A;  2G13 A;  3CVK A;  5B0E A;  3UDL A;  1X7V A;  3HHD A;  1J5E J;  2QYC A;  2PGC A;  3HJV A;  2XHW A;  1N5Y A;  1RTD A;  3KUH A;  5D6G A;  2XGQ A;  1N5Q A;  1NKE A;  3L3C A;  2CIM A;  3QWU A;  4F4W A;  3T9N A;  3OFF A;  4NYO A;  4P10 A;  4I6Y A;  5H9F K;  3H8Y A;  2M0G B;  2NUU G;  4OV1 A;  1HWU A;  3LA0 A;  4ITS A;  4M5H A;  4C11 A;  2XC9 A;  4KYZ A;  1U09 A;  3O8W A;  2AJ0 A;  1IBC B;  2C42 A;  2Z58 B;  4HHJ A;  3PNI A;  4N5S A;  4B9V A;  2VOO A;  3VV2 B;  5KG0 A;  4DX6 A;  3J81 Y;  3N01 A;  1YK9 A;  4WU3 A;  4DR7 J;  5J2N B;  4XO0 A;  3NMR A;  2J0S D;  1VDH A;  2DY9 A;  4LIR A;  3TO8 A;  4Y28 C;  4AFF A;  1MRO B;  1T8E A;  3DRP A;  2IPO B;  2N4D A;  3R7B B;  3OTO F;  1O0P A;  2UVR A;  1NDL A;  1FX4 A;  2OFH X;  4ZIT A;  1K1S A;  2ASL A;  3MZI A;  2VBY A;  1NUE A;  3BPD A;  3PX6 A;  1XER A;  8AT1 B;  5E41 A;  2E7V A;  1XC9 A;  4X84 A;  1RT1 A;  3L7P A;  3Q22 A;  4B3O B;  3GSI A;  3RBX A;  5C42 A;  2IAJ A;  2Y3Y A;  4NCB A;  3F41 A;  3BH6 B;  1FER A;  1OO0 B;  2F9D A;  5C2C A;  4CIO A;  4PXD A;  3HPO A;  5GME A;  2VG7 A;  2K3K A;  2ZEJ A;  4AT1 B;  2JC0 A;  3DLK A;  1N36 F;  2BOA A;  2XSJ B;  3BR9 A;  1SH3 A;  4RBU A;  5M2R A;  2QIF A;  3TWZ A;  3M32 B;  1G2E A;  4QIG A;  1XNQ F;  2VQF J;  2WSE C;  5E0O A;  5KT2 A;  4M5J A;  1T05 A;  1X9S A;  2DRB A;  2YWG A;  1Y10 A;  1ELO A;  2FPH X;  3CO9 A;  3DRR B;  2WHO A;  4PG8 A;  4I2Q B;  1EJ7 L;  3VAK A;  2LQ9 A;  4B3R J;  2C3U A;  4DPW A;  2CAJ A;  2KU7 A;  4DR4 F;  1IBL F;  2FQQ B;  2XEX A;  1NDC A;  1TTH B;  2MPU A;  3N6M A;  2JX2 A;  3AJ1 A;  2IC3 B;  1CSJ A;  3KJV B;  4WBF A;  1RHJ B;  2FGO A;  3IAS 9;  3P6Y C;  3BR8 A;  2UUC F;  2JOQ A;  3RB4 A;  4KT0 C;  5DO2 A;  4RJV A;  4C3L A;  1QAY A;  5KFJ A;  1TUV A;  1REV B;  3ISN C;  3NAH A;  3DLK B;  3PRV A;  3AOC A;  4W90 B;  3HSJ A;  5HAN A;  2MZQ A;  2FJX A;  2AGO A;  1H7X A;  2I9S A;  3E01 A;  3C3L A;  3NS7 B;  1S9F A;  4HH1 A;  1N5V A;  1GQE A;  1P27 B;  2G2O A;  1S97 A;  3ZZO A;  2GA7 A;  3R7S B;  1HNI B;  4TU7 A;  1NK5 A;  2YBV A;  1S1X B;  4N8O A;  1XR6 A;  2XMV A;  1WOS A;  4Q5V A;  2YTC A;  3BSC A;  2OEL A;  3LP0 B;  3KHH A;  4DL0 C;  5KFM A;  3FKB A;  2LXF A;  5A76 A;  1TZ0 A;  4I2P A;  1UL3 A;  1IR2 A;  3D1H A;  2VA2 A;  5F8M A;  4F2S A;  3J81 U;  3ZO7 A;  4NWB A;  1VQL S;  2V5H G;  1FKP A;  2GNK A;  1RYS A;  2ZOG A;  4RW7 B;  5CXT A;  2E9T A;  4DQQ A;  1VQN S;  3SEO A;  3LPE A;  4ZPW R;  5CYJ A;  3B4D A;  4OQJ A;  3GJR B;  3W62 A;  4U8V A;  3GLJ A;  4QJV A;  3A8E A;  3U7J A;  1ZPW X;  3A3O B;  2FC9 A;  2DNY A;  1DY3 A;  1SH0 A;  2KYZ A;  3OR2 B;  5I3U B;  1DQA A;  3SDE A;  2YNG B;  1D0E A;  1OY6 A;  2CG8 A;  1F9H A;  2LEA A;  2MQM A;  2V69 A;  3KUG A;  3CCE S;  4G3I A;  2NXC A;  4MYT A;  1S1V A;  1FJG J;  4WF9 Q;  3JXO A;  2JSX A;  1RAE B;  3K5O A;  4PUO A;  4ALZ A;  1RWV B;  3KK2 A;  4C8L A;  1WC5 A;  3WC2 