3J7YP

Structure of the large ribosomal subunit from human mitochondria
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
138
structure length
133
Chain Sequence
b'AVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIKKHNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3j7yP00
4AQYK 4LF6K 1IBLK 1XNRK 4DV5K 4DV4K 5LL6Z 4DR6K 2UUAK 4LF8K 1XNQK 2UXBK 4JI2K 2HHHK 2UUCK 4JI3K 2F4VK 4DR2K 4DUZK 1FJGK 4DR1K 1N34K 2E5LK 1HNWK 4B3MK 4DR7K 3OTOK 1IBMK 3J81O 4CVNE 5A2QO 1J5EK 1HNZK 4KHPK 3T1YK 4GKKK 4LF9K 1HNXK 1N33K 4LFCK 4NXNK 2VQFK 4LFBK 4JI4K 3JAMO 4JI5K 4JI8K 1XMQK 4YHHK 4V19S 2UUBK 1IBKK 5AJ3K 4DUYK 4LF5K 1I94K 3J7YP 5IT9O 4DV0K 4LFAK 4JI7K 2UXDK 4LF7K 5IWAK 2VQEK 5LMNK 4X65K 4X62K 4JI1K 4B3SK 4DV6K 4DR4K 1N36K 4DR5K 1XMOK 4LF4K 2ZM6K 4YY3K 3T1HK 4X64K 4DV2K 4JI6K 2UU9K 5FLXO 4DR3K 4B3TK 4JI0K 5BR8K 3J80O 4B3RK 3J7AP 4CW7B 4X66K 4DV3K 4DV1K 1HR0K 4GKJK 4JYAK 4DV7K 4K0KK 4OX9K 4NXMK 1N32K 2UXCK 4JV5K 5LMUK
chains in the Genus database with same CATH superfamily
4LF6K 1IBLK 3I0SA 1ZC6A 3LP1A 4KRFA 3CQYA 3OYIA 5AQPA 4KB1A 1RT3A 4DQSA 3L3VA 1NOYA 2VG5A 3DLEA 3LM9A 1BGXT 1QQMA 2NRRA 3AVIA 5KI6A 5BPMA 1GOCA 2E1YA 3UB5A 3DMJA 4NB4A 3VEYA 4DTUA 2VCPA 2XY6A 3OTOK 2FBTA 5C0YA 3AVFA 4CFAA 3PSIA 1T7PA 3AARA 2OZMA 5FRNA 1HNXK 1VQ4N 1HMVA 4NXNK 4FJ7A 1VSIA 4AM6A 3MN5A 2OTJN 3KIOA 1GOBA 2UYTA 3JSMA 3WNFA 3Q7CA 2OPPA 1K9MO 3QEWA 2O4GA 4LF5K 4LD0A 1FKPA 3RRGA 4M7YA 3ZEUA 2W6KA 1VK0A 5BRFA 3MEDA 4JI1K 4ZTFA 3U8XA 3ZSXA 4DR4K 4MO5A 1HX1A 4B1ZA 5ELZA 3AVNA 3H46O 3AA3A 3WXLA 3OY9A 3DAWA 4BDZA 1IKXA 4K25A 3QIPA 3V6DA 3JS6A 4KHWA 1E4FT 3CMAN 1RDCA 4WQ4C 3VTIA 4WE1A 2GWKA 3VEVA 3EYZA 1RDAA 4AHTA 5F0XA 3K5OA 4JAXA 3TARA 4CJ3A 1ATRA 2XY7A 3RVCA 4OX9K 1NK7A 1W7AA 3C6AA 2O8DB 3S3MA 3QNNA 3ZX3A 4JV5K 1TL3A 1REVA 3RRHA 3SPYA 3SYZA 3MXJA 3HBTA 3ZX0A 4DSIA 2QWOA 4DCHA 4CJEA 5M1OA 3SCXA 1VQKN 1BIZA 1WSHA 4OGCA 2AP1A 1S1WA 5HBMA 1J53A 4IO8A 4AF1A 1L3TA 3THXB 3D2FB 3QMLA 4DR2K 4KHUA 4BE2A 1NK5A 4H0XB 1NGGA 3AVCA 5E84A 4B9QA 1J5EK 4CESA 4CZKA 5TKYA 4B8CA 1T8EA 4N5SA 1N8RO 1KD1O 2PYLA 3S3OA 4FM2A 1YJWN 1BG3A 3QBXA 4IFEA 2YNHA 4CJSA 1GLJO 3QINA 4K43A 1YF5L 1MDUB 2NRXA 2P9NB 3VEXA 5CE3A 3K0SA 2OZSA 1WSGA 3IUCA 3V1QA 4KTQA 3NVKA 3S41A 4FWKA 5LMNK 2X78A 1W2BM 4DB3A 3HOTA 3CG7A 3V81A 3TTFA 3ZSWA 1BIUA 2ZGYA 4DQQA 3EE9A 4K8ZA 4KHQA 4LF4K 3MCPA 3QESA 4DQIA 2E88A 4BRLA 4EHUA 3NCIA 4FZXC 1Q81O 1NK6A 4B9LA 4JKGB 2QKKA 1S9EA 4PKHA 4G1QA 2KTQA 4BE0A 3VQ9A 4HWIA 3DLRA 3N4QA 5BR8K 4IOCL 3H45C 3CFOA 3TSPA 3BDPA 1C1CA 3H3OB 3VQAA 1QVGM 4JNEA 1O1WA 4KHNA 2CGLA 1HKBA 3BZKA 1JCEA 2O8DA 4H5TA 4JKHA 5FPDA 1EX4A 1XNRK 4CFBA 4HUFA 3WQUA 4C8LA 3J7ZO 2X74A 4H5RA 3QERA 3DYAA 1N5YA 3LDPA 4NLBA 1TAUA 2LSNA 3CETA 3SQ2A 3WQTA 4DLEA 3OS1A 4JS4A 3DLGA 3L4QA 4DTRA 1SKRA 1HRHA 1E3MA 2CH5A 3ZSOA 3LM2A 2Q3SA 1NGEA 4FJKA 4PKGA 4HTLA 3THXA 4E3SA 4FW1A 3C6UA 2DFHA 2HVHA 3HI0A 3CYMA 1YJNN 3TR8A 4FWPA 1TK8A 4BVPA 2E6LA 1B9FA 3SUOA 3V9SA 1YVUA 1N33K 1TUYA 4CZIA 3E1YA 4FJMA 3BEXA 4EP4A 3ULEB 4FJIA 1HPZA 4XH5A 4O8UA 4JI5K 1XMQK 3ENHA 2UUBK 4F8RA 2H3GX 4M3YA 1J54A 4KTZA 5IT9O 2P9NA 4DSJA 1CZAN 3QBWA 4JI7K 2G8UA 5BPLA 3VMFB 2QW9A 2YCHA 5AQUA 3NF7A 1NJYA 5JLFA 4N76A 4CIGA 3V9UA 1RT2A 1FW6A 1K73O 2P9LA 2ASPA 3OS0A 3ENBA 1X9JA 3D2EB 4A5BA 1C0UA 3CC2N 4H5VA 1RT6A 2A41A 3M1FA 2PYJA 3GDQA 4BWMA 4DU1A 1VSKA 4AHSA 4BRHA 5FDLA 1NGBA 1XUPO 3VQQA 4A2BA 4CEFA 2XY8A 1OKJA 2QK9A 3BP8A 3CPEA 1JLAA 4CHYA 4W5NA 3KK3A 1KXPA 1VRTA 3VEWA 