3J7AS

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
QHILRILNTNVDGKEKVIIALTAIKGIGKRMATVICKQANVDPTKRAGELTTEEIDNIVHIMSTPTQFKIPDWFLNRRKDLKEGKNIHVIANQLDSYLREDLERMKKIRLHRGLRHHWGLRVRGQHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j7aS01
5IWAM 4X64M 4DV3M 3J81S 1Z5CA 3GPUA 2F5QA 3SAVA 1MU5A 3TWLA 5IT9S 4LFCM 3A45A 4JI6M 1N34M 3DOAA 5ITTA 4JI1M 4MB7A 4G4RA 4DR2M 4B3MM 4G4QA 4DV4M 3SASA 5ITXA 4YY3M 3T1HM 1NNJA 3JAMS 1L2BA 5ITQA 2UXDM 1L2CA 1MX0A 3U6OA 4G4NA 2F5NA 2HHHM 4LF8M 1PJIA 4CISA 4GKKM 4LF5M 1HNWM 4NXNM 2Q2EB 3GQ5A 3A46A 4K0KM 2UU9M 4AQYM 3SATA 4LF7M 2OPFA 3VK8A 5ITXE 5LMNM 2F5OA 4NRVA 3GP1A 1XMQM 1L2DA 1K3XA 1XNQM 3J80S 3SAUA 4B3SM 3GPYA 4DV6M 4LFAM 1Q3BA 2XZFA 3GQ4A 4DV2M 4PD2A 3JR4A 3T1YM 4JYAM 1HNZM 4DV1M 1K82A 4DR1M 3JR5A 1XMOM 5BR8M 4NXMM 4KHPM 3U6DA 2UUBM 1IBMM 3U6EA 4DR3M 4DUZM 4DR5M 1FJGM 5ITRA 1I94M 4DR4M 1N36M 1L1TA 3GQ3A 5ITYA 4X62M 3U6CA 4PDIA 3GO8A 1XC8A 1XNRM 1IBKM 1IBLM 2E5LM 3U6QA 2VQEM 3VK7A 4LF9M 4DR6M 4X66M 4X65M 3SAWA 4ITQA 2HKJA 4LFBM 5FLXS 1L1ZA 1N33M 1J5EM 1R2ZA 4JI0M 4DV5M 3A42A 4JI3M 5A2QS 2F5SA 3OTOM 1N32M 2ZM6M 4DV7M 4JI7M 3W0FA 4JV5M 1Q39A 2UUAM 4B3TM 2VQFM 4DV0M 5LMUM 4JI5M 2UXBM 4NRWA 1Q3CA 3GPXA 1HR0M 4GKJM 2XZUA 1Z5AA 1Z5BA 1K3WA 4PCZA 4JI2M 3J7AS 1Z59A 3U6SA 4YHHM 4JI8M 1KFVA 2OQ4A 4PDGA 2EA0A 1PM5A 2F5PA 3C58A 2UXCM 1TDHA 1PJJA 3U6MA 1HNXM 1TDZA 1R2YA 3U6PA 3U6LA 3GPPA 4DR7M 4DUYM 2F4VM 4LF4M 4G4OA 4JI4M 1EE8A 2ZBKB 3TWKA 2UUCM 3TWMA 4OX9M 3SARA 3SBJA 4B3RM 4LF6M 5ITUA
chains in the Genus database with same CATH superfamily
4L4UA 4DV3M 1L8QA 2D7HA 1MU5A 4KO8A 1NV9A 5JI2E 2KW0A 4JXJA 1T3TA 1NY5A 1PJSA 4G4RA 2QHOB 1NJGA 2X8AA 4G4QA 4NSRA 4RKUF 5KPZA 2JUJA 2VDBB 3KP1E 4IBEA 4IBGA 3VKGA 3ZH9B 4LJ6A 3GRYA 3KS4A 2LBCA 1NV8A 4S12A 2CHVA 2DWNA 4GRIA 4AG5A 4G4NA 2JY5A 1TGUA 1G4AE 2EKFA 1WHCA 1HQCA 2J7NA 1WJ7A 4HLQA 4KT0F 2KNVA 3A46A 2LVPC 3PVSA 2C9CA 1HT1E 3SATA 3W0LB 4FD2A 1QAMA 3KOZE 1QDRA 2LHGA 2DVWB 2BJVA 1A5TA 5KO3A 1NHGC 3C9PA 3LQQA 3GLFA 3IG5A 4NRVA 3E9SA 1L2DA 1K3XA 2LXEA 1I4WA 3B89A 1Y8GA 2CFOA 5EP2A 3GQ4A 4DV2M 3L26A 2QPAA 2QCUA 3JR4A 4R7GA 3W67A 5EP4A 3ILKA 2HWJA 5EQTA 4DR1M 3JR5A 2LVOC 5EXSA 4RF1A 1UFZA 3AOGA 3BOSA 4L78A 1IBMM 4FW9A 1OIZA 2L09A 1ZQ9A 4LRSA 2CEAA 4XBOA 1YUBA 1EFUB 3KVWA 4I81A 3Q8GA 4HEOA 4MGZE 3GLFE 2R44A 3DZDA 2CHGA 4LJ5A 2JY7A 1QAOA 2DHYA 1DV0A 4PDIA 1XC8A 4CHTB 3CTWB 3F92A 2ZAOA 1IBLM 4M0DA 1QVRA 1OIPA 3U6QA 3LQRA 3QWLA 2HKJA 2RGOA 4WURA 3RFWA 1L1ZA 5FTJA 1BVSA 2M60A 2I7PA 3FKEA 4L16A 4HL4A 4WP2A 2QSFX 2KNAA 2BNKA 4JI3M 5A2QS 3SFZA 1N32M 4DV7M 4JI7M 1OFHA 1SXJB 2FS1A 2P5TA 3W0FA 2WSFF 1CUKA 1NSFA 2LH0A 3FRHA 1R5LA 2Y0TA 1Q39A 2UUAM 3R9XB 4XGIA 1J7KA 5LMUM 4DV0M 4JI5M 4JN6A 4NRWA 1QUTA 1Q3CA 3ZQJA 4AG6A 1G8PA 3FYDA 1KSFX 3KP0E 5FTNA 1Z5AA 2DZOB 2O5RA 5IREB 2V1CA 3PNVA 1Z6TA 1KFVA 1GVNA 4PDGA 3U60B 3HX3A 1R4GA 1TDHA 2KNZA 2L4EA 1TTEA 5KQ8A 2Z8YM 2XEPA 4M9SA 1TH2A 3CF2A 3U6LA 2QP9X 4LGMA 3AFHA 3U61A 3K9OA 1NJFA 2OOBA 2VF7A 4QNRA 4DUYM 2F4VM 4G4OA 4MM3B 2FOIC 2B3TA 2JZ1A 2ZBKB 3TWMA 2UUCM 2XSZD 5DNYA 2KHHA 1WGLA 3GPUA 1Z5CA 3CGWA 2Z7JA 3SAVA 3TWLA 2CV1A 5IT9S 1VDLA 1XHBA 4LFCM 4TUWA 1UM8A 3A45A 1GL6A 1OAOC 5EJCA 4JI6M 4BLCA 2QZ4A 3DOAA 5DYIA 4MB7A 2L4FA 3M7GA 1OTRA 4IBDA 5JI3E 1NNUC 3SC3A 3TPZA 3FUUA 4DV4M 4LJ9A 4CGYB 3GLGB 1GL7A 5ITXA 3VDPA 2H5XA 4IBKA 1JQJC 3T1HM 1NNJA 2R0IA 4OVZA 1IXRC 4B08A 3UMMA 4LZZA 1F4IA 3KDSE 4F2LA 2Z4SA 3AOEC 3MMPA 2W82A 4IJFA 4GC5A 3TE6A 2XF3A 3HWSA 2F5NA 5EXPA 2HHHM 2G3QA 1GABA 4AKGA 2M5ZA 1KYIA 1ZMVA 1DGHA 4LF5M 3FTEA 4AKHA 2JNHA 3TQSA 3C3DA 1SG9A 4K0KM 3GRVA 2UU9M 2DAMA 4LF7M 1VDDA 1YSYA 2JY6B 1OJLA 5L8RF 1DO2A 1AUAA 5ITXE 1GKIA 1NY6A 3QAUA 2EO2A 2R18A 1IFYA 1HQYE 1NO1A 2KZUA 3E21A 5C1BA 2F5OA 3L2AA 2R6FA 1XNQM 3J80S 3E46A 1IY1A 3SAUA 4MGYE 2DAIA 4L6V6 4B3SM 4LFAM 3HJSA 4M9ZA 4Z8XA 2KRKA 1G71A 1HNZM 2C9OA 3PFIA 4DV1M 4GHLA 2YNMD 5BR8M 3GLIB 2UUBM 2ZAMA 2MROB 