A;  4CLU A;  2FJA B;  1KQF B;  5KFU A;  2DEI A;  2B6A B;  3MM7 A;  1VIO A;  5LXR A;  2RRN A;  1MNE A;  2UUW A;  2QSF A;  2C2D A;  5DRK A;  4UOG A;  2ZJQ Q;  2ZH4 A;  2ZC4 A;  4DS5 A;  4ZOS A;  1KOH A;  4DPU A;  1SKW A;  1M1K T;  1UVJ A;  4ECW A;  4DL4 A;  1UVN A;  3JQM A;  3G2X A;  3THP A;  3BN4 A;  2QGF B;  1NPK A;  1T95 A;  2E66 A;  3R1L A;  2EFQ A;  3BGO P;  1CJK B;  1YHQ S;  1CS4 B;  2OI2 A;  1RLC L;  5IQ6 A;  3DLB A;  4B08 A;  5BR8 J;  3EPI A;  4K4W A;  3DLH A;  3C2P A;  3OW2 R;  2FLN A;  3BKF A;  1AXQ A;  5K8P A;  1GT8 A;  3GTY X;  3Q2S C;  2ZZM A;  5CD4 H;  2PMZ D;  3CJK B;  2R2R A;  2J6U A;  4IOA Q;  1CPZ A;  1IR0 A;  1HA1 A;  4DJB A;  3HZG A;  1XTZ A;  3PV8 A;  4JYA F;  3TEH B;  3J7A N;  4NLG A;  1WKK A;  3FBE A;  1VIS A;  2V2Q A;  2XQC A;  1DJ0 A;  4TNO A;  4ECS A;  4HH0 A;  1R0B G;  1LV5 A;  1N88 A;  1LW0 B;  1TUG B;  1Y11 A;  2ZC3 A;  3U1N A;  4CTA A;  4RW9 A;  2MDA A;  2UP1 A;  5F3T A;  4DHV A;  1U45 A;  2CKW A;  1PKU A;  4ZVO B;  4TKT A;  4KKO B;  3U1L A;  2ALZ A;  3KJN B;  4B3R F;  2JC1 A;  3OVB A;  5LMN F;  1CC7 A;  3EVO A;  3BB5 A;  1O5J A;  3V4I B;  2YNG A;  3RYL A;  2JL9 A;  3EGV A;  5K9F A;  2PE8 A;  2GQ2 A;  4TQR A;  5KG2 A;  3T9Z A;  5KFB A;  4CWB A;  5B0D A;  2OSQ A;  4KPC A;  4JI5 F;  3QT5 A;  1Q95 G;  3BGU A;  3MFH A;  2W2O P;  1RDR A;  3O2I A;  4FYY B;  3AXM A;  3MEC B;  4O4G B;  2LQ8 A;  2CNK B;  4HT7 A;  3DGP A;  2VHG A;  1DRZ A;  4WIQ A;  3EGZ A;  4MMO A;  5DDP C;  2HBZ B;  3ZXW A;  5JVH Q;  2BAC A;  2OPR A;  1K73 T;  1RU2 A;  1H98 A;  2KG0 A;  4LSZ B;  4ZP9 A;  5IT4 A;  1QAI A;  2CNL B;  2FGC A;  7FD1 A;  3F0N A;  3TW0 A;  4DV5 F;  3KLV A;  1APS A;  3W66 A;  1LEO A;  4U7U K;  3PZP A;  1YG0 A;  2GML A;  2LYV A;  1JX4 A;  1M5H A;  2HHS A;  3UN5 A;  2RRA A;  3BF4 A;  3NXZ A;  1LXN A;  5E7O B;  3IP0 A;  3ETO A;  3ILL A;  3O44 A;  4DR3 J;  2KT5 A;  5B08 A;  1TK8 A;  3W3S A;  1I1G A;  1P8G A;  4CT9 A;  1UMJ A;  2DYA A;  1FXD A;  3K5L A;  2VQF F;  3M8Q A;  3AJ2 A;  2CVE A;  4JUZ A;  5C25 A;  2RKI A;  1GEH A;  3G6X A;  2ZH5 A;  4OYZ A;  1D9D A;  4F4K A;  2Y1L B;  3BO3 A;  4ZPB A;  1QD1 A;  3I5C A;  2CPX A;  1YVF A;  2XMM A;  3H59 A;  3M8P A;  3HVR A;  1RT5 B;  3EWG A;  4FVC A;  1CJU B;  3AHP A;  1VQ5 S;  2B5J B;  1M5K C;  2BQR A;  1N33 F;  1S1U A;  1XJW B;  2EG2 A;  1LOU A;  2I8E A;  3TUZ C;  1KTV A;  3BGL A;  1ZS6 A;  2GS8 A;  4DSE A;  4DL6 A;  3RAX A;  4R0E A;  3T1A A;  1X31 C;  2YWW A;  1VIX A;  3PRD A;  4NRU A;  1WD6 A;  2XCA A;  5L1L A;  3WHI A;  3NNA A;  1RTZ A;  2BAN B;  4YY3 F;  3R5C A;  3CJ0 A;  2WB1 D;  2P5V A;  4O3O A;  2ADB A;  4ILL A;  1RAI B;  1PJ5 A;  9ATC B;  2FZC B;  3D6M B;  4X62 J;  4YFU A;  1FXR A;  5AE3 A;  1U1L A;  1X0P A;  2F4V J;  4JI2 F;  1LWF A;  4V1A k;  3PG9 A;  1IBM J;  1W2B R;  1H2V Z;  3KMS A;  2Y1J A;  1VQM S;  1F3V A;  2EEY A;  1U6F A;  1RAH B;  2G9O A;  2V2V