3J7YP

Structure of the large ribosomal subunit from human mitochondria
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
138
structure length
133
Chain Sequence
AVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIKKHNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3j7yP00
5LMNK 4K0KK 4B3MK 4X65K 4B3RK 4DR2K 4DV5K 4DV6K 2F4VK 2UU9K 5FLXO 4DV3K 4JI5K 4KHPK 1IBMK 4NXNK 2UXCK 4JI8K 3JAMO 1XMQK 4DV0K 4LF4K 5LL6Z 4GKJK 2VQFK 4YY3K 1HNXK 4CW7B 4DR3K 1N32K 4LF7K 1J5EK 4OX9K 4DV7K 3J7AP 4JI2K 4JI7K 2UXBK 1N36K 4LF8K 4JV5K 3J81O 4B3SK 4B3TK 4DR5K 4LFBK 3T1HK 4JI4K 4LFAK 2UXDK 1N34K 4LF5K 2ZM6K 4DV1K 4LF9K 4JI6K 1I94K 4X62K 1HNWK 4YHHK 4LF6K 4AQYK 4JI0K 1FJGK 4DV2K 3T1YK 3OTOK 4DUYK 4CVNE 4JI1K 4LFCK 2UUCK 1XNQK 5A2QO 4X64K 1IBLK 5IWAK 2VQEK 4DR6K 2HHHK 5LMUK 5BR8K 1HNZK 1IBKK 3J7YP 2E5LK 2UUBK 4JI3K 4X66K 1N33K 1XNRK 4DUZK 4DR1K 4GKKK 4V19S 5IT9O 4JYAK 3J80O 4DR7K 2UUAK 4NXMK 1XMOK 4DV4K 4DR4K 5AJ3K 1HR0K
chains in the Genus database with same CATH superfamily
4CJQA 2IOCA 1XQSC 2D0PA 5AQFA 4X65K 3MWTA 3OYIA 1KTQA 3TABA 5SZTA 4IEEA 2E2OA 4CK3A 3AO3A 4FLXA 4KHPK 2YJEA 4CF2A 2F9TA 2HF4A 3GBTA 1Q82O 3KHYA 4JHDA 3GL1A 3JAMO 4CHYA 4YORA 1BG3A 4FJJA 2O8BA 4W5RA 4CIFA 4CEBA 4DHYA 4JK8A 2NRZA 4CW7B 3M8RA 3QICA 3B6OA 1S1UA 1RCHA 3LPUA 1CLQA 1U49A 4CJKA 3K5OA 4DFPA 4LF8K 1MWKA 1QZ6A 4CHQA 1BA0A 4DR5K 4LFBK 3VQ8A 4CJ7A 1ZXOA 5D3GA 1ZBLA 3AVHA 1EKEA 5J2NA 3RMBA 2P9IA 4B1UB 3P4IA 3C6AA 5C25A 1FXXA 1TK5A 1SKSA 1OVQA 4CZLA 4DTMA 3D45A 2A3ZA 3U4LA 4LF6K 2OZSA 1VQ4N 3QDKA 4BVOA 1EETA 3C0BA 4H0XB 3U9ZA 4JN4A 3ID8A 3ID6A 4B08A 1JLEA 2E4LA 1LAWA 3SAHA 4IFEA 4RCHA 2LSNA 3OYAA 2OPQA 3SQ2A 3DLKA 4L3QA 2YX6A 1W2BM 4OO1J 2OTLN 2PFUA 4UY8O 2JWKA 1RTJA 5AR0A 3THYA 4IXCA 4KTZA 4I2PA 1IKYA 1A5WA 4KO0A 3EE8A 3D2EB 3K0SA 5J1EA 4W5TA 2XY5A 3LAKA 2OPSA 5T7BA 3LM9A 1ESVA 3L4QA 4FJNA 2VG7A 5ADXH 3DLRA 2YKMA 3K9JA 2P9LB 3KWIA 2E20A 4WQ4C 4RWTA 3FZMA 4DTNA 3S3MA 1IBMK 4FJ7A 2YKNA 4NXNK 1SS6A 3E01A 5FDLA 1IKXA 3VF4A 1XMQK 4O55A 1QVFM 3TAFA 1S1TA 3AO1A 1S22A 4QS9A 5C2DA 1YJWN 3S3NA 2VQFK 2GUPA 1S1VA 2D0CA 1U47A 4DR3K 5DM7L 1IV0A 3LDQA 1RNHA 1ILYA 1WSHA 1RT7A 2J4RA 4BWMA 2WOMA 4E7HA 3A8YA 3ZLJA 4FJIA 1X9JA 1S3XA 3OYCA 4RW9A 4FOEA 4K8ZA 4BRFA 3HTVA 4FWPA 4FK2A 4DQ8A 1TKTA 3V1QA 2YV0X 5JLFA 3F5TA 5C42A 4DTOA 4FLWA 4DQIA 4CK1A 3K9KA 3RMAA 1J9AA 4NO7A 3V6DA 3KLGA 3THVA 1TYQA 1IH7A 3UKUB 4Z4CA 4MFBA 2HNZA 4AHUA 4BY9C 2FF3B 3TTFA 1DLOA 3I0SA 1D8YA 5EX5A 5JS2A 3KK3A 2A6AA 4J8FA 3L6QA 1NGGA 4ISGA 2WC9A 4OJRA 4FJ9A 4B1WB 3SQ1A 1QE1A 4GKKK 1NMDA 3VETA 2KLAA 3NF7A 3J80O 4FWKA 3QEIA 3N4QA 4CZKA 5EU7A 3UKRA 5E41A 3FZFA 4OKKA 3L3UA 1ZYQA 3SMPA 2B4JA 1NKEA 2QW9A 4FK4A 1D9DA 1GLFO 2GUIA 1U2VB 5E26A 5BREA 1Y97A 3SBGA 4EAHD 4DWIA 4HWIA 3K5LA 1I39A 2YHXA 4QAGA 4CJSA 5JS1A 1L3VA 1VSEA 4JKGA 2HBLA 3NH2A 3OYEA 5BR9A 3G6EN 2WUSA 4DV0K 3RRGA 3O3GA 4CJLA 4OKEA 4H0OA 3EZ5A 3P31A 4CCHA 2HNDA 3NMUA 4E19A 3C95A 3KLEA 2KFNA 3OA9A 1HUXA 3VEXA 2GEMA 1KRPA 4EIAA 1CZBA 4K42A 3TU5A 4N56A 3AGKA 2VWKA 3OS2A 4CJEA 1S5JA 4YOUA 1EXQA 3ZT3A 1L3TA 2DTUA 4C1NK 2XY6A 2OANA 2HSTA 3D0PA 4RTFD 5DMRA 4BVPA 4G1QA 1VQ6N 2I5JA 3MEEA 5AZJB 2ZM6K 3V9ZA 2P9KB 1I94K 4DSLA 3KK7A 4H5TA 2ZJQL 1KQSM 3QFUA 4BRQA 3HPHA 2YI1A 1WSFA 2E2PA 3ZETA 3CFRA 1S1WA 4B9QA 4KB0A 3RRHA 4FWLA 3NF6A 2BUPA 5AQYA 1VSJA 4JS5A 4C8OA 4IWVA 2VQEK 2W41A 3OYFA 1BIUA 3A2FA 1KAXA 3DI6A 1JL1A 2JGUA 1T6DA 2X6SA 2NRTA 1JCFA 2VGMA 1SKRA 3AO2A 1QHAA 4X66K 4QOZB 4KHSA 1QZ5A 4DUZK 3W0LA 1NK5A 2HBJA 1BWFO 3OYHA 3RR7A 4IKFA 3K57A 4H0VB 1CZ9A 3QEPA 4FL9A 1VQKN 2F8SA 3RR8A 3PUFA 3FZLA 4BRIA 1BCMA 2XHBA 4B9VA 2ITMA 3THWA 2AJQA 1T3VA 4KH6A 4WQ4A 4CGIA 3TTDA 3A5OC 1P90A 2ASOA 3CD6N 1K8KA 4BRDA 4M3TA 3QFPA 2CGLA 1Z25A 2HHSA 3CC4N 3SYZA 2O8FA 5AQQA 3WUHA 4DTUA 3D7EO 2XO7A 4OVLA 1YAGA 3DOKA 2D5RA 3J8AA 3K2PA 1U48A 1X9MA 5BPLA 2KFZA 4FW2A 4ISFA 2QKBA 3M5RA 3LP3A 2WFBA 1RFQA 1QS4A 2HVHA 1Q81O 4ID1A 3NVMA 3O80A 5FPMA 1NJWA 2GV9A 2ETJA 5KTQA 3C94A 1TK8A 3LL3A 4LSLA 2BDPA 3H1VX 3IDHA 4FPAA 4QS7A 3L2QA 2OA8A 4JRQA 5C12A 2FBTA 4I6MA 5AZIA 4XIUA 3EZWA 1NK0A 4LSNA 3HO1A 3VOVA 4L8RB 2AP1A 1NJYA 4IO9L 1HQEA 2I7NA 3OVNA 1B9FA 4FM1A 1Q7YO 3GDQA 2P9SB 3MMVA 3ZSQA 1FKPA 1J54A 1TV6A 3F9KA 2HB5A 4IFYA 4M42A 1ATNA 3CF5L 1UA1A 4E0DA 1BQMA 3G4SN 4DV1K 4LF9K 1TUUA 2ATQA 4A57A 5AFUH 4ISEA 4M41A 3CETA 3AO5A 3OTOK 1HPMA 4H5WA 4BC5A 2E88A 3HOSA 3AAPA 5A2QO 4K43A 2D1KA 2KHOA 5CZ1A 4CHNA 1C1CA 3PX6A 4AHSA 1J53A 2X78A 4CZJA 2HHXA 3ATVA 2Q1NA 1MDUB 2FSJA 2E1YA 5HBMA 1YVNA 4WQ5A 4H8KA 3RTVA 1VSHA 1KSPA 1TVRA 1UWBA 3ZSVA 3TTCA 3JYTA 4Q5VA 4IG3A 4KHQA 3NH1A 3K5MA 4JHDB 3AGRA 3QEVA 3TAGA 4C23A 3QNOA 3SNNA 4FJ8A 1EP4A 4CJVA 1HKGA 3IMXA 1ATRA 3CHWA 3HSTB 4FWNA 4CJRA 2D0AA 1B92A 3DM2A 3DOLA 3DWLA 2EHGA 5FPDA 4DQPA 4FLTA 2FSNA 1TGOA 1NMNA 1NKBA 4DFKA 5EXWA 3CJBA 1RTDA 4BRMA 2Q0RA 4F8RA 4XH4A 3H3OB 3NFAA 4CERA 3RVCA 2AA4A 4BRPA 