3J7AS

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
QHILRILNTNVDGKEKVIIALTAIKGIGKRMATVICKQANVDPTKRAGELTTEEIDNIVHIMSTPTQFKIPDWFLNRRKDLKEGKNIHVIANQLDSYLREDLERMKKIRLHRGLRHHWGLRVRGQHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j7aS01
4G4NA 1XMOM 1K3WA 2OQ4A 4LF5M 3TWMA 1L2BA 3GQ4A 1Z59A 4DR4M 3SAVA 1N36M 3GPYA 1XNRM 1MX0A 2F5SA 3JR4A 3U6DA 4JI2M 4PDGA 4JI1M 2UUCM 4JI8M 4LF4M 1HNWM 3U6MA 1XMQM 4JV5M 4JI5M 1IBMM 4LFCM 4DV2M 4LF7M 4DV1M 1N32M 3SASA 4G4OA 4JI4M 1PM5A 3J80S 4GKKM 1R2ZA 4DR3M 1IBKM 4NXNM 2ZBKB 4JYAM 2EA0A 2F5QA 1PJJA 1MU5A 1HNZM 5ITYA 4DUYM 3T1YM 1FJGM 4B3SM 1L2DA 4YY3M 3U6QA 2UUAM 1Z5AA 2Q2EB 2UXBM 2UXDM 3U6LA 4LF6M 3GPXA 5IT9S 3U6EA 3J81S 1HNXM 1Q3BA 5ITTA 3TWLA 4X64M 3U6CA 1L1ZA 3GPPA 5A2QS 1Z5BA 4B3RM 3JAMS 3OTOM 1J5EM 1Z5CA 2F5OA 4JI7M 4K0KM 1K3XA 4NXMM 3GQ5A 4NRVA 4PD2A 1TDHA 3GP1A 1XNQM 4JI3M 3SAUA 1N33M 2ZM6M 4AQYM 5IWAM 4LF8M 4DV5M 4KHPM 1K82A 4DV6M 2UXCM 4DR6M 5ITRA 3JR5A 3SAWA 4LFAM 2XZUA 4B3MM 3DOAA 1HR0M 5ITXE 3T1HM 5ITXA 1NNJA 4DV7M 1Q3CA 5FLXS 4G4QA 1Q39A 1KFVA 3GQ3A 1XC8A 3A45A 3SARA 1EE8A 3SATA 4DR7M 4DR1M 4CISA 4DV3M 2VQFM 1TDZA 4GKJM 2F5NA 3U6OA 5LMUM 3GO8A 4JI6M 4G4RA 1L1TA 3A46A 3U6SA 3VK8A 1N34M 2OPFA 1R2YA 4X66M 4ITQA 4X62M 5BR8M 2HHHM 4B3TM 1I94M 4PCZA 4DR2M 4JI0M 3C58A 1PJIA 4DV0M 3TWKA 2VQEM 1IBLM 4NRWA 3U6PA 2UUBM 4YHHM 3W0FA 4OX9M 4DUZM 5ITQA 2HKJA 2XZFA 2F5PA 5LMNM 4MB7A 4PDIA 1L2CA 2F4VM 4LF9M 3A42A 5ITUA 4LFBM 3SBJA 4DR5M 3VK7A 2UU9M 2E5LM 3J7AS 3GPUA 4DV4M 4X65M
chains in the Genus database with same CATH superfamily
4G4NA 1DO2A 3GLHA 3ILKA 5E26A 2OQ4A 2DZNB 3B7NA 1L2BA 4DR4M 2C9OA 1IM2A 2JY7A 4L78A 4IBCA 3GPYA 1BVSA 4MGYE 4Q7JA 1EIJA 2J7NA 2OOAA 4OVZA 1NV9A 3J27B 3QYBA 5EP4A 4LGMA 4R7GA 2QBYA 5FSWA 2LXEA 2JP7A 2MH8A 2XSZA 3MHVC 4AG5A 4JI8M 2ZTCA 1CUKA 1HNWM 4NL4H 1XMQM 1MJGM 4GHLA 2QQ8A 3FTEA 1V92A 4LJ4A 5KPTA 2FOIC 5JI2E 1L8QA 4HLQA 4DV1M 1N32M 4FD2A 1VDDA 1SG9A 3U60B 1DGHB 2K0BX 2G5GX 2G8LA 3I4YA 4GKKM 1JR3D 3HZJA 4DR3M 4D80A 2LVPC 5FTLA 3IG8A 1D0LA 3SC3A 2F5QA 1GABA 2DVWB 3GLIE 2FE8A 1PJJA 1HNZM 4XGIA 1FJGM 3GLIB 1G71A 2Z3XA 4XK8F 2XEPA 2R6FA 2Q2EB 2R4JA 3U6LA 3U5ZB 3I04M 1WIVA 1Q02A 4BBAA 3SFZA 2LWXA 3GRVA 3WHKA 1I4WA 5ITTA 5EQTA 3M7GA 4OW0A 3GPPA 3R9XB 4GH9A 3RE8A 4JN6A 4QHTA 3OTOM 1TH2A 2CEAA 5FTJA 4Z6YA 1YSYA 2V1UA 2L7IA 3W67A 1KSFX 3THGA 3LCUA 4NXMM 2VF8A 1TDHA 3PNVA 2WSCF 1VQ1A 2WZJA 4MGIE 3I01M 3J7BA 4JI3M 4MGKE 3RGPA 3U61B 2CV0A 4LRSA 1QQWA 4AI6A 5EXPA 2HWJA 4LF8M 1MN3A 2FNAA 2R46A 2BJVA 2DHYA 2R18A 5ITRA 3UJNA 2K6BA 3JR5A 3SAWA 4B08A 2XZUA 3KOXE 1QZEA 1GL7A 4XBOA 1DGFA 2M5ZA 2J7OA 3DOAA 5FTKA 3AKZA 4L15A 2LHCA 2QENA 4CGYB 3GQ3A 1IN7A 3FRIA 3MK6A 3WHLA 3FUUA 5EJCA 2BWBA 1RU3A 2KNAA 3KW6A 4IBFA 3T6PA 2VF7A 3UGJA 3PNYA 4KT0F 1IY2A 4L4UA 1TDZA 2D7GA 2ZTDA 2YFQA 3U6OA 3L28A 1IXZA 4GRIA 2LH0A 3VLFB 2JXNA 2CRUA 2DENA 3TE6A 4WP2A 3LMMA 3W68A 2OPFA 2KZSA 2L6OA 1XXHE 1D0MA 2GQFA 2HHHM 4GC5A 5DNYA 4B3TM 4IBKA 1I94M 2J5YA 1XXHB 2DAMA 2MGWA 2C98A 2YR0A 1NNUC 3C58A 3TWKA 2VQEM 4NRWA 2H1RA 4YHHM 3W0FA 4NSRA 4Z8XA 5EXXA 4MB7A 8CATA 4PT5A 2MJ5B 3HY5A 1IN6A 2DWNA 1QUTA 1QAMA 3A42A 3GLFE 2M60A 3SYLA 3SMPA 4DR5M 3J7AS 2E5LM 2K9DA 3LVVA 3GLGA 3ZC7B 5IWAM 1VG5A 3GPUA 3GLFB 3CGWA 3T38A 1IFYA 2QHOB 1S3SA 2ERCA 3CTWB 1GO5A 1E9RA 1AUAA 3KSXA 1N36M 1DGBA 2I7PA 4B7GA 1V34A 1WR1B 3AV0A 1T3TA 1IN5A 1QDRA 3U6DA 3KDSE 1OQYA 1P3QQ 2DZLA 2ZAMA 2OO9A 1HJPA 2YQZA 3HJ8A 4PDGA 1D0KA 2A5YB 4JI2M 4AKIA 1R4GA 4GIPA 3KXEC 2XH9A 2DXIA 4LF4M 4JV5M 1R7RA 2CHGA 3U60A 4LFCM 3FTCA 2JZ1A 5KPRA 4BLCA 4NXNM 1IBKM 4MGHA 3V76A 2Y0TA 4JYAM 3DZDA 3AOEA 1WXQA 1LTMA 4W5WA 5H37D 3HX3A 4AG6A 2GNOA 2EKFA 5ITYA 2V1CA 2JA2A 3MMPA 4DBGB 3U6QA 1SXJA 3D8LA 3U5ZA 1Z5AA 2BJWA 7CATA 4LJAA 2QNJA 4FCWA 4QNMA 4NSOB 3B7ZA 2Y0QA 2XFTA 1Q3BA 2CWBA 3NBIA 4I81A 3TWLA 4X64M 2C5RA 3FYDA 1NHWC 2L2DA 3EIEA 1L1ZA 2JY6B 2DAEA 5A2QS 1Z5BA 4ZPXA 4LY6A 2X4AA 4WURA 4LRTA 