3KOXE 1R7RA 2DWLA 3TL4X 1ZV1A 4DUZM 1XXHA 3KW6A 3I01M 1AIPC 1OFIA 5ITRA 4DR4M 1N36M 3GRRA 8CATA 3SHGB 3MK6A 1L1TA 2KDLA 1VEGA 1W5TA 3GQ3A 5ITYA 1D2NA 1H6UA 1ZMWA 2C96A 3SYKA 4LJ7A 3HGIA 3HY5A 1IBKM 3GRUA 2E5LM 2FFJA 3FTCA 3L29A 2VQEM 2JP7A 2VF8A 2QQ8A 4X65M 1HT2E 3U5ZA 2XH9A 3E4RA 4LFBM 2JA2A 4MGKE 5IZ7D 5FLXS 1N33M 1XXHE 4IBIA 4I8OA 3KS8A 2QBYA 4LGYA 2MH8A 3HKPA 4XK8F 4FVMA 4JI0M 3D8BA 4RF0A 3OTOM 2F5SA 2EJSA 4I4LA 2ZM6M 3FUWA 3HU3A 3V76A 1D0LA 2KA6B 2L7IA 3M0EA 1IM2A 4M9XA 3AOEA 1W5SA 3I4YA 3IHPA 1JB0F 1LTMA 3H4MA 3J7AS 4JI2M 2LNHC 4JI8M 2EA0A 2F5PA 1TH3A 3C58A 2V1UA 3LVVA 1YE9A 4Y28F 3U6MA 4GHAA 4GEWA 1TDZA 1SXJC 1R2YA 1PJTA 2O25A 2APLA 4Q7JA 3T15A 3VDUA 3SMPA 1MJGM 2HL7A 3FTFA 3LVWA 2YR0A 3PNYA 3GLHB 2XLJA 4AKIA 2NQ8C 2R4JA 3HHYA 3ZC7B 2XFSA 4LF4M 2JWSA 4AW4A 4B3RM 4LF9M 2VQFM 1N77A 5IWAM 1ZMUA 4X64M 1V33A 2DXIA 3PXGA 2F5QA 2O01F 4M0WA 2Z3XA 2C99A 1IXSB 2R62A 3B7ZA 4RNAA 4QOSA 3AV0A 1GLNA 3SASA 3HHWA 2GNOA 3DFZA 4YY3M 1E94E 2CV0A 5ITQA 1L2CA 4LRTA 1MX0A 4D80A 4LF8M 2CV2A 5EXXA 3UJNA 1PJIA 4CISA 2ERCA 5FTMA 3LMMA 1X37A 3T38A 3GQ5A 5E26A 1HNWM 3DA1A 4IJEA 5EP3A 2DHRA 1EIJA 3I4VA 4IBJA 3K2LA 4GITA 2DAGA 3HHZA 1G3IA 3RGPA 1N78A 1TR8A 2FNAA 3GP1A 2OO9A 1GO5A 2QNJA 4P17A 2EUCA 1JR3A 4LZJA 3CF6E 3GPYA 4DV6M 1Q3BA 2N35A 2XZFA 2D7EA 4PD2A 3T1YM 1IN8A 2FH0A 4I5SA 2OOAA 4JYAM 1K82A 1XMOM 4KHPM 3L28A 1TH4A 2AHMA 1XXHB 3MJ5A 4LJAA 4Z6YA 4MGHA 1QZMA 3QYEA 4AI6A 3FYCA 3KOYE 5FTLA 4DR3M 4DR5M 2YQZA 1SXJA 3HJ8A 5FTKA 4F1IA 2KEBA 3K92A 1JR3E 2LTUA 4GIPA 2K6BA 2X4AA 3HJQA 5BPVA 2WSEF 4X62M 1V92A 2BWEA 3GLFB 4REZA 3GO8A 2RKOA 4IIWA 1XNRM 2LVNC 4MH0E 4UN2B 2Z4RA 2CUZA 3VK7A 1YLAA 2HCBA 2KXEA 4X66M 3SAWA 3U60A 4LG2A 3KFUG 2Y21A 4DR6M 1MN3A 3D8LA 1IY0A 2CRUA 2DWZB 1J5EM 1SXJE 1R2ZA 2EKKA 4QNMA 2XFTA 4LCBA 4OU7A 4DV5M 2C5RA 3A42A 4LY6A 3FD9A 1XWIA 4LJ4A 1WIVA 2ZTCA 2RRUA 2DKLA 4WW0A 4QHSA 3WHLA 4D81A 4QHTA 2V6ZM 2Y0QA 1RU3A 1DO0A 1VG5A 2MGWA 3GPXA 1HR0M 1PJQA 3EIEA 4CJ6A 2MJ5B 1XB2B 4ZPXA 4PCZA 3A98B 1WXQA 1Z59A 2J7OA 4MGIE 3U6SA 5GKNA 2DWMA 2MR9A 3KOWE 3ZCBB 1HNXM 1R6BX 1IXZA 2DNAA 2C98A 3AL0C 1V34A 2LHCA 2D7GA 3GLGA 2Y20A 4G3OA 4B7HA 4L8RC 2G8LA 2R45A 3J7BA 2HAKA 3RE8A 3WHKA 1IQPA 4DR7M 4NSOB 1QDTA 3K9PA 3T6PA 2WSCF 1EE8A 3RGSA 1IN4A 3UZUA 3SBJA 4LF6M 5ITUA 2L2DA 2JY8A 3I51A 2YFQA 3LCUA 1D0MA 1P3QQ 2KRUA 2X49A 4B7GA 3J81S 3NWLA 3L25A 2LVAA 3EIHA 4IBFA 4FCTA 2JXNA 1N34M 1IN5A 5ITTA 3GLGE 3HHXA 4JI1M 4B3MM 4DR2M 7CATA 2I7NA 1ORYB 2QENA 3HU2A 3B9PA 4GH9A 4PT5A 4FWHA 3U61B 3SMSA 3JAMS 1L2BA 2UXDM 3C3EA 4KODA 1C1KA 2CE7A 2H1RA 1PGYA 4B7FA 3UK6A 3U6OA 1HJPA 3FUTA 5KPRA 3LW5F 2BWBA 2L7HA 4GKKM 5DYGA 3SHFA 3GLIA 5EP1A 1DGFA 3MHVC 4NXNM 2Q2EB 1GJTA 1QYRA 4AQYM 3KSJA 1G41A 1QAQA 2OPFA 2VIIA 3VK8A 1Q02A 3K8ZA 4L15A 3HU1A 5LMNM 1NHWC 1QANA 3B7QA 3H4JA 2CHQA 5DFLA 4G6ZA 3CF0A 5F3WA 2G5GX 1XMQM 1DGBA 4KLNA 2WZJA 3VKHA 5FSWA 1D0KA 1ZAEA 4BBAA 1OAIA 4OVZB 1FNNA 4D82A 3GLIE 1E9RA 4NOOB 1VEKA 4NXMM 3VFDA 2A5YB 3FTDA 4R71A 3IECA 5H37D 3U6DA 3J27B 1DGHB 3U6EA 1J09A 4OW0A 4IBCA 3K1JA 2ZTDA 4GMQA 4R3DA 5KQDA 1QZEA 1GJSA 1FJGM 3R8FA 2DAKA 3M6AA 4NC6A 5EXTA 4CIZA 4GC9A 3THGA 2CWBA 1TF0B 2FE8A 2RGHA 1I94M 3W68A 3NBIA 2L6OA 1LV7A 3L27A 4NL4H 3U6CA 2DZNB 2DAEA 2GQFA 2CP8A 3B7NA 1VQ1A 5KPTA 2DI0A 4A3VB 1NVMA 3FRIA 4DBGB 1QQWA 4AZFA 4W5WA 3FE3A 4FWDA 4EIWA 3LCVB 4ITQA 4IBBA 1N75A 2J5YA 2XSZA 2BJWA 4FCWA 1WR1B 4P16A 4ANRA 4LJ8A 3HZJA 3IG8A 1G59A 2DENA 2XGNA 4QOZC 2LWXA 2K9DA 1JR3D 3QYBA 3GLHA 4FWGA 1IN7A 1WGNA 1E32A 5C18A 4B3TM 1IN6A 4JV5M 5E6JA 1QUSA 3I04M 3SYLA 3UGJA 2UXBM 3BBZA 1PRBA 3B74A 1C7YA 4GKJM 2DZLA 2XZUA 3FUVA 2KZSA 2ZANA 1Z5BA 1K3WA 1OQYA 3J2PB 3NBXX 1IY2A 4YHHM 3VLFB 1OKSA 3AKZA 1SXJD 2OQ4A 1PM5A 1IXSA 3U5ZB 4II7A 2UXCM 1PJJA 3BXWA 1E9SA 1S3SA 2QBYB 3GLHE 3FUXA 2JZ0A 3U6PA 2R4EA 1T43A 3GPPA 4BB9A 1T6OA 3AJIB 2LVQD 3KSXA 2R46A 4JI4M 3KXEC 1DGGA 2K47A 3TWKA 3Q8XA 4OX9M 2R65A 3SARA 1VEJA 2K0BX 4FCVA