1NOZA 1S9EA 1EX4A 1JLGA 1A5XA 3E9PA 1TL1A 5AQJA 2P9IB 1CZAN 4MLEA 1RDWX 3OYDA 5LL6Z 4GKJK 4F2SA 3AV9A 5AQUA 2YHWA 4KV8A 4QS8A 1BUPA 3GOIA 4FVMA 3T1AA 4W5NA 4CBUA 5C15A 2Q97A 4CBWA 4JKBA 1NK4A 4YOYA 4OLAA 3EO3A 2VG6A 2XRIA 3BZCA 3SI6A 3SZ2A 2NNWA 2E1ZA 4O5BA 3HK2A 1K73O 5EOYA 2IVOA 1W97L 3CFPA 4JKDA 3LWMA 4I9LA 3SLCA 5HROA 2P9PA 3SV4A 3V4IA 2G8UA 2CGKA 4K25A 5I9EB 1G15A 1BA1A 4FCYA 1DT9A 2VWBA 5AQOA 1RTHA 1T8EA 3THYB 3ULEA 3K59A 4N76A 3JS6A 4KHUA 1FJGK 4DCHA 4DV2K 3CI5A 3DYAA 4MO5A 3AA4A 5FPEA 3OW2M 1NLVA 3O1WA 2P51A 3V9WA 1NGDA 1IBLK 2HVIA 1DGKN 1RT4A 1YI2N 4BC3A 5B8HA 3IG1A 3WXIA 4NLBA 4BROA 4I7FA 4CHPA 4LY7A 4C1NI 5KQDA 4XH1A 4FM0A 2JLEA 3MECA 1XI1A 3E9OA 2A42A 2G8WA 4DR1K 3OYJA 3PSIA 4JYAK 3ZSOA 3EL2A 3HVTA 1V4SA 1O13A 4RW7A 3EY1A 4B1XB 3I8BA 1EWRA 3TWHA 1BGXT 2JWLA 3UE5A 4F4KA 2YHBA 4B3RK 4JKEA 3DXKB 3MEGA 3VEWA 1VQLN 2O8CB 3F9MA 4CESA 4ZTJA 2HF3A 2UU9K 3CCMN 3CC2N 1N5YA 3L2RA 1L3SA 3L8BA 3TARA 2UXCK 4BC2A 4CIGA 3R9PA 3O3HA 1HNIA 4O5FA 3OBWA 4MO4A 3W3DA 3FFKB 4CEAA 4HTUA 3KKSA 1WSJA 1SL1A 3VTIA 3C6UA 5M1PA 4LF7K 1M90O 1EWQA 5KQ8A 2P9NB 3MDQA 2HNYA 2KZMA 1U04A 4H0PA 3T3FA 1KVAA 4IO8A 5M1QA 3H6EA 5K14A 4Z4FA 2NRRA 3TAMA 5GIOA 3EKSA 3LPTA 3UKRB 4CJFA 4DSFA 2KQ2A 4B8AB 1LV5A 3AVLA 3OYGA 3QETA 4HCCA 2UUCK 1ZBHA 3BZKA 2DFFA 4RW4A 4FJGA 4M3YA 3HM9A 1HPZA 3AVNA 3RSEA 2DFHA 3TR8A 5JVGL 1S72N 3BF1A 5GIPA 2HMPA 3J7YP 4J2DA 2QXFA 1XNRK 5HRSA 1YVUA 1ITGA 5EY4A 4H5RA 3ZT2A 4CF1A 2QWQA 4CE9A 3MAQA 5HL7L 4PL7A 5KRSA 3IUCA 1EO1A 3FLCO 1YT3A 4EZ6A 5AQZA 1TKDA 1RT2A 3TAQA 3A0IX 3B8AX 2PZSA 3CIPA 2IVPA 4DV6K 3S41A 1JJ2M 1NGCA 4DG1A 1S6PA 4DTXA 3J7ZO 3CM6A 4FWOA 5M1KA 1J6ZA 1KVBA 3OBYA 3MN5A 3L2UA 2O8DB 3BDPA 1H1VA 4ELTA 1E4GT 4DTSA 4CFBA 4CHZA 4FJHA 4OGEA 2FC0A 4YDUC 2PBDA 5C2FA 1KC8O 4ILJA 3SAFA 3PX0A 3AVCA 3VEOA 4JK7A 5KPZA 3T69A 2F8TA 1KXPA 3DJCA 4NCBA 3HSCA 4IG0A 5FROA 2O8EA 1JLFA 4KREA 3AVBA 4FO0A 3H3NO 3LDLA 2QWNA 4JI0K 4FK0A 4B8CA 3U9DA 4R5PA 3PO5A 4HVJA 3V1RA 4H0TB 4UQGA 1WAJA 3MN6A 3VERA 5HRRA 1JXEA 5IWAK 2W42A 2HHHK 1HYZA 5AQMA 4BR2A 3KK2A 3NDKA 2NZTA 2GBZA 4E1NA 2GWJA 3CJ9A 3QMLA 4OKJA 4WFBL 1N33K 2RE2A 4KHYA 2G8HA 1WSEA 4OPJA 3EEQA 4QCLA 3MEDA 3E9LA 4YFUA 3LZIA 1JXBA 3NBPA 4C8KA 2H3GX 2VGNA 4OPHA 5AQXA 2V7ZA 3THXB 1ZBFA 1LWCA 1JLCA 4I6MB 1WOQA 3BGRA 5DM6L 3CJ7A 4CJ4A 3DAWA 4CK2A 2F4VK 1K9MO 4Y1CA 4KI4A 4A2AA 2X74A 1XHZA 1G99A 3ISNC 3VQCA 3WNGA 1KLNA 4BG8A 2ZF5O 3LDPA 2QWLA 3HP9A 1BO5O 3IRXA 4JNEA 1ZC6A 5HOOA 2Z1IA 4NCAA 3QBWA 2W6LA 4ILHA 4FWQA 1DTQA 2P5OA 4O0JA 5H1SQ 2WTUA 1SUQA 3CMAN 1VSFA 4BWJA 4FJMA 4E3SA 3L2WA 5J2QA 1HYVA 4JI4K 1NOYA 3FE1A 3V9SA 3VTHA 4AHRA 3ZT0A 4PKHA 4M45A 3KD1E 1DEJA 1B9DA 4MLHA 1RILA 3NCIA 1RT5A 1Q8IA 4F2RA 3VMFB 1K6YA 2QWPA 1T05A 4LFCK 5KPTA 3BUZB 3TAPA 3SQ4A 1U45A 4DR6K 3K58A 3LDSA 4U7BA 3ENBA 4DU4A 5M1OA 3FR0A 1IBKK 2E5LK 4CFDA 2ITGA 5AQKA 4FJKA 4CEEA 1GLCG 3P83D 5KGWA 4KTQA 4A5AA 4FYDA 2Q2RA 3TSPA 1JLAA 3H1QA 2RKIA 3OYMA 4BR0A 1WNSA 1HR0K 5HRPA 1XC9A 2QI2A 3CQXA 5BPMA 3H08A 1BU6O 3AAQA 4NYNA 3C6HA 4BGBA 3ZSZA 3D2EA 4CGDA 4W5QA 5F2RA 2P9UA 3LALA 3HT3A 1T6CA 1WN7A 4WE1A 1C0UA 2RPIA 4BGAA 3I56N 3PV8A 3KLIA 4O44A 4B9UA 4CZGA 5F0XA 3P5JA 3O08A 4DQQA 1QSYA 3CCJN 3SUQA 5CE3A 2P9LA 2RN2A 4AF1A 4B9TA 4PKIA 1Q9XA 5AQLA 3VQPA 1VRUA 2W40A 4GVMA 2E8AA 3SMSA 3AA3A 4J2EA 4CZIA 3LDOA 2V52B 3AVIA 4E89A 3A5MC 4CJTA 2R7YA 5HRNA 3CPEA 3D2FB 4M7YA 4RW6A 1D5AA 1Z05A 3CJAA 1NM1A 3CCSN 1Z26A 2ZE2A 3VEYA 4W5OA 3ZT4A 2HBMA 5JICA 1SZ2A 4CF0A 3NGYA 3DLEA 4CGHA 2GELA 3C7NA 4JI6K 3AVFA 1WUAA 4PL8A 2KKZA 1YITN 3SUNA 3AY9A 4FWRA 4C8NA 3ZX3A 1T03A 1U4BA 3B6PA 3A5LC 3MCPA 4JD2B 1C6VA 1WSGA 3LP1A 3UKUA 3L3VA 3FFIA 4ILGB 4JK9A 4CZHA 1MU2A 1RDUA 4H03B 2Z1JA 3SUOA 2NLXA 1RT3A 3CFOA 4JI3K 1YTAA 1VHXA 3VF2A 4KAZA 4Q0BA 2KW4A 4Z0UA 5HLFA 3HPGA 5IT9O 3CQ8A 4H0YB 4Z4HA 2ZD1A 4HUFA 3P39A 4CEQA 1Z6RA 4DS4A 2GTDA 1WBDA 3FZHA 3LZJA 1JLBA 3MXIA 4CBXA 2B5JA 2XY8A 4PQUA 4C8LA 3M8SA 3NGZA 1V4TA 4KKOA 4DR2K 5ADXA 2P1JA 4AILC 1U2VA 1R59O 3P1GA 3O9RA 3CCRN 4KRFA 4DV3K 3HM8A 4JI5K 1X9WA 3HOTA 1LW0A 4GNIA 5LY3A 4KB1A 2IS3A 2HHUA 2O8BB 3QBXA 4JI8K 3DXMA 3OJSA 4OPKA 3CMEN 4LF4K 2ZQBA 2DY4A 3SK3A 1BQNA 5GADP 4CIEA 3G10A 1QSLA 3QINA 1NJXA 5GAHP 1NJIO 3JSMA 1NK8A 4IDKA 5EVZA 1GLJO 3WEEA 4BREA 1GLBG 4FOIA 2G8VA 1JCGA 5BRDA 3MX5A 4B9MA 1VQ9N 3T1HK 4LFAK 2ASMA 3QLHA 2YHYA 1NU0A 1LOTB 1RDAA 4CHOA 1C0TA 4BE0A 4DF8A 4CF8A 4BDYA 4LF5K 3PLAA 5C0YA 4ID5A 1X9SA 3CXCM 1ASUA 1YF5L 2OPRA 1YXQA 1HNWK 4YHHK 1SAZA 4XH5A 1WB9A 4BDZA 2P9KA 5AQVA 1U6ZA 3LWLA 4CGGA 3AVGA 4CVNE 3LDNA 3NE6A 3OYBA 1RDDA 5CYMA 1HKBA 4CD3A 4KHNA 4KBOA 1VK0A 4AH9A 5AQTA 3ALYA 1VRTA 3KZBA 1BL3A 4CJPA 3N4PA 3DRPA 2FBYA 5C24A 3ZEUA 5FRNA 3MN9A 1F21A 5AQHA 1LCUA 4U67L 3SUPA 1NGHA 1RDBA 3FGUA 1IJJA 4BR9A 4FLVA 1VQ8N 3VQAA 3O8MA 2V51B 5DK5A 4KH4A 1VSDA 2BH1A 4H5NA 3M8QA 1I3AA 4BR5A 1NGFA 4NYFA 3WQUA 1VQ5N 4Z4EA 1IG8A 2ASPA 3BP8A 5TKWA 3IS9A 