A;  2DIS A;  3QT7 A;  2GIQ A;  1OJ4 A;  3I55 S;  1V3S A;  2UXC F;  2F8M A;  1SJ1 A;  3EX7 B;  3GFZ A;  4MKB A;  1VQ9 S;  2V50 A;  4Y34 A;  4LF1 A;  2A3J A;  1KEK A;  1FRH A;  5CYQ A;  1S1T B;  2YH1 A;  4CLW A;  2J9D E;  2IFX A;  3D0I E;  2DGU A;  3NGS A;  3ZNJ 1;  2LVW A;  3DDI A;  5IT0 A;  4USH A;  1QAJ A;  1RZM A;  2J8S A;  5KFV A;  1YQH A;  4NMX A;  4LF6 F;  4DLG A;  4OYX A;  2W7P A;  1F2H A;  5GMK a;  3W7B A;  2EC0 A;  3LGM A;  3JAM Y;  2XTJ P;  3A1Y G;  3R27 A;  2VG7 B;  4KFB A;  1JKH B;  1TR0 A;  1TP7 A;  2M5Y A;  5D4L A;  3SCJ E;  3L95 X;  3UR0 A;  3CXC R;  4DF4 A;  4CLY A;  2QMW A;  1WC0 A;  4RU9 A;  4MT1 A;  1ZOT A;  3T1Y J;  2X3G A;  3Q8Y A;  4YHH F;  3HP6 A;  2I5J A;  1X4F A;  1Y0H A;  2BAB A;  2HQI A;  3IAM 9;  4RO0 A;  3WIU A;  5HAT A;  1N5T A;  3QAT A;  5AXK A;  3K7R A;  2OGU A;  3N5F A;  2OMO A;  4X66 J;  3ISZ A;  5F8L A;  3KLF A;  4Z7Y A;  2JDJ A;  3HXM A;  3K17 A;  2UVW A;  2B43 A;  4ANC A;  1ZAW A;  2QA2 A;  1S1U B;  2I1R A;  4UF4 A;  3SSR A;  1VOM A;  5A8K A;  3FUY A;  1WF1 A;  5EX3 A;  4C11 B;  2VQE F;  4A8Q A;  2VKR A;  3MM8 A;  4TY9 A;  3ZTO A;  6AT1 B;  4RUC A;  3MAQ A;  4C8O A;  2U1A A;  1X4G A;  5EHH A;  2CNO B;  1VC0 A;  2L9W A;  4H4K C;  3RRK A;  1HW8 A;  3OUY A;  3O1L A;  2GO8 A;  3QWP A;  1CLF A;  4B3S F;  3UCZ P;  5C5J A;  3AOB A;  3C19 A;  2FHJ D;  1YZ6 A;  2CQH A;  1OSC A;  1Q4R A;  1RAG B;  1JIH A;  3FK4 A;  3HD2 A;  4URQ U;  4ZKA A;  2E7X A;  3M9N B;  3RBD A;  1MWQ A;  4HL9 A;  4CLT A;  2FDN A;  3SSS A;  3QSY B;  1V3Z A;  4C0H A;  4YR3 A;  2OHD A;  1JQG A;  2VV5 A;  4WXW A;  4TQS A;  2F3J A;  2YKN A;  4F0H A;  4A4J A;  2C2E A;  2XB2 D;  3WQP A;  4L3N A;  2JLG A;  2F4F A;  1WEY A;  3LQV A;  5EUH A;  1YIT S;  2WBM A;  1I94 F;  3MAH A;  4Q2L A;  4LFC F;  4M94 A;  2X51 A;  4Q7A A;  2QJ3 A;  5HP1 A;  4F8R A;  4JI6 F;  2C2N A;  3SCL E;  1S9E A;  3MGJ A;  1U25 A;  4HI1 A;  4NE9 C;  4DPT A;  5L1K A;  3SI8 A;  4O3Q A;  4EFA C;  3BRE A;  4FF3 A;  2HIQ A;  3QNW B;  1PYS B;  1ZM4 A;  3FRY A;  2D41 A;  2RQM A;  3KJF B;  5HRO B;  2XG8 A;  4C97 A;  1ACM B;  1C1C B;  3QGH A;  3VAL A;  2A2C A;  1NHK L;  2ZOF A;  5HLF A;  3JTO A;  3HHL C;  1LWE B;  2EFN A;  1HNW F;  4LFB J;  1TEL A;  1U1R A;  5KTQ A;  1NZA A;  3W5X A;  2KTQ A;  2J9D A;  2PSZ A;  5HI7 A;  1WUU A;  2CJ9 A;  4USM A;  1JLA A;  3GJS B;  1UPM B;  1UWB B;  1TL1 B;  2QA4 S;  2OPQ B;  2P9C A;  1KP6 A;  1LW2 A;  4WP8 A;  5KG6 A;  2F9J A;  4N7T A;  4RR5 A;  5D77 A;  5DET A;  1KN6 A;  3PYF A;  2IDE A;  2J76 E;  3H42 A;  2Z2M A;  5H9F J;  4OYP A;  3RTV A;  1VC6 A;  1QTM A;  1JXV A;  4ZN1 A;  2FVP A;  1ZTT A;  2PMH A;  1SBR A;  1EP4 B;  1UVK A;  3LAK A;  5ETM A;  5HBM B;  4DQS A;  2BR0 A;  3DGP B;  1RT3 B;  1QDU B;  2YNI A;  3QLH B;  4OZ0 A;  1AUS L;  4ANE A;  4PUO B;  3CME S;  1TFY A;  4GKK F;  3GV5 B;  2DCL A;  2ATL A;  4ZS6 A;  1XWL A;  