3J7AS

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
QHILRILNTNVDGKEKVIIALTAIKGIGKRMATVICKQANVDPTKRAGELTTEEIDNIVHIMSTPTQFKIPDWFLNRRKDLKEGKNIHVIANQLDSYLREDLERMKKIRLHRGLRHHWGLRVRGQHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j7aS01
1XNQM 1L2DA 3U6EA 3SAWA 4B3MM 4X62M 4DR4M 2OQ4A 3GP1A 3TWLA 2UXBM 1PJJA 1Z5AA 1N34M 3SATA 5ITRA 1N32M 4DV4M 1EE8A 4DUZM 3GQ3A 3U6MA 3U6PA 1HR0M 3GQ4A 3J7AS 4MB7A 4JI8M 1K82A 1XNRM 1HNXM 2VQEM 1XMQM 5ITXA 3JR4A 1IBMM 4DV1M 5ITXE 5LMNM 4DR6M 2ZM6M 1L1TA 4LF7M 2HKJA 2F5QA 4X66M 4PDIA 2EA0A 1MX0A 4X64M 4NRVA 3SASA 4JYAM 1IBLM 4G4RA 4YHHM 4LF5M 3U6QA 1Z5BA 4DV6M 1N33M 4GKKM 3GQ5A 3SARA 3OTOM 4LFCM 2XZUA 1Q3CA 4PD2A 2HHHM 1Z59A 4DV5M 4JI7M 4NRWA 3U6OA 1HNZM 5A2QS 4DV2M 1TDHA 4DV7M 3U6CA 1PM5A 2UU9M 1HNWM 4GKJM 2XZFA 4JV5M 3A45A 1R2YA 1Q39A 1L2BA 1I94M 2UXDM 3GPUA 4X65M 1PJIA 1IBKM 4LFAM 4JI2M 3SAVA 2F5SA 4JI0M 2F4VM 3U6LA 4K0KM 4G4QA 3A42A 3T1HM 4AQYM 5IWAM 3C58A 2OPFA 3VK7A 4LF6M 5ITQA 1K3XA 4JI4M 3TWKA 3T1YM 4B3RM 4G4OA 1MU5A 5BR8M 4JI6M 4PDGA 4DR2M 1Q3BA 4LF9M 4DR7M 1K3WA 3GPPA 4PCZA 4JI1M 4NXNM 3SAUA 3DOAA 3JAMS 2VQFM 1TDZA 3GPXA 2UUBM 1R2ZA 1L1ZA 3J80S 2UUAM 4LF8M 2F5PA 5ITYA 4DR3M 1N36M 4LFBM 2F5OA 3GPYA 1KFVA 4DR1M 1L2CA 3VK8A 5FLXS 3GO8A 2E5LM 4G4NA 4DUYM 1XC8A 2ZBKB 2UXCM 5ITUA 5ITTA 3SBJA 4JI3M 3J81S 2F5NA 1J5EM 4OX9M 4KHPM 1XMOM 1Z5CA 4CISA 4ITQA 3W0FA 4NXMM 4B3SM 4YY3M 3JR5A 4DR5M 3U6SA 4LF4M 2Q2EB 1NNJA 2UUCM 3TWMA 5IT9S 4DV3M 4JI5M 4B3TM 1FJGM 5LMUM 4DV0M 3U6DA 3A46A
chains in the Genus database with same CATH superfamily
1NY5A 2KA6B 5FTMA 3ZC7B 1PJTA 1G59A 1XNQM 3H4JA 1SXJA 2MR9A 1L2DA 3SAWA 3KS8A 3ZCBB 1XXHE 4B3MM 1L8QA 3J2PB 4DR4M 1C1KA 1JB0F 3CGWA 2LBCA 2W82A 5DYGA 1E94E 3SATA 4LJ4A 3F92A 4DUZM 1GJTA 1TH2A 3U6PA 3RE8A 1ZV1A 1N75A 2DAKA 3DFZA 4KO8A 1IXSB 3FTDA 4MB7A 1QVRA 2JNHA 2DAMA 1DGHA 2HAKA 2KHHA 2KNZA 3U5ZA 3JR4A 1CUKA 3M0EA 2ZM6M 3D8LA 3AL0C 2EKFA 5FTKA 4F2LA 3KOWE 2J7NA 2OOAA 2DVWB 4D80A 2EA0A 4MM3B 4FW9A 4NRVA 4IBGA 2DHYA 3IHPA 2CHVA 1J09A 2MH8A 2R0IA 2Y20A 2K6BA 4LCBA 3FUUA 3VKGA 1N33M 2CV2A 3WHKA 5DNYA 4WURA 3OTOM 3GLHE 3FUXA 4LRSA 1TH3A 4Z8XA 3W67A 2JY5A 4GIPA 2DWNA 2I7PA 1HNZM 1H6UA 1NV9A 1VEJA 3J27B 4P17A 1YSYA 1X37A 3T15A 4FWDA 1HNWM 3L28A 4GKJM 3E46A 3U60B 2K47A 2FS1A 4IBEA 4MGKE 1Q39A 2CRUA 2K9DA 3LCUA 3RGSA 1R2YA 2Z3XA 1W5TA 1IBKM 3IG8A 1R6BX 2F5SA 3FUTA 2XLJA 1NVMA 2KRUA 4LGMA 5IZ7D 4K0KM 4F1IA 5DFLA 4HEOA 1JQJC 1HT1E 2VDBB 1VDLA 1SXJC 3C3DA 1MU5A 5BR8M 4FWHA 4PDGA 1Q3BA 5F3WA 1HQCA 4UN2B 2XSZA 1QUSA 1XWIA 1IN7A 2Y0TA 4BLCA 2MGWA 3SAUA 1WR1B 3DOAA 2KRKA 1KYIA 4IBBA 4LRTA 1MN3A 2BWBA 3LCVB 2EO2A 5E26A 5EP3A 3J80S 3SYLA 2UUAM 2F5PA 2XH9A 5ITYA 2CUZA 4LFBM 5EP4A 2CEAA 2LVPC 3CTWB 3GLIE 2CHGA 3VK8A 1R4GA 2C9CA 5KO3A 5FLXS 1GLNA 2O5RA 1UM8A 3D8BA 2QSFX 2J7OA 1I4WA 5EXPA 2F5NA 2X8AA 5FTJA 2DXIA 3MJ5A 2KEBA 1Z5CA 3TE6A 3R8FA 1D0LA 2APLA 2V1UA 4TUWA 1QYRA 1JR3D 3U6SA 1KSFX 3KVWA 3VDUA 4LF4M 1T43A 3KOYE 1VG5A 1VDDA 4R7GA 3K9OA 3FTCA 5FTLA 4JI5M 4B3TM 1N78A 1R7RA 5IREB 3GLIA 3KOZE 3PFIA 4MH0E 3GLGB 4L15A 2Z4RA 4S12A 1D0KA 5EXXA 4OVZA 2QCUA 4D82A 3FD9A 3M6AA 3L25A 1AUAA 2EJSA 1NO1A 1OTRA 1IY0A 4L16A 1T6OA 3PVSA 3UZUA 4EIWA 1Z6TA 1PJJA 1N34M 2UXBM 5ITRA 1EE8A 4M9XA 1IY1A 3B9PA 3U6MA 2HWJA 1HR0M 2L7IA 2DI0A 3GLFE 4WP2A 5EP1A 2QNJA 2RGHA 3I51A 4I5SA 3J7AS 1K82A 3FRIA 3AJIB 5ITXA 1IBMM 4DV1M 4DR6M 4NSOB 3U61A 4LF7M 2D7EA 2HKJA 2HL7A 3B7ZA 2DHRA 4PDIA 1MX0A 3A98B 1GO5A 2OOBA 3HJQA 3SASA 4AKIA 1WJ7A 2WSCF 4G4RA 1J7KA 3Q8GA 4GMQA 4GHLA 1F4IA 4L4UA 4YHHM 3U6QA 1NSFA 1R5LA 3TPZA 1YUBA 1Z5BA 2LHCA 3DZDA 4GKKM 1HQYE 1IXRC 2ZTCA 1G4AE 3HWSA 1PJSA 3SARA 4G6ZA 2QBYA 3L2AA 3T6PA 2XZUA 5BPVA 2ZAMA 2EKKA 4LJ9A 4AW4A 1XHBA 5DYIA 4PD2A 3KSJA 3KDSE 2HHHM 3SC3A 2CFOA 4NRWA 4MGYE 1OIPA 1WGNA 2B3TA 4QHTA 5A2QS 2QP9X 3I01M 4PT5A 3U61B 3SFZA 3QYBA 3GLFB 3U6CA 1PM5A 2H1RA 3SYKA 2R65A 2LH0A 3HY5A 4RNAA 3A45A 4R3DA 2M60A 