1UAXA 2WONA 1QTMA 4Y0WA 4DTPA 1NGEA 4AM6A 2Y1JA 5FLXO 2ZJPL 3TPQA 1FW6A 3EKUA 3O4QA 4E7JA 1CXUA 1QQMA 2O8EB 1IO2A 3SPZA 5GINA 3AVMA 3KIOA 2QWOA 4EZ9A 5CZ2A 3VENA 3HXMA 2A5XA 3HRGA 4YOVA 2HW3A 4DSEA 1BDGA 2B6AA 4FSVA 1HMVA 2O4GA 2EX3A 1RBRA 3G0ZA 4DV7K 4LC9B 4N5SA 2HHWA 4DSIA 2HOEA 3J81O 4A5BA 4HCBA 4Z4IA 4IBNA 4FWSA 4Y1DA 4EHUA 1E3MA 2BGGA 4E1MA 3GG4A 2CH5A 4CGJA 4CJ3A 1C0MA 3SAGA 1TYQB 2RHKA 3A5NC 4CJUA 3VGMA 3VQ6A 2A41A 2QA4N 2RF2A 2X6NA 4ELVA 4BRNA 4IFVA 3RMCA 3SBTA 2F9WA 3ZCMA 3IAYA 3I0RA 3R3LA 3V81A 1XHXA 2OTJN 5CHIA 3ITHA 5AQWA 4GY2B 3I55N 4O0IA 3VA3A 4V19S 2HHVA 1N6QA 2Y1IA 4BE1A 4A61A 3CCQN 1LWFA 5AJ3K 3PO4A 3M6GA 3ZT1A 3I8DA 4FJLA 4Z94A 4DFMA 4BRHA 4CFAA 5SWMA 2A1RA 4H5VA 3VQ7A 3HI0A 3KWGA 3JXUA 4M3XA 4BC4A 2ZGZA 3VA0A 3KTQA 3VN5A 4I2QA 3SJHA 4CJWA 1OH8A 3C6TA 3MXJA 1YHQN 2Q31A 4JKGB 1LW2A 3QEXA 3RMDA 4BQZA 2G8FA 4LH4A 2I7PA 1S1XA 2V7YA 3PY8A 4CECA 1KFDA 1OH7A 3H45C 1YJ9N 2G8IA 4EP5A 1VAZA 4PWDA 3K5NA 2NRXA 4DTRA 1ZBUA 3O1BA 2FBVA 3DRRA 4AHVA 3KK1A 3V9XA 4FXDA 2CH6A 4YOXA 1VSIA 1DKGD 1HQUA 1IG9A 2WBNA 4JS4A 4ZTFA 4CEFA 5E84A 4FJ5A 3ENOA 4JEPA 4JI7K 1BISA 4JV5K 4AM7A 1YJNN 1XWLA 1ATSA 1QQOA 2HHQA 3OS0A 5AFUA 1DTTA 1N34K 1X3MA 3ZETB 4E7KA 1D4XA 5ELZA 3DLBA 3QESA 3CG7A 2VYPA 3T7ZA 2YNIA 4IZ9A 1UA0A 2YHAA 3ZYYX 1ASWA 1NWKA 4G9ZA 4DKWA 4AHCA 4BRAA 2P9UB 5JLHA 3UIQA 4HTLA 4GMJB 4BR7A 3HPOA 3NVKA 4WYBA 3IFRA 1NBWA 4DSJA 2DFEA 5BPNA 3O5BA 5I42A 1RT6A 4FPBA 4DB3A 3ATUA 3L4IA 4FWMA 3OS1A 2BANA 1NK6A 1C1AA 1VSKA 2UUAK 1T44A 4NXMK 3THWB 4FJXA 1KCFA 3ULDA 2HHTA 3KKRA 1VQMN 2IDOA 1K8KB 4K0KK 2A40A 3QB0A 4B1ZA 1RBTA 4GV3A 1NGIA 2O8FB 3O9UA 4JLHA 3PSFA 1WAFA 5GAGP 1M1KO 2E6MA 2NRHA 3Q7BA 3G25A 5CYQA 1K8AO 2VG5A 3DXKA 4K8XA 1SL2A 3VQ5A 1NKCA 3HZ6A 4O4GA 4M7XA 2O8CA 1OKJA 4C8MA 1BI4A 3VEZA 4JRPA 1REVA 4FZYA 4M3RA 4I9QA 3LM2A 5BN9A 4CI6A 3LAMA 1NGBA 4JKFA 3S9HA 3C7NB 3SPYA 4IOAL 4DLEA 3NAEA 3F2KA 4M3ZA 5AQIA 3VGLA 3AO4A 2DPNA 5AZIB 1YUWA 5JMVA 1OH6A 2KZZA 4CEOA 4IJAA 4CZFA 2HBKA 4BQLA 5BRHA 1GLAG 4RG8A 4IJNA 1BIZA 1GLEG 4CEZA 2P9NA 1TKZA 4BRLA 2IGIA 2QM1A 3C65A 2OPPA 3ASMA 2UXDK 1KAYA 1MA9B 1RGIA 3WNHA 1RBVA 3SQ0A 1OH5A 3CERA 4B3OA 4MDBA 2W6KA 3O6WA 3TANA 2IIRA 3E66A 4BRCA 3T1YK 1W7AA 1FKOA 3DLLL 3U8XA 1BHLA 4OLBA 2YNFA 1TUYA 1QVGM 1HRHA 3CPWM 2D4WA 4WQ5C 3QEWA 4CZEA 4J2AA 2PYLA 4JKAA 4FLYA 1HNZK 3VQBA 2BTFA 4B9LA 1XC3A 4K41A 2Q3SA 3OJUA 4DQSA 4B9NA 3QO9A 1OVYA 2IVNA 4EP4A 3R8EA 3KJVA 1LAVA 5KPRA 2VWJA 3ZSXA 4DV4K 2NUBA 1TL3A 3DXMB 1TAQA 5LMNK 4B1YB 1W0HA 2E2QA 4BDPA 4DQRA 1UOCA 4B3MK 4CGFA 2CGJA 4WFAL 4E7IA 2E6LA 4CEDA 2QXLA 5BRFA 4FLUA 1L5UA 4DMNA 5CY4A 2ZWHA 1SQKA 3O4NA 3WEEB 3WQTA 4A62A 4A2BA 3VQ9A 4PA1A 5LJWA 3O9TA 3M3ZA 5AQNA 1N8RO 4YOTA 3TSUA 1HX1A 3LP2A 3NHGA 3EYZA 4B1VA 4KTWA 3U3GA 1GOAA 3FZKA 4BRGA 3CCVN 1NNEA 4KFBA 3PIOL 1BCOA 1RTIA 4DLGA 2FLOA 3P38A 1S9GA 3SJJA 3VPZA 2O8DA 1HJRA 5LJVA 1HJOA 1NK7A 3OHRA 2IAJA 1L3UA 1EQYA 4YDUA 2Z1GA 4OX9K 1P8ZA 4PUOA 5FRMA 2HMIA 4HUGA 2P5GA 3AA2A 2OYQA 4F9OA 3DMJA 1FK9A 4CD1A 3V1OA 3VGKA 2YNGA 3KVGA 2P9PB 4XEIA 2EWSA 5J2MA 2OCEA 2OZMA 2A1SA 4M3UA 4PHTX 4BRKA 4PY5A 3ZEUB 3ULEB 1CXQA 4YOWA 2UYTA 4X62K 4LD0A 4A59A 1QHTA 4RW8A 4WFNL 2QTDA 3WXMB 4ELUA 4CFCA 4DU3A 4GW6A 4CJ5A 4DFJA 1QQCA 3HP6A 5BN8A 4OPAA 2QKKA 4DF4A 1KAZA 3SV3A 5LMUK 5BR8K 3AARA 2UUBK 1SL0A 2BE2A 3CJ1A 1X1PA 4ICLA 3D6RA 3WXJA 1C1BA 3NF8A 3O3FA 1KLMA 2FSKA 1XMOK 3HJFA 1HYSA 4DR4K 2F96A 1RT1A 3Q7CA 3KLFA 1VQ7N 2ZJRL 1VQON 4JAXA 3HYFA 2YNHA 5AQPA 3TAEA 3BY5A 4M3WA 4ZHRA 4DTJA 3THXA 1LWEA 2YJFA 3GE1A 4DV5K 1WBBA 1GOCA 1W9HA 2NRWA 3LP0A 4MDAA 5F1XA 4F3OA 3VEVA 4R79A 3U3YA 4BG9A 3HVRA 1VQNN 3WXKA 1Y64A 3S3OA 1SV5A 4M63C 3VESA 3RWUA 1S6QA 2D0BA 4PKGA 1QSSA 1KFSA 2O4IA 4KH5A 2NRVA 3O4WA 4N41A 4DS5A 4YY3K 3R1XA 1T7PA 4B9SA 1Q18A 3BEXA 3TSQA 2QWRA 2YCHA 3G71N 1N32K 4IOCL 3QERA 1ASVA 5M1NA 3EN9A 4HUEA 2UXBK 4H4OA 4B3SK 4B3TK 3PIPL 5MLCQ 2Q0UA 4O8UA 4FLZA 1A5VA 3PX4A 1J5OA 4WF9L 3NH0A 3HL8A 1ZBIA 3VQDA 1GLDG 3F73A 1RDCA 1JLQA 3ZSRA 2E2NA 1TKXA 4AQYK 2ZGYA 1SKWA 3T19A 4DUYK 4BR4A 4NCGA 4JI1K 1C0FA 5J2PA 4YNQA 3RSEB 3DRSA 3WNFA 4F3TA 1VQPN 4X64K 2PY5A 2Q36A 3ZX0A 3L0QA 4FM2A 3M8PA 5AQGA 1Q9YA 3TI0A 4OGCA 4MQ3A 4DU1A 3O9QA 5HP1A 3NF9A 3OY9A 1NK9A 3R6MA 3L2VA 3MX2A 2GX9A 2QWMA 1JL2A 2XY7A 5AZJA 5JVHL 3VQ4A 1RBSA 2VCPA 3MXMA 3CCEN 3WXLA 1XUPO 5M1FA 3U6FA 3IKMA 4CF9A 1WSIA 3VF6A 2FBXA 3E1YA 2PYJA 3BF3A 2QEXN 5TKYA 5I3UA 2Z1HA 4TSXA 3MN7A 1YIJN 1JCEA 1RBUA 4LH5A 3UB5A 3CYMA 4IOXA 1HLUA 5GAEP 5KRTA 2QK9A 4KHWA 2FXUA 4FZXC 1NGJA 3QIOA 4FW1A 1QQNA 4GVEA 4DSKA 3O9SA 4BE2A 3CJCA 4E7LA 1IKVA 4JKCA 3I33A 1TK0A 3SCXA 4E1JA 4FZZA 1YTUA 1BOTO 3NGIA 5CR4A 3QNNA 4EHTA 5AQRA 4IEIA 3CCLN 4KPYA 1HNXK 3ZSYA 3ZX2A 4O8KA 2GWKA 3WNEA 3QIPA 3DLGA 3AVAA 4AHTA 1O1WA 3KLHA 1J5EK 4CZMA 3VQEA 4J2BA 3J7AP 1WLJA 1X3NA 4N47A 3AVJA 4NLCA 4JI2K 2D0OA 3CC7N 3D2FA 2G8KA 4GV9A 1Q86O 3M1FA 1N36K 1HKCA 1NG9A 3H46O 1NGAA 4JKHA 3CQYA 1D9FA 5C10A 3OYKA 5FPNA 1GLLO 1C0GA 1NJZA 2KTQA 3V9UA 3LANA 2F7TA 1KVCA 1GOBA 1E4FT 3WT0A 3ZSWA 3DLHA 3CCUN 3KD5E 4KI6A 4Z4GA 4H4MA 5KGXA 5KI6A 2PAVA 4HHTA 1KD1O 1IKWA 1XNQK 2FF6A 4GV6A 1ZBSA 3AVKA 4BACA 3MK6A 4WCEL 4IDHA 4JD2A 3ENHA 3MCAB 3VQQA 3EE9A 1MWMA 4NB4A 3OYLA 3OYNA 3AA5X 3MWPA 2P9SA 3HBTA 4FVUA 2IC3A 1TAUA 1BI4B 1HNVA 1VSLA 1VSMA 4EFHA 5AQSA 4DR7K 1R0AA 3CM5A 1JKHA