chains in the Genus database with same CATH topology
4L4UA 4DV3M 1L8QA 2D7HA 1MU5A 4KO8A 5JI2E 2KW0A 4JXJA 1T3TA 1NY5A 4G4RA 2X8AA 1NJGA 4G4QA 4NSRA 5KPZA 4IBEA 3KP1E 4IBGA 3VKGA 3ZH9B 4LJ6A 3GRYA 3KS4A 4S12A 2CHVA 2DWNA 4GRIA 4AG5A 4G4NA 1TGUA 1G4AE 1HQCA 2J7NA 4HLQA 3A46A 3PVSA 2C9CA 1HT1E 3SATA 3W0LB 4FD2A 1QAMA 3KOZE 2DVWB 2BJVA 5KO3A 1NHGC 3LQQA 3GLFA 3IG5A 4NRVA 3E9SA 1L2DA 1K3XA 2LXEA 1I4WA 2CFOA 5EP2A 3GQ4A 4DV2M 3L26A 2QPAA 2QCUA 3JR4A 4R7GA 5EP4A 3ILKA 5EQTA 4DR1M 3JR5A 5EXSA 4RF1A 3AOGA 3BOSA 4L78A 1IBMM 4FW9A 2L09A 1ZQ9A 4LRSA 2CEAA 4XBOA 1YUBA 3KVWA 4I81A 4MGZE 3DZDA 2CHGA 4LJ5A 1QAOA 4PDIA 1XC8A 4CHTB 3CTWB 2ZAOA 1IBLM 4M0DA 1QVRA 3U6QA 3LQRA 3QWLA 2HKJA 2RGOA 4WURA 3RFWA 1L1ZA 5FTJA 2M60A 2I7PA 3FKEA 4L16A 4HL4A 1N32M 4JI3M 2BNKA 5A2QS 3SFZA 4DV7M 4JI7M 1OFHA 1SXJB 3W0FA 2P5TA 5BPVA 1NSFA 2LH0A 2Y0TA 1Q39A 2UUAM 3R9XB 4XGIA 1J7KA 5LMUM 4DV0M 4JI5M 4JN6A 4NRWA 1Q3CA 4AG6A 1G8PA 3FYDA 1KSFX 3KP0E 5FTNA 1Z5AA 2DZOB 2O5RA 5IREB 2V1CA 3PNVA 1Z6TA 1KFVA 1GVNA 4PDGA 3U60B 1TDHA 5KQ8A 2XEPA 4M9SA 1TH2A 3CF2A 3U6LA 2QP9X 4LGMA 3AFHA 3U61A 1NJFA 4QNRA 4DUYM 2F4VM 4G4OA 4MM3B 2FOIC 2ZBKB 2UUCM 3TWMA 2XSZD 5DNYA 3GPUA 1Z5CA 2Z7JA 3SAVA 3TWLA 2CV1A 5IT9S 1XHBA 4LFCM 4TUWA 1UM8A 3A45A 1GL6A 5EJCA 4JI6M 4BLCA 2QZ4A 3DOAA 5DYIA 4MB7A 3M7GA 4IBDA 5JI3E 1NNUC 3SC3A 3TPZA 3FUUA 4DV4M 4LJ9A 4CGYB 3GLGB 1GL7A 5ITXA 3VDPA 4IBKA 1JQJC 3T1HM 1NNJA 4OVZA 1IXRC 4B08A 3UMMA 4LZZA 3KDSE 2Z4SA 3AOEC 2W82A 4IJFA 4GC5A 3TE6A 2XF3A 3HWSA 2F5NA 5EXPA 2HHHM 4AKGA 2M5ZA 1KYIA 1DGHA 4LF5M 3FTEA 4AKHA 3TQSA 4K0KM 3GRVA 2UU9M 4LF7M 1VDDA 1YSYA 1OJLA 1DO2A 5ITXE 1GKIA 1NY6A 3QAUA 2EO2A 2R18A 1HQYE 2F5OA 2KZUA 5C1BA 3L2AA 1XNQM 3J80S 3SAUA 1IY1A 4B3SM 4MGYE 4LFAM 3HJSA 4M9ZA 4Z8XA 2KRKA 1HNZM 2C9OA 3PFIA 4DV1M 4GHLA 2YNMD 5BR8M 3GLIB 2UUBM 2ZAMA 3KOXE 1R7RA 2DWLA 3TL4X 4DUZM 1XXHA 3KW6A 1OFIA 5ITRA 4DR4M 1N36M 3GRRA 8CATA 3SHGB 3MK6A 1L1TA 3GQ3A 1W5TA 5ITYA 1D2NA 1H6UA 2C96A 3SYKA 4LJ7A 3HGIA 1IBKM 3GRUA 2E5LM 2FFJA 3FTCA 3L29A 2VQEM 4X65M 1HT2E 3U5ZA 2XH9A 3E4RA 4LFBM 2JA2A 4MGKE 5IZ7D 5FLXS 1N33M 4IBIA 4I8OA 3KS8A 2QBYA 4LGYA 3HKPA 4JI0M 4FVMA 3D8BA 4RF0A 3OTOM 2F5SA 4I4LA 2ZM6M 3FUWA 3HU3A 2KA6B 2L7IA 3M0EA 1IM2A 4M9XA 3AOEA 1W5SA 3I4YA 3H4MA 3J7AS 4JI2M 2LNHC 4JI8M 2EA0A 2F5PA 1TH3A 3C58A 2V1UA 3LVVA 1YE9A 3U6MA 4GHAA 1TDZA 1SXJC 1R2YA 3T15A 3VDUA 3SMPA 2HL7A 3FTFA 3LVWA 2YR0A 3PNYA 3GLHB 2XLJA 4AKIA 2NQ8C 2R4JA 3HHYA 3ZC7B 2XFSA 4LF4M 4AW4A 4B3RM 4LF9M 2VQFM 1N77A 5IWAM 4X64M 2DXIA 3PXGA 2F5QA 4M0WA 2Z3XA 2C99A 1IXSB 2R62A 4RNAA 4QOSA 3AV0A 1GLNA 3SASA 3HHWA 3DFZA 4YY3M 1E94E 2CV0A 5ITQA 1L2CA 4LRTA 1MX0A 4D80A 4LF8M 2CV2A 5EXXA 3UJNA 1PJIA 4CISA 2ERCA 5FTMA 3LMMA 1X37A 3T38A 3GQ5A 5E26A 1HNWM 3DA1A 4IJEA 5EP3A 2DHRA 3I4VA 4IBJA 3K2LA 4GITA 3HHZA 1G3IA 3RGPA 1N78A 2FNAA 3GP1A 2EUCA 1JR3A 4LZJA 3CF6E 3GPYA 4DV6M 1Q3BA 2XZFA 2D7EA 4PD2A 3T1YM 1IN8A 4I5SA 4JYAM 1K82A 1XMOM 4KHPM 3L28A 1TH4A 2AHMA 1XXHB 3MJ5A 4LJAA 4Z6YA 4MGHA 1QZMA 4AI6A 3FYCA 3KOYE 5FTLA 4DR3M 4DR5M 2YQZA 1SXJA 3HJ8A 5FTKA 2KEBA 3K92A 4GIPA 2X4AA 4X62M 3HJQA 3GLFB 4REZA 3GO8A 2RKOA 4IIWA 1XNRM 4MH0E 2Z4RA 2CUZA 3VK7A 4LG2A 2HCBA 2KXEA 4X66M 3SAWA 3U60A 3KFUG 4DR6M 2Y21A 3D8LA 1IY0A 2DWZB 1J5EM 1SXJE 1R2ZA 4QNMA 4DV5M 2XFTA 4LCBA 4OU7A 2C5RA 3A42A 4LY6A 3FD9A 1XWIA 4LJ4A 4WW0A 4QHSA 3WHLA 4D81A 4QHTA 2V6ZM 2Y0QA 1DO0A 3GPXA 1HR0M 3EIEA 4ZPXA 4PCZA 3A98B 1WXQA 1Z59A 2J7OA 4MGIE 3U6SA 5GKNA 2DWMA 3KOWE 3ZCBB 1HNXM 1R6BX 1IXZA 3AL0C 2C98A 2D7GA 3GLGA 2Y20A 4B7HA 4L8RC 2G8LA 2R45A 3J7BA 3RE8A 3WHKA 4DR7M 1IQPA 4NSOB 1EE8A 3RGSA 1IN4A 3UZUA 3SBJA 4LF6M 5ITUA 3I51A 2YFQA 3L25A 2KRUA 3J81S 2X49A 4B7GA 3NWLA 3EIHA 4IBFA 4FCTA 1N34M 1IN5A 5ITTA 3HHXA 4JI1M 4B3MM 4DR2M 7CATA 2I7NA 1ORYB 2QENA 3HU2A 3B9PA 4GH9A 4PT5A 4FWHA 3U61B 3SMSA 3JAMS 1L2BA 2UXDM 4KODA 1C1KA 2CE7A 2H1RA 4B7FA 3UK6A 3U6OA 3FUTA 5KPRA 2L7HA 