3GRYA 5EQTA 2I7NA 2L2DA 2KZUA 5FTNA 3I4VA 4LFAM 2JA2A 3UK6A 3AOEC 1IN4A 3NWLA 3KSXA 3L29A 3U5ZB 1TF0B 4G4QA 3GRRA 5EXTA 2BNKA 2KNVA 5EJCA 3RGPA 4D81A 3GLGE 4IBDA 4B7HA 2OPFA 2JWSA 3KFUG 4JI4M 1OKSA 3T1YM 4M0DA 4G4OA 2KW0A 2BWEA 2Y0QA 1AIPC 3EIHA 2R45A 3QWLA 3JAMS 4IJEA 2VQFM 4OW0A 2BJVA 2WSFF 3AV0A 3LVVA 1R2ZA 1SXJE 3B89A 2L7HA 4LJ5A 4LF8M 4DR3M 3BXWA 3K8ZA 2F5OA 1GKIA 3GPYA 4DR1M 1LV7A 4HLQA 5KQDA 2DAGA 3VDPA 4G4NA 1GL6A 4CIZA 3FTFA 1ZMWA 2KDLA 5ITUA 5ITTA 3GLFA 4JI3M 2LTUA 4OX9M 2DKLA 4FD2A 4NSRA 1OJLA 4AKGA 3HHXA 1EIJA 2DWZB 3MHVC 4FCTA 4B3SM 1QUTA 2M5ZA 2Z7JA 4YY3M 1G71A 1VEKA 2WSEF 1ZQ9A 2C99A 3HHZA 4GRIA 2D7HA 2C9OA 3TWMA 2QBYB 5IT9S 2KXEA 1IM2A 3FUWA 4LJAA 1TH4A 4MGHA 4FVMA 3ZQJA 4XBOA 3U6DA 3KP0E 2R4JA 4L8RC 4FCVA 1SXJB 1HT2E 3U6EA 2LXEA 4FCWA 2XGNA 2CE7A 4IBJA 1V34A 4X62M 1T3TA 2OQ4A 1PJQA 3HZJA 3GP1A 2A5YB 3TWLA 2RRUA 1Z5AA 2CP8A 1N32M 4DV4M 4I4LA 1DGBA 3Q8XA 4KLNA 1SXJD 4IBCA 3GQ3A 1DO2A 3GQ4A 1ZMUA 3HHWA 4G3OA 3AOEA 1A5TA 7CATA 1S3SA 3AOGA 4JI8M 2DZLA 4RF1A 2VQEM 2GQFA 3I04M 4ANRA 3E21A 3W0LB 3K9PA 5LMNM 1NHWC 1L1TA 3TQSA 3HJ8A 2F5QA 2OO9A 3B7NA 1QZEA 2JY6B 1LTMA 3KW6A 2P5TA 4JYAM 1IBLM 1VEGA 4IJFA 1IY2A 4Z6YA 1DGGA 4MGZE 2JXNA 4P16A 4BB9A 1OQYA 1E9SA 1N77A 3GQ5A 5KPRA 1PGYA 1QAMA 1W5SA 2O01F 2R46A 3J7BA 1Y8GA 3PNVA 4M9SA 1Q3CA 3AKZA 2J5YA 3GLIB 4LFCM 3HU2A 1G41A 2JY7A 2YQZA 3VFDA 3VLFB 8CATA 1Z59A 1QANA 4L78A 4JI7M 1GVNA 2EUCA 3LQRA 2L4FA 5JI3E 1WIVA 1E9RA 2KZSA 3GRUA 4DV2M 1GABA 2Y21A 3VKHA 2XEPA 4REZA 5H37D 3HJSA 3LVWA 2UU9M 1D2NA 1IQPA 2FNAA 2JP7A 2R62A 2DAEA 4JV5M 1V33A 2R44A 2WZJA 2GNOA 5EXSA 4NL4H 1QDTA 3GRVA 3HHYA 2JZ1A 2C5RA 2VIIA 3GPUA 1L2BA 3TL4X 1I94M 4JI2M 3DA1A 4NOOB 3B74A 2UXDM 3SAVA 4GHAA 1QAOA 4CGYB 4IBIA 1G8PA 2C96A 4AG6A 1DO0A 1XB2B 2XSZD 1OAOC 3EIEA 2MJ5B 3A42A 3T1HM 2ERCA 2MROB 4GC5A 1FNNA 3GLGA 3CF6E 2LVOC 3BOSA 5C1BA 2NQ8C 5ITQA 4B3RM 3TWKA 3MMPA 2CHQA 4LJ7A 3HX3A 4DR2M 1IFYA 1K3WA 3GPPA 3BBZA 1HJPA 3E9SA 3KS4A 4NXNM 2HCBA 1PRBA 2VF7A 2DNAA 3GPXA 2JUJA 4AI6A 1P3QQ 2C98A 3HKPA 1L1ZA 4CJ6A 2O25A 2RGOA 1QQWA 4I81A 2LVNC 1N36M 2DWMA 2FH0A 2D7GA 2LVAA 2XFTA 4DBGB 1KFVA 2CV0A 3L27A 4IBFA 2DZNB 3MK6A 4LY6A 2X49A 5FSWA 1WXQA 3GO8A 3NBXX 4DUYM 4KODA 1XC8A 2ZTDA 1YE9A 4GEWA 3SHFA 2QPAA 2YR0A 1J5EM 3FE3A 3UMMA 4KHPM 1XMOM 2YFQA 4LJ6A 4XK8F 3QAUA 3ILKA 3C3EA 1OFHA 1DGFA 1SG9A 3W0FA 1WHCA 4RKUF 4CISA 4ITQA 4NXMM 4DR5M 4JN6A 3FUVA 2G5GX 2QENA 1XXHA 2UUCM 4OU7A 1EFUB 4M9ZA 5EP2A 2R18A 3PXGA 4DV0M 2R6FA 2DZOB 3A46A 1IN5A 3FRHA 1IN8A 3WHLA 1NJFA 3W68A 2G8LA 3FTEA 4MGIE 1ZMVA 3RFWA 1VQ1A 2JY8A 2QHOB 1Q02A 4QNMA 3IG5A 2AHMA 5KPZA 3U60A 2LWXA 3R9XB 5KQ8A 1IXZA 1V92A 2ZAOA 1IXSA 3HU1A 3T38A 1QAQA 4LZJA 1XNRM 1NY6A 1G3IA 4IBKA 1DGHB 1HNXM 4OVZB 4AKHA 1WGLA 1XMQM 4RF0A 4QOZC 1JR3A 3AFHA 3KXEC 4JXJA 3UGJA 5ITXE 4B7GA 1TR8A 2G3QA 4X66M 3THGA 4X64M 3PNYA 2LHGA 3FYCA 2LNHC 3SHGB 1OFIA 4HL4A 5L8RF 1NJGA 1TGUA 4LF5M 2CWBA 2YNMD 3K92A 4DV6M 4R71A 2DWLA 4B7FA 2FFJA 2QQ8A 1NV8A 3M7GA 5KPTA 2FE8A 2BJWA 2VF8A 5JI2E 2L4EA 3LW5F 4WW0A 4DV5M 4AG5A 3E4RA 3FYDA 2V1CA 1D0MA 3UJNA 3U6OA 2XF3A 1OIZA 2Z8YM 3KP1E 4L6V6 4KT0F 1ORYB 1TDHA 3NBIA 4DV7M 4LG2A 3B7QA 2XZFA 4I8OA 4QNRA 4W5WA 2X4AA 4X65M 2LVQD 3HU3A 4GITA 1PJIA 4II7A 1E32A 1NNUC 4GH9A 4JI0M 3GLHA 2KNAA 1IN6A 3I4YA 4A3VB 3LMMA 3U6LA 2K0BX 2F4VM 4LZZA 4FWGA 4CHTB 2QZ4A 1OAIA 4Q7JA 1TTEA 4AQYM 1DV0A 5IWAM 4LJ8A 3C58A 3VK7A 4LF6M 1K3XA 4GC9A 1BVSA 3ZH9B 2DAIA 4QOSA 2CV1A 3KOXE 4JI6M 3HGIA 4LF9M 2Z4SA 4DR7M 4PCZA 3V76A 3SMSA 3FKEA 4JI1M 5GKNA 3SMPA 1C7YA 1TDZA 1XXHB 3L26A 2UUBM 1QZMA 4XGIA 2L6OA 3K2LA 1NHGC 2V6ZM 1JR3E 4NC6A 4IIWA 1ZAEA 2XFSA 3GLHB 1L2CA 2JZ0A 2E5LM 4BBAA 1UFZA 5C18A 2ZBKB 2UXCM 2L09A 5E6JA 2FOIC 1QDRA 4Y28F 2DENA 4B08A 3LQQA 3J81S 3SBJA 1MJGM 3CF0A 2H5XA 1RU3A 4AZFA 2ZANA 3K1JA 2RKOA 4QHSA 4M0WA 3C9PA 3JR5A 2R4EA 2Q2EB 1GL7A 2N35A 1GJSA 4LGYA 3CF2A 1NNJA 3QYEA 3IECA 4ZPXA 3H4MA 4DV3M 1YLAA 1FJGM 5LMUM