chains in the Genus database with same CATH topology
5LMNK 4K0KK 4B3MK 4X65K 4B3RK 4DR2K 4DV5K 4DV6K 2F4VK 2UU9K 5FLXO 4DV3K 4JI5K 4KHPK 1IBMK 4NXNK 2UXCK 4JI8K 3JAMO 1XMQK 4DV0K 4LF4K 5LL6Z 4GKJK 2VQFK 4YY3K 1HNXK 4CW7B 4DR3K 1N32K 4LF7K 1J5EK 4OX9K 4DV7K 3J7AP 4JI2K 4JI7K 2UXBK 1N36K 4LF8K 4JV5K 3J81O 4B3SK 4B3TK 4DR5K 4LFBK 3T1HK 4JI4K 4LFAK 2UXDK 1N34K 4LF5K 2ZM6K 4DV1K 4LF9K 4JI6K 1I94K 4X62K 1HNWK 4YHHK 4LF6K 4AQYK 4JI0K 1FJGK 4DV2K 3T1YK 3OTOK 4DUYK 4CVNE 4JI1K 4LFCK 2UUCK 1XNQK 5A2QO 4X64K 1IBLK 5IWAK 2VQEK 4DR6K 2HHHK 5LMUK 5BR8K 1HNZK 1IBKK 3J7YP 2E5LK 2UUBK 4JI3K 4X66K 1N33K 1XNRK 4DUZK 4DR1K 4GKKK 4V19S 5IT9O 4JYAK 3J80O 4DR7K 2UUAK 4NXMK 1XMOK 4DV4K 4DR4K 5AJ3K 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN K;  4K0K K;  4B3M K;  4X65 K;  4B3R K;  4DR2 K;  4DV5 K;  4DV6 K;  2F4V K;  2UU9 K;  5FLX O;  4DV3 K;  4JI5 K;  4KHP K;  1IBM K;  4NXN K;  2UXC K;  4JI8 K;  3JAM O;  1XMQ K;  4DV0 K;  4LF4 K;  5LL6 Z;  4GKJ K;  2VQF K;  4YY3 K;  1HNX K;  4CW7 B;  4DR3 K;  1N32 K;  4LF7 K;  1J5E K;  4OX9 K;  4DV7 K;  3J7A P;  4JI2 K;  4JI7 K;  2UXB K;  1N36 K;  4LF8 K;  4JV5 K;  3J81 O;  4B3S K;  4B3T K;  4DR5 K;  4LFB K;  3T1H K;  4JI4 K;  4LFA K;  2UXD K;  1N34 K;  4LF5 K;  2ZM6 K;  4DV1 K;  4LF9 K;  4JI6 K;  1I94 K;  4X62 K;  1HNW K;  4YHH K;  4LF6 K;  4AQY K;  4JI0 K;  1FJG K;  4DV2 K;  3T1Y K;  3OTO K;  4DUY K;  4CVN E;  4JI1 K;  4LFC K;  2UUC K;  1XNQ K;  5A2Q O;  4X64 K;  1IBL K;  5IWA K;  2VQE K;  4DR6 K;  2HHH K;  5LMU K;  5BR8 K;  1HNZ K;  1IBK K;  3J7Y P;  2E5L K;  2UUB K;  4JI3 K;  4X66 K;  1N33 K;  1XNR K;  4DUZ K;  4DR1 K;  4GKK K;  4V19 S;  5IT9 O;  4JYA K;  3J80 O;  4DR7 K;  2UUA K;  4NXM K;  1XMO K;  4DV4 K;  4DR4 K;  5AJ3 K;  1HR0 K; 
#chains in the Genus database with same CATH topology
 4CJQ A;  2IOC A;  1XQS C;  2D0P A;  5AQF A;  4X65 K;  3MWT A;  3OYI A;  1KTQ A;  3TAB A;  5SZT A;  4IEE A;  2E2O A;  4CK3 A;  3AO3 A;  4FLX A;  4KHP K;  2YJE A;  4CF2 A;  2F9T A;  2HF4 A;  3GBT A;  1Q82 O;  3KHY A;  4JHD A;  3GL1 A;  3JAM O;  4CHY A;  4YOR A;  1BG3 A;  4FJJ A;  2O8B A;  4W5R A;  4CIF A;  4CEB A;  4DHY A;  4JK8 A;  2NRZ A;  4CW7 B;  3M8R A;  3QIC A;  3B6O A;  1S1U A;  1RCH A;  3LPU A;  1CLQ A;  1U49 A;  4CJK A;  3K5O A;  4DFP A;  4LF8 K;  1MWK A;  1QZ6 A;  4CHQ A;  1BA0 A;  4DR5 K;  4LFB K;  3VQ8 A;  4CJ7 A;  1ZXO A;  5D3G A;  1ZBL A;  3AVH A;  1EKE A;  5J2N A;  3RMB A;  2P9I A;  4B1U B;  3P4I A;  3C6A A;  5C25 A;  1FXX A;  1TK5 A;  1SKS A;  1OVQ A;  4CZL A;  4DTM A;  3D45 A;  2A3Z A;  3U4L A;  4LF6 K;  2OZS A;  1VQ4 N;  3QDK A;  4BVO A;  1EET A;  3C0B A;  4H0X B;  3U9Z A;  4JN4 A;  3ID8 A;  3ID6 A;  4B08 A;  1JLE A;  2E4L A;  1LAW A;  3SAH A;  4IFE A;  4RCH A;  2LSN A;  3OYA A;  2OPQ A;  3SQ2 A;  3DLK A;  4L3Q A;  2YX6 A;  1W2B M;  4OO1 J;  2OTL N;  2PFU A;  4UY8 O;  2JWK A;  1RTJ A;  5AR0 A;  3THY A;  4IXC A;  4KTZ A;  4I2P A;  1IKY A;  1A5W A;  4KO0 A;  3EE8 A;  3D2E B;  3K0S A;  5J1E A;  4W5T A;  2XY5 A;  3LAK A;  2OPS A;  5T7B A;  3LM9 A;  1ESV A;  3L4Q A;  4FJN A;  2VG7 A;  5ADX H;  3DLR A;  2YKM A;  3K9J A;  2P9L B;  3KWI A;  2E20 A;  4WQ4 C;  4RWT A;  3FZM A;  4DTN A;  3S3M A;  1IBM K;  4FJ7 A;  2YKN A;  4NXN K;  1SS6 A;  3E01 A;  5FDL A;  1IKX A;  3VF4 A;  1XMQ K;  4O55 A;  1QVF M;  3TAF A;  1S1T A;  3AO1 A;  1S22 A;  4QS9 A;  5C2D A;  1YJW N;  3S3N A;  2VQF K;  2GUP A;  1S1V A;  2D0C A;  1U47 A;  4DR3 K;  5DM7 L;  1IV0 A;  3LDQ A;  1RNH A;  1ILY A;  1WSH A;  1RT7 A;  2J4R A;  4BWM A;  2WOM A;  4E7H A;  3A8Y A;  3ZLJ A;  4FJI A;  1X9J A;  1S3X A;  3OYC A;  4RW9 A;  4FOE A;  4K8Z A;  4BRF A;  3HTV A;  4FWP A;  4FK2 A;  4DQ8 A;  1TKT A;  3V1Q A;  2YV0 X;  5JLF A;  3F5T A;  5C42 A;  4DTO A;  4FLW A;  4DQI A;  4CK1 A;  3K9K A;  3RMA A;  1J9A A;  4NO7 A;  3V6D A;  3KLG A;  3THV A;  1TYQ A;  1IH7 A;  3UKU B;  4Z4C A;  4MFB A;  2HNZ A;  4AHU A;  4BY9 C;  2FF3 B;  3TTF A;  1DLO A;  3I0S A;  1D8Y A;  5EX5 A;  5JS2 A;  3KK3 A;  2A6A A;  4J8F A;  3L6Q A;  1NGG A;  4ISG A;  2WC9 A;  4OJR A;  4FJ9 A;  4B1W B;  3SQ1 A;  1QE1 A;  4GKK K;  1NMD A;  3VET A;  2KLA A;  3NF7 A;  3J80 O;  4FWK A;  3QEI A;  3N4Q A;  4CZK A;  5EU7 A;  3UKR A;  5E41 A;  3FZF A;  4OKK A;  3L3U A;  1ZYQ A;  3SMP A;  2B4J A;  1NKE A;  2QW9 A;  4FK4 A;  1D9D A;  1GLF O;  2GUI A;  1U2V B;  5E26 A;  5BRE A;  1Y97 A;  3SBG A;  4EAH D;  4DWI A;  4HWI A;  3K5L A;  1I39 A;  2YHX A;  