3L6QA 5AZJA 3AA2A 2PBDA 4M3UA 3W0LA 4OVLA 1OH8A 1K8AO 1KLMA 1XHXA 3DXMB 4CFCA 3TABA 5CHIA 4FVUA 3JYTA 1ASUA 4BC3A 3F2KA 4KKOA 5HROA 3C95A 5JMVA 4J2AA 5ADXH 4RWTA 2GELA 4XH1A 1GLEG 5KPTA 1SUQA 4FWSA 2D5RA 3O3GA 3I56N 4XEIA 1HNWK 4O0JA 3C7NB 1S5JA 1WSEA 2RE2A 4CF8A 2CGKA 1S3XA 3NVMA 1NJIO 3G25A 3CM6A 4NYNA 4IKFA 4PUOA 4CGFA 3I8DA 4BRCA 2OPRA 1QE1A 3PUFA 3KK1A 3ULEA 2YNFA 4KH5A 4NYFA 4CJQA 2Q97A 4E7JA 3E9PA 1D4XA 1VQON 3NF8A 3LALA 3KZBA 4O4GA 4F2RA 2VQEK 2KFZA 4CJ7A 3ZT3A 1LAVA 2GEMA 4AHVA 1NGCA 1LW0A 3K59A 4WF9L 5DM6L 3V9XA 3CJ1A 1Q86O 1X9WA 4DTJA 1QS4A 4JLHA 2QEXN 3K57A 3C6HA 4FLVA 4ELTA 1QHTA 1VSLA 3DLBA 2UU9K 5ADXA 3THVA 3G4SN 4BDPA 3CCRN 2EX3A 3CJBA 4BACA 3IAYA 4CW7B 2HSTA 3FZFA 1WUAA 4Z4EA 2IVOA 4LSNA 3UIQA 1KFDA 2BH1A 4EAHD 4GKJK 4QS7A 4K0KK 4KO0A 3PX4A 4CJLA 3GG4A 1U49A 5C10A 3CCEN 5BN8A 5J2MA 5HRPA 3VQ6A 5GIOA 2HVIA 5C24A 2J4RA 1BOTO 1NGIA 4GMJB 1J6ZA 3GL1A 5JS1A 3VGLA 3AAPA 4E0DA 4JK9A 1XNQK 3TTDA 3VQDA 4CZHA 4KV8A 3AA4A 3WUHA 4W5TA 3E66A 2W41A 5E26A 4DUZK 1MWMA 4FLUA 3OJUA 4KTWA 2F8TA 3CJAA 3OBWA 4FJ8A 4IBNA 4YOVA 2ASMA 4CEZA 4C8MA 3ZT0A 4WYBA 3U9ZA 4J2DA 1NGDA 4A5AA 2HW3A 1EWRA 4CJFA 4O5BA 3CFPA 4J8FA 3TU5A 3WNGA 4M3XA 2HHVA 1L3SA 5B8HA 3BZCA 5CR4A 2YHXA 4RCHA 5KTQA 3ZT2A 2V52B 4Y1CA 5AJ3K 4LFAK 2YKMA 4FJLA 2NNWA 4OPJA 2O8BB 2HBMA 4IJAA 1BUPA 1E4GT 2D0AA 1X1PA 2GX9A 3T1AA 4FM1A 3RSEB 3AA5X 1N36K 1K8KA 1JLGA 1XMOK 1BQNA 3KLHA 1BWFO 1B92A 2ZM6K 3K5LA 2JGUA 4CJWA 4IZ9A 4WQ5C 4FCYA 2RHKA 1GOAA 1T3VA 3NH2A 3I33A 2DPNA 1ILYA 2P9IB 1WSFA 4FWNA 4FK4A 3FZLA 2FXUA 4B3RK 2OPQA 3LPUA 2IS3A 1K6YA 1HYVA 1BO5O 2Q31A 4BGAA 4FWOA 4O44A 4NXMK 1QVFM 5I3UA 3VQ5A 1KVCA 2F9TA 2YHAA 3UKRB 3OYLA 4CEQA 3V1OA 2GWJA 2OTLN 1VAZA 1VSDA 1Q9YA 1WLJA 4EIAA 1HKGA 2FBXA 4DV5K 5CZ1A 5E41A 3ZYYX 3NAEA 3QEPA 3UKUA 3V9WA 4E1MA 3DXKB 1L3VA 4CECA 4CI6A 4I2QA 2UXBK 3QEVA 2RF2A 3WXMB 4BRDA 4B9MA 1GLCG 4CZEA 3FGUA 3BUZB 1RBTA 5LJVA 5CZ2A 2ITMA 3M3ZA 2YV0X 1FJGK 2IC3A 4E7KA 5J2PA 4B1XB 3LAKA 4JRPA 1C1AA 3RR7A 4FJNA 3NGIA 1GLDG 1RDDA 2YX6A 4DU4A 4AILC 1R0AA 2FF6A 4CHPA 3I0RA 2Q1NA 1NJWA 3MAQA 3PSFA 1W97L 3T1YK 3AO3A 4H0VB 4GV6A 5KQDA 3O5BA 2HNZA 3VQ4A 3WXIA 1VQ9N 1BI4B 4Z4IA 5KRSA 3TAMA 3THYB 1CZBA 1LWEA 1VHXA 3E9LA 5AQKA 1VQ5N 4CJTA 3HYFA 1RT5A 4CGGA 2QI2A 3H08A 4M41A 2UXDK 4W5OA 4FLWA 4FK0A 1B9DA 4Z4HA 2YKNA 4JHDB 1D9FA 4DQRA 4JD2B 1S9GA 3TAFA 1BHLA 1VQPN 4KH6A 3S9HA 4C23A 3VQPA 4BRAA 3I55N 4BRNA 5JLHA 2VG6A 1F21A 3D0PA 2O8CA 3CMEN 1A5VA 4DHYA 2NZTA 4YDUC 1NGAA 3MEEA 4I7FA 2P9UB 3L4IA 4KI4A 2VWBA 4FWLA 4MLEA 3OYBA 4IEEA 2X6NA 3DJCA 3CJ7A 4FZZA 1NKCA 3WXKA 1IH7A 2A42A 1YHQN 5HL7L 3O80A 5AQOA 1VSJA 5T7BA 5HRSA 1U6ZA 1HNVA 3WT0A 4H0TB 2D0BA 1DGKN 2HBKA 1S1TA 1T6DA 4AQYK 1LV5A 2HF3A 2XY5A 3LPTA 2B4JA 3UKRA 3WEEB 1MWKA 1S72N 3I8BA 4AM7A 5MLCQ 3ZT4A 4EZ9A 4FLXA 1EQYA 4C1NK 3CERA 5JVHL 2HHHK 3U6FA 3KLIA 1QZ5A 3P38A 5K14A 3ZETB 4Q5VA 2G8KA 3L3UA 4FOIA 3MEGA 4HUEA 3O3HA 3FZHA 1RBSA 1U2VA 2WFBA 5DM7L 1WB9A 1YITN 4M63C 1SAZA 1UAXA 1IKWA 2E4LA 2G8WA 2HBLA 2E5LK 5M1KA 4KBOA 1SL2A 3AVHA 5KGXA 4DTXA 2XHBA 1Q8IA 4CVNE 3IG1A 2VGMA 4YORA 1HYSA 2O8FB 1NMDA 3EO3A 4ZTJA 4TSXA 4E7LA 4CF0A 5F1XA 1JLFA 5M1NA 2VQFK 4CEOA 1NK8A 4JK7A 3FZMA 4NO7A 4KHSA 1S6QA 3MX2A 2ZD1A 4KI6A 3LANA 1GLAG 1BI4A 3LWMA 5KPRA 2NRTA 4CIFA 4JN4A 1I94K 3CD6N 4F9OA 2ZF5O 2WOMA 3K2PA 1QZ6A 4BG8A 4LH5A 3SBGA 4ELVA 1RDUA 3D6RA 3IFRA 4FSVA 4JHDA 4DKWA 4JD2A 3NDKA 4DTPA 3CFRA 3V9ZA 1NLVA 4K42A 2ZJQL 4N47A 4FW2A 4A62A 2QWQA 4X64K 