4JI7M 4K0KM 4LZJA 4GC9A 5DYIA 2C9CA 2R44A 3I4VA 4WW0A 3TPZA 1N78A 2XLJA 3FD9A 1E94E 3KOWE 1VEJA 2KA6B 2DKLA 1IXRC 2D7HA 1JB0F 1ZMWA 3U61A 3TQSA 3GRYA 3FUWA 3SAUA 2DWLA 2Z4RA 2HCBA 1K82A 4DV6M 1DV0A 3SHFA 2UXCM 3B89A 3KOZE 4B3MM 2Y20A 5ITXE 1DO0A 3BOSA 3SYKA 3QWLA 3ZQJA 4DV7M 1Q3CA 3HU1A 2WSFF 3T1HM 3AOEC 1H6UA 1Q39A 1JQJC 5FTNA 1IY1A 3HJSA 1XC8A 1OFHA 3SARA 3EIHA 4UN2B 2RKOA 3SATA 2K47A 2Z4SA 2CP8A 4LG2A 4DR1M 1OAOC 1SXJC 4QNRA 3L2AA 2DWZB 4QOZC 3VKHA 3RFWA 1VEGA 3BBZA 3Q8GA 4M0WA 1QAOA 3R8FA 5LMUM 3GO8A 4JI6M 4D82A 4FCVA 5IREB 1NVMA 3U6SA 1XHBA 3VDPA 1WJ7A 4JXJA 2QBYB 3GRRA 3DFZA 4F1IA 3KFUG 2I7NA 4JI0M 1DGGA 4KODA 1PJIA 5KQDA 1PGYA 3SMSA 1HT2E 2LTUA 1IBLM 3U6PA 4M0DA 3HJQA 4NOOB 3IECA 3L29A 3B9PA 2XZFA 3VKGA 4PDIA 3K9PA 5F3WA 1IN4A 1Z6TA 1WGLA 1IN8A 3GLFA 1OKSA 4AW4A 3VK7A 2UU9M 4LFBM 2ZANA 4I4LA 4I5SA 3E46A 3FUVA 4LJ7A 4M9ZA 3VDUA 3TWMA 2OOBA 3FYCA 3KS4A 1SXJD 3FUXA 4IBBA 4LZZA 3RGSA 4A3VB 3SAVA 1GVNA 3LQRA 1XNRM 1TF0B 2QCUA 2F5SA 3C9PA 1HQYE 4IJFA 3F92A 1PJSA 4FVMA 3C3EA 1T6OA 2L7HA 2XSZD 2UUCM 2Z7JA 2MROB 1IXSB 1NHGC 2FH0A 3U6MA 1YLAA 4JI5M 3D8BA 1IBMM 2BWEA 4LF7M 4I8OA 3KP1E 4D81A 2JY5A 3SASA 4NC6A 2JWSA 1PM5A 1NJGA 3J80S 1JR3A 2ZBKB 3HU2A 5KO3A 4AZFA 2JY8A 2B3TA 3UMMA 2KNVA 3H4MA 2JZ0A 1C7YA 1MU5A 1XWIA 2P5TA 2RGHA 3QAUA 4DUYM 3CF0A 3W0LB 4YY3M 2UUAM 1D2NA 2C96A 2UXDM 1LV7A 2G3QA 3GPXA 4LF6M 1QYRA 2X8AA 2EKKA 1HT1E 4QHSA 5FTMA 2XF3A 1G8PA 2H5XA 2LNHC 1Y8GA 3HKPA 1G41A 1GL6A 1HQCA 4AKGA 1J7KA 3UK6A 2VDBB 2EO2A 4LJ5A 3FTFA 2KRKA 2CFOA 3UZUA 1IY0A 3M0EA 1PJQA 2R4EA 3E4RA 1DGHA 1J5EM 3FTDA 1Z5CA 2RGOA 4KLNA 4R3DA 1E32A 1OJLA 5DYGA 4F2LA 4FCTA 2NQ8C 1J09A 2HAKA 2JUJA 4QOSA 2AHMA 3H4JA 4NRVA 4EIWA 1ZMUA 1N75A 4CIZA 4MH0E 4II7A 2YNMD 4L8RC 4GEWA 3GLIA 4G6ZA 2ZM6M 5L8RF 4OU7A 1TTEA 2CV1A 1W5TA 4DV5M 4KHPM 3HHYA 2L4FA 1ZMVA 4LFAM 4IBEA 3KS8A 2DAKA 4AKHA 4RNAA 1HR0M 2LVQD 5ITXA 4GMQA 4GITA 2O01F 4BB9A 3PVSA 5GKNA 1TGUA 3I51A 1EE8A 1FNNA 2KW0A 3GLGE 4FWGA 4DR7M 5KQ8A 2X49A 2LVNC 3GLGB 5EXSA 3KSJA 4GKJM 1A5TA 2DHRA 3M6AA 3L25A 1GJTA 1G3IA 1L1TA 1V33A 2WSEF 4MGZE 4FW9A 1QZMA 3FKEA 3VFDA 3VK8A 3CF2A 4R71A 3NBXX 4X66M 1NV8A 2R45A 2CHVA 3CF6E 1WGNA 4IIWA 3ZH9B 5KPZA 5EP3A 2XGNA 5IZ7D 5E6JA 3BXWA 4IBIA 2UUBM 4OX9M 3LQQA 2R62A 3Q8XA 2JNHA 2RRUA 2VIIA 3L26A 2F4VM 2L09A 5BPVA 4M9SA 5ITUA 3K9OA 1EFUB 2D7EA 3C3DA 1NJFA 3SBJA 3J2PB 2CUZA 4DV4M 2R65A 4X65M 3GLHE 1XMOM 1K3WA 1GKIA 3E21A 4LF5M 3GQ4A 1SXJE 1Z59A 2QSFX 4Y28F 3GLHB 1SXJB 1MX0A 2R0IA 3TL4X 3HHWA 3KP0E 4IBJA 5EP1A 3JR4A 2O5RA 2LVAA 1XXHA 3LCVB 4FWDA 4OVZB 4LGYA 4JI1M 4L6V6 3SHGB 1IXSA 1UFZA 1XB2B 3PXGA 4CJ6A 2KNZA 2LBCA 2HL7A 3IG5A 3AL0C 3E9SA 2BNKA 4DV2M 1TR8A 1NSFA 3GRUA 4G4OA 1T43A 1VEKA 4JI4M 1TH4A 3B7QA 1R2ZA 1PRBA 2KDLA 2DNAA 2KHHA 3ZCBB 3HHXA 2QP9X 4IBDA 4LJ6A 1E9SA 2DAGA 1ORYB 2O25A 2EA0A 2DI0A 3DA1A 4GHAA 3T1YM 4B3SM 1L2DA 1GLNA 1VDLA 3MJ5A 4RF0A 2UXBM 4HL4A 4MM3B 2CV2A 5IT9S 3U6EA 3J81S 3HWSA 1WHCA 3HU3A 1HNXM 2V6ZM 1KYIA 1NY6A 1R5LA 4KO8A 3HGIA 4L16A 2ZAOA 3U6CA 1G59A 1GJSA 2QZ4A 3K8ZA 4P16A 4B3RM 3NWLA 4ANRA 3JAMS 2F5OA 3FUTA 2Z8YM 1K3XA 1YUBA 3L27A 3AJIB 4B7FA 3B74A 3QYEA 2KZUA 3HHZA 3GQ5A 3K92A 4PD2A 1OTRA 1ZAEA 3GP1A 3K1JA 1NO1A 2MR9A 1C1KA 1OAIA 1XNQM 4LCBA 2EJSA 2L4EA 2Y21A 3AFHA 1N33M 1IQPA 1QUSA 1QDTA 2CE7A 4AQYM 4IJEA 3KVWA 2LVOC 4RF1A 4P17A 3FRHA 4DR6M 2EUCA 4CHTB 4HEOA 2DAIA 1QVRA 3KOYE 2KEBA 2N35A 2KRUA 1PJTA 5C1BA 3IHPA 1NNJA 4RKUF 2C99A 4M9XA 4FWHA 4LJ8A 1ZQ9A 5FLXS 4G4QA 2FS1A 3AOGA 3FE3A 1KFVA 3A45A 3LVWA 2XFSA 4IBGA 4G3OA 4CISA 4DV3M 2VQFM 3K2LA 1QANA 1W5SA 2F5NA 4B7HA 1TH3A 5C18A 4G4RA 3LW5F 3A46A 1N34M 1UM8A 2CHQA 1ZV1A 4LJ9A 1R2YA 2QPAA 2DWMA 4X62M 5BR8M 4ITQA 3A98B 1X37A 2W82A 4PCZA 4DR2M 2KXEA 3PFIA 1YE9A 2LHGA 1OIZA 5JI3E 4DV0M 1G4AE 1OIPA 5EP2A 2DZOB 3T15A 4TUWA 4REZA 4DUZM 5ITQA 2HKJA 1OFIA 2F5PA 1NY5A 5DFLA 2APLA 5LMNM 2FFJA 1N77A 1JR3E 1L2CA 4LF9M 4S12A 1AIPC 1QAQA 1F4IA 5EXTA 1R6BX