4QAG A;  4CJS A;  5JS1 A;  1L3V A;  1VSE A;  4JKG A;  2HBL A;  3NH2 A;  3OYE A;  5BR9 A;  3G6E N;  2WUS A;  4DV0 K;  3RRG A;  3O3G A;  4CJL A;  4OKE A;  4H0O A;  3EZ5 A;  3P31 A;  4CCH A;  2HND A;  3NMU A;  4E19 A;  3C95 A;  3KLE A;  2KFN A;  3OA9 A;  1HUX A;  3VEX A;  2GEM A;  1KRP A;  4EIA A;  1CZB A;  4K42 A;  3TU5 A;  4N56 A;  3AGK A;  2VWK A;  3OS2 A;  4CJE A;  1S5J A;  4YOU A;  1EXQ A;  3ZT3 A;  1L3T A;  2DTU A;  4C1N K;  2XY6 A;  2OAN A;  2HST A;  3D0P A;  4RTF D;  5DMR A;  4BVP A;  4G1Q A;  1VQ6 N;  2I5J A;  3MEE A;  5AZJ B;  2ZM6 K;  3V9Z A;  2P9K B;  1I94 K;  4DSL A;  3KK7 A;  4H5T A;  2ZJQ L;  1KQS M;  3QFU A;  4BRQ A;  3HPH A;  2YI1 A;  1WSF A;  2E2P A;  3ZET A;  3CFR A;  1S1W A;  4B9Q A;  4KB0 A;  3RRH A;  4FWL A;  3NF6 A;  2BUP A;  5AQY A;  1VSJ A;  4JS5 A;  4C8O A;  4IWV A;  2VQE K;  2W41 A;  3OYF A;  1BIU A;  3A2F A;  1KAX A;  3DI6 A;  1JL1 A;  2JGU A;  1T6D A;  2X6S A;  2NRT A;  1JCF A;  2VGM A;  1SKR A;  3AO2 A;  1QHA A;  4X66 K;  4QOZ B;  4KHS A;  1QZ5 A;  4DUZ K;  3W0L A;  1NK5 A;  2HBJ A;  1BWF O;  3OYH A;  3RR7 A;  4IKF A;  3K57 A;  4H0V B;  1CZ9 A;  3QEP A;  4FL9 A;  1VQK N;  2F8S A;  3RR8 A;  3PUF A;  3FZL A;  4BRI A;  1BCM A;  2XHB A;  4B9V A;  2ITM A;  3THW A;  2AJQ A;  1T3V A;  4KH6 A;  4WQ4 A;  4CGI A;  3TTD A;  3A5O C;  1P90 A;  2ASO A;  3CD6 N;  1K8K A;  4BRD A;  4M3T A;  3QFP A;  2CGL A;  1Z25 A;  2HHS A;  3CC4 N;  3SYZ A;  2O8F A;  5AQQ A;  3WUH A;  4DTU A;  3D7E O;  2XO7 A;  4OVL A;  1YAG A;  3DOK A;  2D5R A;  3J8A A;  3K2P A;  1U48 A;  1X9M A;  5BPL A;  2KFZ A;  4FW2 A;  4ISF A;  2QKB A;  3M5R A;  3LP3 A;  2WFB A;  1RFQ A;  1QS4 A;  2HVH A;  1Q81 O;  4ID1 A;  3NVM A;  3O80 A;  5FPM A;  1NJW A;  2GV9 A;  2ETJ A;  5KTQ A;  3C94 A;  1TK8 A;  3LL3 A;  4LSL A;  2BDP A;  3H1V X;  3IDH A;  4FPA A;  4QS7 A;  3L2Q A;  2OA8 A;  4JRQ A;  5C12 A;  2FBT A;  4I6M A;  5AZI A;  4XIU A;  3EZW A;  1NK0 A;  4LSN A;  3HO1 A;  3VOV A;  4L8R B;  2AP1 A;  1NJY A;  4IO9 L;  1HQE A;  2I7N A;  3OVN A;  1B9F A;  4FM1 A;  1Q7Y O;  3GDQ A;  2P9S B;  3MMV A;  3ZSQ A;  1FKP A;  1J54 A;  1TV6 A;  3F9K A;  2HB5 A;  4IFY A;  4M42 A;  1ATN A;  3CF5 L;  1UA1 A;  4E0D A;  1BQM A;  3G4S N;  4DV1 K;  4LF9 K;  1TUU A;  2ATQ A;  4A57 A;  5AFU H;  4ISE A;  4M41 A;  3CET A;  3AO5 A;  3OTO K;  1HPM A;  4H5W A;  4BC5 A;  2E88 A;  3HOS A;  3AAP A;  5A2Q O;  4K43 A;  2D1K A;  2KHO A;  5CZ1 A;  4CHN A;  1C1C A;  3PX6 A;  4AHS A;  1J53 A;  2X78 A;  4CZJ A;  2HHX A;  3ATV A;  2Q1N A;  1MDU B;  2FSJ A;  2E1Y A;  5HBM A;  1YVN A;  4WQ5 A;  4H8K A;  3RTV A;  1VSH A;  1KSP A;  1TVR A;  1UWB A;  3ZSV A;  3TTC A;  3JYT A;  4Q5V A;  4IG3 A;  4KHQ A;  3NH1 A;  3K5M A;  4JHD B;  3AGR A;  3QEV A;  3TAG A;  4C23 A;  3QNO A;  3SNN A;  4FJ8 A;  1EP4 A;  4CJV A;  1HKG A;  3IMX A;  1ATR A;  3CHW A;  3HST B;  4FWN A;  4CJR A;  2D0A A;  1B92 A;  3DM2 A;  3DOL A;  3DWL A;  2EHG A;  5FPD A;  4DQP A;  4FLT A;  2FSN A;  1TGO A;  1NMN A;  1NKB A;  4DFK A;  5EXW A;  3CJB A;  1RTD A;  4BRM A;  2Q0R A;  4F8R A;  4XH4 A;  3H3O B;  3NFA A;  4CER A;  3RVC A;  2AA4 A;  4BRP A;  1NOZ A;  1S9E A;  1EX4 A;  1JLG A;  1A5X A;  3E9P A;  1TL1 A;  5AQJ A;  2P9I B;  1CZA N;  4MLE A;  1RDW X;  3OYD A;  5LL6 Z;  4GKJ K;  4F2S A;  3AV9 A;  5AQU A;  2YHW A;  4KV8 A;  4QS8 A;  1BUP A;  3GOI A;  4FVM A;  3T1A A;  4W5N A;  4CBU A;  5C15 A;  2Q97 A;  4CBW A;  4JKB A;  1NK4 A;  4YOY A;  4OLA A;  3EO3 A;  2VG6 A;  2XRI A;  3BZC A;  3SI6 A;  3SZ2 A;  2NNW A;  2E1Z A;  4O5B A;  3HK2 A;  1K73 O;  5EOY A;  2IVO A;  1W97 L;  3CFP A;  4JKD A;  3LWM A;  4I9L A;  3SLC A;  5HRO A;  2P9P A;  3SV4 A;  3V4I A;  2G8U A;  2CGK A;  4K25 A;  5I9E B;  1G15 A;  1BA1 A;  4FCY A;  1DT9 A;  2VWB A;  5AQO A;  1RTH A;  1T8E A;  3THY B;  3ULE A;  3K59 A;  4N76 A;  3JS6 A;  4KHU A;  1FJG K;  4DCH A;  4DV2 K;  3CI5 A;  3DYA A;  4MO5 A;  3AA4 A;  5FPE A;  3OW2 M;  1NLV A;  3O1W A;  2P51 A;  3V9W A;  1NGD A;  1IBL K;  2HVI A;  1DGK N;  1RT4 A;  1YI2 N;  4BC3 A;  5B8H A;  3IG1 A;  3WXI A;  4NLB A;  4BRO A;  4I7F A;  4CHP A;  4LY7 A;  4C1N I;  5KQD A;  4XH1 A;  4FM0 A;  2JLE A;  3MEC A;  1XI1 A;  3E9O A;  2A42 A;  2G8W A;  4DR1 K;  3OYJ A;  3PSI A;  4JYA K;  3ZSO A;  3EL2 A;  3HVT A;  1V4S A;  1O13 A;  4RW7 A;  3EY1 A;  4B1X B;  3I8B A;  1EWR A;  3TWH A;  1BGX T;  2JWL A;  3UE5 A;  4F4K A;  2YHB A;  4B3R K;  4JKE A;  3DXK B;  3MEG A;  3VEW A;  1VQL N;  2O8C B;  3F9M A;  4CES A;  4ZTJ A;  2HF3 A;  2UU9 K;  3CCM N;  3CC2 N;  1N5Y A;  3L2R A;  1L3S A;  3L8B A;  3TAR A;  2UXC K;  4BC2 A;  4CIG A;  3R9P A;  3O3H A;  1HNI A;  4O5F A;  3OBW A;  4MO4 A;  3W3D A;  3FFK B;  4CEA A;  4HTU A;  3KKS A;  1WSJ A;  1SL1 A;  3VTI A;  3C6U A;  5M1P A;  4LF7 K;  1M90 O;  1EWQ A;  5KQ8 A;  2P9N B;  3MDQ A;  2HNY A;  2KZM A;  1U04 A;  4H0P A;  3T3F A;  1KVA A;  4IO8 A;  