1SKWA 1HQUA 5JVGL 3DM2A 2P9UA 4BR7A 3LL3A 4DV1K 2E2QA 4H8KA 4DFMA 4KAZA 1TKDA 2P51A 4AHCA 3OYFA 3SQ0A 4DTMA 3AO2A 1YUWA 2GBZA 4BDYA 1KRPA 3R8EA 5BR9A 4ISEA 2R7YA 4CCHA 1QTMA 4QCLA 1NBWA 1U04A 3WEEA 1ASWA 1OVQA 3SNNA 1EP4A 3CM5A 2D1KA 4CK3A 3SV3A 3LP3A 1VQNN 3C94A 3WXJA 5AQTA 4CJVA 2A6AA 3CQXA 1DEJA 2EHGA 5TKWA 4E7HA 4FJGA 3ZETA 3A8YA 1IO2A 5LY3A 3VA3A 1DKGD 1NGHA 4WQ5A 2QM1A 3R3LA 4Z4FA 1Q18A 4DFKA 4Z94A 5EY4A 4IEIA 3AAQA 3ISNC 1JL1A 4DQPA 3EL2A 4B08A 4OLAA 4CEEA 2O8FA 2A40A 1RTHA 3LAMA 1D5AA 3KLFA 2NRVA 4LFBK 4RG8A 4ID5A 4CD3A 3DOLA 4RW6A 1LCUA 4XIUA 1ZXOA 3EKUA 3QFUA 4FPAA 3D2FA 3QB0A 1FK9A 3SUQA 4F3OA 3E9OA 4DV0K 4NCGA 2WONA 2E8AA 5AQIA 3L2UA 3PO4A 5AQYA 3UE5A 2QTDA 5AZIB 4CIEA 1QSSA 3ZSYA 3MECA 4MLHA 3TAEA 4HCCA 2WUSA 3V4IA 2Z1JA 1YT3A 5C25A 1VQMN 3L2WA 5J2QA 5M1FA 4QS9A 2E1ZA 3NH1A 4WCEL 2NRWA 3J7AP 4HHTA 3BY5A 5AQJA 3MXIA 4DV3K 4FO0A 1NU0A 1KAYA 3ATVA 3G71N 4RW8A 3ZT1A 4DV7K 3TWHA 3A5MC 3P31A 3EZ5A 1IV0A 3P39A 4C1NI 1CXUA 2Q2RA 3BF1A 5AQQA 1SL1A 2F9WA 3OA9A 3E01A 3CCJN 3SJJA 3F9KA 3VGKA 4CBWA 2VYPA 3VQBA 1QSLA 1VQ8N 1T05A 2P9SB 4DV4K 2KLAA 3MWTA 1Q9XA 3CJCA 4JKGA 4PY5A 3M5RA 4IFVA 3CCMN 2YNIA 4FWRA 1VQLN 2NUBA 1JCFA 4WFAL 5EOYA 1ZBIA 5CY4A 1JLBA 3HT3A 3KTQA 1LWFA 4WFNL 2Z1IA 3CCLN 3C65A 1Q7YO 1RBUA 2YJFA 1IKYA 4O5FA 3NE6A 3M8PA 2E20A 1SL0A 3B8AX 3HVRA 4YDUA 4W5RA 4IDKA 4B3MK 3J8AA 1T44A 2OANA 5HRRA 1HQEA 1KSPA 1ITGA 3VGMA 2VGNA 3M8QA 4H0OA 1HNZK 3RMDA 4L8RB 4RTFD 1XWLA 3KK2A 3PX0A 1RTIA 4IG3A 4BY9C 2IIRA 4BR0A 3EKSA 3LP2A 3QFPA 4BR9A 4EZ6A 3V1RA 4IJNA 4CZFA 4RW9A 4HCBA 1SKSA 3O9SA 3O4WA 5M1PA 5I42A 3R9PA 2GUIA 4CBXA 1RT1A 1BA1A 1Y64A 4LC9B 1C6VA 4CK2A 2BUPA 4Y0WA 1HJRA 2Q36A 2E6MA 4DSFA 3CCVN 3AVLA 3VEZA 5AZIA 4JKBA 1RGIA 1YVNA 3KKSA 1NMNA 3SAFA 2HB5A 4HVJA 2KZMA 3QIOA 5AQRA 5SWMA 4AHUA 2HHSA 1LOTB 1OH7A 3R6MA 4HTUA 3QNOA 4I6MB 3F73A 4JYAK 4CHZA 1KVAA 1I39A 3CCQN 1N32K 2QKBA 1HLUA 4FJHA 4YOUA 1S1VA 3AGRA 3GBTA 3MK6A 3QETA 2YJEA 3D2EA 4M7XA 3K9KA 1VSHA 3MMVA 4GW6A 4FJXA 3S3NA 5AQXA 3MN6A 2P9SA 4QOZB 4CZJA 1C0TA 3DI6A 4CJ5A 3HSTB 4C8NA 3SI6A 2ITGA 5AQFA 3T7ZA 1T03A 1NKBA 3OYNA 2KQ2A 3OHRA 1BA0A 3Q7BA 4DR1K 4CK1A 4H4MA 3ZSRA 4DQ8A 2FBYA 1WBDA 2HMPA 2ETJA 3A5OC 3TSQA 1JLEA 2ZJRL 3MXMA 5FROA 5HOOA 1KQSM 4GKKK 3P83D 3ITHA 4PHTX 2HNDA 3SK3A 1HNIA 2IDOA 1C0GA 2KHOA 5CYMA 3DXMA 4KHYA 1RTJA 1Z6RA 3SAGA 4FM0A 1NGJA 3OYGA 4V19S 5I9EB 5BREA 3KVGA 2QWNA 4OPKA 4F4KA 3O1BA 1U48A 4ILJA 3ID8A 2YHYA 4MFBA 4QS8A 4B1UB 3MWPA 4B9VA 2JLEA 4X65K 3VESA 3C7NA 4DLGA 1ESVA 1G99A 2X6SA 3QEIA 2V7YA 3EE8A 5H1SQ 1L3UA 3IKMA 4R5PA 1BL3A 2KW4A 3T1HK 4B1YB 3G6EN 4M3ZA 1CZ9A 4EFHA 4F3TA 4JI6K 4MQ3A 2KZZA 3U9DA 3L2VA 1RNHA 3QO9A 1RT4A 4B9SA 5HP1A 1KC8O 4IDHA 4CGHA 4ICLA 1DT9A 1VQ7N 2IVNA 2HOEA 1S6PA 2GV9A 3EZWA 2PY5A 3QLHA 1V4TA 1CLQA 2DFFA 3G0ZA 1SV5A 2YHBA 3HTVA 4IXCA 1JXEA 3HJFA 1WNSA 4FJ5A 2ZGZA 4IWVA 5GAEP 4K41A 1WOQA 1S1UA 4JKCA 2W42A 2QWLA 1NWKA 3BF3A 5AQZA 4DMNA 1H1VA 3WNHA 3G10A 4AHRA 4O0IA 3ZSVA 1RBVA 3ZEUB 3O3FA 1ZYQA 1ZBFA 4E1NA 1L5UA 1OVYA 3PV8A 3ULDA 1VRUA 4JKAA 1UOCA 4DR7K 1SZ2A 3SMSA 5BN9A 1KLNA 1VSEA 4PL7A 3LWLA 5SZTA 2XO7A 3SUPA 3SV4A 4FVMA 4OKKA 4BRQA 2QWRA 3ATUA 4FOEA 3QDKA 4ID1A 5CYQA 4U67L 1S22A 2I5JA 4F2SA 3U4LA 4DG1A 1M1KO 5BRHA 1QQCA 5EVZA 3KLGA 2NRZA 1JLCA 4DFJA 2JWLA 2G8HA 3HM8A 4BRPA 4A59A 1P90A 3DLKA 3FFKB 3SAHA 1YXQA 5BPNA 4YOWA 2HNYA 3LZIA 1TKXA 1J9AA 1KAXA 2OYQA 4BE1A 3SLCA 1BQMA 2FC0A 4KB0A 2BE2A 3CJ9A 4IOAL 3HZ6A 3HOSA 5J2NA 1QSYA 3QEXA 4AH9A 