chains in the Genus database with same CATH topology
1NY5A 2KA6B 5FTMA 3ZC7B 1G59A 1XNQM 1L2DA 1SXJA 3SAWA 3KS8A 3ZCBB 4B3MM 1L8QA 3J2PB 4DR4M 1C1KA 2W82A 5DYGA 1E94E 3SATA 4LJ4A 4DUZM 1TH2A 3U6PA 3RE8A 1N75A 3DFZA 4KO8A 1IXSB 3FTDA 4MB7A 1QVRA 1DGHA 3U5ZA 3JR4A 3M0EA 2ZM6M 3D8LA 3AL0C 5FTKA 3KOWE 2J7NA 4D80A 2DVWB 2EA0A 4MM3B 4FW9A 4NRVA 4IBGA 2CHVA 1J09A 2Y20A 4LCBA 3FUUA 3VKGA 1N33M 2CV2A 3WHKA 5DNYA 4WURA 3OTOM 3FUXA 4LRSA 1TH3A 4Z8XA 4GIPA 2DWNA 2I7PA 1HNZM 1H6UA 3J27B 1YSYA 1X37A 3T15A 4FWDA 1HNWM 3L28A 4GKJM 3U60B 2K47A 3RGSA 4IBEA 4MGKE 1Q39A 1R2YA 2Z3XA 1W5TA 1IBKM 3IG8A 1R6BX 2F5SA 3FUTA 2XLJA 1NVMA 2KRUA 4LGMA 5IZ7D 4K0KM 1JQJC 1HT1E 1SXJC 1MU5A 5BR8M 4FWHA 4PDGA 1Q3BA 5F3WA 1HQCA 2XSZA 1XWIA 2Y0TA 1IN7A 4BLCA 3SAUA 3DOAA 2KRKA 1KYIA 4IBBA 4LRTA 2EO2A 5E26A 5EP3A 3J80S 3SYLA 2UUAM 2F5PA 2XH9A 5ITYA 2CUZA 4LFBM 5EP4A 2CEAA 3CTWB 2CHGA 3VK8A 5FLXS 2C9CA 5KO3A 1GLNA 2O5RA 1UM8A 3D8BA 2J7OA 1I4WA 5EXPA 2F5NA 2X8AA 5FTJA 2DXIA 3MJ5A 2KEBA 1Z5CA 3TE6A 3R8FA 2V1UA 4TUWA 1QYRA 1JR3D 3U6SA 1KSFX 3KVWA 3VDUA 4LF4M 3KOYE 1VDDA 4R7GA 3FTCA 5FTLA 4JI5M 4B3TM 1N78A 1R7RA 5IREB 3GLIA 3KOZE 3PFIA 4MH0E 3GLGB 4L15A 2Z4RA 4S12A 5EXXA 4OVZA 2QCUA 4D82A 3FD9A 3M6AA 3L25A 1IY0A 4L16A 3UZUA 3PVSA 1PJJA 4EIWA 1Z6TA 1N34M 2UXBM 5ITRA 1EE8A 4M9XA 1IY1A 3B9PA 3U6MA 1HR0M 2L7IA 5EP1A 2RGHA 4I5SA 3I51A 3J7AS 1K82A 3AJIB 5ITXA 1IBMM 4DV1M 4DR6M 4NSOB 3U61A 4LF7M 2D7EA 2HKJA 2HL7A 2DHRA 4PDIA 1MX0A 3A98B 3HJQA 3SASA 4AKIA 4G4RA 1J7KA 4GMQA 4GHLA 4L4UA 4YHHM 3U6QA 1NSFA 3TPZA 1YUBA 1Z5BA 3DZDA 4GKKM 1HQYE 1IXRC 1G4AE 3HWSA 3SARA 4G6ZA 2QBYA 3L2AA 2XZUA 5BPVA 2ZAMA 4LJ9A 4AW4A 1XHBA 5DYIA 4PD2A 3KSJA 3KDSE 2HHHM 3SC3A 2CFOA 4NRWA 4MGYE 4QHTA 5A2QS 2QP9X 4PT5A 3U61B 3SFZA 3GLFB 3U6CA 1PM5A 2H1RA 3SYKA 2R65A 2LH0A 4RNAA 3A45A 4R3DA 2M60A 3GRYA 5EQTA 2I7NA 2KZUA 5FTNA 3I4VA 4LFAM 2JA2A 3UK6A 3AOEC 1IN4A 3NWLA 3KSXA 3L29A 3U5ZB 4G4QA 3GRRA 5EXTA 2BNKA 5EJCA 4D81A 3RGPA 4IBDA 4B7HA 2OPFA 3KFUG 4JI4M 3T1YM 4M0DA 4G4OA 2KW0A 2Y0QA 3EIHA 2R45A 3QWLA 3JAMS 4IJEA 2VQFM 4OW0A 2BJVA 3AV0A 3LVVA 1R2ZA 1SXJE 2L7HA 4LJ5A 4LF8M 4DR3M 3K8ZA 2F5OA 1GKIA 3GPYA 4DR1M 1LV7A 4HLQA 5KQDA 3VDPA 4G4NA 1GL6A 3FTFA 5ITUA 5ITTA 3GLFA 4JI3M 4OX9M 4FD2A 4NSRA 1OJLA 4AKGA 3HHXA 2DWZB 3MHVC 4FCTA 4B3SM 2M5ZA 2Z7JA 4YY3M 1ZQ9A 2C99A 3HHZA 4GRIA 2D7HA 2C9OA 3TWMA 2QBYB 5IT9S 2KXEA 1IM2A 3FUWA 4LJAA 1TH4A 4MGHA 4FVMA 4XBOA 3U6DA 3KP0E 2R4JA 4L8RC 4FCVA 1SXJB 1HT2E 3U6EA 2LXEA 4FCWA 2XGNA 2CE7A 4IBJA 4X62M 1T3TA 2OQ4A 3GP1A 2A5YB 3TWLA 1Z5AA 1N32M 4DV4M 4I4LA 1DGBA 3Q8XA 4KLNA 1SXJD 4IBCA 3GQ3A 1DO2A 3GQ4A 3HHWA 3AOEA 7CATA 1S3SA 3AOGA 4JI8M 4RF1A 2VQEM 3W0LB 5LMNM 1NHWC 1L1TA 3TQSA 3HJ8A 2F5QA 3KW6A 2P5TA 4JYAM 1IBLM 4IJFA 1IY2A 4Z6YA 1DGGA 4MGZE 4P16A 4BB9A 1E9SA 1N77A 3GQ5A 5KPRA 1QAMA 2R46A 1W5SA 3J7BA 3PNVA 4M9SA 3GLIB 3AKZA 1Q3CA 4LFCM 3HU2A 1G41A 2YQZA 3VFDA 3VLFB 8CATA 1Z59A 1QANA 4L78A 4JI7M 1GVNA 2EUCA 3LQRA 5JI3E 1E9RA 2KZSA 3GRUA 4DV2M 2Y21A 3VKHA 2XEPA 4REZA 5H37D 3HJSA 3LVWA 2UU9M 1D2NA 1IQPA 2FNAA 2R62A 4JV5M 5EXSA 3HHYA 1L2BA 4NL4H 1I94M 3GRVA 2C5RA 2VIIA 3GPUA 2UXDM 3TL4X 4JI2M 3DA1A 4NOOB 3SAVA 4GHAA 1QAOA 4CGYB 4IBIA 1G8PA 2C96A 4AG6A 1DO0A 3EIEA 2XSZD 3A42A 3T1HM 2ERCA 4GC5A 1FNNA 3GLGA 3CF6E 3BOSA 5C1BA 2NQ8C 5ITQA 4B3RM 3TWKA 2CHQA 4LJ7A 4DR2M 1K3WA 3GPPA 3E9SA 3KS4A 4NXNM 2HCBA 3GPXA 4AI6A 2C98A 3HKPA 1L1ZA 2RGOA 1QQWA 4I81A 1N36M 2DWMA 2D7GA 2XFTA 2CV0A 1KFVA 3L27A 4IBFA 2DZNB 3MK6A 4LY6A 2X49A 5FSWA 1WXQA 3GO8A 4DUYM 4KODA 1XC8A 1YE9A 3SHFA 2QPAA 2YR0A 1J5EM 3UMMA 4KHPM 1XMOM 2YFQA 4LJ6A 3QAUA 3ILKA 1OFHA 1DGFA 3W0FA 4CISA 4ITQA 4NXMM 4DR5M 4JN6A 3FUVA 2G5GX 2QENA 1XXHA 2UUCM 4OU7A 4M9ZA 5EP2A 2R18A 3PXGA 4DV0M 2DZOB 3A46A 1IN5A 1IN8A 3WHLA 1NJFA 2G8LA 3FTEA 4MGIE 3RFWA 4QNMA 3IG5A 2AHMA 5KPZA 3U60A 2LWXA 3R9XB 5KQ8A 1IXZA 2ZAOA 3HU1A 3T38A 1QAQA 4LZJA 1XNRM 1NY6A 1G3IA 4IBKA 