3J7AW

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
95
Chain Sequence
RVRTKTIKRAARQIVEKYYAKLTLDFQINKKITEEVAIIPSKRMKNKVAGFVTHLMKRIQKGPVRGISLKLQEEERERRLDYVEPDTLRMIKSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 22
structure length 95
sequence length 108
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00833 Ribosomal_S17e Ribosomal S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.20 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Ribosomal protein S17e-like 3j7aW01
1RQ6A 3J81R 3J80R 5A2QR 3J7AW 5FLXR 5IT9R 3JAMR
chains in the Genus database with same CATH superfamily
1XCVA 1FWZA 1G3TA 2MZ4A 2QQ9A 1BI3A 1ON1A 2F5EA 5A2QR 3GLXA 1G3YA 1U8RA 4HV6A 2QQBA 2EV6A 3R61A 3R60A 2EV0A 1BI0A 2M35A 1G3SA 1F5TA 1P92A 2TDXA 4HV5A 2F5FA 2F5DA 3J7AW 2EV5A 2P0TA 2QQAA 1ON2A 4O6JA 5FLXR 1RQ6A 2MUNA 1BI2A 1BI1A 2HYGD 4HX8A 1C0WA 3J81R 2ISZA 1G3WA 1DPRA 5IT9R 1B1BA 2DTRA 2F5CA 1DDNA 1FX7A 2H09A 2HYFA 3J80R 2MVTA 3A52A 2X98A 4HX7A 4O5VA 4HX4A 3JAMR
chains in the Genus database with same CATH topology
1RQ6A 3J81R 3J80R 5A2QR 3J7AW 5FLXR 5IT9R 3JAMR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQ6 A;  3J81 R;  3J80 R;  5A2Q R;  3J7A W;  5FLX R;  5IT9 R;  3JAM R; 
#chains in the Genus database with same CATH topology
 1XCV A;  1FWZ A;  1G3T A;  2MZ4 A;  2QQ9 A;  1BI3 A;  1ON1 A;  2F5E A;  5A2Q R;  3GLX A;  1G3Y A;  1U8R A;  4HV6 A;  2QQB A;  2EV6 A;  3R61 A;  3R60 A;  2EV0 A;  1BI0 A;  2M35 A;  1G3S A;  1F5T A;  1P92 A;  2TDX A;  4HV5 A;  2F5F A;  2F5D A;  3J7A W;  2EV5 A;  2P0T A;  2QQA A;  1ON2 A;  4O6J A;  5FLX R;  1RQ6 A;  2MUN A;  1BI2 A;  1BI1 A;  2HYG D;  4HX8 A;  1C0W A;  3J81 R;  2ISZ A;  1G3W A;  1DPR A;  5IT9 R;  1B1B A;  2DTR A;  2F5C A;  1DDN A;  1FX7 A;  2H09 A;  2HYF A;  3J80 R;  2MVT A;  3A52 A;  2X98 A;  4HX7 A;  4O5V A;  4HX4 A;  3JAM R; 
#chains in the Genus database with same CATH homology
 1RQ6 A;  3J81 R;  3J80 R;  5A2Q R;  3J7A W;  5FLX R;  5IT9 R;  3JAM R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...