4H5NA 4B3OA 4A2AA 4B8AB 4ILGB 4YFUA 4NCAA 4B3TK 3AGKA 3M8SA 3P4IA 4FLYA 2Z1HA 1TKTA 4N41A 1TVRA 3RWUA 2A5XA 1ZBHA 4B1WB 3TANA 2O8BA 5J1EA 2OCEA 3T3FA 2UXCK 4MDAA 3AO5A 4CJPA 3RSEA 4DSLA 5LMUK 1KCFA 1JXBA 5AQWA 3GOIA 1S1XA 3ZX2A 2D4WA 5AQMA 2BANA 4DU3A 3CQ8A 1KFSA 1NG9A 3NH0A 4CEAA 4OPHA 2P9IA 5FPEA 3THWB 3VF6A 1HJOA 2VWKA 2YNGA 3VOVA 1YIJN 4NCBA 5D3GA 4BRKA 3ALYA 2P5GA 3OJSA 1NM1A 4OJRA 4CHOA 2QWPA 2F96A 2AA4A 4BGBA 3DOKA 3TAPA 5GIPA 4ELUA 2F7TA 3O4NA 3PX6A 2JWKA 1IBMK 3HPOA 5C12A 3TTCA 5A2QO 3EEQA 3MN9A 3LDNA 4BROA 1EWQA 2FBVA 4R79A 3DRRA 2HHQA 2Z1GA 5AR0A 4DF8A 3DXKA 4LFCK 1A5WA 1YAGA 4BR2A 2G8VA 5BRDA 3NF6A 2HHTA 4LH4A 2FSKA 3IRXA 3KWIA 2V7ZA 4CEBA 3SPZA 3O8MA 3HP9A 2WC9A 4IG0A 5AQNA 3OYEA 4DUYK 3NFAA 5JS2A 2FSNA 3A5NC 4ISFA 1BU6O 3LDOA 3OYCA 1DLOA 2CGJA 1WAJA 3AVGA 2XRIA 3EY1A 1XHZA 4UQGA 3KKRA 1TAQA 3RMCA 2P9KB 1RILA 3A0IX 4NLCA 5KPZA 1MU2A 4FJ9A 1SS6A 5KQ8A 4DTSA 3T69A 3OYDA 3PIOL 3THYA 3HK2A 2QXFA 3MDQA 4DR3K 4BQLA 4ISGA 3HPHA 3MN7A 5EXWA 2QXLA 1JCGA 1W9HA 3LP0A 2ZE2A 5GAHP 2KKZA 4E89A 3TAGA 2ZWHA 1LAWA 5LJWA 1VSFA 5AQVA 3D7EO 1YJ9N 4CHQA 1JJ2M 2P1JA 5DMRA 3NBPA 3U3GA 3AY9A 3NGZA 4KH4A 4FWQA 3OYAA 1JKHA 3OYMA 3HXMA 4IOXA 4BRGA 2O4IA 5C15A 4FPBA 1C1BA 1CXQA 2UUCK 4JI3K 3THWA 5AFUH 3PO5A 3CF5L 4A57A 2E2NA 4U7BA 2CH6A 1TL1A 1X3MA 3LDQA 3SMPA 3TSUA 3SZ2A 3AO1A 3RR8A 2P5OA 1NK4A 3C6TA 1BISA 3IMXA 3U3YA 1XC3A 2P9LB 1JLQA 4E1JA 4CBUA 2YHWA 4W5QA 3KK7A 3O9RA 3LZJA 3LDLA 1EKEA 3F9MA 1NJZA 1A5XA 3HL8A 2Y1JA 3KD1E 4I9QA 5EU7A 1Y97A 4YOTA 1TYQB 3AVKA 4CHNA 4FYDA 1U47A 3O6WA 4CZMA 3K9JA 3TAQA 1NOZA 3CC4N 2Q0RA 3H1VX 4B9UA 1Z05A 4L3QA 3LDSA 2BGGA 2NRHA 2NLXA 1UA1A 1RDBA 2YI1A 2DFEA 2D0PA 1XI1A 4Z4CA 2D0CA 2RN2A 1VSMA 4G9ZA 5AZJB 3ASMA 4BRMA 4BR5A 4Z4GA 2P9KA 5AFUA 2HBJA 4GV3A 1EXQA 4BC2A 2G8IA 1GLBG 5FLXO 4XH4A 3CHWA 4BC4A 1ZBLA 4OGEA 3OW2M 2RPIA 1WSJA 5FRMA 3CI5A 2HHWA 3HSCA 3HO1A 4B1VA 4GY2B 4FZYA 4J2EA 3M8RA 1V4SA 2PZSA 2D0OA 4OPAA 3DRPA 1J5OA 4B9NA 1U45A 4CJUA 3FR0A 4N56A 4DTOA 4CE9A 5LL6Z 3CCUN 4DR6K 1FXXA 2BTFA 2PAVA 3CPWM 3OYJA 2OA8A 2WBNA 4JI2K 3AVBA 4KPYA 2DTUA 1IG9A 2IGIA 3K58A 3NMUA 4IFYA 5DK5A 3SUNA 3L2QA 4FXDA 2B6AA 1HKCA 4CGDA 5GINA 3TI0A 1RTDA 1RDWX 1RBRA 1YTAA 5GAGP 1DTTA 3TPQA 4JEPA 1YI2N 3HRGA 2BDPA 2IOCA 3RMBA 4DF4A 3VQ7A 1BDGA 2E2OA 4PL8A 5FPNA 5JICA 4CJ4A 1T6CA 4BQZA 3AVMA 2W6LA 1ASVA 2ZJPL 1I3AA 3ZLJA 1TV6A 2KFNA 4H5WA 4M42A 1R59O 1WBBA 3JAMO 1KVBA 4JI8K 3O1WA 1ATNA 1IBKK 2DY4A 3J7YP 4BRFA 4WFBL 4CZGA 4BG9A 1TYQA 1RCHA 3VERA 3ID6A 4CEDA 3P1GA 4BREA 1UWBA 3OVNA 3ZCMA 4EHTA 3IDHA 3O9QA 4X62K 1KAZA 1NNEA 2ATQA 4H03B 4DR5K 3VQ8A 3PLAA 1HUXA 1LWCA 5KGWA 1G15A 2RKIA 4CJKA 2A1SA 2B5JA 5AQLA 5AQGA 2W40A 4LY7A 3RTVA 3SJHA 2IAJA 1WAFA 3C0BA 4RW4A 3J80O 4ILHA 3HM9A 4FK2A 1TUUA 4OLBA 1MA9B 4I9LA 5F2RA 1ZBSA 1N6QA 1HR0K 3AO4A 3PY8A 1HPMA 4J2BA 1JL2A 3O9UA 1QQNA 3KWGA 1TK5A 1YTUA 1ATSA 4H0PA 2ZQBA 2P9PB 4DWIA 1TKZA 1Z26A 3N4PA 3BGRA 4CZLA 3K5MA 2ASOA 1GLFO 2I7PA 2OPSA 1WN7A 4M45A 4DTNA 4JKEA 3D45A 4WQ4A 1M90O 4M3RA 3AV9A 3AVAA 3ZSQA 1D8YA 3CC7N 3VQCA 1QHAA 2VWJA 2GUPA 5HRNA 1P8ZA 2FSJA 2FF3B 3VETA 5GADP 5M1QA 5C2FA 2WTUA 4YOYA 5AQHA 1UA0A 3FE1A 4HUGA 2VG7A 4FLTA 3VF2A 4BWJA 1N34K 4H0YB 2HHUA 1GLLO 5HLFA 1K8KB 4BVOA 4CD1A 2GTDA 4KHPK 3GE1A 1TK0A 4E7IA 1Q82O 5FPMA 4DS4A 4LF9K 1X9SA 3T19A 2I7NA 3CIPA 2O8EB 1NK9A 3SQ4A 4DSEA 1DTQA 4MDBA 4YHHK 3QICA 3OYHA 1XQSC 4FL9A 3VN5A 5AQSA 4EP5A 3O4QA 4DS5A 4LF7K 3KHYA 2HMIA 5IWAK 3NF9A 1NKEA 4B3SK 3B6OA 