4GO5 X;  1CS4 A;  4B3S J;  3IRX A;  2DVI A;  3W2W B;  3CO0 P;  3DLG A;  5KFZ A;  3I0R B;  3HVW A;  2ATC B;  2DIV A;  3I32 A;  5HQM A;  5DM7 Q;  2ZBC A;  2ZM6 F;  4ZK7 M;  1IKX B;  1W7W A;  2APO A;  3OLB A;  2HZV A;  2L3M A;  4JI1 J;  4AXJ A;  1ZAX A;  2HAF A;  1FI4 A;  2DGS A;  2YNI B;  4WK1 A;  5ETT A;  2IVF B;  4B9U A;  2IY5 B;  2DR7 A;  4RW4 A;  5KT7 A;  1A9N B;  4IG0 A;  4C0B A;  1FKP B;  2KL8 A;  4DDF A;  1QVG R;  4CTA B;  4CYU A;  5A8R A;  1A0O B;  2GQQ A;  1ZM3 A;  2MYF A;  3KLE B;  4M1K A;  1XNR F;  3H2L A;  5ETL A;  1KQS R;  4YB1 P;  4HT5 A;  3PJW A;  4P71 A;  2AV5 A;  4UST A;  3DOL B;  4OI1 A;  3W2V A;  4CI0 B;  5IXU A;  3IXQ A;  1GX5 A;  2BJ8 A;  2XMJ A;  1U4B A;  2JLF A;  1RGV A;  2K8G A;  1VRT B;  3PJX A;  1SC6 A;  2E5G A;  2OEK A;  4UQT A;  1S77 D;  3N5B A;  3QID A;  4KH1 B;  4LRC A;  3M6X A;  3PW7 A;  3M6V A;  1K44 A;  1REV A;  4F4A A;  5J2Q A;  3FGV A;  4DCP B;  1BE4 A;  4O3R A;  4I64 A;  4ID8 A;  3IG1 B;  2NSB A;  3PR5 B;  1RAA B;  2QO3 A;  4W4M A;  1PIL A;  3H4D A;  1UET A;  1S6O A;  3OL8 A;  1SKS A;  4WE1 B;  1UJ5 A;  2GAH C;  1LKZ A;  3KWM A;  3S6E A;  3LP0 A;  1RJJ A;  1YJV A;  3UCU P;  2A0F B;  2PA8 D;  2EK1 A;  3TVY A;  1HNI A;  2VOP A;  2PI5 A;  2L9D A;  1SC3 B;  2HRY A;  1KHV A;  3MMA B;  3DRR A;  2XY6 A;  3OD2 A;  4LJM A;  1NPR A;  5LJ3 Y;  3E01 B;  4M8L A;  5D0H A;  1CQN A;  1RBA A;  2KG1 A;  5GAH U;  3M6W A;  3WC0 A;  3P5B P;  2Y1I A;  3A3N B;  1SJ4 P;  1HQU A;  1S5Z A;  2Q6C A;  3ZC4 A;  1RT2 B;  3M8Q B;  3G6E S;  2ZVS A;  3TA0 A;  2HMI A;  4DV1 F;  4J9V A;  3ELH A;  4N8N A;  3M30 B;  2RAQ A;  2XMK A;  5AE2 A;  4EYH B;  1Q81 T;  1Q5Y A;  1YDL A;  2KHC A;  4P2F A;  2RQC A;  3OTB A;  4N76 A;  4V19 X;  5M2P A;  4ES2 A;  1UFW A;  1IXK A;  3V81 B;  2MB0 B;  2HFZ A;  3MI7 X;  3D5M A;  3PEH A;  4OJ3 A;  4JI3 J;  5IZH A;  1PJ7 A;  5T7L A;  3CJ3 A;  4WFZ A;  1S59 A;  1U02 A;  1HW9 A;  2EFG A;  2MLZ A;  3FBF A;  3UVJ B;  5GAD U;  1TK5 A;  2W9B A;  5GAG U;  3JSY A;  3B82 A;  3CCJ S;  3IM9 A;  2M9K A;  4X62 F;  1YJT A;  3PVX A;  3CD6 S;  2RF2 A;  1N34 F;  2MKY A;  2QEX S;  4HLB A;  3DRP B;  3CF5 Q;  3OR1 A;  4LRF A;  3HDS A;  3N0V A;  2D9P A;  4ZN3 A;  3G8S A;  2DGX A;  1H74 A;  3DU5 A;  1VRU A;  4DV7 F;  1HLW A;  1RHU B;  4OHW A;  3EZU A;  4O4R A;  2QLW A;  1AFJ A;  3G8Q A;  4ES1 A;  1B3T A;  2HVH A;  1R7I A;  1WHY A;  4JP8 A;  4JI0 F;  2LU1 A;  4DL3 A;  1EKR A;  4LR7 A;  2AZ1 A;  4ZLJ A;  4XIU A;  3V6K A;  4JV2 A;  2M7S A;  1R8P A;  3KDN A;  1W25 A;  1FDN A;  1UKU A;  2IMO A;  2XZW A;  5C7P A;  4ED8 A;  3AOA A;  4UTG A;  3NG8 A;  3RB3 A;  2RJZ A;  1IQZ A;  1T02 A;  2OD6 A;  2HBQ B;  4FKX A;  3Q8Q B;  2E5L J;  2L9N A;  1U2F A;  2Q1L A;  4OYA A;  2FYX A;  1FRM A;  4GVB A;  4DI6 A;  3TZY A;  5IC6 B;  3TZW A;  4GKK J;  3R5A A;  4BS2 A;  2GW8 A;  1LW2 B;  3NGD A;  2VF3 A;  4WFA Q;  2F8E X;  2R2U A;  