1DGHB 1HNXM 4OVZB 4AKHA 1XMQM 4RF0A 4QOZC 1JR3A 3AFHA 3KXEC 4JXJA 3UGJA 5ITXE 4B7GA 4X66M 3THGA 4X64M 3PNYA 3FYCA 2LNHC 3SHGB 1OFIA 4HL4A 1NJGA 1TGUA 4LF5M 2YNMD 3K92A 4DV6M 2DWLA 4B7FA 2FFJA 3M7GA 5KPTA 2FE8A 2BJWA 5JI2E 4WW0A 4DV5M 4AG5A 3E4RA 3FYDA 2V1CA 3UJNA 3U6OA 2XF3A 3KP1E 1ORYB 1TDHA 3NBIA 4DV7M 4LG2A 2XZFA 4I8OA 4QNRA 4W5WA 2X4AA 4X65M 1PJIA 3HU3A 4GITA 4II7A 1E32A 1NNUC 4GH9A 4JI0M 3GLHA 1IN6A 3I4YA 4A3VB 3LMMA 3U6LA 2F4VM 4LZZA 4FWGA 4CHTB 2QZ4A 4AQYM 5IWAM 4LJ8A 3C58A 3VK7A 4LF6M 1K3XA 4GC9A 3ZH9B 4QOSA 2CV1A 3KOXE 4JI6M 3HGIA 4LF9M 2Z4SA 4DR7M 4PCZA 3SMSA 3FKEA 4JI1M 5GKNA 3SMPA 1TDZA 1XXHB 3L26A 2UUBM 1QZMA 4XGIA 2L6OA 3K2LA 1NHGC 2V6ZM 4IIWA 1ZAEA 2XFSA 3GLHB 1L2CA 2E5LM 4BBAA 5C18A 2ZBKB 2UXCM 2L09A 5E6JA 2FOIC 3SBJA 4B08A 3J81S 3LQQA 3CF0A 4AZFA 2ZANA 3K1JA 2RKOA 4QHSA 4M0WA 3JR5A 2R4EA 2Q2EB 1GL7A 4LGYA 3CF2A 1NNJA 4ZPXA 3H4MA 4DV3M 1FJGM 5LMUM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ M;  1L2D A;  3U6E A;  3SAW A;  4B3M M;  4X62 M;  4DR4 M;  2OQ4 A;  3GP1 A;  3TWL A;  2UXB M;  1PJJ A;  1Z5A A;  1N34 M;  3SAT A;  5ITR A;  1N32 M;  4DV4 M;  1EE8 A;  4DUZ M;  3GQ3 A;  3U6M A;  3U6P A;  1HR0 M;  3GQ4 A;  3J7A S;  4MB7 A;  4JI8 M;  1K82 A;  1XNR M;  1HNX M;  2VQE M;  1XMQ M;  5ITX A;  3JR4 A;  1IBM M;  4DV1 M;  5ITX E;  5LMN M;  4DR6 M;  2ZM6 M;  1L1T A;  4LF7 M;  2HKJ A;  2F5Q A;  4X66 M;  4PDI A;  2EA0 A;  1MX0 A;  4X64 M;  4NRV A;  3SAS A;  4JYA M;  1IBL M;  4G4R A;  4YHH M;  4LF5 M;  3U6Q A;  1Z5B A;  4DV6 M;  1N33 M;  4GKK M;  3GQ5 A;  3SAR A;  3OTO M;  4LFC M;  2XZU A;  1Q3C A;  4PD2 A;  2HHH M;  1Z59 A;  4DV5 M;  4JI7 M;  4NRW A;  3U6O A;  1HNZ M;  5A2Q S;  4DV2 M;  1TDH A;  4DV7 M;  3U6C A;  1PM5 A;  2UU9 M;  1HNW M;  4GKJ M;  2XZF A;  4JV5 M;  3A45 A;  1R2Y A;  1Q39 A;  1L2B A;  1I94 M;  2UXD M;  3GPU A;  4X65 M;  1PJI A;  1IBK M;  4LFA M;  4JI2 M;  3SAV A;  2F5S A;  4JI0 M;  2F4V M;  3U6L A;  4K0K M;  4G4Q A;  3A42 A;  3T1H M;  4AQY M;  5IWA M;  3C58 A;  2OPF A;  3VK7 A;  4LF6 M;  5ITQ A;  1K3X A;  4JI4 M;  3TWK A;  3T1Y M;  4B3R M;  4G4O A;  1MU5 A;  5BR8 M;  4JI6 M;  4PDG A;  4DR2 M;  1Q3B A;  4LF9 M;  4DR7 M;  1K3W A;  3GPP A;  4PCZ A;  4JI1 M;  4NXN M;  3SAU A;  3DOA A;  3JAM S;  2VQF M;  1TDZ A;  3GPX A;  2UUB M;  1R2Z A;  1L1Z A;  3J80 S;  2UUA M;  4LF8 M;  2F5P A;  5ITY A;  4DR3 M;  1N36 M;  4LFB M;  2F5O A;  3GPY A;  1KFV A;  4DR1 M;  1L2C A;  3VK8 A;  5FLX S;  3GO8 A;  2E5L M;  4G4N A;  4DUY M;  1XC8 A;  2ZBK B;  2UXC M;  5ITU A;  5ITT A;  3SBJ A;  4JI3 M;  3J81 S;  2F5N A;  1J5E M;  4OX9 M;  4KHP M;  1XMO M;  1Z5C A;  4CIS A;  4ITQ A;  3W0F A;  4NXM M;  4B3S M;  4YY3 M;  3JR5 A;  4DR5 M;  3U6S A;  4LF4 M;  2Q2E B;  1NNJ A;  2UUC M;  3TWM A;  5IT9 S;  4DV3 M;  4JI5 M;  4B3T M;  1FJG M;  5LMU M;  4DV0 M;  3U6D A;  3A46 A; 
#chains in the Genus database with same CATH topology
 1NY5 A;  2KA6 B;  5FTM A;  3ZC7 B;  1PJT A;  1G59 A;  1XNQ M;  3H4J A;  1SXJ A;  2MR9 A;  1L2D A;  3SAW A;  3KS8 A;  3ZCB B;  1XXH E;  4B3M M;  1L8Q A;  3J2P B;  4DR4 M;  1C1K A;  1JB0 F;  3CGW A;  2LBC A;  2W82 A;  5DYG A;  1E94 E;  3SAT A;  4LJ4 A;  3F92 A;  4DUZ M;  1GJT A;  1TH2 A;  3U6P A;  3RE8 A;  1ZV1 A;  1N75 A;  2DAK A;  3DFZ A;  4KO8 A;  1IXS B;  3FTD A;  4MB7 A;  1QVR A;  2JNH A;  2DAM A;  1DGH A;  2HAK A;  2KHH A;  2KNZ A;  3U5Z A;  3JR4 A;  1CUK A;  3M0E A;  2ZM6 M;  3D8L A;  3AL0 C;  2EKF A;  5FTK A;  4F2L A;  3KOW E;  2J7N A;  2OOA A;  2DVW B;  4D80 A;  2EA0 A;  4MM3 B;  4FW9 A;  4NRV A;  4IBG A;  2DHY A;  3IHP A;  2CHV A;  1J09 A;  2MH8 A;  2R0I A;  2Y20 A;  2K6B A;  4LCB A;  3FUU A;  3VKG A;  1N33 M;  2CV2 A;  3WHK A;  5DNY A;  4WUR A;  3OTO M;  3GLH E;  3FUX A;  4LRS A;  1TH3 A;  4Z8X A;  3W67 A;  2JY5 A;  4GIP A;  2DWN A;  2I7P A;  1HNZ M;  1H6U A;  1NV9 A;  1VEJ A;  3J27 B;  4P17 A;  1YSY A;  1X37 A;  3T15 A;  4FWD A;  