3B6PA 4DV6K 3RMAA 1IG8A 3ENOA 3OBYA 2Y1IA 4FJJA 4O8KA 1NJXA 4CGIA 4YNQA 3ZSZA 3IS9A 1U4BA 4DSKA 1RFQA 3F5TA 4GNIA 3UKUB 4YY3K 4C8OA 4BC5A 3VEOA 5C42A 3L0QA 4C8KA 4LSLA 3VTHA 3L8BA 4OKEA 3SBTA 4CGJA 3HPGA 2EWSA 3H6EA 4GVEA 2G8FA 2AJQA 4ZHRA 3VQEA 3OS2A 1OH5A 3VENA 3FLCO 4RW7A 2A1RA 4GVMA 4PQUA 4FWMA 3DLLL 4JKFA 4Y1DA 4K8XA 4QAGA 3SQ1A 2P9PA 3EN9A 4BR4A 1EO1A 3MX5A 5C2DA 1FKOA 1IJJA 2UUAK 1NK0A 4PA1A 4LF8K 4JRQA 1D9DA 2A3ZA 4PWDA 2PFUA 1TGOA 3A2FA 3M6GA 1O13A 4DFPA 4I6MA 4CF2A 3A5LC 3R1XA 1SQKA 2F4VK 3H1QA 2Q0UA 1IKVA 4CFDA 1C0FA 4IO9L 4CJRA 4CERA 3O9TA 3J81O 4Z0UA 4I2PA 4Q0BA 3K5NA 3KLEA 1KTQA 1LW2A 2QA4N 1VQ6N 2V51B 4YOXA 4B9TA 2O8CB 1X9MA 1WSIA 1X3NA 1BCMA 4M3WA 3PIPL 3VPZA 4JI4K 1RT7A 3WNEA 4E19A 3H3NO 4PKIA 4CF1A 3CXCM 1Z25A 2O8EA 3NHGA 1OH6A 4OO1J 1BCOA 3VA0A 4O55A 1C0MA 4H4OA 2HHXA 4M3TA 3P5JA 1XC9A 3KD5E 5KRTA 1EETA 4KFBA 3NGYA 3HVTA 3FZKA 4FLZA 1QQOA 4JKDA 3DWLA 2FLOA 3CCSN 4MO4A 3KJVA 3AVJA 3L2RA 4A61A 3OYKA 5EX5A 1HYZA 3DRSA 2F8SA 1W0HA 3O08A 4OKJA 4GV9A 4DV2K 4CF9A 3DLHA 3FFIA 4JI0K 3JXUA 4JK8A 3W3DA 4UY8O 3HP6A 2E2PA 2QWMA 4X66K 4KREA 3MCAB 1NGFA 1ZBUA 4BRIA 1U2VB 4JS5A 2HF4A 2IVPA 3VF4A
chains in the Genus database with same CATH topology
4AQYK 4LF6K 1IBLK 1XNRK 4DV5K 4DV4K 5LL6Z 4DR6K 2UUAK 4LF8K 1XNQK 2UXBK 4JI2K 2HHHK 2UUCK 4JI3K 2F4VK 4DR2K 4DUZK 1FJGK 4DR1K 1N34K 2E5LK 1HNWK 4B3MK 4DR7K 3OTOK 1IBMK 3J81O 4CVNE 5A2QO 1J5EK 1HNZK 4KHPK 3T1YK 4GKKK 4LF9K 1HNXK 1N33K 4LFCK 4NXNK 2VQFK 4LFBK 4JI4K 3JAMO 4JI5K 4JI8K 1XMQK 4YHHK 4V19S 2UUBK 1IBKK 5AJ3K 4DUYK 4LF5K 1I94K 3J7YP 5IT9O 4DV0K 4LFAK 4JI7K 2UXDK 4LF7K 5IWAK 2VQEK 5LMNK 4X65K 4X62K 4JI1K 4B3SK 4DV6K 4DR4K 1N36K 4DR5K 1XMOK 4LF4K 2ZM6K 4YY3K 3T1HK 4X64K 4DV2K 4JI6K 2UU9K 5FLXO 4DR3K 4B3TK 4JI0K 5BR8K 3J80O 4B3RK 3J7AP 4CW7B 4X66K 4DV3K 4DV1K 1HR0K 4GKJK 4JYAK 4DV7K 4K0KK 4OX9K 4NXMK 1N32K 2UXCK 4JV5K 5LMUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY K;  4LF6 K;  1IBL K;  1XNR K;  4DV5 K;  4DV4 K;  5LL6 Z;  4DR6 K;  2UUA K;  4LF8 K;  1XNQ K;  2UXB K;  4JI2 K;  2HHH K;  2UUC K;  4JI3 K;  2F4V K;  4DR2 K;  4DUZ K;  1FJG K;  4DR1 K;  1N34 K;  2E5L K;  1HNW K;  4B3M K;  4DR7 K;  3OTO K;  1IBM K;  3J81 O;  4CVN E;  5A2Q O;  1J5E K;  1HNZ K;  4KHP K;  3T1Y K;  4GKK K;  4LF9 K;  1HNX K;  1N33 K;  4LFC K;  4NXN K;  2VQF K;  4LFB K;  4JI4 K;  3JAM O;  4JI5 K;  4JI8 K;  1XMQ K;  4YHH K;  4V19 S;  2UUB K;  1IBK K;  5AJ3 K;  4DUY K;  4LF5 K;  1I94 K;  3J7Y P;  5IT9 O;  4DV0 K;  4LFA K;  4JI7 K;  2UXD K;  4LF7 K;  5IWA K;  2VQE K;  5LMN K;  4X65 K;  4X62 K;  4JI1 K;  4B3S K;  4DV6 K;  4DR4 K;  1N36 K;  4DR5 K;  1XMO K;  4LF4 K;  2ZM6 K;  4YY3 K;  3T1H K;  4X64 K;  4DV2 K;  4JI6 K;  2UU9 K;  5FLX O;  4DR3 K;  4B3T K;  4JI0 K;  5BR8 K;  3J80 O;  4B3R K;  3J7A P;  4CW7 B;  4X66 K;  4DV3 K;  4DV1 K;  1HR0 K;  4GKJ K;  4JYA K;  4DV7 K;  4K0K K;  4OX9 K;  4NXM K;  1N32 K;  2UXC K;  4JV5 K;  5LMU K; 
#chains in the Genus database with same CATH topology