1PAU B;  1OY9 A;  5KFQ A;  1FNM A;  4I68 A;  3AD9 C;  4I7F A;  4QW8 A;  4DPO A;  1FRX A;  1L3T A;  2MKC A;  2V68 A;  1TAQ A;  1HPZ B;  3D1Q A;  3IWN C;  1TL3 B;  2GC8 A;  2G0I A;  2XWY A;  3OHB A;  1QY7 A;  3FFI B;  1YRT A;  2AD9 A;  3JAM U;  3TEG A;  5DZ6 A;  2X1A A;  4JI5 J;  1BUX A;  4GVL A;  4X4V A;  1C1C A;  1ZZF A;  4HEA 9;  4AQY F;  4UY8 T;  1PSD A;  4O3N A;  5DDO C;  2GVD A;  2DR6 A;  1WOP A;  2HVI A;  2B5J A;  1WKL A;  1VRQ C;  1HD0 A;  1JB0 C;  4DR1 J;  1U1M A;  3QSI A;  4PRF A;  1FDB A;  2RS8 A;  1NZ8 A;  2RSQ A;  1S99 A;  2XLI A;  4A8S A;  5CCL A;  2J6T A;  2R2S A;  1X4D A;  4AL7 A;  4NXM F;  2C1E B;  2N3L A;  4IR9 A;  5KFC A;  2ROG A;  1AB8 A;  1X5S A;  4ED4 A;  1IKY A;  3X3U A;  2LKZ A;  4DV1 J;  3P49 B;  2X1B A;  3D67 A;  4KSE B;  4NAS A;  3M2V B;  4PCQ A;  3Q8S B;  2RQK A;  1WTF A;  5ETS A;  2GAG C;  1FKO B;  4WZM A;  2WSF C;  2QLB B;  4F04 B;  2ZZN A;  1I94 J;  4UZB A;  2QMU B;  4ETX A;  4NLQ A;  2B9X A;  2AP6 A;  2U2F A;  2C2R A;  3GZ7 A;  3OFH A;  2DNH A;  4P7T A;  3CJR A;  3UFC X;  4RUA A;  2ERR A;  2VON A;  5E3P A;  3KMQ A;  4RW6 B;  2P6S A;  4YR0 A;  3J7Y U;  4B3M J;  1K0T A;  2NZC A;  3Q2T C;  4JYA J;  3D0H E;  4E0D A;  1F3F A;  3FDS A;  1D09 B;  2JZ5 A;  3EXY A;  4MAK A;  2DIU A;  2MMY A;  4EZ9 A;  4CM0 A;  1XMB A;  2W9C B;  1WEL A;  4DPY A;  1TKT A;  3D6F B;  3PJ9 A;  5KFN A;  3W5Z A;  2DNL A;  2K7J A;  3BZQ A;  1U8W A;  4RW8 B;  5SZT A;  3MPV A;  1OQ3 A;  2PN6 A;  3C16 B;  4DL5 A;  1PBU A;  3S01 A;  3RB0 A;  1EZZ B;  2JEG A;  4DR2 F;  4WFX A;  2OAU A;  1JLC A;  3IGN A;  1FWP A;  4C8M A;  2FVS A;  2NXU A;  4KHP F;  2VC0 A;  3M8Z A;  3OTE A;  4WYL A;  1HBM B;  1E6Y A;  4LF2 A;  2NXJ A;  1B7F A;  5ETV A;  1U1N A;  2ZBR A;  2NPF A;  1Q82 T;  3H5Y A;  1HNV A;  3FQK A;  2HQ3 A;  1Q1K A;  4OV6 A;  4LF8 F;  1KC8 T;  4OYB A;  4L74 A;  2CQ0 A;  1SL0 A;  4EGL A;  1H2U X;  3DOK A;  3J7A 1;  2DCU B;  4BWJ A;  1S1T A;  1ZAV A;  3KJV A;  3H40 A;  2IJF A;  2J5A A;  1DTQ A;  1EQM A;  2ZWP A;  4X65 F;  4IFY B;  4UQG A;  3RW6 A;  3KHG A;  3FBC A;  3EZO A;  4A47 A;  4B3T J;  1KQK A;  1ITP A;  4LBI A;  2CJY B;  2KXF A;  3LGN A;  8RUC A;  3CNQ P;  4DUY F;  2M2B A;  3DRS B;  2DD8 S;  1I3O B;  2Z2L A;  1KFD A;  5LT5 A;  1CUL A;  1DTT B;  3K5N A;  2J0X A;  5F41 A;  2IJR A;  5A6P A;  3CJS A;  2KXN B;  1FRJ A;  1IBK J;  2BOP A;  3OR1 B;  4OHY A;  3DI6 A;  2FD2 A;  3H5U A;  5DLF A;  1M1G A;  1WF0 A;  2H51 B;  2FIU A;  5DDQ C;  4IRD A;  2WRM A;  2OP5 A;  3BDE A;  4YS2 A;  4Q2M A;  4BBY A;  3HHL A;  3I31 A;  3HFZ B;  4CH1 A;  3UO0 A;  1DAX A;  1CQM A;  3VZH A;  1SL1 A;  4O0I A;  3DYA B;  3GSD A;  1NPP A;  4WKY A;  2M52 A;  4BDP A;  2JJ4 D;  2D7S A;  1TL7 A;  5CYQ B;  3MPD A;  3G8T A;  2OPS B;  3KHR A;  2A18 A;  2YKM B;  2I5J B;  5T7L B;  1FKA F;  1U26 A;  5BYQ A;  1KLN A;  3H5X A;  1AUD A;  2HWI A;  2BKO A;  4KH0 B;  