chains in the Genus database with same CATH topology
4G4NA 1DO2A 3GLHA 3ILKA 5E26A 2OQ4A 2DZNB 1L2BA 4DR4M 2C9OA 1IM2A 4L78A 4IBCA 3GPYA 4MGYE 2J7NA 4OVZA 3J27B 2QBYA 5EP4A 4LGMA 4R7GA 5FSWA 2LXEA 2XSZA 3MHVC 4AG5A 4JI8M 1HNWM 4NL4H 1XMQM 4GHLA 3FTEA 4LJ4A 5KPTA 2FOIC 5JI2E 1L8QA 4HLQA 4DV1M 1N32M 4FD2A 1VDDA 3U60B 1DGHB 2G5GX 2G8LA 3I4YA 4GKKM 1JR3D 4DR3M 4D80A 5FTLA 3IG8A 3SC3A 2F5QA 2DVWB 2FE8A 1PJJA 1HNZM 4XGIA 1FJGM 3GLIB 2Z3XA 2XEPA 2Q2EB 2R4JA 3U6LA 3U5ZB 4BBAA 3SFZA 2LWXA 3GRVA 3WHKA 1I4WA 5ITTA 5EQTA 3M7GA 4OW0A 3GPPA 3R9XB 4GH9A 3RE8A 4JN6A 4QHTA 3OTOM 1TH2A 2CEAA 5FTJA 4Z6YA 1YSYA 2V1UA 2L7IA 1KSFX 3THGA 4NXMM 1TDHA 3PNVA 4MGIE 3J7BA 4JI3M 4MGKE 3RGPA 3U61B 2CV0A 4LRSA 1QQWA 4AI6A 5EXPA 4LF8M 2FNAA 2R46A 2BJVA 2R18A 5ITRA 3UJNA 3JR5A 3SAWA 4B08A 2XZUA 3KOXE 1GL7A 4XBOA 1DGFA 2M5ZA 2J7OA 3DOAA 5FTKA 3AKZA 4L15A 2QENA 4CGYB 3GQ3A 1IN7A 3WHLA 3MK6A 3FUUA 5EJCA 3KW6A 4IBFA 3UGJA 3PNYA 1IY2A 4L4UA 1TDZA 2D7GA 2YFQA 3U6OA 3L28A 1IXZA 4GRIA 2LH0A 3VLFB 3TE6A 3LMMA 2OPFA 2KZSA 2L6OA 2HHHM 4GC5A 5DNYA 4B3TM 4IBKA 1I94M 1XXHB 2C98A 2YR0A 1NNUC 3C58A 3TWKA 2VQEM 4NRWA 2H1RA 4YHHM 3W0FA 4NSRA 4Z8XA 5EXXA 4MB7A 8CATA 4PT5A 1IN6A 2DWNA 1QAMA 3A42A 2M60A 3SYLA 3SMPA 4DR5M 3J7AS 2E5LM 3LVVA 3GLGA 3ZC7B 5IWAM 3GPUA 3GLFB 3T38A 1S3SA 2ERCA 3CTWB 1E9RA 3KSXA 1N36M 1DGBA 2I7PA 4B7GA 3AV0A 1T3TA 1IN5A 3U6DA 3KDSE 3HJ8A 2ZAMA 4JI2M 4PDGA 2YQZA 2A5YB 4AKIA 4GIPA 3KXEC 2XH9A 2DXIA 4LF4M 4JV5M 1R7RA 2CHGA 3U60A 4LFCM 3FTCA 5KPRA 4BLCA 4NXNM 1IBKM 4MGHA 4JYAM 2Y0TA 3DZDA 3AOEA 1WXQA 4W5WA 5H37D 4AG6A 5ITYA 2V1CA 2JA2A 3U6QA 1SXJA 3D8LA 3U5ZA 1Z5AA 2BJWA 7CATA 4LJAA 4FCWA 4QNMA 4NSOB 2Y0QA 2XFTA 1Q3BA 3NBIA 4I81A 3TWLA 4X64M 2C5RA 3FYDA 1NHWC 1L1ZA 3EIEA 5A2QS 1Z5BA 4ZPXA 4LY6A 2X4AA 4WURA 4LRTA 4JI7M 4K0KM 4LZJA 4GC9A 5DYIA 2C9CA 3I4VA 1N78A 4WW0A 3TPZA 2XLJA 3FD9A 1E94E 3KOWE 2KA6B 1IXRC 2D7HA 3U61A 3TQSA 3GRYA 3FUWA 3SAUA 2DWLA 2Z4RA 2HCBA 1K82A 4DV6M 3SHFA 2UXCM 3KOZE 4B3MM 2Y20A 5ITXE 1DO0A 3BOSA 3SYKA 3QWLA 4DV7M 3T1HM 1Q3CA 3HU1A 3AOEC 1H6UA 1Q39A 1JQJC 5FTNA 1IY1A 3HJSA 1XC8A 1OFHA 3SARA 3EIHA 2RKOA 3SATA 2K47A 2Z4SA 4LG2A 4DR1M 1SXJC 4QNRA 3L2AA 2DWZB 4QOZC 3VKHA 3RFWA 4M0WA 1QAOA 3R8FA 5LMUM 3GO8A 4JI6M 4D82A 4FCVA 5IREB 1NVMA 3U6SA 1XHBA 3VDPA 2QBYB 4JXJA 3GRRA 3DFZA 3KFUG 2I7NA 4JI0M 1DGGA 4KODA 1PJIA 5KQDA 3SMSA 1HT2E 1IBLM 3U6PA 4M0DA 3HJQA 4NOOB 3L29A 3B9PA 2XZFA 3VKGA 4PDIA 5F3WA 1IN4A 1Z6TA 4LFBM 1IN8A 3GLFA 4AW4A 3VK7A 2UU9M 2ZANA 4I4LA 4I5SA 3FUVA 4LJ7A 4M9ZA 3VDUA 3TWMA 3KS4A 3FYCA 4LZZA 1SXJD 3FUXA 4IBBA 4A3VB 3RGSA 3SAVA 1GVNA 3LQRA 1XNRM 2QCUA 2F5SA 1HQYE 4IJFA 4FVMA 2L7HA 2XSZD 2UUCM 2Z7JA 1IXSB 1NHGC 3U6MA 4JI5M 3D8BA 1IBMM 4LF7M 4I8OA 3KP1E 4D81A 3SASA 1PM5A 1NJGA 3J80S 1JR3A 2ZBKB 3HU2A 5KO3A 4AZFA 3UMMA 3H4MA 1MU5A 1XWIA 2P5TA 2RGHA 3QAUA 4DUYM 3CF0A 3W0LB 4YY3M 2UUAM 1D2NA 2C96A 2UXDM 1LV7A 3GPXA 4LF6M 1QYRA 2X8AA 1HT1E 4QHSA 5FTMA 2XF3A 1G8PA 2LNHC 3HKPA 1G41A 1GL6A 1HQCA 4AKGA 1J7KA 3UK6A 4LJ5A 2EO2A 3FTFA 2KRKA 2CFOA 3UZUA 1IY0A 3M0EA 3E4RA 2R4EA 1DGHA 1J5EM 3FTDA 1Z5CA 2RGOA 4KLNA 4R3DA 1E32A 1OJLA 5DYGA 4FCTA 2NQ8C 1J09A 4QOSA 2AHMA 4NRVA 4EIWA 1N75A 4MH0E 4II7A 2YNMD 4L8RC 3GLIA 4G6ZA 2ZM6M 4OU7A 2CV1A 1W5TA 4DV5M 4KHPM 3HHYA 4LFAM 4IBEA 3KS8A 4AKHA 4RNAA 1HR0M 5ITXA 4GMQA 4GITA 4BB9A 3PVSA 5GKNA 1TGUA 3I51A 1EE8A 1FNNA 2KW0A 4FWGA 4DR7M 5KQ8A 2X49A 3GLGB 5EXSA 3KSJA 4GKJM 2DHRA 3M6AA 3L25A 1G3IA 1L1TA 4MGZE 3VK8A 4FW9A 1QZMA 3FKEA 3VFDA 3CF2A 4X66M 3CF6E 2R45A 2CHVA 4IIWA 3ZH9B 5KPZA 5EP3A 2XGNA 5IZ7D 5E6JA 4IBIA 2UUBM 4OX9M 3LQQA 2R62A 3Q8XA 2VIIA 3L26A 2F4VM 2L09A 5BPVA 4M9SA 5ITUA 2D7EA 3SBJA 1NJFA 3J2PB 2CUZA 4DV4M 2R65A 4X65M 1XMOM 1K3WA 1GKIA 4LF5M 3GQ4A 1SXJE 1Z59A 3GLHB 1SXJB 1MX0A 3TL4X 3HHWA 3KP0E 4IBJA 5EP1A 3JR4A 2O5RA 1XXHA 4FWDA 4OVZB 4LGYA 4JI1M 3SHGB 3PXGA 2HL7A 3IG5A 3AL0C 3E9SA 2BNKA 4DV2M 1NSFA 3GRUA 4G4OA 