4GKKM 5DYGA 3SHFA 3GLIA 5EP1A 1DGFA 3MHVC 4NXNM 2Q2EB 1QYRA 4AQYM 3KSJA 1G41A 1QAQA 2OPFA 2VIIA 3VK8A 3K8ZA 4L15A 3HU1A 5LMNM 1NHWC 1QANA 2CHQA 4G6ZA 3CF0A 5F3WA 2G5GX 1XMQM 1DGBA 4KLNA 3VKHA 5FSWA 1ZAEA 4BBAA 4D82A 4OVZB 1FNNA 1E9RA 4NOOB 4NXMM 3VFDA 2A5YB 3FTDA 5H37D 3U6DA 3J27B 1DGHB 3U6EA 1J09A 4OW0A 4IBCA 3K1JA 4GMQA 4R3DA 5KQDA 1FJGM 3R8FA 3M6AA 5EXTA 1I94M 4GC9A 3THGA 2FE8A 2RGHA 3NBIA 2L6OA 1LV7A 3L27A 4NL4H 3U6CA 2DZNB 5KPTA 4A3VB 1NVMA 1QQWA 4AZFA 4W5WA 4FWDA 4EIWA 4ITQA 4IBBA 1N75A 2XSZA 4FCWA 2BJWA 4P16A 4LJ8A 3IG8A 1G59A 2XGNA 4QOZC 2LWXA 1JR3D 3GLHA 4FWGA 1IN7A 4JV5M 1E32A 5C18A 4B3TM 1IN6A 5E6JA 3SYLA 2UXBM 3UGJA 4GKJM 2XZUA 3FUVA 2KZSA 2ZANA 1Z5BA 1K3WA 3J2PB 1IY2A 4YHHM 3VLFB 2OQ4A 3AKZA 1SXJD 1PM5A 3U5ZB 4II7A 2UXCM 1PJJA 1E9SA 1S3SA 2QBYB 3FUXA 3U6PA 2R4EA 3GPPA 4BB9A 3AJIB 3KSXA 2R46A 4JI4M 3KXEC 1DGGA 2K47A 3TWKA 3Q8XA 4OX9M 2R65A 3SARA 4FCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA M;  4X64 M;  4DV3 M;  3J81 S;  1Z5C A;  3GPU A;  2F5Q A;  3SAV A;  1MU5 A;  3TWL A;  5IT9 S;  4LFC M;  3A45 A;  4JI6 M;  1N34 M;  3DOA A;  5ITT A;  4JI1 M;  4MB7 A;  4G4R A;  4DR2 M;  4B3M M;  4G4Q A;  4DV4 M;  3SAS A;  5ITX A;  4YY3 M;  3T1H M;  1NNJ A;  3JAM S;  1L2B A;  5ITQ A;  2UXD M;  1L2C A;  1MX0 A;  3U6O A;  4G4N A;  2F5N A;  2HHH M;  4LF8 M;  1PJI A;  4CIS A;  4GKK M;  4LF5 M;  1HNW M;  4NXN M;  2Q2E B;  3GQ5 A;  3A46 A;  4K0K M;  2UU9 M;  4AQY M;  3SAT A;  4LF7 M;  2OPF A;  3VK8 A;  5ITX E;  5LMN M;  2F5O A;  4NRV A;  3GP1 A;  1XMQ M;  1L2D A;  1K3X A;  1XNQ M;  3J80 S;  3SAU A;  4B3S M;  3GPY A;  4DV6 M;  4LFA M;  1Q3B A;  2XZF A;  3GQ4 A;  4DV2 M;  4PD2 A;  3JR4 A;  3T1Y M;  4JYA M;  1HNZ M;  4DV1 M;  1K82 A;  4DR1 M;  3JR5 A;  1XMO M;  5BR8 M;  4NXM M;  4KHP M;  3U6D A;  2UUB M;  1IBM M;  3U6E A;  4DR3 M;  4DUZ M;  4DR5 M;  1FJG M;  5ITR A;  1I94 M;  4DR4 M;  1N36 M;  1L1T A;  3GQ3 A;  5ITY A;  4X62 M;  3U6C A;  4PDI A;  3GO8 A;  1XC8 A;  1XNR M;  1IBK M;  1IBL M;  2E5L M;  3U6Q A;  2VQE M;  3VK7 A;  4LF9 M;  4DR6 M;  4X66 M;  4X65 M;  3SAW A;  4ITQ A;  2HKJ A;  4LFB M;  5FLX S;  1L1Z A;  1N33 M;  1J5E M;  1R2Z A;  4JI0 M;  4DV5 M;  3A42 A;  4JI3 M;  5A2Q S;  2F5S A;  3OTO M;  1N32 M;  2ZM6 M;  4DV7 M;  4JI7 M;  3W0F A;  4JV5 M;  1Q39 A;  2UUA M;  4B3T M;  2VQF M;  4DV0 M;  5LMU M;  4JI5 M;  2UXB M;  4NRW A;  1Q3C A;  3GPX A;  1HR0 M;  4GKJ M;  2XZU A;  1Z5A A;  1Z5B A;  1K3W A;  4PCZ A;  4JI2 M;  3J7A S;  1Z59 A;  3U6S A;  4YHH M;  4JI8 M;  1KFV A;  2OQ4 A;  4PDG A;  2EA0 A;  1PM5 A;  2F5P A;  3C58 A;  2UXC M;  1TDH A;  1PJJ A;  3U6M A;  1HNX M;  1TDZ A;  1R2Y A;  3U6P A;  3U6L A;  3GPP A;  4DR7 M;  4DUY M;  2F4V M;  4LF4 M;  4G4O A;  4JI4 M;  1EE8 A;  2ZBK B;  3TWK A;  2UUC M;  3TWM A;  4OX9 M;  3SAR A;  3SBJ A;  4B3R M;  4LF6 M;  5ITU A; 
#chains in the Genus database with same CATH topology
 4L4U A;  4DV3 M;  1L8Q A;  2D7H A;  1MU5 A;  4KO8 A;  1NV9 A;  5JI2 E;  2KW0 A;  4JXJ A;  1T3T A;  1NY5 A;  1PJS A;  4G4R A;  2QHO B;  1NJG A;  2X8A A;  4G4Q A;  4NSR A;  4RKU F;  5KPZ A;  2JUJ A;  2VDB B;  3KP1 E;  4IBE A;  4IBG A;  3VKG A;  3ZH9 B;  4LJ6 A;  3GRY A;  3KS4 A;  2LBC A;  1NV8 A;  4S12 A;  2CHV A;  2DWN A;  4GRI A;  4AG5 A;  4G4N A;  2JY5 A;  1TGU A;  1G4A E;  2EKF A;  1WHC A;  1HQC A;  2J7N A;  1WJ7 A;  4HLQ A;  4KT0 F;  2KNV A;  3A46 A;  2LVP C;  3PVS A;  2C9C A;  1HT1 E;  3SAT A;  3W0L B;  4FD2 A;  1QAM A;  3KOZ E;  1QDR A;  2LHG A;  2DVW B;  2BJV A;  1A5T A;  5KO3 A;  1NHG C;  3C9P A;  3LQQ A;  3GLF A;  3IG5 A;  4NRV A;  3E9S A;  1L2D A;  1K3X A;  2LXE A;  1I4W A;  3B89 A;  1Y8G A;  2CFO A;  5EP2 A;  3GQ4 A;  4DV2 M;  3L26 A;  2QPA A;  2QCU A;  3JR4 A;  4R7G A;  3W67 A;  5EP4 A;  3ILK A;  2HWJ A;  5EQT A;  4DR1 M;  3JR5 A;  2LVO C;  5EXS A;  4RF1 A;  1UFZ A;  3AOG A;  3BOS A;  4L78 A;  1IBM M;  4FW9 A;  1OIZ A;  2L09 A;  