1HNW M;  3L28 A;  4GKJ M;  3E46 A;  3U60 B;  2K47 A;  2FS1 A;  4IBE A;  4MGK E;  1Q39 A;  2CRU A;  2K9D A;  3LCU A;  3RGS A;  1R2Y A;  2Z3X A;  1W5T A;  1IBK M;  3IG8 A;  1R6B X;  2F5S A;  3FUT A;  2XLJ A;  1NVM A;  2KRU A;  4LGM A;  5IZ7 D;  4K0K M;  4F1I A;  5DFL A;  4HEO A;  1JQJ C;  1HT1 E;  2VDB B;  1VDL A;  1SXJ C;  3C3D A;  1MU5 A;  5BR8 M;  4FWH A;  4PDG A;  1Q3B A;  5F3W A;  1HQC A;  4UN2 B;  2XSZ A;  1QUS A;  1XWI A;  1IN7 A;  2Y0T A;  4BLC A;  2MGW A;  3SAU A;  1WR1 B;  3DOA A;  2KRK A;  1KYI A;  4IBB A;  4LRT A;  1MN3 A;  2BWB A;  3LCV B;  2EO2 A;  5E26 A;  5EP3 A;  3J80 S;  3SYL A;  2UUA M;  2F5P A;  2XH9 A;  5ITY A;  2CUZ A;  4LFB M;  5EP4 A;  2CEA A;  2LVP C;  3CTW B;  3GLI E;  2CHG A;  3VK8 A;  1R4G A;  2C9C A;  5KO3 A;  5FLX S;  1GLN A;  2O5R A;  1UM8 A;  3D8B A;  2QSF X;  2J7O A;  1I4W A;  5EXP A;  2F5N A;  2X8A A;  5FTJ A;  2DXI A;  3MJ5 A;  2KEB A;  1Z5C A;  3TE6 A;  3R8F A;  1D0L A;  2APL A;  2V1U A;  4TUW A;  1QYR A;  1JR3 D;  3U6S A;  1KSF X;  3KVW A;  3VDU A;  4LF4 M;  1T43 A;  3KOY E;  1VG5 A;  1VDD A;  4R7G A;  3K9O A;  3FTC A;  5FTL A;  4JI5 M;  4B3T M;  1N78 A;  1R7R A;  5IRE B;  3GLI A;  3KOZ E;  3PFI A;  4MH0 E;  3GLG B;  4L15 A;  2Z4R A;  4S12 A;  1D0K A;  5EXX A;  4OVZ A;  2QCU A;  4D82 A;  3FD9 A;  3M6A A;  3L25 A;  1AUA A;  2EJS A;  1NO1 A;  1OTR A;  1IY0 A;  4L16 A;  1T6O A;  3PVS A;  3UZU A;  4EIW A;  1Z6T A;  1PJJ A;  1N34 M;  2UXB M;  5ITR A;  1EE8 A;  4M9X A;  1IY1 A;  3B9P A;  3U6M A;  2HWJ A;  1HR0 M;  2L7I A;  2DI0 A;  3GLF E;  4WP2 A;  5EP1 A;  2QNJ A;  2RGH A;  3I51 A;  4I5S A;  3J7A S;  1K82 A;  3FRI A;  3AJI B;  5ITX A;  1IBM M;  4DV1 M;  4DR6 M;  4NSO B;  3U61 A;  4LF7 M;  2D7E A;  2HKJ A;  2HL7 A;  3B7Z A;  2DHR A;  4PDI A;  1MX0 A;  3A98 B;  1GO5 A;  2OOB A;  3HJQ A;  3SAS A;  4AKI A;  1WJ7 A;  2WSC F;  4G4R A;  1J7K A;  3Q8G A;  4GMQ A;  4GHL A;  1F4I A;  4L4U A;  4YHH M;  3U6Q A;  1NSF A;  1R5L A;  3TPZ A;  1YUB A;  1Z5B A;  2LHC A;  3DZD A;  4GKK M;  1HQY E;  1IXR C;  2ZTC A;  1G4A E;  3HWS A;  1PJS A;  3SAR A;  4G6Z A;  2QBY A;  3L2A A;  3T6P A;  2XZU A;  5BPV A;  2ZAM A;  2EKK A;  4LJ9 A;  4AW4 A;  1XHB A;  5DYI A;  4PD2 A;  3KSJ A;  3KDS E;  2HHH M;  3SC3 A;  2CFO A;  4NRW A;  4MGY E;  1OIP A;  1WGN A;  2B3T A;  4QHT A;  5A2Q S;  2QP9 X;  3I01 M;  4PT5 A;  3U61 B;  3SFZ A;  3QYB A;  3GLF B;  3U6C A;  1PM5 A;  2H1R A;  3SYK A;  2R65 A;  2LH0 A;  3HY5 A;  4RNA A;  3A45 A;  4R3D A;  2M60 A;  3GRY A;  5EQT A;  2I7N A;  2L2D A;  2KZU A;  5FTN A;  3I4V A;  4LFA M;  2JA2 A;  3UK6 A;  3AOE C;  1IN4 A;  3NWL A;  3KSX A;  3L29 A;  3U5Z B;  1TF0 B;  4G4Q A;  3GRR A;  5EXT A;  2BNK A;  2KNV A;  5EJC A;  3RGP A;  4D81 A;  3GLG E;  4IBD A;  4B7H A;  2OPF A;  2JWS A;  3KFU G;  4JI4 M;  1OKS A;  3T1Y M;  4M0D A;  4G4O A;  2KW0 A;  2BWE A;  2Y0Q A;  1AIP C;  3EIH A;  2R45 A;  3QWL A;  3JAM S;  4IJE A;  2VQF M;  4OW0 A;  2BJV A;  2WSF F;  3AV0 A;  3LVV A;  1R2Z A;  1SXJ E;  3B89 A;  2L7H A;  4LJ5 A;  4LF8 M;  4DR3 M;  3BXW A;  3K8Z A;  2F5O A;  1GKI A;  3GPY A;  4DR1 M;  1LV7 A;  4HLQ A;  5KQD A;  2DAG A;  3VDP A;  4G4N A;  1GL6 A;  4CIZ A;  3FTF A;  1ZMW A;  2KDL A;  5ITU A;  5ITT A;  3GLF A;  4JI3 M;  2LTU A;  4OX9 M;  2DKL A;  4FD2 A;  4NSR A;  1OJL A;  4AKG A;  3HHX A;  1EIJ A;  2DWZ B;  3MHV C;  4FCT A;  4B3S M;  1QUT A;  2M5Z A;  2Z7J A;  4YY3 M;  1G71 A;  1VEK A;  2WSE F;  1ZQ9 A;  2C99 A;  3HHZ A;  4GRI A;  2D7H A;  2C9O A;  3TWM A;  2QBY B;  5IT9 S;  2KXE A;  1IM2 A;  3FUW A;  4LJA A;  1TH4 A;  4MGH A;  4FVM A;  3ZQJ A;  4XBO A;  3U6D A;  3KP0 E;  2R4J A;  4L8R C;  4FCV A;  1SXJ B;  1HT2 E;  3U6E A;  2LXE A;  4FCW A;  2XGN A;  2CE7 A;  4IBJ A;  1V34 A;  4X62 M;  1T3T A;  2OQ4 A;  1PJQ A;  3HZJ A;  3GP1 A;  2A5Y B;  3TWL A;  2RRU A;  1Z5A A;  2CP8 A;  1N32 M;  4DV4 M;  4I4L A;  1DGB A;  3Q8X A;  4KLN A;  1SXJ D;  