5M1Q A;  3H6E A;  5K14 A;  4Z4F A;  2NRR A;  3TAM A;  5GIO A;  3EKS A;  3LPT A;  3UKR B;  4CJF A;  4DSF A;  2KQ2 A;  4B8A B;  1LV5 A;  3AVL A;  3OYG A;  3QET A;  4HCC A;  2UUC K;  1ZBH A;  3BZK A;  2DFF A;  4RW4 A;  4FJG A;  4M3Y A;  3HM9 A;  1HPZ A;  3AVN A;  3RSE A;  2DFH A;  3TR8 A;  5JVG L;  1S72 N;  3BF1 A;  5GIP A;  2HMP A;  3J7Y P;  4J2D A;  2QXF A;  1XNR K;  5HRS A;  1YVU A;  1ITG A;  5EY4 A;  4H5R A;  3ZT2 A;  4CF1 A;  2QWQ A;  4CE9 A;  3MAQ A;  5HL7 L;  4PL7 A;  5KRS A;  3IUC A;  1EO1 A;  3FLC O;  1YT3 A;  4EZ6 A;  5AQZ A;  1TKD A;  1RT2 A;  3TAQ A;  3A0I X;  3B8A X;  2PZS A;  3CIP A;  2IVP A;  4DV6 K;  3S41 A;  1JJ2 M;  1NGC A;  4DG1 A;  1S6P A;  4DTX A;  3J7Z O;  3CM6 A;  4FWO A;  5M1K A;  1J6Z A;  1KVB A;  3OBY A;  3MN5 A;  3L2U A;  2O8D B;  3BDP A;  1H1V A;  4ELT A;  1E4G T;  4DTS A;  4CFB A;  4CHZ A;  4FJH A;  4OGE A;  2FC0 A;  4YDU C;  2PBD A;  5C2F A;  1KC8 O;  4ILJ A;  3SAF A;  3PX0 A;  3AVC A;  3VEO A;  4JK7 A;  5KPZ A;  3T69 A;  2F8T A;  1KXP A;  3DJC A;  4NCB A;  3HSC A;  4IG0 A;  5FRO A;  2O8E A;  1JLF A;  4KRE A;  3AVB A;  4FO0 A;  3H3N O;  3LDL A;  2QWN A;  4JI0 K;  4FK0 A;  4B8C A;  3U9D A;  4R5P A;  3PO5 A;  4HVJ A;  3V1R A;  4H0T B;  4UQG A;  1WAJ A;  3MN6 A;  3VER A;  5HRR A;  1JXE A;  5IWA K;  2W42 A;  2HHH K;  1HYZ A;  5AQM A;  4BR2 A;  3KK2 A;  3NDK A;  2NZT A;  2GBZ A;  4E1N A;  2GWJ A;  3CJ9 A;  3QML A;  4OKJ A;  4WFB L;  1N33 K;  2RE2 A;  4KHY A;  2G8H A;  1WSE A;  4OPJ A;  3EEQ A;  4QCL A;  3MED A;  3E9L A;  4YFU A;  3LZI A;  1JXB A;  3NBP A;  4C8K A;  2H3G X;  2VGN A;  4OPH A;  5AQX A;  2V7Z A;  3THX B;  1ZBF A;  1LWC A;  1JLC A;  4I6M B;  1WOQ A;  3BGR A;  5DM6 L;  3CJ7 A;  4CJ4 A;  3DAW A;  4CK2 A;  2F4V K;  1K9M O;  4Y1C A;  4KI4 A;  4A2A A;  2X74 A;  1XHZ A;  1G99 A;  3ISN C;  3VQC A;  3WNG A;  1KLN A;  4BG8 A;  2ZF5 O;  3LDP A;  2QWL A;  3HP9 A;  1BO5 O;  3IRX A;  4JNE A;  1ZC6 A;  5HOO A;  2Z1I A;  4NCA A;  3QBW A;  2W6L A;  4ILH A;  4FWQ A;  1DTQ A;  2P5O A;  4O0J A;  5H1S Q;  2WTU A;  1SUQ A;  3CMA N;  1VSF A;  4BWJ A;  4FJM A;  4E3S A;  3L2W A;  5J2Q A;  1HYV A;  4JI4 K;  1NOY A;  3FE1 A;  3V9S A;  3VTH A;  4AHR A;  3ZT0 A;  4PKH A;  4M45 A;  3KD1 E;  1DEJ A;  1B9D A;  4MLH A;  1RIL A;  3NCI A;  1RT5 A;  1Q8I A;  4F2R A;  3VMF B;  1K6Y A;  2QWP A;  1T05 A;  4LFC K;  5KPT A;  3BUZ B;  3TAP A;  3SQ4 A;  1U45 A;  4DR6 K;  3K58 A;  3LDS A;  4U7B A;  3ENB A;  4DU4 A;  5M1O A;  3FR0 A;  1IBK K;  2E5L K;  4CFD A;  2ITG A;  5AQK A;  4FJK A;  4CEE A;  1GLC G;  3P83 D;  5KGW A;  4KTQ A;  4A5A A;  4FYD A;  2Q2R A;  3TSP A;  1JLA A;  3H1Q A;  2RKI A;  3OYM A;  4BR0 A;  1WNS A;  1HR0 K;  5HRP A;  1XC9 A;  2QI2 A;  3CQX A;  5BPM A;  3H08 A;  1BU6 O;  3AAQ A;  4NYN A;  3C6H A;  4BGB A;  3ZSZ A;  3D2E A;  4CGD A;  4W5Q A;  5F2R A;  2P9U A;  3LAL A;  3HT3 A;  1T6C A;  1WN7 A;  4WE1 A;  1C0U A;  2RPI A;  4BGA A;  3I56 N;  3PV8 A;  3KLI A;  4O44 A;  4B9U A;  4CZG A;  5F0X A;  3P5J A;  3O08 A;  4DQQ A;  1QSY A;  3CCJ N;  3SUQ A;  5CE3 A;  2P9L A;  2RN2 A;  4AF1 A;  4B9T A;  4PKI A;  1Q9X A;  5AQL A;  3VQP A;  1VRU A;  2W40 A;  4GVM A;  2E8A A;  3SMS A;  3AA3 A;  4J2E A;  4CZI A;  3LDO A;  2V52 B;  3AVI A;  4E89 A;  3A5M C;  4CJT A;  2R7Y A;  5HRN A;  3CPE A;  3D2F B;  4M7Y A;  4RW6 A;  1D5A A;  1Z05 A;  3CJA A;  1NM1 A;  3CCS N;  1Z26 A;  2ZE2 A;  3VEY A;  4W5O A;  3ZT4 A;  2HBM A;  5JIC A;  1SZ2 A;  4CF0 A;  3NGY A;  3DLE A;  4CGH A;  2GEL A;  3C7N A;  4JI6 K;  3AVF A;  1WUA A;  4PL8 A;  2KKZ A;  1YIT N;  3SUN A;  3AY9 A;  4FWR A;  4C8N A;  3ZX3 A;  1T03 A;  1U4B A;  3B6P A;  3A5L C;  3MCP A;  4JD2 B;  1C6V A;  1WSG A;  3LP1 A;  3UKU A;  3L3V A;  3FFI A;  4ILG B;  4JK9 A;  4CZH A;  1MU2 A;  1RDU A;  4H03 B;  2Z1J A;  3SUO A;  2NLX A;  1RT3 A;  3CFO A;  4JI3 K;  1YTA A;  1VHX A;  3VF2 A;  4KAZ A;  4Q0B A;  2KW4 A;  4Z0U A;  5HLF A;  3HPG A;  5IT9 O;  3CQ8 A;  4H0Y B;  4Z4H A;  2ZD1 A;  4HUF A;  3P39 A;  4CEQ A;  1Z6R A;  4DS4 A;  2GTD A;  1WBD A;  3FZH A;  3LZJ A;  1JLB A;  3MXI A;  4CBX A;  2B5J A;  2XY8 A;  4PQU A;  4C8L A;  3M8S A;  3NGZ A;  1V4T A;  4KKO A;  4DR2 K;  5ADX A;  2P1J A;  4AIL C;  1U2V A;  1R59 O;  3P1G A;  3O9R A;  3CCR N;  4KRF A;  4DV3 K;  3HM8 A;  4JI5 K;  1X9W A;  3HOT A;  1LW0 A;  4GNI A;  5LY3 A;  4KB1 A;  2IS3 A;  2HHU A;  2O8B B;  3QBX A;  4JI8 K;  3DXM A;  3OJS A;  4OPK A;  3CME N;  4LF4 K;  2ZQB A;  2DY4 A;  3SK3 A;  1BQN A;  5GAD P;  4CIE A;  3G10 A;  1QSL A;  3QIN A;  1NJX A;  5GAH P;  1NJI O;  3JSM A;  1NK8 A;  4IDK A;  5EVZ A;  1GLJ O;  3WEE A;  4BRE A;  1GLB G;  4FOI A;  2G8V A;  1JCG A;  5BRD A;  3MX5 A;  4B9M A;  1VQ9 N;  3T1H K;  4LFA K;  2ASM A;  3QLH A;  2YHY A;  1NU0 A;  1LOT B;  1RDA A;  4CHO A;  1C0T A;  4BE0 A;  4DF8 A;  4CF8 A;  4BDY A;  4LF5 K;  3PLA A;  5C0Y A;  4ID5 A;  1X9S A;  3CXC