4JI4M 1TH4A 1R2ZA 3ZCBB 3HHXA 2QP9X 4IBDA 4LJ6A 1E9SA 2EA0A 1ORYB 3DA1A 4GHAA 3T1YM 4B3SM 1L2DA 1GLNA 3MJ5A 4RF0A 2UXBM 4HL4A 4MM3B 2CV2A 5IT9S 3U6EA 3J81S 3HWSA 3HU3A 1HNXM 2V6ZM 1KYIA 1NY6A 4KO8A 3HGIA 4L16A 2ZAOA 3U6CA 1G59A 2QZ4A 3K8ZA 4P16A 4B3RM 3NWLA 3JAMS 2F5OA 3FUTA 1K3XA 1YUBA 3L27A 3AJIB 4B7FA 2KZUA 3HHZA 3GQ5A 3K92A 4PD2A 1ZAEA 3GP1A 3K1JA 1XNQM 1C1KA 4LCBA 2Y21A 3AFHA 1N33M 1IQPA 2CE7A 4AQYM 4IJEA 3KVWA 4RF1A 4DR6M 2EUCA 4CHTB 3KOYE 1QVRA 2KEBA 2KRUA 5C1BA 1NNJA 2C99A 4M9XA 4FWHA 4LJ8A 1ZQ9A 5FLXS 4G4QA 3AOGA 1KFVA 3A45A 3LVWA 2XFSA 4IBGA 4CISA 4DV3M 2VQFM 3K2LA 1QANA 1W5SA 2F5NA 4B7HA 1TH3A 5C18A 4G4RA 3A46A 1N34M 1UM8A 2CHQA 4LJ9A 1R2YA 2QPAA 2DWMA 4X62M 5BR8M 4ITQA 3A98B 1X37A 2W82A 4PCZA 4DR2M 2KXEA 3PFIA 1YE9A 5JI3E 4DV0M 1G4AE 5EP2A 2DZOB 3T15A 4TUWA 4REZA 4DUZM 5ITQA 2HKJA 1OFIA 2F5PA 1NY5A 5LMNM 2FFJA 1N77A 1L2CA 4LF9M 4S12A 1QAQA 5EXTA 1R6BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4N A;  1XMO M;  1K3W A;  2OQ4 A;  4LF5 M;  3TWM A;  1L2B A;  3GQ4 A;  1Z59 A;  4DR4 M;  3SAV A;  1N36 M;  3GPY A;  1XNR M;  1MX0 A;  2F5S A;  3JR4 A;  3U6D A;  4JI2 M;  4PDG A;  4JI1 M;  2UUC M;  4JI8 M;  4LF4 M;  1HNW M;  3U6M A;  1XMQ M;  4JV5 M;  4JI5 M;  1IBM M;  4LFC M;  4DV2 M;  4LF7 M;  4DV1 M;  1N32 M;  3SAS A;  4G4O A;  4JI4 M;  1PM5 A;  3J80 S;  4GKK M;  1R2Z A;  4DR3 M;  1IBK M;  4NXN M;  2ZBK B;  4JYA M;  2EA0 A;  2F5Q A;  1PJJ A;  1MU5 A;  1HNZ M;  5ITY A;  4DUY M;  3T1Y M;  1FJG M;  4B3S M;  1L2D A;  4YY3 M;  3U6Q A;  2UUA M;  1Z5A A;  2Q2E B;  2UXB M;  2UXD M;  3U6L A;  4LF6 M;  3GPX A;  5IT9 S;  3U6E A;  3J81 S;  1HNX M;  1Q3B A;  5ITT A;  3TWL A;  4X64 M;  3U6C A;  1L1Z A;  3GPP A;  5A2Q S;  1Z5B A;  4B3R M;  3JAM S;  3OTO M;  1J5E M;  1Z5C A;  2F5O A;  4JI7 M;  4K0K M;  1K3X A;  4NXM M;  3GQ5 A;  4NRV A;  4PD2 A;  1TDH A;  3GP1 A;  1XNQ M;  4JI3 M;  3SAU A;  1N33 M;  2ZM6 M;  4AQY M;  5IWA M;  4LF8 M;  4DV5 M;  4KHP M;  1K82 A;  4DV6 M;  2UXC M;  4DR6 M;  5ITR A;  3JR5 A;  3SAW A;  4LFA M;  2XZU A;  4B3M M;  3DOA A;  1HR0 M;  5ITX E;  3T1H M;  5ITX A;  1NNJ A;  4DV7 M;  1Q3C A;  5FLX S;  4G4Q A;  1Q39 A;  1KFV A;  3GQ3 A;  1XC8 A;  3A45 A;  3SAR A;  1EE8 A;  3SAT A;  4DR7 M;  4DR1 M;  4CIS A;  4DV3 M;  2VQF M;  1TDZ A;  4GKJ M;  2F5N A;  3U6O A;  5LMU M;  3GO8 A;  4JI6 M;  4G4R A;  1L1T A;  3A46 A;  3U6S A;  3VK8 A;  1N34 M;  2OPF A;  1R2Y A;  4X66 M;  4ITQ A;  4X62 M;  5BR8 M;  2HHH M;  4B3T M;  1I94 M;  4PCZ A;  4DR2 M;  4JI0 M;  3C58 A;  1PJI A;  4DV0 M;  3TWK A;  2VQE M;  1IBL M;  4NRW A;  3U6P A;  2UUB M;  4YHH M;  3W0F A;  4OX9 M;  4DUZ M;  5ITQ A;  2HKJ A;  2XZF A;  2F5P A;  5LMN M;  4MB7 A;  4PDI A;  1L2C A;  2F4V M;  4LF9 M;  3A42 A;  5ITU A;  4LFB M;  3SBJ A;  4DR5 M;  3VK7 A;  2UU9 M;  2E5L M;  3J7A S;  3GPU A;  4DV4 M;  4X65 M; 
#chains in the Genus database with same CATH topology
 4G4N A;  1DO2 A;  3GLH A;  3ILK A;  5E26 A;  2OQ4 A;  2DZN B;  3B7N A;  1L2B A;  4DR4 M;  2C9O A;  1IM2 A;  2JY7 A;  4L78 A;  4IBC A;  3GPY A;  1BVS A;  4MGY E;  4Q7J A;  1EIJ A;  2J7N A;  2OOA A;  4OVZ A;  1NV9 A;  3J27 B;  3QYB A;  5EP4 A;  4LGM A;  4R7G A;  2QBY A;  5FSW A;  2LXE A;  2JP7 A;  2MH8 A;  2XSZ A;  3MHV C;  4AG5 A;  4JI8 M;  2ZTC A;  1CUK A;  1HNW M;  4NL4 H;  1XMQ M;  1MJG M;  4GHL A;  2QQ8 A;  3FTE A;  1V92 A;  4LJ4 A;  5KPT A;  2FOI C;  5JI2 E;  1L8Q A;  4HLQ A;  4DV1 M;  1N32 M;  4FD2 A;  1VDD A;  1SG9 A;  3U60 B;  1DGH B;  2K0B X;  2G5G X;  2G8L A;  3I4Y A;  4GKK M;  1JR3 D;  3HZJ A;  4DR3 M;  4D80 A;  2LVP C;  5FTL A;  3IG8 A;  1D0L A;  3SC3 A;  2F5Q A;  1GAB A;  2DVW B;  3GLI E;  2FE8 A;  1PJJ A;  1HNZ M;  4XGI A;  1FJG M;  3GLI B;  1G71 A;  2Z3X A;  4XK8 F;  2XEP A;  2R6F A;  2Q2E B;  2R4J A;  3U6L A;  3U5Z B;  3I04 M;  1WIV A;  1Q02 A;  4BBA A;  3SFZ A;  2LWX A;  3GRV A;  3WHK A;  1I4W A;  5ITT A;  5EQT A;  3M7G A;  