1ZQ9 A;  4LRS A;  2CEA A;  4XBO A;  1YUB A;  1EFU B;  3KVW A;  4I81 A;  3Q8G A;  4HEO A;  4MGZ E;  3GLF E;  2R44 A;  3DZD A;  2CHG A;  4LJ5 A;  2JY7 A;  1QAO A;  2DHY A;  1DV0 A;  4PDI A;  1XC8 A;  4CHT B;  3CTW B;  3F92 A;  2ZAO A;  1IBL M;  4M0D A;  1QVR A;  1OIP A;  3U6Q A;  3LQR A;  3QWL A;  2HKJ A;  2RGO A;  4WUR A;  3RFW A;  1L1Z A;  5FTJ A;  1BVS A;  2M60 A;  2I7P A;  3FKE A;  4L16 A;  4HL4 A;  4WP2 A;  2QSF X;  2KNA A;  2BNK A;  4JI3 M;  5A2Q S;  3SFZ A;  1N32 M;  4DV7 M;  4JI7 M;  1OFH A;  1SXJ B;  2FS1 A;  2P5T A;  3W0F A;  2WSF F;  1CUK A;  1NSF A;  2LH0 A;  3FRH A;  1R5L A;  2Y0T A;  1Q39 A;  2UUA M;  3R9X B;  4XGI A;  1J7K A;  5LMU M;  4DV0 M;  4JI5 M;  4JN6 A;  4NRW A;  1QUT A;  1Q3C A;  3ZQJ A;  4AG6 A;  1G8P A;  3FYD A;  1KSF X;  3KP0 E;  5FTN A;  1Z5A A;  2DZO B;  2O5R A;  5IRE B;  2V1C A;  3PNV A;  1Z6T A;  1KFV A;  1GVN A;  4PDG A;  3U60 B;  3HX3 A;  1R4G A;  1TDH A;  2KNZ A;  2L4E A;  1TTE A;  5KQ8 A;  2Z8Y M;  2XEP A;  4M9S A;  1TH2 A;  3CF2 A;  3U6L A;  2QP9 X;  4LGM A;  3AFH A;  3U61 A;  3K9O A;  1NJF A;  2OOB A;  2VF7 A;  4QNR A;  4DUY M;  2F4V M;  4G4O A;  4MM3 B;  2FOI C;  2B3T A;  2JZ1 A;  2ZBK B;  3TWM A;  2UUC M;  2XSZ D;  5DNY A;  2KHH A;  1WGL A;  3GPU A;  1Z5C A;  3CGW A;  2Z7J A;  3SAV A;  3TWL A;  2CV1 A;  5IT9 S;  1VDL A;  1XHB A;  4LFC M;  4TUW A;  1UM8 A;  3A45 A;  1GL6 A;  1OAO C;  5EJC A;  4JI6 M;  4BLC A;  2QZ4 A;  3DOA A;  5DYI A;  4MB7 A;  2L4F A;  3M7G A;  1OTR A;  4IBD A;  5JI3 E;  1NNU C;  3SC3 A;  3TPZ A;  3FUU A;  4DV4 M;  4LJ9 A;  4CGY B;  3GLG B;  1GL7 A;  5ITX A;  3VDP A;  2H5X A;  4IBK A;  1JQJ C;  3T1H M;  1NNJ A;  2R0I A;  4OVZ A;  1IXR C;  4B08 A;  3UMM A;  4LZZ A;  1F4I A;  3KDS E;  4F2L A;  2Z4S A;  3AOE C;  3MMP A;  2W82 A;  4IJF A;  4GC5 A;  3TE6 A;  2XF3 A;  3HWS A;  2F5N A;  5EXP A;  2HHH M;  2G3Q A;  1GAB A;  4AKG A;  2M5Z A;  1KYI A;  1ZMV A;  1DGH A;  4LF5 M;  3FTE A;  4AKH A;  2JNH A;  3TQS A;  3C3D A;  1SG9 A;  4K0K M;  3GRV A;  2UU9 M;  2DAM A;  4LF7 M;  1VDD A;  1YSY A;  2JY6 B;  1OJL A;  5L8R F;  1DO2 A;  1AUA A;  5ITX E;  1GKI A;  1NY6 A;  3QAU A;  2EO2 A;  2R18 A;  1IFY A;  1HQY E;  1NO1 A;  2KZU A;  3E21 A;  5C1B A;  2F5O A;  3L2A A;  2R6F A;  1XNQ M;  3J80 S;  3E46 A;  1IY1 A;  3SAU A;  4MGY E;  2DAI A;  4L6V 6;  4B3S M;  4LFA M;  3HJS A;  4M9Z A;  4Z8X A;  2KRK A;  1G71 A;  1HNZ M;  2C9O A;  3PFI A;  4DV1 M;  4GHL A;  2YNM D;  5BR8 M;  3GLI B;  2UUB M;  2ZAM A;  2MRO B;  3KOX E;  1R7R A;  2DWL A;  3TL4 X;  1ZV1 A;  4DUZ M;  1XXH A;  3KW6 A;  3I01 M;  1AIP C;  1OFI A;  5ITR A;  4DR4 M;  1N36 M;  3GRR A;  8CAT A;  3SHG B;  3MK6 A;  1L1T A;  2KDL A;  1VEG A;  1W5T A;  3GQ3 A;  5ITY A;  1D2N A;  1H6U A;  1ZMW A;  2C96 A;  3SYK A;  4LJ7 A;  3HGI A;  3HY5 A;  1IBK M;  3GRU A;  2E5L M;  2FFJ A;  3FTC A;  3L29 A;  2VQE M;  2JP7 A;  2VF8 A;  2QQ8 A;  4X65 M;  1HT2 E;  3U5Z A;  2XH9 A;  3E4R A;  4LFB M;  2JA2 A;  4MGK E;  5IZ7 D;  5FLX S;  1N33 M;  1XXH E;  4IBI A;  4I8O A;  3KS8 A;  2QBY A;  4LGY A;  2MH8 A;  3HKP A;  4XK8 F;  4FVM A;  4JI0 M;  3D8B A;  4RF0 A;  3OTO M;  2F5S A;  2EJS A;  4I4L A;  2ZM6 M;  3FUW A;  3HU3 A;  3V76 A;  1D0L A;  2KA6 B;  2L7I A;  3M0E A;  1IM2 A;  4M9X A;  3AOE A;  1W5S A;  3I4Y A;  3IHP A;  1JB0 F;  1LTM A;  3H4M A;  3J7A S;  4JI2 M;  2LNH C;  4JI8 M;  2EA0 A;  2F5P A;  1TH3 A;  3C58 A;  2V1U A;  3LVV A;  1YE9 A;  4Y28 F;  3U6M A;  4GHA A;  4GEW A;  1TDZ A;  1SXJ C;  1R2Y A;  1PJT A;  2O25 A;  2APL A;  4Q7J A;  3T15 A;  3VDU A;  3SMP A;  1MJG M;  2HL7 A;  3FTF A;  3LVW A;  2YR0 A;  3PNY A;  3GLH B;  2XLJ A;  4AKI A;  2NQ8 C;  2R4J A;  3HHY A;  3ZC7 B;  2XFS A;  4LF4 M;  2JWS A;  4AW4 A;  4B3R M;  4LF9 M;  2VQF M;  1N77 A;  5IWA M;  1ZMU A;  4X64 M;  1V33 A;  2DXI A;  3PXG A;  2F5Q A;  2O01 F;  4M0W A;  2Z3X A;  2C99 A;  1IXS B;  2R62 A;  3B7Z A;  4RNA A;  4QOS