2XO6 A;  1T11 A;  1R6Y A;  5IM0 A;  2BJE A;  4F3O A;  1TKZ B;  1JKH A;  4BCA A;  4Z2X A;  3CDU A;  1L3S A;  1NND A;  3C6T B;  4KTQ A;  1TVR B;  1D8Z A;  1HBN A;  2MST A;  2YH0 A;  2OJ3 A;  3JSM B;  4M63 A;  1TL7 B;  2D9O A;  2H5I B;  1JLQ A;  4TYB A;  1N36 J;  5L8R C;  4NCA A;  1RAO A;  1CJT A;  5FDL B;  3DYA A;  1GMW A;  4LR8 A;  1MSW D;  3I5B A;  4OI3 A;  3IRW P;  4PWD B;  2F5G A;  3MWB A;  2QL9 B;  4CZC A;  1TL4 A;  4W98 A;  3W65 A;  2MKK A;  4HAC A;  1CVJ A;  1NDK A;  2E1M C;  2R7V A;  1BGX T;  1H7W A;  1WAC A;  2XY7 A;  3M8P B;  2AX1 A;  3QMQ A;  1LWF B;  3J7Y I;  1WHW A;  4P52 A;  1FK9 A;  4RUH A;  1B0P A;  3BSO A;  5LMU F;  1HI8 A;  4B17 A;  4FS2 A;  1HBO A;  1HBO B;  1N4L A;  2AF6 A;  1H72 C;  3MMB A;  1TVR A;  3N4W A;  3GIM A;  5HVG A;  2KJV A;  4H4K A;  2BJ3 A;  5KFG A;  5B0C A;  3OTO J;  4A8W A;  2C2Z B;  1JK9 B;  4KHR A;  1YJU A;  5D3G A;  4ZP8 A;  3E2E A;  4U7U D;  2EPI A;  3KLE A;  4TXS A;  5KFF A;  3B54 A;  3KLI B;  4C2M A;  1V6H A;  4LSN B;  2W9B B;  1VBX A;  2J6S A;  1S76 D;  4I2Q A;  1N32 F;  2FHK A;  1C0T A;  3N28 A;  2KM8 C;  1EET B;  1XMO F;  2IBK A;  4J37 A;  2E1C A;  3CCZ A;  1Y00 A;  2MY8 A;  1JLQ B;  2HHT A;  2RDI A;  3M32 A;  3ZZY A;  5BJR A;  1URN A;  3NEK A;  3FCW A;  1IKW A;  3GON A;  5DZ7 A;  1KFS A;  2CPJ A;  2E29 A;  2P6T A;  1QSY A;  3IGV A;  1IM6 A;  3VCD A;  1S4E A;  3TA1 A;  4WYW A;  3JSB A;  3CDE A;  3EIC A;  5D0G A;  1R3N A;  1SIW B;  5HQ8 A;  4B3M F;  2HZA A;  2B3T B;  2WVD A;  2HNZ B;  2HVZ A;  5FLX Y;  1REG X;  2C3P A;  3SZ2 A;  2AMC B;  1UWA A;  2QG9 B;  4GMK A;  3C16 A;  5E3A A;  3HD1 A;  4H4O A;  4MFB B;  5SUH A;  3AAW B;  2J0W A;  1RT7 A;  3FMB A;  3NGU A;  2MQQ A;  4DFM A;  4ZVG A;  3QPI A;  4FYV B;  1FVS A;  1QVF R;  4PAB A;  5BYS A;  2AJ1 A;  3GV8 B;  1FFW B;  2V8G A;  2F40 A;  2L08 A;  2O66 A;  4NEZ A;  2ZH9 A;  5K14 A;  3P45 B;  3M7V A;  5A2Q U;  1P9Q C;  3GYX B;  1OWX A;  2X3D A;  3THV A;  4B3T F;  1LFW A;  1VFJ A;  3OVA A;  4K5S A;  4FF2 A;  1HI1 A;  4LF4 J;  1BC6 A;  1JLA B;  2E1R A;  2HLU A;  3EDQ B;  4FXV A;  4KB7 A;  2N4C A;  3ZZZ A;  4EBD A;  1R8H A;  3RAQ A;  2BYC A;  3PW0 A;  2FLL A;  3MMC B;  2ZBP A;  1PC4 A;  3C8Y A;  4DLE A;  2HG4 A;  1XR7 A;  3QYY A;  1MML A;  3NOG A;  3MPW A;  3TJ8 A;  3UQS A;  4BC7 A;  3CCQ S;  4K4X A;  4ECU A;  5HLF B;  4J9N A;  4Y2C A;  5HBM A;  2A6M A;  1MWZ A;  2H4W B;  4R0J A;  4RW7 A;  3OJU A;  4AQY J;  3RRH A;  1JLE B;  3H7H B;  3EGW B;  4XDC A;  3AY0 A;  3KK3 B;  4X4T A;  4PAA A;  3IO1 A;  4RX6 A;  4U8Y A;  1MU2 B;  3CCM S;  1Q86 T;  4OMF G;  4YUD A;  1HQ2 A;  1HNV B;  2E1P A;  1TL1 A;  1HMV B;  2BJ9 A;  4PKD B;  5DDR C;  1R8A A;  4JI8 F;  4ES3 A;  2R8I A;  3T1H J;  3QJP A;  4M5D B;  1UAW A;  2Z8Q A;  3FCV A;  4DR5 J;  1J5O A;  1LWE A;  1NSA A;  2XHC A;  4FVM A;  4CP5 A;  2DXD A;  2A2D A;  2PFD A;  2QT7 A;  2RD5 C;  1JLE A;  