4OW0 A;  3GPP A;  3R9X B;  4GH9 A;  3RE8 A;  4JN6 A;  4QHT A;  3OTO M;  1TH2 A;  2CEA A;  5FTJ A;  4Z6Y A;  1YSY A;  2V1U A;  2L7I A;  3W67 A;  1KSF X;  3THG A;  3LCU A;  4NXM M;  2VF8 A;  1TDH A;  3PNV A;  2WSC F;  1VQ1 A;  2WZJ A;  4MGI E;  3I01 M;  3J7B A;  4JI3 M;  4MGK E;  3RGP A;  3U61 B;  2CV0 A;  4LRS A;  1QQW A;  4AI6 A;  5EXP A;  2HWJ A;  4LF8 M;  1MN3 A;  2FNA A;  2R46 A;  2BJV A;  2DHY A;  2R18 A;  5ITR A;  3UJN A;  2K6B A;  3JR5 A;  3SAW A;  4B08 A;  2XZU A;  3KOX E;  1QZE A;  1GL7 A;  4XBO A;  1DGF A;  2M5Z A;  2J7O A;  3DOA A;  5FTK A;  3AKZ A;  4L15 A;  2LHC A;  2QEN A;  4CGY B;  3GQ3 A;  1IN7 A;  3FRI A;  3MK6 A;  3WHL A;  3FUU A;  5EJC A;  2BWB A;  1RU3 A;  2KNA A;  3KW6 A;  4IBF A;  3T6P A;  2VF7 A;  3UGJ A;  3PNY A;  4KT0 F;  1IY2 A;  4L4U A;  1TDZ A;  2D7G A;  2ZTD A;  2YFQ A;  3U6O A;  3L28 A;  1IXZ A;  4GRI A;  2LH0 A;  3VLF B;  2JXN A;  2CRU A;  2DEN A;  3TE6 A;  4WP2 A;  3LMM A;  3W68 A;  2OPF A;  2KZS A;  2L6O A;  1XXH E;  1D0M A;  2GQF A;  2HHH M;  4GC5 A;  5DNY A;  4B3T M;  4IBK A;  1I94 M;  2J5Y A;  1XXH B;  2DAM A;  2MGW A;  2C98 A;  2YR0 A;  1NNU C;  3C58 A;  3TWK A;  2VQE M;  4NRW A;  2H1R A;  4YHH M;  3W0F A;  4NSR A;  4Z8X A;  5EXX A;  4MB7 A;  8CAT A;  4PT5 A;  2MJ5 B;  3HY5 A;  1IN6 A;  2DWN A;  1QUT A;  1QAM A;  3A42 A;  3GLF E;  2M60 A;  3SYL A;  3SMP A;  4DR5 M;  3J7A S;  2E5L M;  2K9D A;  3LVV A;  3GLG A;  3ZC7 B;  5IWA M;  1VG5 A;  3GPU A;  3GLF B;  3CGW A;  3T38 A;  1IFY A;  2QHO B;  1S3S A;  2ERC A;  3CTW B;  1GO5 A;  1E9R A;  1AUA A;  3KSX A;  1N36 M;  1DGB A;  2I7P A;  4B7G A;  1V34 A;  1WR1 B;  3AV0 A;  1T3T A;  1IN5 A;  1QDR A;  3U6D A;  3KDS E;  1OQY A;  1P3Q Q;  2DZL A;  2ZAM A;  2OO9 A;  1HJP A;  2YQZ A;  3HJ8 A;  4PDG A;  1D0K A;  2A5Y B;  4JI2 M;  4AKI A;  1R4G A;  4GIP A;  3KXE C;  2XH9 A;  2DXI A;  4LF4 M;  4JV5 M;  1R7R A;  2CHG A;  3U60 A;  4LFC M;  3FTC A;  2JZ1 A;  5KPR A;  4BLC A;  4NXN M;  1IBK M;  4MGH A;  3V76 A;  2Y0T A;  4JYA M;  3DZD A;  3AOE A;  1WXQ A;  1LTM A;  4W5W A;  5H37 D;  3HX3 A;  4AG6 A;  2GNO A;  2EKF A;  5ITY A;  2V1C A;  2JA2 A;  3MMP A;  4DBG B;  3U6Q A;  1SXJ A;  3D8L A;  3U5Z A;  1Z5A A;  2BJW A;  7CAT A;  4LJA A;  2QNJ A;  4FCW A;  4QNM A;  4NSO B;  3B7Z A;  2Y0Q A;  2XFT A;  1Q3B A;  2CWB A;  3NBI A;  4I81 A;  3TWL A;  4X64 M;  2C5R A;  3FYD A;  1NHW C;  2L2D A;  3EIE A;  1L1Z A;  2JY6 B;  2DAE A;  5A2Q S;  1Z5B A;  4ZPX A;  4LY6 A;  2X4A A;  4WUR A;  4LRT A;  4JI7 M;  4K0K M;  4LZJ A;  4GC9 A;  5DYI A;  2C9C A;  2R44 A;  3I4V A;  4WW0 A;  3TPZ A;  1N78 A;  2XLJ A;  3FD9 A;  1E94 E;  3KOW E;  1VEJ A;  2KA6 B;  2DKL A;  1IXR C;  2D7H A;  1JB0 F;  1ZMW A;  3U61 A;  3TQS A;  3GRY A;  3FUW A;  3SAU A;  2DWL A;  2Z4R A;  2HCB A;  1K82 A;  4DV6 M;  1DV0 A;  3SHF A;  2UXC M;  3B89 A;  3KOZ E;  4B3M M;  2Y20 A;  5ITX E;  1DO0 A;  3BOS A;  3SYK A;  3QWL A;  3ZQJ A;  4DV7 M;  1Q3C A;  3HU1 A;  2WSF F;  3T1H M;  3AOE C;  1H6U A;  1Q39 A;  1JQJ C;  5FTN A;  1IY1 A;  3HJS A;  1XC8 A;  1OFH A;  3SAR A;  3EIH A;  4UN2 B;  2RKO A;  3SAT A;  2K47 A;  2Z4S A;  2CP8 A;  4LG2 A;  4DR1 M;  1OAO C;  1SXJ C;  4QNR A;  3L2A A;  2DWZ B;  4QOZ C;  3VKH A;  3RFW A;  1VEG A;  3BBZ A;  3Q8G A;  4M0W A;  1QAO A;  3R8F A;  5LMU M;  3GO8 A;  4JI6 M;  4D82 A;  4FCV A;  5IRE B;  1NVM A;  3U6S A;  1XHB A;  3VDP A;  1WJ7 A;  4JXJ A;  2QBY B;  3GRR A;  3DFZ A;  4F1I A;  3KFU G;  2I7N A;  4JI0 M;  1DGG A;  4KOD A;  1PJI A;  5KQD A;  1PGY A;  3SMS A;  1HT2 E;  2LTU A;  1IBL M;  3U6P A;  4M0D A;  3HJQ A;  4NOO B;  3IEC A;  3L29 A;  3B9P A;  2XZF A;  3VKG A;  4PDI A;  3K9P A;  5F3W A;  1IN4 A;  1Z6T A;  1WGL A;  1IN8 A;  3GLF A;  1OKS A;  4AW4 A;  3VK7 A;  2UU9 M;  4LFB M;  2ZAN A;  4I4L A;  4I5S A;  3E46 A;  3FUV A;  4LJ7 A;  4M9Z A;  3VDU A;  3TWM A;  2OOB A;  3FYC A;  3KS4 A;  1SXJ D;  3FUX A;  4IBB A;  4LZZ A;  3RGS A;  4A3V B;  3SAV A;  1GVN A;  3LQR A;  1XNR M;  1TF0 B;  2QCU A;  2F5S A;  3C9P A;  1HQY E;  4IJF A;  3F92 A;  1PJS A;  4FVM A;  3C3E A;  1T6O A;  2L7H A;  2XSZ D;  2UUC M;  2Z7J A;  2MRO B;  1IXS B;  1NHG C;  2FH0 A;  3U6M A;  1YLA A;  4JI5 M;  3D8B A;  1IBM M;  2BWE A;  4LF7 M;  4I8O A;  3KP1 E;  4D81 A;  2JY5 A;  3SAS A;  4NC6 A;  2JWS A;  1PM5 A;  1NJG A;  3J80 S;  1JR3 A;  2ZBK B;  3HU2 A;  5KO3 A;  4AZF A;  2JY8 A;  2B3T A;  3UMM A;  2KNV A;  3H4M A;  2JZ0 A;  1C7Y A;  1MU5 A;  1XWI A;  2P5T A;  2RGH A;  3QAU A;  4DUY M;  3CF0 A;  3W0L B;  4YY3 M;  2UUA M;  1D2N A;  2C96 A;  2UXD M;  1LV7 A;  2G3Q A;  3GPX A;  4LF6 M;  1QYR A;  2X8A A;  2EKK A;  1HT1 E;  4QHS A;  5FTM A;  2XF3 A;  1G8P A;  2H5X A;  2LNH C;  1Y8G A;  3HKP A;  1G41 A;  1GL6 A;  1HQC A;  4AKG A;  1J7K A;  3UK6 A;  2VDB B;  2EO2 A;  4LJ5 A;  3FTF A;  2KRK A;  2CFO A;  3UZU A;  1IY0 A;  3M0E A;  1PJQ A;  2R4E A;  3E4R A;  1DGH A;  1J5E M;  3FTD A;  1Z5C A;  2RGO A;  4KLN A;  4R3D A;  1E32 A;  1OJL A;  5DYG A;  4F2L A;  4FCT A;  2NQ8 C;  1J09 A;  2HAK A;  2JUJ A;  4QOS A;  2AHM A;  3H4J A;  4NRV A;  4EIW A;  1ZMU A;  1N75 A;  4CIZ A;  4MH0 E;  4II7 A;  2YNM D;  4L8R C;  4GEW A;  3GLI A;  4G6Z A;  2ZM6 M;  5L8R F;  4OU7 A;  1TTE A;  2CV1 A;  1W5T A;  4DV5 M;  4KHP M;  3HHY A;  2L4F A;  1ZMV A;  4LFA M;  4IBE A;  3KS8 A;  2DAK A;  4AKH A;  4RNA A;  1HR0 M;  2LVQ D;  5ITX A;  4GMQ A;  4GIT A;  2O01 F;  4BB9 A;  3PVS A;  5GKN A;  1TGU A;  3I51 A;  1EE8 A;  1FNN A;  2KW0 A;  3GLG E;  4FWG A;  4DR7 M;  5KQ8 A;  2X49 A;  2LVN C;  3GLG B;  5EXS A;  3KSJ A;  4GKJ M;  1A5T A;  2DHR A;  3M6A A;  3L25 A;  1GJT A;  1G3I A;  1L1T A;  1V33 A;  2WSE F;  4MGZ E;  4FW9 A;  1QZM A;  3FKE A;  3VFD A;  3VK8 A;  3CF2 A;  4R71 A;  3NBX X;  4X66 M;  1NV8 A;  2R45 A;  2CHV A;  3CF6 E;  1WGN A;  4IIW A;  3ZH9 B;  5KPZ A;  5EP3 A;  2XGN A;  5IZ7 D;  5E6J A;  3BXW A;  4IBI A;  2UUB M;  4OX9 M;  3LQQ A;  2R62 A;  3Q8X A;  2JNH A;  2RRU A;  2VII A;  3L26 A;  2F4V M;  2L09 A;  5BPV A;  4M9S A;  5ITU A;  3K9O A;  1EFU B;  2D7E A;  3C3D A;  1NJF A;  3SBJ A;  3J2P B;  2CUZ A;  4DV4 M;  2R65 A;  4X65 M;  3GLH E;  1XMO M;  1K3W A;  1GKI A;  3E21 A;  4LF5 M;  3GQ4 A;  1SXJ E;  1Z59 A;  2QSF X;  4Y28 F;  3GLH B;  1SXJ B;  1MX0 A;  2R0I A;  3TL4 X;  3HHW A;  3KP0 E;  4IBJ A;  5EP1 A;  3JR4 A;  2O5R A;  2LVA A;  1XXH A;  3LCV B;  4FWD A;  4OVZ B;  4LGY A;  4JI1 M;  4L6V 6;  3SHG B;  1IXS A;  1UFZ A;  1XB2 B;  3PXG A;  4CJ6 A;  2KNZ A;  2LBC A;  2HL7 A;  3IG5 A;  3AL0 C;  3E9S A;  2BNK A;  4DV2 M;  1TR8 A;  1NSF A;  3GRU A;  4G4O A;  1T43 A;  1VEK A;  4JI4 M;  1TH4 A;  3B7Q A;  1R2Z A;  1PRB A;  2KDL A;  2DNA A;  2KHH A;  3ZCB B;  3HHX A;  2QP9 X;  4IBD A;  4LJ6 A;  1E9S A;  2DAG A;  1ORY B;  2O25 A;  2EA0 A;  2DI0 A;  3DA1 A;  4GHA A;  3T1Y M;  4B3S M;  1L2D A;  1GLN A;  1VDL A;  3MJ5 A;  4RF0 A;  2UXB M;  4HL4 A;  4MM3 B;  2CV2 A;  5IT9 S;  3U6E A;  3J81 S;  3HWS A;  1WHC A;  3HU3 A;  1HNX M;  2V6Z M;  1KYI A;  1NY6 A;  1R5L A;  4KO8 A;  3HGI A;  4L16 A;  2ZAO A;  3U6C A;  1G59 A;  1GJS A;  2QZ4 A;  3K8Z A;  4P16 A;  4B3R M;  3NWL A;  4ANR A;  3JAM S;  2F5O A;  3FUT A;  2Z8Y M;  1K3X A;  1YUB A;  3L27 A;  3AJI B;  4B7F A;  3B74 A;  3QYE A;  2KZU A;  3HHZ A;  3GQ5 A;  3K92 A;  4PD2 A;  1OTR A;  1ZAE A;  3GP1 A;  3K1J A;  1NO1 A;  2MR9 A;  1C1K A;  1OAI A;  1XNQ M;  4LCB A;  2EJS A;  2L4E A;  2Y21 A;  3AFH A;  1N33 M;  1IQP A;  1QUS A;  1QDT A;  2CE7 A;  4AQY M;  4IJE A;  3KVW A;  2LVO C;  4RF1 A;  4P17 A;  3FRH A;  4DR6 M;  2EUC A;  4CHT B;  4HEO A;  2DAI A;  1QVR A;  3KOY E;  2KEB A;  2N35 A;  2KRU A;  1PJT A;  5C1B A;  3IHP A;  1NNJ A;  4RKU F;  2C99 A;  4M9X A;  4FWH A;  4LJ8 A;  1ZQ9 A;  5FLX S;  4G4Q A;  2FS1 A;  3AOG A;  3FE3 A;  1KFV A;  3A45 A;  3LVW A;  2XFS A;  4IBG A;  4G3O A;  4CIS A;  4DV3 M;  2VQF M;  3K2L A;  1QAN A;  1W5S A;  2F5N A;  4B7H A;  1TH3 A;  5C18 A;  4G4R A;  3LW5 F;  3A46 A;  1N34 M;  1UM8 A;  2CHQ A;  1ZV1 A;  4LJ9 A;  1R2Y A;  2QPA A;  2DWM A;  4X62 M;  5BR8 M;  4ITQ A;  3A98 B;  1X37 A;  2W82 A;  4PCZ A;  4DR2 M;  2KXE A;  3PFI A;  1YE9 A;  2LHG A;  1OIZ A;  5JI3 E;  4DV0 M;  1G4A E;  1OIP A;  5EP2 A;  2DZO B;  3T15 A;  4TUW A;  4REZ A;  4DUZ M;  5ITQ A;  2HKJ A;  1OFI A;  2F5P A;  1NY5 A;  5DFL A;  2APL A;  5LMN M;  2FFJ A;  1N77 A;  1JR3 E;  1L2C A;  4LF9 M;  4S12 A;  1AIP C;  1QAQ A;  1F4I A;  5EXT A;  1R6B X; 