 4LF6 K;  1IBL K;  3I0S A;  1ZC6 A;  3LP1 A;  4KRF A;  3CQY A;  3OYI A;  5AQP A;  4KB1 A;  1RT3 A;  4DQS A;  3L3V A;  1NOY A;  2VG5 A;  3DLE A;  3LM9 A;  1BGX T;  1QQM A;  2NRR A;  3AVI A;  5KI6 A;  5BPM A;  1GOC A;  2E1Y A;  3UB5 A;  3DMJ A;  4NB4 A;  3VEY A;  4DTU A;  2VCP A;  2XY6 A;  3OTO K;  2FBT A;  5C0Y A;  3AVF A;  4CFA A;  3PSI A;  1T7P A;  3AAR A;  2OZM A;  5FRN A;  1HNX K;  1VQ4 N;  1HMV A;  4NXN K;  4FJ7 A;  1VSI A;  4AM6 A;  3MN5 A;  2OTJ N;  3KIO A;  1GOB A;  2UYT A;  3JSM A;  3WNF A;  3Q7C A;  2OPP A;  1K9M O;  3QEW A;  2O4G A;  4LF5 K;  4LD0 A;  1FKP A;  3RRG A;  4M7Y A;  3ZEU A;  2W6K A;  1VK0 A;  5BRF A;  3MED A;  4JI1 K;  4ZTF A;  3U8X A;  3ZSX A;  4DR4 K;  4MO5 A;  1HX1 A;  4B1Z A;  5ELZ A;  3AVN A;  3H46 O;  3AA3 A;  3WXL A;  3OY9 A;  3DAW A;  4BDZ A;  1IKX A;  4K25 A;  3QIP A;  3V6D A;  3JS6 A;  4KHW A;  1E4F T;  3CMA N;  1RDC A;  4WQ4 C;  3VTI A;  4WE1 A;  2GWK A;  3VEV A;  3EYZ A;  1RDA A;  4AHT A;  5F0X A;  3K5O A;  4JAX A;  3TAR A;  4CJ3 A;  1ATR A;  2XY7 A;  3RVC A;  4OX9 K;  1NK7 A;  1W7A A;  3C6A A;  2O8D B;  3S3M A;  3QNN A;  3ZX3 A;  4JV5 K;  1TL3 A;  1REV A;  3RRH A;  3SPY A;  3SYZ A;  3MXJ A;  3HBT A;  3ZX0 A;  4DSI A;  2QWO A;  4DCH A;  4CJE A;  5M1O A;  3SCX A;  1VQK N;  1BIZ A;  1WSH A;  4OGC A;  2AP1 A;  1S1W A;  5HBM A;  1J53 A;  4IO8 A;  4AF1 A;  1L3T A;  3THX B;  3D2F B;  3QML A;  4DR2 K;  4KHU A;  4BE2 A;  1NK5 A;  4H0X B;  1NGG A;  3AVC A;  5E84 A;  4B9Q A;  1J5E K;  4CES A;  4CZK A;  5TKY A;  4B8C A;  1T8E A;  4N5S A;  1N8R O;  1KD1 O;  2PYL A;  3S3O A;  4FM2 A;  1YJW N;  1BG3 A;  3QBX A;  4IFE A;  2YNH A;  4CJS A;  1GLJ O;  3QIN A;  4K43 A;  1YF5 L;  1MDU B;  2NRX A;  2P9N B;  3VEX A;  5CE3 A;  3K0S A;  2OZS A;  1WSG A;  3IUC A;  3V1Q A;  4KTQ A;  3NVK A;  3S41 A;  4FWK A;  5LMN K;  2X78 A;  1W2B M;  4DB3 A;  3HOT A;  3CG7 A;  3V81 A;  3TTF A;  3ZSW A;  1BIU A;  2ZGY A;  4DQQ A;  3EE9 A;  4K8Z A;  4KHQ A;  4LF4 K;  3MCP A;  3QES A;  4DQI A;  2E88 A;  4BRL A;  4EHU A;  3NCI A;  4FZX C;  1Q81 O;  1NK6 A;  4B9L A;  4JKG B;  2QKK A;  1S9E A;  4PKH A;  4G1Q A;  2KTQ A;  4BE0 A;  3VQ9 A;  4HWI A;  3DLR A;  3N4Q A;  5BR8 K;  4IOC L;  3H45 C;  3CFO A;  3TSP A;  3BDP A;  1C1C A;  3H3O B;  3VQA A;  1QVG M;  4JNE A;  1O1W A;  4KHN A;  2CGL A;  1HKB A;  3BZK A;  1JCE A;  2O8D A;  4H5T A;  4JKH A;  5FPD A;  1EX4 A;  1XNR K;  4CFB A;  4HUF A;  3WQU A;  4C8L A;  3J7Z O;  2X74 A;  4H5R A;  3QER A;  3DYA A;  1N5Y A;  3LDP A;  4NLB A;  1TAU A;  2LSN A;  3CET A;  3SQ2 A;  3WQT A;  4DLE A;  3OS1 A;  4JS4 A;  3DLG A;  3L4Q A;  4DTR A;  1SKR A;  1HRH A;  1E3M A;  2CH5 A;  3ZSO A;  3LM2 A;  2Q3S A;  1NGE A;  4FJK A;  4PKG A;  4HTL A;  3THX A;  4E3S A;  4FW1 A;  3C6U A;  2DFH A;  2HVH A;  3HI0 A;  3CYM A;  1YJN N;  3TR8 A;  4FWP A;  1TK8 A;  4BVP A;  2E6L A;  1B9F A;  3SUO A;  3V9S A;  1YVU A;  1N33 K;  1TUY A;  4CZI A;  3E1Y A;  4FJM A;  3BEX A;  4EP4 A;  3ULE B;  4FJI A;  1HPZ A;  4XH5 A;  4O8U A;  4JI5 K;  1XMQ K;  3ENH A;  2UUB K;  4F8R A;  2H3G X;  4M3Y A;  1J54 A;  4KTZ A;  5IT9 O;  2P9N A;  4DSJ A;  1CZA N;  3QBW A;  4JI7 K;  2G8U A;  5BPL A;  3VMF B;  2QW9 A;  2YCH A;  5AQU A;  3NF7 A;  1NJY A;  5JLF A;  4N76 A;  4CIG A;  3V9U A;  1RT2 A;  1FW6 A;  1K73 O;  2P9L A;  2ASP A;  3OS0 A;  3ENB A;  1X9J A;  3D2E B;  4A5B A;  1C0U A;  3CC2 N;  4H5V A;  1RT6 A;  2A41 A;  3M1F A;  2PYJ A;  3GDQ A;  4BWM A;  4DU1 A;  1VSK A;  4AHS A;  4BRH A;  5FDL A;  1NGB A;  1XUP O;  3VQQ A;  4A2B A;  4CEF A;  2XY8 A;  1OKJ A;  2QK9 A;  3BP8 A;  3CPE A;  1JLA A;  4CHY A;  4W5N A;  3KK3 A;  1KXP A;  1VRT A;  3VEW A;  3L6Q A;  5AZJ A;  3AA2 A;  2PBD A;  4M3U A;  3W0L A;  4OVL A;  1OH8 A;  1K8A O;  1KLM A;  1XHX A;  3DXM B;  4CFC A;  3TAB A;  5CHI A;  4FVU A;  3JYT A;  1ASU A;  4BC3 A;  3F2K A;  4KKO A;  5HRO A;  3C95 A;  5JMV A;  4J2A A;  5ADX H;  4RWT A;  2GEL A;  4XH1 A;  