M;  1ASU A;  1YF5 L;  2OPR A;  1YXQ A;  1HNW K;  4YHH K;  1SAZ A;  4XH5 A;  1WB9 A;  4BDZ A;  2P9K A;  5AQV A;  1U6Z A;  3LWL A;  4CGG A;  3AVG A;  4CVN E;  3LDN A;  3NE6 A;  3OYB A;  1RDD A;  5CYM A;  1HKB A;  4CD3 A;  4KHN A;  4KBO A;  1VK0 A;  4AH9 A;  5AQT A;  3ALY A;  1VRT A;  3KZB A;  1BL3 A;  4CJP A;  3N4P A;  3DRP A;  2FBY A;  5C24 A;  3ZEU A;  5FRN A;  3MN9 A;  1F21 A;  5AQH A;  1LCU A;  4U67 L;  3SUP A;  1NGH A;  1RDB A;  3FGU A;  1IJJ A;  4BR9 A;  4FLV A;  1VQ8 N;  3VQA A;  3O8M A;  2V51 B;  5DK5 A;  4KH4 A;  1VSD A;  2BH1 A;  4H5N A;  3M8Q A;  1I3A A;  4BR5 A;  1NGF A;  4NYF A;  3WQU A;  1VQ5 N;  4Z4E A;  1IG8 A;  2ASP A;  3BP8 A;  5TKW A;  3IS9 A;  1UAX A;  2WON A;  1QTM A;  4Y0W A;  4DTP A;  1NGE A;  4AM6 A;  2Y1J A;  5FLX O;  2ZJP L;  3TPQ A;  1FW6 A;  3EKU A;  3O4Q A;  4E7J A;  1CXU A;  1QQM A;  2O8E B;  1IO2 A;  3SPZ A;  5GIN A;  3AVM A;  3KIO A;  2QWO A;  4EZ9 A;  5CZ2 A;  3VEN A;  3HXM A;  2A5X A;  3HRG A;  4YOV A;  2HW3 A;  4DSE A;  1BDG A;  2B6A A;  4FSV A;  1HMV A;  2O4G A;  2EX3 A;  1RBR A;  3G0Z A;  4DV7 K;  4LC9 B;  4N5S A;  2HHW A;  4DSI A;  2HOE A;  3J81 O;  4A5B A;  4HCB A;  4Z4I A;  4IBN A;  4FWS A;  4Y1D A;  4EHU A;  1E3M A;  2BGG A;  4E1M A;  3GG4 A;  2CH5 A;  4CGJ A;  4CJ3 A;  1C0M A;  3SAG A;  1TYQ B;  2RHK A;  3A5N C;  4CJU A;  3VGM A;  3VQ6 A;  2A41 A;  2QA4 N;  2RF2 A;  2X6N A;  4ELV A;  4BRN A;  4IFV A;  3RMC A;  3SBT A;  2F9W A;  3ZCM A;  3IAY A;  3I0R A;  3R3L A;  3V81 A;  1XHX A;  2OTJ N;  5CHI A;  3ITH A;  5AQW A;  4GY2 B;  3I55 N;  4O0I A;  3VA3 A;  4V19 S;  2HHV A;  1N6Q A;  2Y1I A;  4BE1 A;  4A61 A;  3CCQ N;  1LWF A;  5AJ3 K;  3PO4 A;  3M6G A;  3ZT1 A;  3I8D A;  4FJL A;  4Z94 A;  4DFM A;  4BRH A;  4CFA A;  5SWM A;  2A1R A;  4H5V A;  3VQ7 A;  3HI0 A;  3KWG A;  3JXU A;  4M3X A;  4BC4 A;  2ZGZ A;  3VA0 A;  3KTQ A;  3VN5 A;  4I2Q A;  3SJH A;  4CJW A;  1OH8 A;  3C6T A;  3MXJ A;  1YHQ N;  2Q31 A;  4JKG B;  1LW2 A;  3QEX A;  3RMD A;  4BQZ A;  2G8F A;  4LH4 A;  2I7P A;  1S1X A;  2V7Y A;  3PY8 A;  4CEC A;  1KFD A;  1OH7 A;  3H45 C;  1YJ9 N;  2G8I A;  4EP5 A;  1VAZ A;  4PWD A;  3K5N A;  2NRX A;  4DTR A;  1ZBU A;  3O1B A;  2FBV A;  3DRR A;  4AHV A;  3KK1 A;  3V9X A;  4FXD A;  2CH6 A;  4YOX A;  1VSI A;  1DKG D;  1HQU A;  1IG9 A;  2WBN A;  4JS4 A;  4ZTF A;  4CEF A;  5E84 A;  4FJ5 A;  3ENO A;  4JEP A;  4JI7 K;  1BIS A;  4JV5 K;  4AM7 A;  1YJN N;  1XWL A;  1ATS A;  1QQO A;  2HHQ A;  3OS0 A;  5AFU A;  1DTT A;  1N34 K;  1X3M A;  3ZET B;  4E7K A;  1D4X A;  5ELZ A;  3DLB A;  3QES A;  3CG7 A;  2VYP A;  3T7Z A;  2YNI A;  4IZ9 A;  1UA0 A;  2YHA A;  3ZYY X;  1ASW A;  1NWK A;  4G9Z A;  4DKW A;  4AHC A;  4BRA A;  2P9U B;  5JLH A;  3UIQ A;  4HTL A;  4GMJ B;  4BR7 A;  3HPO A;  3NVK A;  4WYB A;  3IFR A;  1NBW A;  4DSJ A;  2DFE A;  5BPN A;  3O5B A;  5I42 A;  1RT6 A;  4FPB A;  4DB3 A;  3ATU A;  3L4I A;  4FWM A;  3OS1 A;  2BAN A;  1NK6 A;  1C1A A;  1VSK A;  2UUA K;  1T44 A;  4NXM K;  3THW B;  4FJX A;  1KCF A;  3ULD A;  2HHT A;  3KKR A;  1VQM N;  2IDO A;  1K8K B;  4K0K K;  2A40 A;  3QB0 A;  4B1Z A;  1RBT A;  4GV3 A;  1NGI A;  2O8F B;  3O9U A;  4JLH A;  3PSF A;  1WAF A;  5GAG P;  1M1K O;  2E6M A;  2NRH A;  3Q7B A;  3G25 A;  5CYQ A;  1K8A O;  2VG5 A;  3DXK A;  4K8X A;  1SL2 A;  3VQ5 A;  1NKC A;  3HZ6 A;  4O4G A;  4M7X A;  2O8C A;  1OKJ A;  4C8M A;  1BI4 A;  3VEZ A;  4JRP A;  1REV A;  4FZY A;  4M3R A;  4I9Q A;  3LM2 A;  5BN9 A;  4CI6 A;  3LAM A;  1NGB A;  4JKF A;  3S9H A;  3C7N B;  3SPY A;  4IOA L;  4DLE A;  3NAE A;  3F2K A;  4M3Z A;  5AQI A;  3VGL A;  3AO4 A;  2DPN A;  5AZI B;  1YUW A;  5JMV A;  1OH6 A;  2KZZ A;  4CEO A;  4IJA A;  4CZF A;  2HBK A;  4BQL A;  5BRH A;  1GLA G;  4RG8 A;  4IJN A;  1BIZ A;  1GLE G;  4CEZ A;  2P9N A;  1TKZ A;  4BRL A;  2IGI A;  2QM1 A;  3C65 A;  2OPP A;  3ASM A;  2UXD K;  1KAY A;  1MA9 B;  1RGI A;  3WNH A;  1RBV A;  3SQ0 A;  1OH5 A;  3CER A;  4B3O A;  4MDB A;  2W6K A;  3O6W A;  3TAN A;  2IIR A;  3E66 A;  4BRC A;  3T1Y K;  1W7A A;  1FKO A;  3DLL L;  3U8X A;  1BHL A;  4OLB A;  2YNF A;  1TUY A;  1QVG M;  1HRH A;  3CPW M;  2D4W A;  4WQ5 C;  3QEW A;  4CZE A;  4J2A A;  2PYL A;  4JKA A;  4FLY A;  1HNZ K;  3VQB A;  2BTF A;  4B9L A;  1XC3 A;  4K41 A;  2Q3S A;  3OJU A;  4DQS A;  4B9N A;  3QO9 A;  1OVY A;  2IVN A;  4EP4 A;  3R8E A;  3KJV A;  1LAV A;  5KPR A;  2VWJ A;  3ZSX A;  4DV4 K;  2NUB A;  1TL3 A;  3DXM B;  1TAQ A;  5LMN K;  4B1Y B;  1W0H A;  2E2Q A;  4BDP A;  4DQR A;  1UOC A;  4B3M K;  4CGF A;  2CGJ A;  4WFA L;  4E7I A;  2E6L A;  4CED A;  2QXL A;  5BRF A;  4FLU A;  1L5U A;  4DMN A;  5CY4 A;  2ZWH A;  1SQK A;  3O4N A;  3WEE B;  3WQT A;  4A62 A;  4A2B A;  3VQ9 A;  4PA1 A;  5LJW A;  3O9T A;  3M3Z A;  5AQN A;  1N8R O;  4YOT A;  3TSU A;  1HX1 A;  3LP2 A;  3NHG A;  3EYZ A;  4B1V A;  4KTW A;  3U3G A;  1GOA A;  3FZK A;  4BRG A;  3CCV