#chains in the Genus database with same CATH homology
 4G4N A;  1DO2 A;  3GLH A;  3ILK A;  5E26 A;  2OQ4 A;  2DZN B;  1L2B A;  4DR4 M;  2C9O A;  1IM2 A;  4L78 A;  4IBC A;  3GPY A;  4MGY E;  2J7N A;  4OVZ A;  3J27 B;  2QBY A;  5EP4 A;  4LGM A;  4R7G A;  5FSW A;  2LXE A;  2XSZ A;  3MHV C;  4AG5 A;  4JI8 M;  1HNW M;  4NL4 H;  1XMQ M;  4GHL A;  3FTE A;  4LJ4 A;  5KPT A;  2FOI C;  5JI2 E;  1L8Q A;  4HLQ A;  4DV1 M;  1N32 M;  4FD2 A;  1VDD A;  3U60 B;  1DGH B;  2G5G X;  2G8L A;  3I4Y A;  4GKK M;  1JR3 D;  4DR3 M;  4D80 A;  5FTL A;  3IG8 A;  3SC3 A;  2F5Q A;  2DVW B;  2FE8 A;  1PJJ A;  1HNZ M;  4XGI A;  1FJG M;  3GLI B;  2Z3X A;  2XEP A;  2Q2E B;  2R4J A;  3U6L A;  3U5Z B;  4BBA A;  3SFZ A;  2LWX A;  3GRV A;  3WHK A;  1I4W A;  5ITT A;  5EQT A;  3M7G A;  4OW0 A;  3GPP A;  3R9X B;  4GH9 A;  3RE8 A;  4JN6 A;  4QHT A;  3OTO M;  1TH2 A;  2CEA A;  5FTJ A;  4Z6Y A;  1YSY A;  2V1U A;  2L7I A;  1KSF X;  3THG A;  4NXM M;  1TDH A;  3PNV A;  4MGI E;  3J7B A;  4JI3 M;  4MGK E;  3RGP A;  3U61 B;  2CV0 A;  4LRS A;  1QQW A;  4AI6 A;  5EXP A;  4LF8 M;  2FNA A;  2R46 A;  2BJV A;  2R18 A;  5ITR A;  3UJN A;  3JR5 A;  3SAW A;  4B08 A;  2XZU A;  3KOX E;  1GL7 A;  4XBO A;  1DGF A;  2M5Z A;  2J7O A;  3DOA A;  5FTK A;  3AKZ A;  4L15 A;  2QEN A;  4CGY B;  3GQ3 A;  1IN7 A;  3WHL A;  3MK6 A;  3FUU A;  5EJC A;  3KW6 A;  4IBF A;  3UGJ A;  3PNY A;  1IY2 A;  4L4U A;  1TDZ A;  2D7G A;  2YFQ A;  3U6O A;  3L28 A;  1IXZ A;  4GRI A;  2LH0 A;  3VLF B;  3TE6 A;  3LMM A;  2OPF A;  2KZS A;  2L6O A;  2HHH M;  4GC5 A;  5DNY A;  4B3T M;  4IBK A;  1I94 M;  1XXH B;  2C98 A;  2YR0 A;  1NNU C;  3C58 A;  3TWK A;  2VQE M;  4NRW A;  2H1R A;  4YHH M;  3W0F A;  4NSR A;  4Z8X A;  5EXX A;  4MB7 A;  8CAT A;  4PT5 A;  1IN6 A;  2DWN A;  1QAM A;  3A42 A;  2M60 A;  3SYL A;  3SMP A;  4DR5 M;  3J7A S;  2E5L M;  3LVV A;  3GLG A;  3ZC7 B;  5IWA M;  3GPU A;  3GLF B;  3T38 A;  1S3S A;  2ERC A;  3CTW B;  1E9R A;  3KSX A;  1N36 M;  1DGB A;  2I7P A;  4B7G A;  3AV0 A;  1T3T A;  1IN5 A;  3U6D A;  3KDS E;  3HJ8 A;  2ZAM A;  4JI2 M;  4PDG A;  2YQZ A;  2A5Y B;  4AKI A;  4GIP A;  3KXE C;  2XH9 A;  2DXI A;  4LF4 M;  4JV5 M;  1R7R A;  2CHG A;  3U60 A;  4LFC M;  3FTC A;  5KPR A;  4BLC A;  4NXN M;  1IBK M;  4MGH A;  4JYA M;  2Y0T A;  3DZD A;  3AOE A;  1WXQ A;  4W5W A;  5H37 D;  4AG6 A;  5ITY A;  2V1C A;  2JA2 A;  3U6Q A;  1SXJ A;  3D8L A;  3U5Z A;  1Z5A A;  2BJW A;  7CAT A;  4LJA A;  4FCW A;  4QNM A;  4NSO B;  2Y0Q A;  2XFT A;  1Q3B A;  3NBI A;  4I81 A;  3TWL A;  4X64 M;  2C5R A;  3FYD A;  1NHW C;  1L1Z A;  3EIE A;  5A2Q S;  1Z5B A;  4ZPX A;  4LY6 A;  2X4A A;  4WUR A;  4LRT A;  4JI7 M;  4K0K M;  4LZJ A;  4GC9 A;  5DYI A;  2C9C A;  3I4V A;  1N78 A;  4WW0 A;  3TPZ A;  2XLJ A;  3FD9 A;  1E94 E;  3KOW E;  2KA6 B;  1IXR C;  2D7H A;  3U61 A;  3TQS A;  3GRY A;  3FUW A;  3SAU A;  2DWL A;  2Z4R A;  2HCB A;  1K82 A;  4DV6 M;  3SHF A;  2UXC M;  3KOZ E;  4B3M M;  2Y20 A;  5ITX E;  1DO0 A;  3BOS A;  3SYK A;  3QWL A;  4DV7 M;  3T1H M;  1Q3C A;  3HU1 A;  3AOE C;  1H6U A;  1Q39 A;  1JQJ C;  5FTN A;  1IY1 A;  3HJS A;  1XC8 A;  1OFH A;  3SAR A;  3EIH A;  2RKO A;  3SAT A;  2K47 A;  2Z4S A;  4LG2 A;  4DR1 M;  1SXJ C;  4QNR A;  3L2A A;  2DWZ B;  4QOZ C;  3VKH A;  3RFW A;  4M0W A;  1QAO A;  3R8F A;  5LMU M;  3GO8 A;  4JI6 M;  4D82 A;  