A;  3AV0 A;  1GLN A;  3SAS A;  3HHW A;  2GNO A;  3DFZ A;  4YY3 M;  1E94 E;  2CV0 A;  5ITQ A;  1L2C A;  4LRT A;  1MX0 A;  4D80 A;  4LF8 M;  2CV2 A;  5EXX A;  3UJN A;  1PJI A;  4CIS A;  2ERC A;  5FTM A;  3LMM A;  1X37 A;  3T38 A;  3GQ5 A;  5E26 A;  1HNW M;  3DA1 A;  4IJE A;  5EP3 A;  2DHR A;  1EIJ A;  3I4V A;  4IBJ A;  3K2L A;  4GIT A;  2DAG A;  3HHZ A;  1G3I A;  3RGP A;  1N78 A;  1TR8 A;  2FNA A;  3GP1 A;  2OO9 A;  1GO5 A;  2QNJ A;  4P17 A;  2EUC A;  1JR3 A;  4LZJ A;  3CF6 E;  3GPY A;  4DV6 M;  1Q3B A;  2N35 A;  2XZF A;  2D7E A;  4PD2 A;  3T1Y M;  1IN8 A;  2FH0 A;  4I5S A;  2OOA A;  4JYA M;  1K82 A;  1XMO M;  4KHP M;  3L28 A;  1TH4 A;  2AHM A;  1XXH B;  3MJ5 A;  4LJA A;  4Z6Y A;  4MGH A;  1QZM A;  3QYE A;  4AI6 A;  3FYC A;  3KOY E;  5FTL A;  4DR3 M;  4DR5 M;  2YQZ A;  1SXJ A;  3HJ8 A;  5FTK A;  4F1I A;  2KEB A;  3K92 A;  1JR3 E;  2LTU A;  4GIP A;  2K6B A;  2X4A A;  3HJQ A;  5BPV A;  2WSE F;  4X62 M;  1V92 A;  2BWE A;  3GLF B;  4REZ A;  3GO8 A;  2RKO A;  4IIW A;  1XNR M;  2LVN C;  4MH0 E;  4UN2 B;  2Z4R A;  2CUZ A;  3VK7 A;  1YLA A;  2HCB A;  2KXE A;  4X66 M;  3SAW A;  3U60 A;  4LG2 A;  3KFU G;  2Y21 A;  4DR6 M;  1MN3 A;  3D8L A;  1IY0 A;  2CRU A;  2DWZ B;  1J5E M;  1SXJ E;  1R2Z A;  2EKK A;  4QNM A;  2XFT A;  4LCB A;  4OU7 A;  4DV5 M;  2C5R A;  3A42 A;  4LY6 A;  3FD9 A;  1XWI A;  4LJ4 A;  1WIV A;  2ZTC A;  2RRU A;  2DKL A;  4WW0 A;  4QHS A;  3WHL A;  4D81 A;  4QHT A;  2V6Z M;  2Y0Q A;  1RU3 A;  1DO0 A;  1VG5 A;  2MGW A;  3GPX A;  1HR0 M;  1PJQ A;  3EIE A;  4CJ6 A;  2MJ5 B;  1XB2 B;  4ZPX A;  4PCZ A;  3A98 B;  1WXQ A;  1Z59 A;  2J7O A;  4MGI E;  3U6S A;  5GKN A;  2DWM A;  2MR9 A;  3KOW E;  3ZCB B;  1HNX M;  1R6B X;  1IXZ A;  2DNA A;  2C98 A;  3AL0 C;  1V34 A;  2LHC A;  2D7G A;  3GLG A;  2Y20 A;  4G3O A;  4B7H A;  4L8R C;  2G8L A;  2R45 A;  3J7B A;  2HAK A;  3RE8 A;  3WHK A;  1IQP A;  4DR7 M;  4NSO B;  1QDT A;  3K9P A;  3T6P A;  2WSC F;  1EE8 A;  3RGS A;  1IN4 A;  3UZU A;  3SBJ A;  4LF6 M;  5ITU A;  2L2D A;  2JY8 A;  3I51 A;  2YFQ A;  3LCU A;  1D0M A;  1P3Q Q;  2KRU A;  2X49 A;  4B7G A;  3J81 S;  3NWL A;  3L25 A;  2LVA A;  3EIH A;  4IBF A;  4FCT A;  2JXN A;  1N34 M;  1IN5 A;  5ITT A;  3GLG E;  3HHX A;  4JI1 M;  4B3M M;  4DR2 M;  7CAT A;  2I7N A;  1ORY B;  2QEN A;  3HU2 A;  3B9P A;  4GH9 A;  4PT5 A;  4FWH A;  3U61 B;  3SMS A;  3JAM S;  1L2B A;  2UXD M;  3C3E A;  4KOD A;  1C1K A;  2CE7 A;  2H1R A;  1PGY A;  4B7F A;  3UK6 A;  3U6O A;  1HJP A;  3FUT A;  5KPR A;  3LW5 F;  2BWB A;  2L7H A;  4GKK M;  5DYG A;  3SHF A;  3GLI A;  5EP1 A;  1DGF A;  3MHV C;  4NXN M;  2Q2E B;  1GJT A;  1QYR A;  4AQY M;  3KSJ A;  1G41 A;  1QAQ A;  2OPF A;  2VII A;  3VK8 A;  1Q02 A;  3K8Z A;  4L15 A;  3HU1 A;  5LMN M;  1NHW C;  1QAN A;  3B7Q A;  3H4J A;  2CHQ A;  5DFL A;  4G6Z A;  3CF0 A;  5F3W A;  2G5G X;  1XMQ M;  1DGB A;  4KLN A;  2WZJ A;  3VKH A;  5FSW A;  1D0K A;  1ZAE A;  4BBA A;  1OAI A;  4OVZ B;  1FNN A;  4D82 A;  3GLI E;  1E9R A;  4NOO B;  1VEK A;  4NXM M;  3VFD A;  2A5Y B;  3FTD A;  4R71 A;  3IEC A;  5H37 D;  3U6D A;  3J27 B;  1DGH B;  3U6E A;  1J09 A;  4OW0 A;  4IBC A;  3K1J A;  2ZTD A;  4GMQ A;  4R3D A;  5KQD A;  1QZE A;  1GJS A;  1FJG M;  3R8F A;  2DAK A;  3M6A A;  4NC6 A;  5EXT A;  4CIZ A;  4GC9 A;  3THG A;  2CWB A;  1TF0 B;  2FE8 A;  2RGH A;  1I94 M;  3W68 A;  3NBI A;  2L6O A;  1LV7 A;  3L27 A;  4NL4 H;  3U6C A;  2DZN B;  2DAE A;  2GQF A;  2CP8 A;  3B7N A;  1VQ1 A;  5KPT A;  2DI0 A;  4A3V B;  1NVM A;  3FRI A;  4DBG B;  1QQW A;  4AZF A;  4W5W A;  3FE3 A;  4FWD A;  4EIW A;  3LCV B;  4ITQ A;  4IBB A;  1N75 A;  2J5Y A;  2XSZ A;  2BJW A;  4FCW A;  1WR1 B;  4P16 A;  4ANR A;  4LJ8 A;  3HZJ A;  3IG8 A;  1G59 A;  2DEN A;  2XGN A;  4QOZ C;  2LWX A;  2K9D A;  1JR3 D;  3QYB A;  3GLH A;  4FWG A;  1IN7 A;  1WGN A;  1E32 A;  5C18 A;  4B3T M;  1IN6 A;  4JV5 M;  5E6J A;  1QUS A;  3I04 M;  3SYL A;  3UGJ A;  2UXB M;  3BBZ A;  1PRB A;  3B74 A;  1C7Y A;  4GKJ M;  2DZL A;  2XZU A;  3FUV A;  2KZS A;  2ZAN A;  1Z5B A;  1K3W A;  1OQY A;  3J2P B;  3NBX X;  1IY2 A;  4YHH M;  3VLF B;  1OKS A;  3AKZ A;  1SXJ D;  2OQ4 A;  1PM5 A;  1IXS A;  3U5Z B;  4II7 A;  2UXC M;  1PJJ A;  3BXW A;  1E9S A;  1S3S A;  2QBY B;  3GLH E;  3FUX A;  2JZ0 A;  3U6P A;  2R4E A;  1T43 A;  3GPP A;  4BB9 A;  1T6O A;  3AJI B;  2LVQ D;  3KSX A;  2R46 A;  4JI4 M;  3KXE C;  1DGG A;  2K47 A;  3TWK A;  3Q8X A;  4OX9 M;  2R65 A;  3SAR A;  1VEJ A;  2K0B X;  4FCV A; 