4IBC A;  3GQ3 A;  1DO2 A;  3GQ4 A;  1ZMU A;  3HHW A;  4G3O A;  3AOE A;  1A5T A;  7CAT A;  1S3S A;  3AOG A;  4JI8 M;  2DZL A;  4RF1 A;  2VQE M;  2GQF A;  3I04 M;  4ANR A;  3E21 A;  3W0L B;  3K9P A;  5LMN M;  1NHW C;  1L1T A;  3TQS A;  3HJ8 A;  2F5Q A;  2OO9 A;  3B7N A;  1QZE A;  2JY6 B;  1LTM A;  3KW6 A;  2P5T A;  4JYA M;  1IBL M;  1VEG A;  4IJF A;  1IY2 A;  4Z6Y A;  1DGG A;  4MGZ E;  2JXN A;  4P16 A;  4BB9 A;  1OQY A;  1E9S A;  1N77 A;  3GQ5 A;  5KPR A;  1PGY A;  1QAM A;  1W5S A;  2O01 F;  2R46 A;  3J7B A;  1Y8G A;  3PNV A;  4M9S A;  1Q3C A;  3AKZ A;  2J5Y A;  3GLI B;  4LFC M;  3HU2 A;  1G41 A;  2JY7 A;  2YQZ A;  3VFD A;  3VLF B;  8CAT A;  1Z59 A;  1QAN A;  4L78 A;  4JI7 M;  1GVN A;  2EUC A;  3LQR A;  2L4F A;  5JI3 E;  1WIV A;  1E9R A;  2KZS A;  3GRU A;  4DV2 M;  1GAB A;  2Y21 A;  3VKH A;  2XEP A;  4REZ A;  5H37 D;  3HJS A;  3LVW A;  2UU9 M;  1D2N A;  1IQP A;  2FNA A;  2JP7 A;  2R62 A;  2DAE A;  4JV5 M;  1V33 A;  2R44 A;  2WZJ A;  2GNO A;  5EXS A;  4NL4 H;  1QDT A;  3GRV A;  3HHY A;  2JZ1 A;  2C5R A;  2VII A;  3GPU A;  1L2B A;  3TL4 X;  1I94 M;  4JI2 M;  3DA1 A;  4NOO B;  3B74 A;  2UXD M;  3SAV A;  4GHA A;  1QAO A;  4CGY B;  4IBI A;  1G8P A;  2C96 A;  4AG6 A;  1DO0 A;  1XB2 B;  2XSZ D;  1OAO C;  3EIE A;  2MJ5 B;  3A42 A;  3T1H M;  2ERC A;  2MRO B;  4GC5 A;  1FNN A;  3GLG A;  3CF6 E;  2LVO C;  3BOS A;  5C1B A;  2NQ8 C;  5ITQ A;  4B3R M;  3TWK A;  3MMP A;  2CHQ A;  4LJ7 A;  3HX3 A;  4DR2 M;  1IFY A;  1K3W A;  3GPP A;  3BBZ A;  1HJP A;  3E9S A;  3KS4 A;  4NXN M;  2HCB A;  1PRB A;  2VF7 A;  2DNA A;  3GPX A;  2JUJ A;  4AI6 A;  1P3Q Q;  2C98 A;  3HKP A;  1L1Z A;  4CJ6 A;  2O25 A;  2RGO A;  1QQW A;  4I81 A;  2LVN C;  1N36 M;  2DWM A;  2FH0 A;  2D7G A;  2LVA A;  2XFT A;  4DBG B;  1KFV A;  2CV0 A;  3L27 A;  4IBF A;  2DZN B;  3MK6 A;  4LY6 A;  2X49 A;  5FSW A;  1WXQ A;  3GO8 A;  3NBX X;  4DUY M;  4KOD A;  1XC8 A;  2ZTD A;  1YE9 A;  4GEW A;  3SHF A;  2QPA A;  2YR0 A;  1J5E M;  3FE3 A;  3UMM A;  4KHP M;  1XMO M;  2YFQ A;  4LJ6 A;  4XK8 F;  3QAU A;  3ILK A;  3C3E A;  1OFH A;  1DGF A;  1SG9 A;  3W0F A;  1WHC A;  4RKU F;  4CIS A;  4ITQ A;  4NXM M;  4DR5 M;  4JN6 A;  3FUV A;  2G5G X;  2QEN A;  1XXH A;  2UUC M;  4OU7 A;  1EFU B;  4M9Z A;  5EP2 A;  2R18 A;  3PXG A;  4DV0 M;  2R6F A;  2DZO B;  3A46 A;  1IN5 A;  3FRH A;  1IN8 A;  3WHL A;  1NJF A;  3W68 A;  2G8L A;  3FTE A;  4MGI E;  1ZMV A;  3RFW A;  1VQ1 A;  2JY8 A;  2QHO B;  1Q02 A;  4QNM A;  3IG5 A;  2AHM A;  5KPZ A;  3U60 A;  2LWX A;  3R9X B;  5KQ8 A;  1IXZ A;  1V92 A;  2ZAO A;  1IXS A;  3HU1 A;  3T38 A;  1QAQ A;  4LZJ A;  1XNR M;  1NY6 A;  1G3I A;  4IBK A;  1DGH B;  1HNX M;  4OVZ B;  4AKH A;  1WGL A;  1XMQ M;  4RF0 A;  4QOZ C;  1JR3 A;  3AFH A;  3KXE C;  4JXJ A;  3UGJ A;  5ITX E;  4B7G A;  1TR8 A;  2G3Q A;  4X66 M;  3THG A;  4X64 M;  3PNY A;  2LHG A;  3FYC A;  2LNH C;  3SHG B;  1OFI A;  4HL4 A;  5L8R F;  1NJG A;  1TGU A;  4LF5 M;  2CWB A;  2YNM D;  3K92 A;  4DV6 M;  4R71 A;  2DWL A;  4B7F A;  2FFJ A;  2QQ8 A;  1NV8 A;  3M7G A;  5KPT A;  2FE8 A;  2BJW A;  2VF8 A;  5JI2 E;  2L4E A;  3LW5 F;  4WW0 A;  4DV5 M;  4AG5 A;  3E4R A;  3FYD A;  2V1C A;  1D0M A;  3UJN A;  3U6O A;  2XF3 A;  1OIZ A;  2Z8Y M;  3KP1 E;  4L6V 6;  4KT0 F;  1ORY B;  1TDH A;  3NBI A;  4DV7 M;  4LG2 A;  3B7Q A;  2XZF A;  4I8O A;  4QNR A;  4W5W A;  2X4A A;  4X65 M;  2LVQ D;  3HU3 A;  4GIT A;  1PJI A;  4II7 A;  1E32 A;  1NNU C;  4GH9 A;  4JI0 M;  3GLH A;  2KNA A;  1IN6 A;  3I4Y A;  4A3V B;  3LMM A;  3U6L A;  2K0B X;  2F4V M;  4LZZ A;  4FWG A;  4CHT B;  2QZ4 A;  1OAI A;  4Q7J A;  1TTE A;  4AQY M;  1DV0 A;  5IWA M;  4LJ8 A;  3C58 A;  3VK7 A;  4LF6 M;  1K3X A;  4GC9 A;  1BVS A;  3ZH9 B;  2DAI A;  4QOS A;  2CV1 A;  3KOX E;  4JI6 M;  3HGI A;  4LF9 M;  2Z4S A;  4DR7 M;  4PCZ A;  3V76 A;  3SMS A;  3FKE A;  4JI1 M;  5GKN A;  3SMP A;  1C7Y A;  1TDZ A;  1XXH B;  3L26 A;  2UUB M;  1QZM A;  4XGI A;  2L6O A;  3K2L A;  1NHG C;  2V6Z M;  1JR3 E;  4NC6 A;  4IIW A;  1ZAE A;  2XFS A;  3GLH B;  1L2C A;  2JZ0 A;  2E5L M;  4BBA A;  1UFZ A;  5C18 A;  2ZBK B;  2UXC M;  2L09 A;  5E6J A;  2FOI C;  1QDR A;  4Y28 F;  2DEN A;  4B08 A;  3LQQ A;  3J81 S;  3SBJ A;  1MJG M;  3CF0 A;  2H5X A;  1RU3 A;  4AZF A;  2ZAN A;  3K1J A;  2RKO A;  4QHS A;  4M0W A;  3C9P A;  3JR5 A;  2R4E A;  2Q2E B;  1GL7 A;  2N35 A;  1GJS A;  4LGY A;  3CF2 A;  1NNJ A;  3QYE A;  3IEC A;  4ZPX A;  3H4M A;  4DV3 M;  1YLA A;  1FJG M;  5LMU M; 
#chains in the Genus database with same CATH homology
 1NY5 A;  2KA6 B;  5FTM A;  3ZC7 B;  1G59 A;  1XNQ M;  1L2D A;  1SXJ A;  3SAW A;  3KS8 A;  3ZCB B;  4B3M M;  1L8Q A;  3J2P B;  4DR4 M;  1C1K A;  2W82 A;  5DYG A;  1E94 E;  3SAT A;  4LJ4 A;  4DUZ M;  1TH2 A;  3U6P A;  3RE8 A;  1N75 A;  3DFZ A;  4KO8 A;  1IXS B;  3FTD A;  4MB7 A;  1QVR A;  1DGH A;  3U5Z A;  3JR4 A;  3M0E A;  2ZM6 M;  3D8L A;  3AL0 C;  5FTK A;  3KOW E;  2J7N A;  4D80 A;  2DVW B;  2EA0 A;  4MM3 B;  4FW9 A;  4NRV A;  4IBG A;  2CHV A;  1J09 A;  2Y20 A;  4LCB A;  3FUU A;  3VKG A;  1N33 M;  2CV2 A;  3WHK A;  5DNY A;  4WUR A;  3OTO M;  3FUX A;  4LRS A;  1TH3 A;  4Z8X A;  4GIP A;  2DWN A;  2I7P A;  1HNZ M;  1H6U A;  3J27 B;  1YSY A;  1X37 A;  3T15 A;  4FWD A;  1HNW M;  3L28 A;  4GKJ M;  3U60 B;  2K47 A;  3RGS A;  4IBE A;  4MGK E;  1Q39 A;  1R2Y A;  2Z3X A;  1W5T A;  1IBK M;  3IG8 A;  1R6B X;  2F5S A;  3FUT A;  2XLJ A;  1NVM A;  2KRU A;  4LGM A;  5IZ7 D;  4K0K M;  1JQJ C;  1HT1 E;  1SXJ C;  1MU5 A;  5BR8 M;  4FWH A;  4PDG A;  1Q3B A;  5F3W A;  1HQC A;  2XSZ A;  1XWI A;  2Y0T A;  1IN7 A;  4BLC A;  3SAU A;  3DOA A;  2KRK A;  1KYI A;  4IBB A;  4LRT A;  2EO2 A;  5E26 A;  5EP3 A;  3J80 S;  3SYL A;  2UUA M;  2F5P A;  2XH9 A;  5ITY A;  2CUZ A;  4LFB M;  5EP4 A;  2CEA A;  3CTW B;  2CHG A;  3VK8 A;  5FLX S;  2C9C A;  5KO3 A;  1GLN A;  2O5R A;  1UM8 A;  3D8B A;  2J7O A;  1I4W A;  5EXP A;  2F5N A;  2X8A A;  5FTJ A;  2DXI A;  3MJ5 A;  2KEB A;  1Z5C A;  3TE6 A;  3R8F A;  2V1U A;  4TUW A;  1QYR A;  1JR3 D;  3U6S A;  1KSF X;  3KVW A;  3VDU A;  4LF4 M;  3KOY E;  1VDD A;  4R7G A;  3FTC A;  5FTL A;  4JI5 M;  4B3T M;  1N78 A;  1R7R A;  5IRE B;  3GLI A;  3KOZ E;  3PFI A;  4MH0 E;  3GLG B;  4L15 A;  2Z4R A;  4S12 A;  5EXX A;  4OVZ A;  2QCU A;  4D82 A;  3FD9 A;  3M6A A;  3L25 A;  1IY0 A;  4L16 A;  3UZU A;  3PVS A;  1PJJ A;  4EIW A;  1Z6T A;  1N34 M;  2UXB M;  5ITR A;  1EE8 A;  4M9X A;  1IY1 A;  3B9P A;  3U6M A;  1HR0 M;  2L7I A;  5EP1 A;  2RGH A;  4I5S A;  3I51 A;  3J7A S;  1K82 A;  3AJI B;  5ITX A;  1IBM M;  4DV1 M;  4DR6 M;  4NSO B;  3U61 A;  4LF7 M;  2D7E A;  2HKJ A;  2HL7 A;  2DHR A;  4PDI A;  1MX0 A;  3A98 B;  3HJQ A;  3SAS A;  4AKI A;  4G4R A;  1J7K A;  4GMQ A;  4GHL A;  4L4U A;  4YHH M;  3U6Q A;  1NSF A;  3TPZ A;  1YUB A;  1Z5B A;  3DZD A;  4GKK M;  1HQY E;  1IXR C;  1G4A E;  3HWS A;  3SAR A;  4G6Z A;  2QBY A;  3L2A A;  2XZU A;  5BPV A;  2ZAM A;  4LJ9 A;  4AW4 A;  1XHB A;  5DYI A;  4PD2 A;  3KSJ A;  3KDS E;  2HHH M;  3SC3 A;  2CFO A;  4NRW A;  4MGY E;  4QHT A;  5A2Q S;  2QP9 X;  4PT5 A;  3U61 B;  3SFZ A;  3GLF B;  3U6C A;  1PM5 A;  2H1R A;  3SYK A;  2R65 A;  2LH0 A;  4RNA A;  3A45 A;  4R3D A;  2M60 A;  3GRY A;  5EQT A;  2I7N A;  2KZU A;  5FTN A;  3I4V A;  4LFA M;  2JA2 A;  3UK6 A;  3AOE C;  1IN4 A;  3NWL A;  3KSX A;  3L29 A;  3U5Z B;  4G4Q A;  3GRR A;  5EXT A;  2BNK A;  5EJC A;  4D81 A;  3RGP A;  4IBD A;  4B7H A;  2OPF A;  3KFU G;  4JI4 M;  3T1Y M;  4M0D A;  4G4O A;  2KW0 A;  2Y0Q A;  3EIH A;  2R45 A;  3QWL A;  3JAM S;  4IJE A;  2VQF M;  4OW0 A;  2BJV A;  3AV0 A;  3LVV A;  1R2Z A;  1SXJ E;  2L7H A;  4LJ5 A;  4LF8 M;  4DR3 M;  3K8Z A;  2F5O A;  1GKI A;  3GPY A;  4DR1 M;  1LV7 A;  4HLQ A;  5KQD A;  3VDP A;  4G4N A;  1GL6 A;  3FTF A;  5ITU A;  5ITT A;  3GLF A;  4JI3 M;  4OX9 M;  4FD2 A;  