N;  1NNE A;  4KFB A;  3PIO L;  1BCO A;  1RTI A;  4DLG A;  2FLO A;  3P38 A;  1S9G A;  3SJJ A;  3VPZ A;  2O8D A;  1HJR A;  5LJV A;  1HJO A;  1NK7 A;  3OHR A;  2IAJ A;  1L3U A;  1EQY A;  4YDU A;  2Z1G A;  4OX9 K;  1P8Z A;  4PUO A;  5FRM A;  2HMI A;  4HUG A;  2P5G A;  3AA2 A;  2OYQ A;  4F9O A;  3DMJ A;  1FK9 A;  4CD1 A;  3V1O A;  3VGK A;  2YNG A;  3KVG A;  2P9P B;  4XEI A;  2EWS A;  5J2M A;  2OCE A;  2OZM A;  2A1S A;  4M3U A;  4PHT X;  4BRK A;  4PY5 A;  3ZEU B;  3ULE B;  1CXQ A;  4YOW A;  2UYT A;  4X62 K;  4LD0 A;  4A59 A;  1QHT A;  4RW8 A;  4WFN L;  2QTD A;  3WXM B;  4ELU A;  4CFC A;  4DU3 A;  4GW6 A;  4CJ5 A;  4DFJ A;  1QQC A;  3HP6 A;  5BN8 A;  4OPA A;  2QKK A;  4DF4 A;  1KAZ A;  3SV3 A;  5LMU K;  5BR8 K;  3AAR A;  2UUB K;  1SL0 A;  2BE2 A;  3CJ1 A;  1X1P A;  4ICL A;  3D6R A;  3WXJ A;  1C1B A;  3NF8 A;  3O3F A;  1KLM A;  2FSK A;  1XMO K;  3HJF A;  1HYS A;  4DR4 K;  2F96 A;  1RT1 A;  3Q7C A;  3KLF A;  1VQ7 N;  2ZJR L;  1VQO N;  4JAX A;  3HYF A;  2YNH A;  5AQP A;  3TAE A;  3BY5 A;  4M3W A;  4ZHR A;  4DTJ A;  3THX A;  1LWE A;  2YJF A;  3GE1 A;  4DV5 K;  1WBB A;  1GOC A;  1W9H A;  2NRW A;  3LP0 A;  4MDA A;  5F1X A;  4F3O A;  3VEV A;  4R79 A;  3U3Y A;  4BG9 A;  3HVR A;  1VQN N;  3WXK A;  1Y64 A;  3S3O A;  1SV5 A;  4M63 C;  3VES A;  3RWU A;  1S6Q A;  2D0B A;  4PKG A;  1QSS A;  1KFS A;  2O4I A;  4KH5 A;  2NRV A;  3O4W A;  4N41 A;  4DS5 A;  4YY3 K;  3R1X A;  1T7P A;  4B9S A;  1Q18 A;  3BEX A;  3TSQ A;  2QWR A;  2YCH A;  3G71 N;  1N32 K;  4IOC L;  3QER A;  1ASV A;  5M1N A;  3EN9 A;  4HUE A;  2UXB K;  4H4O A;  4B3S K;  4B3T K;  3PIP L;  5MLC Q;  2Q0U A;  4O8U A;  4FLZ A;  1A5V A;  3PX4 A;  1J5O A;  4WF9 L;  3NH0 A;  3HL8 A;  1ZBI A;  3VQD A;  1GLD G;  3F73 A;  1RDC A;  1JLQ A;  3ZSR A;  2E2N A;  1TKX A;  4AQY K;  2ZGY A;  1SKW A;  3T19 A;  4DUY K;  4BR4 A;  4NCG A;  4JI1 K;  1C0F A;  5J2P A;  4YNQ A;  3RSE B;  3DRS A;  3WNF A;  4F3T A;  1VQP N;  4X64 K;  2PY5 A;  2Q36 A;  3ZX0 A;  3L0Q A;  4FM2 A;  3M8P A;  5AQG A;  1Q9Y A;  3TI0 A;  4OGC A;  4MQ3 A;  4DU1 A;  3O9Q A;  5HP1 A;  3NF9 A;  3OY9 A;  1NK9 A;  3R6M A;  3L2V A;  3MX2 A;  2GX9 A;  2QWM A;  1JL2 A;  2XY7 A;  5AZJ A;  5JVH L;  3VQ4 A;  1RBS A;  2VCP A;  3MXM A;  3CCE N;  3WXL A;  1XUP O;  5M1F A;  3U6F A;  3IKM A;  4CF9 A;  1WSI A;  3VF6 A;  2FBX A;  3E1Y A;  2PYJ A;  3BF3 A;  2QEX N;  5TKY A;  5I3U A;  2Z1H A;  4TSX A;  3MN7 A;  1YIJ N;  1JCE A;  1RBU A;  4LH5 A;  3UB5 A;  3CYM A;  4IOX A;  1HLU A;  5GAE P;  5KRT A;  2QK9 A;  4KHW A;  2FXU A;  4FZX C;  1NGJ A;  3QIO A;  4FW1 A;  1QQN A;  4GVE A;  4DSK A;  3O9S A;  4BE2 A;  3CJC A;  4E7L A;  1IKV A;  4JKC A;  3I33 A;  1TK0 A;  3SCX A;  4E1J A;  4FZZ A;  1YTU A;  1BOT O;  3NGI A;  5CR4 A;  3QNN A;  4EHT A;  5AQR A;  4IEI A;  3CCL N;  4KPY A;  1HNX K;  3ZSY A;  3ZX2 A;  4O8K A;  2GWK A;  3WNE A;  3QIP A;  3DLG A;  3AVA A;  4AHT A;  1O1W A;  3KLH A;  1J5E K;  4CZM A;  3VQE A;  4J2B A;  3J7A P;  1WLJ A;  1X3N A;  4N47 A;  3AVJ A;  4NLC A;  4JI2 K;  2D0O A;  3CC7 N;  3D2F A;  2G8K A;  4GV9 A;  1Q86 O;  3M1F A;  1N36 K;  1HKC A;  1NG9 A;  3H46 O;  1NGA A;  4JKH A;  3CQY A;  1D9F A;  5C10 A;  3OYK A;  5FPN A;  1GLL O;  1C0G A;  1NJZ A;  2KTQ A;  3V9U A;  3LAN A;  2F7T A;  1KVC A;  1GOB A;  1E4F T;  3WT0 A;  3ZSW A;  3DLH A;  3CCU N;  3KD5 E;  4KI6 A;  4Z4G A;  4H4M A;  5KGX A;  5KI6 A;  2PAV A;  4HHT A;  1KD1 O;  1IKW A;  1XNQ K;  2FF6 A;  4GV6 A;  1ZBS A;  3AVK A;  4BAC A;  3MK6 A;  4WCE L;  4IDH A;  4JD2 A;  3ENH A;  3MCA B;  3VQQ A;  3EE9 A;  1MWM A;  4NB4 A;  3OYL A;  3OYN A;  3AA5 X;  3MWP A;  2P9S A;  3HBT A;  4FVU A;  2IC3 A;  1TAU A;  1BI4 B;  1HNV A;  1VSL A;  1VSM A;  4EFH A;  5AQS A;  4DR7 K;  1R0A A;  3CM5 A;  1JKH A; 
#chains in the Genus database with same CATH homology
 5LMN K;  4K0K K;  4B3M K;  4X65 K;  4B3R K;  4DR2 K;  4DV5 K;  4DV6 K;  2F4V K;  2UU9 K;  5FLX O;  4DV3 K;  4JI5 K;  4KHP K;  1IBM K;  4NXN K;  2UXC K;  4JI8 K;  3JAM O;  1XMQ K;  4DV0 K;  4LF4 K;  5LL6 Z;  4GKJ K;  2VQF K;  4YY3 K;  1HNX K;  4CW7 B;  4DR3 K;  1N32 K;  4LF7 K;  1J5E K;  4OX9 K;  4DV7 K;  3J7A P;  4JI2 K;  4JI7 K;  2UXB K;  1N36 K;  4LF8 K;  4JV5 K;  3J81 O;  4B3S K;  4B3T K;  4DR5 K;  4LFB K;  3T1H K;  4JI4 K;  4LFA K;  2UXD K;  1N34 K;  4LF5 K;  2ZM6 K;  4DV1 K;  4LF9 K;  4JI6 K;  1I94 K;  4X62 K;  1HNW K;  4YHH K;  4LF6 K;  4AQY K;  4JI0 K;  1FJG K;  4DV2 K;  3T1Y K;  3OTO K;  4DUY K;  4CVN E;  4JI1 K;  4LFC K;  2UUC K;  1XNQ K;  5A2Q O;  4X64 K;  1IBL K;  5IWA K;  2VQE K;  4DR6 K;  2HHH K;  5LMU K;  5BR8 K;  1HNZ K;  1IBK K;  3J7Y P;  2E5L K;  2UUB K;  4JI3 K;  4X66 K;  1N33 K;  1XNR K;  4DUZ K;  4DR1 K;  4GKK K;  4V19 S;  5IT9 O;  4JYA K;  3J80 O;  4DR7 K;  2UUA K;  4NXM K;  1XMO K;  4DV4 K;  4DR4 K;  5AJ3 K;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...