1GLE G;  5KPT A;  1SUQ A;  4FWS A;  2D5R A;  3O3G A;  3I56 N;  4XEI A;  1HNW K;  4O0J A;  3C7N B;  1S5J A;  1WSE A;  2RE2 A;  4CF8 A;  2CGK A;  1S3X A;  3NVM A;  1NJI O;  3G25 A;  3CM6 A;  4NYN A;  4IKF A;  4PUO A;  4CGF A;  3I8D A;  4BRC A;  2OPR A;  1QE1 A;  3PUF A;  3KK1 A;  3ULE A;  2YNF A;  4KH5 A;  4NYF A;  4CJQ A;  2Q97 A;  4E7J A;  3E9P A;  1D4X A;  1VQO N;  3NF8 A;  3LAL A;  3KZB A;  4O4G A;  4F2R A;  2VQE K;  2KFZ A;  4CJ7 A;  3ZT3 A;  1LAV A;  2GEM A;  4AHV A;  1NGC A;  1LW0 A;  3K59 A;  4WF9 L;  5DM6 L;  3V9X A;  3CJ1 A;  1Q86 O;  1X9W A;  4DTJ A;  1QS4 A;  4JLH A;  2QEX N;  3K57 A;  3C6H A;  4FLV A;  4ELT A;  1QHT A;  1VSL A;  3DLB A;  2UU9 K;  5ADX A;  3THV A;  3G4S N;  4BDP A;  3CCR N;  2EX3 A;  3CJB A;  4BAC A;  3IAY A;  4CW7 B;  2HST A;  3FZF A;  1WUA A;  4Z4E A;  2IVO A;  4LSN A;  3UIQ A;  1KFD A;  2BH1 A;  4EAH D;  4GKJ K;  4QS7 A;  4K0K K;  4KO0 A;  3PX4 A;  4CJL A;  3GG4 A;  1U49 A;  5C10 A;  3CCE N;  5BN8 A;  5J2M A;  5HRP A;  3VQ6 A;  5GIO A;  2HVI A;  5C24 A;  2J4R A;  1BOT O;  1NGI A;  4GMJ B;  1J6Z A;  3GL1 A;  5JS1 A;  3VGL A;  3AAP A;  4E0D A;  4JK9 A;  1XNQ K;  3TTD A;  3VQD A;  4CZH A;  4KV8 A;  3AA4 A;  3WUH A;  4W5T A;  3E66 A;  2W41 A;  5E26 A;  4DUZ K;  1MWM A;  4FLU A;  3OJU A;  4KTW A;  2F8T A;  3CJA A;  3OBW A;  4FJ8 A;  4IBN A;  4YOV A;  2ASM A;  4CEZ A;  4C8M A;  3ZT0 A;  4WYB A;  3U9Z A;  4J2D A;  1NGD A;  4A5A A;  2HW3 A;  1EWR A;  4CJF A;  4O5B A;  3CFP A;  4J8F A;  3TU5 A;  3WNG A;  4M3X A;  2HHV A;  1L3S A;  5B8H A;  3BZC A;  5CR4 A;  2YHX A;  4RCH A;  5KTQ A;  3ZT2 A;  2V52 B;  4Y1C A;  5AJ3 K;  4LFA K;  2YKM A;  4FJL A;  2NNW A;  4OPJ A;  2O8B B;  2HBM A;  4IJA A;  1BUP A;  1E4G T;  2D0A A;  1X1P A;  2GX9 A;  3T1A A;  4FM1 A;  3RSE B;  3AA5 X;  1N36 K;  1K8K A;  1JLG A;  1XMO K;  1BQN A;  3KLH A;  1BWF O;  1B92 A;  2ZM6 K;  3K5L A;  2JGU A;  4CJW A;  4IZ9 A;  4WQ5 C;  4FCY A;  2RHK A;  1GOA A;  1T3V A;  3NH2 A;  3I33 A;  2DPN A;  1ILY A;  2P9I B;  1WSF A;  4FWN A;  4FK4 A;  3FZL A;  2FXU A;  4B3R K;  2OPQ A;  3LPU A;  2IS3 A;  1K6Y A;  1HYV A;  1BO5 O;  2Q31 A;  4BGA A;  4FWO A;  4O44 A;  4NXM K;  1QVF M;  5I3U A;  3VQ5 A;  1KVC A;  2F9T A;  2YHA A;  3UKR B;  3OYL A;  4CEQ A;  3V1O A;  2GWJ A;  2OTL N;  1VAZ A;  1VSD A;  1Q9Y A;  1WLJ A;  4EIA A;  1HKG A;  2FBX A;  4DV5 K;  5CZ1 A;  5E41 A;  3ZYY X;  3NAE A;  3QEP A;  3UKU A;  3V9W A;  4E1M A;  3DXK B;  1L3V A;  4CEC A;  4CI6 A;  4I2Q A;  2UXB K;  3QEV A;  2RF2 A;  3WXM B;  4BRD A;  4B9M A;  1GLC G;  4CZE A;  3FGU A;  3BUZ B;  1RBT A;  5LJV A;  5CZ2 A;  2ITM A;  3M3Z A;  2YV0 X;  1FJG K;  2IC3 A;  4E7K A;  5J2P A;  4B1X B;  3LAK A;  4JRP A;  1C1A A;  3RR7 A;  4FJN A;  3NGI A;  1GLD G;  1RDD A;  2YX6 A;  4DU4 A;  4AIL C;  1R0A A;  2FF6 A;  4CHP A;  3I0R A;  2Q1N A;  1NJW A;  3MAQ A;  3PSF A;  1W97 L;  3T1Y K;  3AO3 A;  4H0V B;  4GV6 A;  5KQD A;  3O5B A;  2HNZ A;  3VQ4 A;  3WXI A;  1VQ9 N;  1BI4 B;  4Z4I A;  5KRS A;  3TAM A;  3THY B;  1CZB A;  1LWE A;  1VHX A;  3E9L A;  5AQK A;  1VQ5 N;  4CJT A;  3HYF A;  1RT5 A;  4CGG A;  2QI2 A;  3H08 A;  4M41 A;  2UXD K;  4W5O A;  4FLW A;  4FK0 A;  1B9D A;  4Z4H A;  2YKN A;  4JHD B;  1D9F A;  4DQR A;  4JD2 B;  1S9G A;  3TAF A;  1BHL A;  1VQP N;  4KH6 A;  3S9H A;  4C23 A;  3VQP A;  4BRA A;  3I55 N;  4BRN A;  5JLH A;  2VG6 A;  1F21 A;  3D0P A;  2O8C A;  3CME N;  1A5V A;  4DHY A;  2NZT A;  4YDU C;  1NGA A;  3MEE A;  