1M0S A;  5HP1 B;  4LUB A;  2OIH A;  2DXF A;  5LSR A;  4A8K A;  3D28 A;  4QIE A;  3MDF A;  3TUJ C;  3UWT A;  1X4C A;  4Y2M A;  5K5M A;  3TX8 A;  3MHY A;  3PFE A;  3N6N A;  5KT4 A;  4GKJ F;  4DBQ A;  4PQU A;  3Q8U A;  3NNC A;  1QE1 A;  1RWP B;  4KGK A;  3OJS A;  3HM9 A;  1TL3 A;  4M5I A;  3NOC A;  4NLY A;  3EYZ A;  1QUV A;  2VUG A;  1NKB A;  2GZO A;  3L7U A;  2CG4 A;  4H4M B;  4K4Y A;  1U1K A;  3QJL A;  1HMV A;  3TZZ A;  3SQO P;  3KK2 B;  3O5T B;  1Y3J A;  4MIA A;  4TYA A;  4PQA A;  1KDN A;  3N6L A;  3B8H A;  4J9K A;  1Y4Z B;  4HVZ A;  4CO2 A;  2E5H A;  3OSN A;  3KK3 A;  2JEI A;  4I0W A;  4DXL A;  3JB9 k;  1FF2 A;  4OLP A;  5KG3 A;  4CM2 A;  4I2P B;  3QO9 B;  4DSF A;  3W8G A;  3AB2 B;  5FJ4 A;  5CH7 B;  2WW4 A;  1C2P A;  1S48 A;  1IWA A;  1SV5 A;  4NLO A;  4QPT A;  1FKO A;  7FDR A;  4NXM J;  2BJD A;  5HMX A;  4DQR A;  1KLM B;  1RE1 B;  1HQE A;  3CJ2 A;  3ET6 A;  2EVZ A;  2CDQ A;  2HZC A;  4P7V A;  4U9R A;  5A8K B;  1IQT A;  2I6W A;  1DQ9 A;  2LMI A;  3V6D A;  2HHP A;  3T6B A;  3HKZ D;  1N48 A;  1RBO B;  4K0K J;  4H54 A;  1S1W B;  4PG6 A;  1TL5 A;  3NGK A;  2QYG A;  1GH8 A;  1FRK A;  5KFE A;  4UUX A;  1S6Q B;  2H9Z A;  4C48 A;  3M8W A;  1ZYQ A;  4K7Q A;  3NBP B;  4DQI A;  5K14 B;  3D0G E;  1FNO A;  1FFG B;  1F0X A;  4LRE A;  2C28 A;  2XS7 A;  4CO3 A;  5JMN A;  2RF2 B;  2CQC A;  2JWN A;  5AJ3 F;  1T94 A;  1KVK A;  2JEJ A;  2OKQ A;  1SQG A;  4X64 J;  3R6G B;  3MD1 A;  2IC3 A;  3KKF A;  2BE7 D;  1RAD B;  1JXE A;  4U67 Q;  3M9O B;  2W4C A;  2XS2 A;  2W4P A;  2LCW A;  2RNE A;  4FXD A;  4OZ3 A;  4Y2K A;  1VK3 A;  3HX9 A;  3BYR A;  3KLI A;  1P9Y A;  4DR4 J;  3HKW A;  2HSE B;  5KFA A;  4O0N A;  2AWZ A;  1KON A;  4QBU A;  3T5K A;  1VQY A;  1T05 B;  1FJC A;  4OX6 A;  4I7F B;  2IRX A;  2R7U A;  1ZM2 A;  2DR8 A;  3K8W A;  4HI2 A;  1SC1 B;  4K4S A;  4TY8 A;  4TY8 B;  4EBE A;  3K89 A;  1IKW B;  1GK8 A;  4Q45 A;  2H4Y B;  3R2D J;  1GX6 A;  2GX8 A;  3D4J A;  4ZCM A;  2G0C A;  3ICL A;  2XLJ A;  2RIJ A;  1GAO A;  2PMW A;  3W5Y A;  4ERD A;  2IBO A;  4YDD B;  1RBL A;  5IWA F;  3BN7 A;  4DV6 F;  4J9R A;  1RCO B;  4LRD A;  2UXD F;  3KXD A;  5L9X A;  2R8J A;  3OT9 A;  3RRG A;  3UR3 C;  2AHO B;  2CA9 A;  4ZPT R;  1BQM B;  2K06 A;  4KO0 B;  3TNV A;  1WI6 A;  4XAK A;  3T1Y F;  4ZLN A;  3PTW A;  5FDL A;  5KFT A;  3TUI C;  3TVZ A;  1ZBT A;  2V34 A;  5KAK A;  3UD3 P;  1I6J A;  4NLU A;  4ZJL A;  2W9A A;  1RWU A;  3MM5 A;  1Q8I A;  2UUB F;  1LQ9 A;  4PPD A;  3R6L B;  3DC2 A;  4RWX A;  2IDL A;  1NK9 A;  2PEH A;  2YWF A;  4LF6 J;  1G7C B;  2DNP A;  2BQ3 A;  4EUV A;  1C1B B;  4OFZ A;  2CVI A;  4A48 A;  4RLE A;  4RNN A;  1VC5 A;  2BA9 A;  4CH0 S;  3I9V 9;  3SBM A;  2V9K A;  4B3O A;  2HHV A;  1RTH B;  2R7O A;  2ILY A;  4KFB B;  3T5H A;  2PDA A;  1LFP A;  4DFP A;  2XYH B;  3CJ8 A;  5EDW A;  3GG0 A;  1PG5 B;  1HNX F;  2M8D B;  2ASY A;  3BKT A;  4B9T A;  