#chains in the Genus database with same CATH homology
 4L4U A;  4DV3 M;  1L8Q A;  2D7H A;  1MU5 A;  4KO8 A;  5JI2 E;  2KW0 A;  4JXJ A;  1T3T A;  1NY5 A;  4G4R A;  2X8A A;  1NJG A;  4G4Q A;  4NSR A;  5KPZ A;  4IBE A;  3KP1 E;  4IBG A;  3VKG A;  3ZH9 B;  4LJ6 A;  3GRY A;  3KS4 A;  4S12 A;  2CHV A;  2DWN A;  4GRI A;  4AG5 A;  4G4N A;  1TGU A;  1G4A E;  1HQC A;  2J7N A;  4HLQ A;  3A46 A;  3PVS A;  2C9C A;  1HT1 E;  3SAT A;  3W0L B;  4FD2 A;  1QAM A;  3KOZ E;  2DVW B;  2BJV A;  5KO3 A;  1NHG C;  3LQQ A;  3GLF A;  3IG5 A;  4NRV A;  3E9S A;  1L2D A;  1K3X A;  2LXE A;  1I4W A;  2CFO A;  5EP2 A;  3GQ4 A;  4DV2 M;  3L26 A;  2QPA A;  2QCU A;  3JR4 A;  4R7G A;  5EP4 A;  3ILK A;  5EQT A;  4DR1 M;  3JR5 A;  5EXS A;  4RF1 A;  3AOG A;  3BOS A;  4L78 A;  1IBM M;  4FW9 A;  2L09 A;  1ZQ9 A;  4LRS A;  2CEA A;  4XBO A;  1YUB A;  3KVW A;  4I81 A;  4MGZ E;  3DZD A;  2CHG A;  4LJ5 A;  1QAO A;  4PDI A;  1XC8 A;  4CHT B;  3CTW B;  2ZAO A;  1IBL M;  4M0D A;  1QVR A;  3U6Q A;  3LQR A;  3QWL A;  2HKJ A;  2RGO A;  4WUR A;  3RFW A;  1L1Z A;  5FTJ A;  2M60 A;  2I7P A;  3FKE A;  4L16 A;  4HL4 A;  1N32 M;  4JI3 M;  2BNK A;  5A2Q S;  3SFZ A;  4DV7 M;  4JI7 M;  1OFH A;  1SXJ B;  3W0F A;  2P5T A;  5BPV A;  1NSF A;  2LH0 A;  2Y0T A;  1Q39 A;  2UUA M;  3R9X B;  4XGI A;  1J7K A;  5LMU M;  4DV0 M;  4JI5 M;  4JN6 A;  4NRW A;  1Q3C A;  4AG6 A;  1G8P A;  3FYD A;  1KSF X;  3KP0 E;  5FTN A;  1Z5A A;  2DZO B;  2O5R A;  5IRE B;  2V1C A;  3PNV A;  1Z6T A;  1KFV A;  1GVN A;  4PDG A;  3U60 B;  1TDH A;  5KQ8 A;  2XEP A;  4M9S A;  1TH2 A;  3CF2 A;  3U6L A;  2QP9 X;  4LGM A;  3AFH A;  3U61 A;  1NJF A;  4QNR A;  4DUY M;  2F4V M;  4G4O A;  4MM3 B;  2FOI C;  2ZBK B;  2UUC M;  3TWM A;  2XSZ D;  5DNY A;  3GPU A;  1Z5C A;  2Z7J A;  3SAV A;  3TWL A;  2CV1 A;  5IT9 S;  1XHB A;  4LFC M;  4TUW A;  1UM8 A;  3A45 A;  1GL6 A;  5EJC A;  4JI6 M;  4BLC A;  2QZ4 A;  3DOA A;  5DYI A;  4MB7 A;  3M7G A;  4IBD A;  5JI3 E;  1NNU C;  3SC3 A;  3TPZ A;  3FUU A;  4DV4 M;  4LJ9 A;  4CGY B;  3GLG B;  1GL7 A;  5ITX A;  3VDP A;  4IBK A;  1JQJ C;  3T1H M;  1NNJ A;  4OVZ A;  1IXR C;  4B08 A;  3UMM A;  4LZZ A;  3KDS E;  2Z4S A;  3AOE C;  2W82 A;  4IJF A;  4GC5 A;  3TE6 A;  2XF3 A;  3HWS A;  2F5N A;  5EXP A;  2HHH M;  4AKG A;  2M5Z A;  1KYI A;  1DGH A;  4LF5 M;  3FTE A;  4AKH A;  3TQS A;  4K0K M;  3GRV A;  2UU9 M;  4LF7 M;  1VDD A;  1YSY A;  1OJL A;  1DO2 A;  5ITX E;  1GKI A;  1NY6 A;  3QAU A;  2EO2 A;  2R18 A;  1HQY E;  2F5O A;  2KZU A;  5C1B A;  3L2A A;  1XNQ M;  3J80 S;  3SAU A;  1IY1 A;  4B3S M;  4MGY E;  4LFA M;  3HJS A;  4M9Z A;  4Z8X A;  2KRK A;  1HNZ M;  2C9O A;  3PFI A;  4DV1 M;  4GHL A;  2YNM D;  5BR8 M;  3GLI B;  2UUB M;  2ZAM A;  3KOX E;  1R7R A;  2DWL A;  3TL4 X;  4DUZ M;  1XXH A;  3KW6 A;  1OFI A;  5ITR A;  4DR4 M;  1N36 M;  3GRR A;  8CAT A;  3SHG B;  3MK6 A;  1L1T A;  3GQ3 A;  1W5T A;  5ITY A;  1D2N A;  1H6U A;  2C96 A;  3SYK A;  4LJ7 A;  3HGI A;  1IBK M;  3GRU A;  2E5L M;  2FFJ A;  3FTC A;  3L29 A;  2VQE M;  4X65 M;  1HT2 E;  3U5Z A;  2XH9 A;  3E4R A;  4LFB M;  2JA2 A;  4MGK E;  5IZ7 D;  5FLX S;  1N33 M;  4IBI A;  4I8O A;  3KS8 A;  2QBY A;  4LGY A;  3HKP A;  4JI0 M;  4FVM A;  3D8B A;  4RF0 A;  3OTO M;  2F5S A;  4I4L A;  2ZM6 M;  3FUW A;  3HU3 A;  2KA6 B;  2L7I A;  3M0E A;  1IM2 A;  4M9X A;  3AOE A;  