4FCV A;  5IRE B;  1NVM A;  3U6S A;  1XHB A;  3VDP A;  2QBY B;  4JXJ A;  3GRR A;  3DFZ A;  3KFU G;  2I7N A;  4JI0 M;  1DGG A;  4KOD A;  1PJI A;  5KQD A;  3SMS A;  1HT2 E;  1IBL M;  3U6P A;  4M0D A;  3HJQ A;  4NOO B;  3L29 A;  3B9P A;  2XZF A;  3VKG A;  4PDI A;  5F3W A;  1IN4 A;  1Z6T A;  4LFB M;  1IN8 A;  3GLF A;  4AW4 A;  3VK7 A;  2UU9 M;  2ZAN A;  4I4L A;  4I5S A;  3FUV A;  4LJ7 A;  4M9Z A;  3VDU A;  3TWM A;  3KS4 A;  3FYC A;  4LZZ A;  1SXJ D;  3FUX A;  4IBB A;  4A3V B;  3RGS A;  3SAV A;  1GVN A;  3LQR A;  1XNR M;  2QCU A;  2F5S A;  1HQY E;  4IJF A;  4FVM A;  2L7H A;  2XSZ D;  2UUC M;  2Z7J A;  1IXS B;  1NHG C;  3U6M A;  4JI5 M;  3D8B A;  1IBM M;  4LF7 M;  4I8O A;  3KP1 E;  4D81 A;  3SAS A;  1PM5 A;  1NJG A;  3J80 S;  1JR3 A;  2ZBK B;  3HU2 A;  5KO3 A;  4AZF A;  3UMM A;  3H4M A;  1MU5 A;  1XWI A;  2P5T A;  2RGH A;  3QAU A;  4DUY M;  3CF0 A;  3W0L B;  4YY3 M;  2UUA M;  1D2N A;  2C96 A;  2UXD M;  1LV7 A;  3GPX A;  4LF6 M;  1QYR A;  2X8A A;  1HT1 E;  4QHS A;  5FTM A;  2XF3 A;  1G8P A;  2LNH C;  3HKP A;  1G41 A;  1GL6 A;  1HQC A;  4AKG A;  1J7K A;  3UK6 A;  4LJ5 A;  2EO2 A;  3FTF A;  2KRK A;  2CFO A;  3UZU A;  1IY0 A;  3M0E A;  3E4R A;  2R4E A;  1DGH A;  1J5E M;  3FTD A;  1Z5C A;  2RGO A;  4KLN A;  4R3D A;  1E32 A;  1OJL A;  5DYG A;  4FCT A;  2NQ8 C;  1J09 A;  4QOS A;  2AHM A;  4NRV A;  4EIW A;  1N75 A;  4MH0 E;  4II7 A;  2YNM D;  4L8R C;  3GLI A;  4G6Z A;  2ZM6 M;  4OU7 A;  2CV1 A;  1W5T A;  4DV5 M;  4KHP M;  3HHY A;  4LFA M;  4IBE A;  3KS8 A;  4AKH A;  4RNA A;  1HR0 M;  5ITX A;  4GMQ A;  4GIT A;  4BB9 A;  3PVS A;  5GKN A;  1TGU A;  3I51 A;  1EE8 A;  1FNN A;  2KW0 A;  4FWG A;  4DR7 M;  5KQ8 A;  2X49 A;  3GLG B;  5EXS A;  3KSJ A;  4GKJ M;  2DHR A;  3M6A A;  3L25 A;  1G3I A;  1L1T A;  4MGZ E;  3VK8 A;  4FW9 A;  1QZM A;  3FKE A;  3VFD A;  3CF2 A;  4X66 M;  3CF6 E;  2R45 A;  2CHV A;  4IIW A;  3ZH9 B;  5KPZ A;  5EP3 A;  2XGN A;  5IZ7 D;  5E6J A;  4IBI A;  2UUB M;  4OX9 M;  3LQQ A;  2R62 A;  3Q8X A;  2VII A;  3L26 A;  2F4V M;  2L09 A;  5BPV A;  4M9S A;  5ITU A;  2D7E A;  3SBJ A;  1NJF A;  3J2P B;  2CUZ A;  4DV4 M;  2R65 A;  4X65 M;  1XMO M;  1K3W A;  1GKI A;  4LF5 M;  3GQ4 A;  1SXJ E;  1Z59 A;  3GLH B;  1SXJ B;  1MX0 A;  3TL4 X;  3HHW A;  3KP0 E;  4IBJ A;  5EP1 A;  3JR4 A;  2O5R A;  1XXH A;  4FWD A;  4OVZ B;  4LGY A;  4JI1 M;  3SHG B;  3PXG A;  2HL7 A;  3IG5 A;  3AL0 C;  3E9S A;  2BNK A;  4DV2 M;  1NSF A;  3GRU A;  4G4O A;  4JI4 M;  1TH4 A;  1R2Z A;  3ZCB B;  3HHX A;  2QP9 X;  4IBD A;  4LJ6 A;  1E9S A;  2EA0 A;  1ORY B;  3DA1 A;  4GHA A;  3T1Y M;  4B3S M;  1L2D A;  1GLN A;  3MJ5 A;  4RF0 A;  2UXB M;  4HL4 A;  4MM3 B;  2CV2 A;  5IT9 S;  3U6E A;  3J81 S;  3HWS A;  3HU3 A;  1HNX M;  2V6Z M;  1KYI A;  1NY6 A;  4KO8 A;  3HGI A;  4L16 A;  2ZAO A;  3U6C A;  1G59 A;  2QZ4 A;  3K8Z A;  4P16 A;  4B3R M;  3NWL A;  3JAM S;  2F5O A;  3FUT A;  1K3X A;  1YUB A;  3L27 A;  3AJI B;  4B7F A;  2KZU A;  3HHZ A;  3GQ5 A;  3K92 A;  4PD2 A;  1ZAE A;  3GP1 A;  3K1J A;  1XNQ M;  1C1K A;  4LCB A;  2Y21 A;  3AFH A;  1N33 M;  1IQP A;  2CE7 A;  4AQY M;  4IJE A;  3KVW A;  4RF1 A;  4DR6 M;  2EUC A;  4CHT B;  3KOY E;  1QVR A;  2KEB A;  2KRU A;  5C1B A;  1NNJ A;  2C99 A;  4M9X A;  4FWH A;  4LJ8 A;  1ZQ9 A;  5FLX S;  4G4Q A;  3AOG A;  1KFV A;  3A45 A;  3LVW A;  2XFS A;  4IBG A;  4CIS A;  4DV3 M;  2VQF M;  3K2L A;  1QAN A;  1W5S A;  2F5N A;  4B7H A;  1TH3 A;  5C18 A;  4G4R A;  3A46 A;  1N34 M;  1UM8 A;  2CHQ A;  4LJ9 A;  1R2Y A;  2QPA A;  2DWM A;  4X62 M;  5BR8 M;  4ITQ A;  3A98 B;  1X37 A;  2W82 A;  4PCZ A;  4DR2 M;  2KXE A;  3PFI A;  1YE9 A;  5JI3 E;  4DV0 M;  1G4A E;  5EP2 A;  2DZO B;  3T15 A;  4TUW A;  4REZ A;  4DUZ M;  5ITQ A;  2HKJ A;  1OFI A;  2F5P A;  1NY5 A;  5LMN M;  2FFJ A;  1N77 A;  1L2C A;  4LF9 M;  4S12 A;  1QAQ A;  5EXT A;  1R6B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...