1HQU B;  2R2T A;  1L3V A;  2ZUA A;  4LQ3 A;  4LR9 A;  1FXL A;  4BLG A;  1GXU A;  2QMX A;  4X66 F;  2BKN A;  3DDK A;  3ZTR A;  2D3U A;  2HLT A;  3DM2 B;  3M30 A;  4LFA J;  1NB7 A;  2NLW A;  3OTC A;  2YWE A;  2Y8W A;  3HHL B;  3PX4 A;  2OPR B;  3QIP B;  4DZD A;  1N0V C;  1ZPV A;  2BM1 A;  4OYM A;  4RW4 B;  3VAG A;  3ULH A;  2OTL S;  3MUV P;  1SJR A;  4ED7 A;  3W9I A;  3HMJ G;  1X60 A;  3KLH B;  2J8A A;  4ZPC A;  2A6O A;  1HBU A;  5DM6 Q;  2AT1 B;  1SIZ A;  2B9Y A;  2LDI A;  3R5B A;  4PWD A;  2OPS A;  4X64 F;  4PQU B;  1YRX A;  2VL1 A;  2F7V A;  2ZBQ A;  2CQ4 A;  2BUN A;  3VGT A;  3X1L B;  2LQ5 A;  4O3S A;  4ED2 A;  3RUB L;  1EQ0 A;  3VTI A;  1KWM A;  1LWC A;  1R8B A;  2IM2 A;  2DO0 A;  2M8H A;  3NCQ A;  4PG7 A;  1IBL J;  1M1H A;  2IA6 A;  4Q8E A;  4F25 A;  2MZS A;  3W2V B;  3E51 A;  3JYT A;  4DL7 A;  1QSL A;  5T41 A;  4OI0 A;  1RWK B;  2IVM A;  4KGZ B;  2UVV A;  4ZP7 A;  1J2V A;  1RT5 A;  1S6U A;  1E6V B;  2C3Y A;  1N52 B;  3CMA S;  4YB6 A;  4DR3 F;  2V8V A;  4FZV A;  1TV6 B;  4RW9 B;  2VIH A;  3IC1 A;  1VK8 A;  3D3B J;  2Q66 A;  4OL8 A;  5ETR A;  3GYG A;  5KG5 A;  1G4C A;  1GXL A;  3GCW P;  2M88 A;  3PDN A;  1WOR A;  4R25 A;  4Q43 A;  2NZ4 A;  3DXB A;  4KKO A;  3C6T A;  4Y3C A;  4ZPA A;  5J2P B;  3K57 A;  4Q0B B;  5DG9 A;  1FWL A;  3LF0 A;  1NME B;  1VBZ A;  1V3R A;  1VRT A;  2WZ1 A;  3KG0 A;  4X4O A;  1IJE B;  4LF9 F;  4FF1 A;  2X1G A;  1DHM A;  1NSK L;  2CPE A;  4TN2 A;  2AJ2 A;  2BRL A;  2PEB A;  2RHS B;  4FPR A;  4DL2 A;  3HVT B;  3MMC A;  1D8Y A;  3BBF A;  4Y00 A;  3KYL A;  5AT1 B;  1ZTW A;  5A8R B;  4C6A A;  3M1V A;  2ZM6 J;  5EWF A; 
#chains in the Genus database with same CATH homology
 4DV7 J;  4DUY J;  4X64 J;  2VQF J;  2UUC J;  3R2C J;  4B3R J;  5LMN J;  4NEY A;  4DR4 J;  5LMU J;  3W1Y C;  3D3C J;  4JI3 J;  4RJV A;  2UXD J;  4KY3 A;  2VQE J;  3R2D J;  4JI4 J;  2UUA J;  1N32 J;  4DR3 J;  4NEZ A;  4JI7 J;  4B3T J;  5A2Q U;  4LFB J;  4GKJ J;  4PWW A;  2KVQ E;  5AJ3 J;  1HNZ J;  4KHP J;  4LF4 J;  4JI0 J;  4HHU A;  4DR2 J;  4LF8 J;  3J81 U;  1IBK J;  2UU9 J;  4LF6 J;  4JI2 J;  4AQY J;  4X65 J;  2E5L J;  4LFC J;  1XMO J;  1XMQ J;  5IT9 U;  5FLX U;  4JV5 J;  4YY3 J;  4GKK J;  2UXC J;  4B3S J;  2UXB J;  4X62 J;  5LM7 E;  2F4V J;  4JI8 J;  4V1A k;  1IBM J;  3T1H J;  4DV4 J;  1J5E J;  1FJG J;  4LFA J;  4YHH J;  4DR5 J;  1N34 J;  3JAM U;  4DV2 J;  4JI5 J;  4JI1 J;  2HHH J;  4LF5 J;  2MTL A;  2KL8 A;  4KYZ A;  4JI6 J;  4DR1 J;  4DV0 J;  4NXN J;  4DR6 J;  1N36 J;  1XNR J;  4DR7 J;  1IBL J;  4DUZ J;  5BR8 J;  3J80 U;  3T1Y J;  3IMQ J;  4DV1 J;  4DV6 J;  2UUB J;  4X66 J;  1N33 J;  2MEW A;  4LF7 J;  4NXM J;  3D3B J;  1I94 J;  1HNX J;  3J7A N;  4OX9 J;  4K0K J;  2MQ8 A;  3OTO J;  4LF9 J;  1HR0 J;  1XNQ J;  4B3M J;  1HNW J;  4JYA J;  5IWA J;  4DV3 J;  4DV5 J;  2ZM6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...