4NSR A;  1OJL A;  4AKG A;  3HHX A;  2DWZ B;  3MHV C;  4FCT A;  4B3S M;  2M5Z A;  2Z7J A;  4YY3 M;  1ZQ9 A;  2C99 A;  3HHZ A;  4GRI A;  2D7H A;  2C9O A;  3TWM A;  2QBY B;  5IT9 S;  2KXE A;  1IM2 A;  3FUW A;  4LJA A;  1TH4 A;  4MGH A;  4FVM A;  4XBO A;  3U6D A;  3KP0 E;  2R4J A;  4L8R C;  4FCV A;  1SXJ B;  1HT2 E;  3U6E A;  2LXE A;  4FCW A;  2XGN A;  2CE7 A;  4IBJ A;  4X62 M;  1T3T A;  2OQ4 A;  3GP1 A;  2A5Y B;  3TWL A;  1Z5A A;  1N32 M;  4DV4 M;  4I4L A;  1DGB A;  3Q8X A;  4KLN A;  1SXJ D;  4IBC A;  3GQ3 A;  1DO2 A;  3GQ4 A;  3HHW A;  3AOE A;  7CAT A;  1S3S A;  3AOG A;  4JI8 M;  4RF1 A;  2VQE M;  3W0L B;  5LMN M;  1NHW C;  1L1T A;  3TQS A;  3HJ8 A;  2F5Q A;  3KW6 A;  2P5T A;  4JYA M;  1IBL M;  4IJF A;  1IY2 A;  4Z6Y A;  1DGG A;  4MGZ E;  4P16 A;  4BB9 A;  1E9S A;  1N77 A;  3GQ5 A;  5KPR A;  1QAM A;  2R46 A;  1W5S A;  3J7B A;  3PNV A;  4M9S A;  3GLI B;  3AKZ A;  1Q3C A;  4LFC M;  3HU2 A;  1G41 A;  2YQZ A;  3VFD A;  3VLF B;  8CAT A;  1Z59 A;  1QAN A;  4L78 A;  4JI7 M;  1GVN A;  2EUC A;  3LQR A;  5JI3 E;  1E9R A;  2KZS A;  3GRU A;  4DV2 M;  2Y21 A;  3VKH A;  2XEP A;  4REZ A;  5H37 D;  3HJS A;  3LVW A;  2UU9 M;  1D2N A;  1IQP A;  2FNA A;  2R62 A;  4JV5 M;  5EXS A;  3HHY A;  1L2B A;  4NL4 H;  1I94 M;  3GRV A;  2C5R A;  2VII A;  3GPU A;  2UXD M;  3TL4 X;  4JI2 M;  3DA1 A;  4NOO B;  3SAV A;  4GHA A;  1QAO A;  4CGY B;  4IBI A;  1G8P A;  2C96 A;  4AG6 A;  1DO0 A;  3EIE A;  2XSZ D;  3A42 A;  3T1H M;  2ERC A;  4GC5 A;  1FNN A;  3GLG A;  3CF6 E;  3BOS A;  5C1B A;  2NQ8 C;  5ITQ A;  4B3R M;  3TWK A;  2CHQ A;  4LJ7 A;  4DR2 M;  1K3W A;  3GPP A;  3E9S A;  3KS4 A;  4NXN M;  2HCB A;  3GPX A;  4AI6 A;  2C98 A;  3HKP A;  1L1Z A;  2RGO A;  1QQW A;  4I81 A;  1N36 M;  2DWM A;  2D7G A;  2XFT A;  2CV0 A;  1KFV A;  3L27 A;  4IBF A;  2DZN B;  3MK6 A;  4LY6 A;  2X49 A;  5FSW A;  1WXQ A;  3GO8 A;  4DUY M;  4KOD A;  1XC8 A;  1YE9 A;  3SHF A;  2QPA A;  2YR0 A;  1J5E M;  3UMM A;  4KHP M;  1XMO M;  2YFQ A;  4LJ6 A;  3QAU A;  3ILK A;  1OFH A;  1DGF A;  3W0F A;  4CIS A;  4ITQ A;  4NXM M;  4DR5 M;  4JN6 A;  3FUV A;  2G5G X;  2QEN A;  1XXH A;  2UUC M;  4OU7 A;  4M9Z A;  5EP2 A;  2R18 A;  3PXG A;  4DV0 M;  2DZO B;  3A46 A;  1IN5 A;  1IN8 A;  3WHL A;  1NJF A;  2G8L A;  3FTE A;  4MGI E;  3RFW A;  4QNM A;  3IG5 A;  2AHM A;  5KPZ A;  3U60 A;  2LWX A;  3R9X B;  5KQ8 A;  1IXZ A;  2ZAO A;  3HU1 A;  3T38 A;  1QAQ A;  4LZJ A;  1XNR M;  1NY6 A;  1G3I A;  4IBK A;  1DGH B;  1HNX M;  4OVZ B;  4AKH A;  1XMQ M;  4RF0 A;  4QOZ C;  1JR3 A;  3AFH A;  3KXE C;  4JXJ A;  3UGJ A;  5ITX E;  4B7G A;  4X66 M;  3THG A;  4X64 M;  3PNY A;  3FYC A;  2LNH C;  3SHG B;  1OFI A;  4HL4 A;  1NJG A;  1TGU A;  4LF5 M;  2YNM D;  3K92 A;  4DV6 M;  2DWL A;  4B7F A;  2FFJ A;  3M7G A;  5KPT A;  2FE8 A;  2BJW A;  5JI2 E;  4WW0 A;  4DV5 M;  4AG5 A;  3E4R A;  3FYD A;  2V1C A;  3UJN A;  3U6O A;  2XF3 A;  3KP1 E;  1ORY B;  1TDH A;  3NBI A;  4DV7 M;  4LG2 A;  2XZF A;  4I8O A;  4QNR A;  4W5W A;  2X4A A;  4X65 M;  1PJI A;  3HU3 A;  4GIT A;  4II7 A;  1E32 A;  1NNU C;  4GH9 A;  4JI0 M;  3GLH A;  1IN6 A;  3I4Y A;  4A3V B;  3LMM A;  3U6L A;  2F4V M;  4LZZ A;  4FWG A;  4CHT B;  2QZ4 A;  4AQY M;  5IWA M;  4LJ8 A;  3C58 A;  3VK7 A;  4LF6 M;  1K3X A;  4GC9 A;  3ZH9 B;  4QOS A;  2CV1 A;  3KOX E;  4JI6 M;  3HGI A;  4LF9 M;  2Z4S A;  4DR7 M;  4PCZ A;  3SMS A;  3FKE A;  4JI1 M;  5GKN A;  3SMP A;  1TDZ A;  1XXH B;  3L26 A;  2UUB M;  1QZM A;  4XGI A;  2L6O A;  3K2L A;  1NHG C;  2V6Z M;  4IIW A;  1ZAE A;  2XFS A;  3GLH B;  1L2C A;  2E5L M;  4BBA A;  5C18 A;  2ZBK B;  2UXC M;  2L09 A;  5E6J A;  2FOI C;  3SBJ A;  4B08 A;  3J81 S;  3LQQ A;  3CF0 A;  4AZF A;  2ZAN A;  3K1J A;  2RKO A;  4QHS A;  4M0W A;  3JR5 A;  2R4E A;  2Q2E B;  1GL7 A;  4LGY A;  3CF2 A;  1NNJ A;  4ZPX A;  3H4M A;  4DV3 M;  1FJG M;  5LMU M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...