1W5S A;  3I4Y A;  3H4M A;  3J7A S;  4JI2 M;  2LNH C;  4JI8 M;  2EA0 A;  2F5P A;  1TH3 A;  3C58 A;  2V1U A;  3LVV A;  1YE9 A;  3U6M A;  4GHA A;  1TDZ A;  1SXJ C;  1R2Y A;  3T15 A;  3VDU A;  3SMP A;  2HL7 A;  3FTF A;  3LVW A;  2YR0 A;  3PNY A;  3GLH B;  2XLJ A;  4AKI A;  2NQ8 C;  2R4J A;  3HHY A;  3ZC7 B;  2XFS A;  4LF4 M;  4AW4 A;  4B3R M;  4LF9 M;  2VQF M;  1N77 A;  5IWA M;  4X64 M;  2DXI A;  3PXG A;  2F5Q A;  4M0W A;  2Z3X A;  2C99 A;  1IXS B;  2R62 A;  4RNA A;  4QOS A;  3AV0 A;  1GLN A;  3SAS A;  3HHW A;  3DFZ A;  4YY3 M;  1E94 E;  2CV0 A;  5ITQ A;  1L2C A;  4LRT A;  1MX0 A;  4D80 A;  4LF8 M;  2CV2 A;  5EXX A;  3UJN A;  1PJI A;  4CIS A;  2ERC A;  5FTM A;  3LMM A;  1X37 A;  3T38 A;  3GQ5 A;  5E26 A;  1HNW M;  3DA1 A;  4IJE A;  5EP3 A;  2DHR A;  3I4V A;  4IBJ A;  3K2L A;  4GIT A;  3HHZ A;  1G3I A;  3RGP A;  1N78 A;  2FNA A;  3GP1 A;  2EUC A;  1JR3 A;  4LZJ A;  3CF6 E;  3GPY A;  4DV6 M;  1Q3B A;  2XZF A;  2D7E A;  4PD2 A;  3T1Y M;  1IN8 A;  4I5S A;  4JYA M;  1K82 A;  1XMO M;  4KHP M;  3L28 A;  1TH4 A;  2AHM A;  1XXH B;  3MJ5 A;  4LJA A;  4Z6Y A;  4MGH A;  1QZM A;  4AI6 A;  3FYC A;  3KOY E;  5FTL A;  4DR3 M;  4DR5 M;  2YQZ A;  1SXJ A;  3HJ8 A;  5FTK A;  2KEB A;  3K92 A;  4GIP A;  2X4A A;  4X62 M;  3HJQ A;  3GLF B;  4REZ A;  3GO8 A;  2RKO A;  4IIW A;  1XNR M;  4MH0 E;  2Z4R A;  2CUZ A;  3VK7 A;  4LG2 A;  2HCB A;  2KXE A;  4X66 M;  3SAW A;  3U60 A;  3KFU G;  4DR6 M;  2Y21 A;  3D8L A;  1IY0 A;  2DWZ B;  1J5E M;  1SXJ E;  1R2Z A;  4QNM A;  4DV5 M;  2XFT A;  4LCB A;  4OU7 A;  2C5R A;  3A42 A;  4LY6 A;  3FD9 A;  1XWI A;  4LJ4 A;  4WW0 A;  4QHS A;  3WHL A;  4D81 A;  4QHT A;  2V6Z M;  2Y0Q A;  1DO0 A;  3GPX A;  1HR0 M;  3EIE A;  4ZPX A;  4PCZ A;  3A98 B;  1WXQ A;  1Z59 A;  2J7O A;  4MGI E;  3U6S A;  5GKN A;  2DWM A;  3KOW E;  3ZCB B;  1HNX M;  1R6B X;  1IXZ A;  3AL0 C;  2C98 A;  2D7G A;  3GLG A;  2Y20 A;  4B7H A;  4L8R C;  2G8L A;  2R45 A;  3J7B A;  3RE8 A;  3WHK A;  4DR7 M;  1IQP A;  4NSO B;  1EE8 A;  3RGS A;  1IN4 A;  3UZU A;  3SBJ A;  4LF6 M;  5ITU A;  3I51 A;  2YFQ A;  3L25 A;  2KRU A;  3J81 S;  2X49 A;  4B7G A;  3NWL A;  3EIH A;  4IBF A;  4FCT A;  1N34 M;  1IN5 A;  5ITT A;  3HHX A;  4JI1 M;  4B3M M;  4DR2 M;  7CAT A;  2I7N A;  1ORY B;  2QEN A;  3HU2 A;  3B9P A;  4GH9 A;  4PT5 A;  4FWH A;  3U61 B;  3SMS A;  3JAM S;  1L2B A;  2UXD M;  4KOD A;  1C1K A;  2CE7 A;  2H1R A;  4B7F A;  3UK6 A;  3U6O A;  3FUT A;  5KPR A;  2L7H A;  4GKK M;  5DYG A;  3SHF A;  3GLI A;  5EP1 A;  1DGF A;  3MHV C;  4NXN M;  2Q2E B;  1QYR A;  4AQY M;  3KSJ A;  1G41 A;  1QAQ A;  2OPF A;  2VII A;  3VK8 A;  3K8Z A;  4L15 A;  3HU1 A;  5LMN M;  1NHW C;  1QAN A;  2CHQ A;  4G6Z A;  3CF0 A;  5F3W A;  2G5G X;  1XMQ M;  1DGB A;  4KLN A;  3VKH A;  5FSW A;  1ZAE A;  4BBA A;  4D82 A;  4OVZ B;  1FNN A;  1E9R A;  4NOO B;  4NXM M;  3VFD A;  2A5Y B;  3FTD A;  5H37 D;  3U6D A;  3J27 B;  1DGH B;  3U6E A;  1J09 A;  4OW0 A;  4IBC A;  3K1J A;  4GMQ A;  4R3D A;  5KQD A;  1FJG M;  3R8F A;  3M6A A;  5EXT A;  1I94 M;  4GC9 A;  3THG A;  2FE8 A;  2RGH A;  3NBI A;  2L6O A;  1LV7 A;  3L27 A;  4NL4 H;  3U6C A;  2DZN B;  5KPT A;  4A3V B;  1NVM A;  1QQW A;  4AZF A;  4W5W A;  4FWD A;  4EIW A;  4ITQ A;  4IBB A;  1N75 A;  2XSZ A;  4FCW A;  2BJW A;  4P16 A;  4LJ8 A;  3IG8 A;  1G59 A;  2XGN A;  4QOZ C;  2LWX A;  1JR3 D;  3GLH A;  4FWG A;  1IN7 A;  4JV5 M;  1E32 A;  5C18 A;  4B3T M;  1IN6 A;  5E6J A;  3SYL A;  2UXB M;  3UGJ A;  4GKJ M;  2XZU A;  3FUV A;  2KZS A;  2ZAN A;  1Z5B A;  1K3W A;  3J2P B;  1IY2 A;  4YHH M;  3VLF B;  2OQ4 A;  3AKZ A;  1SXJ D;  1PM5 A;  3U5Z B;  4II7 A;  2UXC M;  1PJJ A;  1E9S A;  1S3S A;  2QBY B;  3FUX A;  3U6P A;  2R4E A;  3GPP A;  4BB9 A;  3AJI B;  3KSX A;  2R46 A;  4JI4 M;  3KXE C;  1DGG A;  2K47 A;  3TWK A;  3Q8X A;  4OX9 M;  2R65 A;  3SAR A;  4FCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...