4I7F A;  2P9U B;  3L4I A;  4KI4 A;  2VWB A;  4FWL A;  4MLE A;  3OYB A;  4IEE A;  2X6N A;  3DJC A;  3CJ7 A;  4FZZ A;  1NKC A;  3WXK A;  1IH7 A;  2A42 A;  1YHQ N;  5HL7 L;  3O80 A;  5AQO A;  1VSJ A;  5T7B A;  5HRS A;  1U6Z A;  1HNV A;  3WT0 A;  4H0T B;  2D0B A;  1DGK N;  2HBK A;  1S1T A;  1T6D A;  4AQY K;  1LV5 A;  2HF3 A;  2XY5 A;  3LPT A;  2B4J A;  3UKR A;  3WEE B;  1MWK A;  1S72 N;  3I8B A;  4AM7 A;  5MLC Q;  3ZT4 A;  4EZ9 A;  4FLX A;  1EQY A;  4C1N K;  3CER A;  5JVH L;  2HHH K;  3U6F A;  3KLI A;  1QZ5 A;  3P38 A;  5K14 A;  3ZET B;  4Q5V A;  2G8K A;  3L3U A;  4FOI A;  3MEG A;  4HUE A;  3O3H A;  3FZH A;  1RBS A;  1U2V A;  2WFB A;  5DM7 L;  1WB9 A;  1YIT N;  4M63 C;  1SAZ A;  1UAX A;  1IKW A;  2E4L A;  2G8W A;  2HBL A;  2E5L K;  5M1K A;  4KBO A;  1SL2 A;  3AVH A;  5KGX A;  4DTX A;  2XHB A;  1Q8I A;  4CVN E;  3IG1 A;  2VGM A;  4YOR A;  1HYS A;  2O8F B;  1NMD A;  3EO3 A;  4ZTJ A;  4TSX A;  4E7L A;  4CF0 A;  5F1X A;  1JLF A;  5M1N A;  2VQF K;  4CEO A;  1NK8 A;  4JK7 A;  3FZM A;  4NO7 A;  4KHS A;  1S6Q A;  3MX2 A;  2ZD1 A;  4KI6 A;  3LAN A;  1GLA G;  1BI4 A;  3LWM A;  5KPR A;  2NRT A;  4CIF A;  4JN4 A;  1I94 K;  3CD6 N;  4F9O A;  2ZF5 O;  2WOM A;  3K2P A;  1QZ6 A;  4BG8 A;  4LH5 A;  3SBG A;  4ELV A;  1RDU A;  3D6R A;  3IFR A;  4FSV A;  4JHD A;  4DKW A;  4JD2 A;  3NDK A;  4DTP A;  3CFR A;  3V9Z A;  1NLV A;  4K42 A;  2ZJQ L;  4N47 A;  4FW2 A;  4A62 A;  2QWQ A;  4X64 K;  1SKW A;  1HQU A;  5JVG L;  3DM2 A;  2P9U A;  4BR7 A;  3LL3 A;  4DV1 K;  2E2Q A;  4H8K A;  4DFM A;  4KAZ A;  1TKD A;  2P51 A;  4AHC A;  3OYF A;  3SQ0 A;  4DTM A;  3AO2 A;  1YUW A;  2GBZ A;  4BDY A;  1KRP A;  3R8E A;  5BR9 A;  4ISE A;  2R7Y A;  4CCH A;  1QTM A;  4QCL A;  1NBW A;  1U04 A;  3WEE A;  1ASW A;  1OVQ A;  3SNN A;  1EP4 A;  3CM5 A;  2D1K A;  4CK3 A;  3SV3 A;  3LP3 A;  1VQN N;  3C94 A;  3WXJ A;  5AQT A;  4CJV A;  2A6A A;  3CQX A;  1DEJ A;  2EHG A;  5TKW A;  4E7H A;  4FJG A;  3ZET A;  3A8Y A;  1IO2 A;  5LY3 A;  3VA3 A;  1DKG D;  1NGH A;  4WQ5 A;  2QM1 A;  3R3L A;  4Z4F A;  1Q18 A;  4DFK A;  4Z94 A;  5EY4 A;  4IEI A;  3AAQ A;  3ISN C;  1JL1 A;  4DQP A;  3EL2 A;  4B08 A;  4OLA A;  4CEE A;  2O8F A;  2A40 A;  1RTH A;  3LAM A;  1D5A A;  3KLF A;  2NRV A;  4LFB K;  4RG8 A;  4ID5 A;  4CD3 A;  3DOL A;  4RW6 A;  1LCU A;  4XIU A;  1ZXO A;  3EKU A;  3QFU A;  4FPA A;  3D2F A;  3QB0 A;  1FK9 A;  3SUQ A;  4F3O A;  3E9O A;  4DV0 K;  4NCG A;  2WON A;  2E8A A;  5AQI A;  3L2U A;  3PO4 A;  5AQY A;  3UE5 A;  2QTD A;  5AZI B;  4CIE A;  1QSS A;  3ZSY A;  3MEC A;  4MLH A;  3TAE A;  4HCC A;  2WUS A;  3V4I A;  2Z1J A;  1YT3 A;  5C25 A;  1VQM N;  3L2W A;  5J2Q A;  5M1F A;  4QS9 A;  2E1Z A;  3NH1 A;  4WCE L;  2NRW A;  3J7A P;  4HHT A;  3BY5 A;  5AQJ A;  3MXI A;  4DV3 K;  4FO0 A;  1NU0 A;  1KAY A;  3ATV A;  3G71 N;  4RW8 A;  3ZT1 A;  4DV7 K;  3TWH A;  3A5M C;  3P31 A;  3EZ5 A;  1IV0 A;  3P39 A;  4C1N I;  1CXU A;  2Q2R A;  3BF1 A;  5AQQ A;  1SL1 A;  2F9W A;  3OA9 A;  3E01 A;  3CCJ N;  3SJJ A;  3F9K A;  3VGK A;  4CBW A;  2VYP A;  3VQB A;  1QSL A;  1VQ8 N;  1T05 A;  2P9S B;  4DV4 K;  2KLA A;  3MWT A;  1Q9X A;  3CJC A;  4JKG A;  4PY5 A;  3M5R A;  4IFV A;  3CCM N;  2YNI A;  4FWR A;  1VQL N;  2NUB A;  1JCF A;  4WFA L;  5EOY A;  1ZBI A;  5CY4 A;  1JLB A;  3HT3 A;  3KTQ A;  1LWF A;  4WFN L;  2Z1I A;  3CCL N;  3C65 A;  1Q7Y O;  1RBU A;  2YJF A;  1IKY A;  4O5F A;  3NE6 A;  3M8P A;  2E20 A;  1SL0 A;  3B8A X;  3HVR A;  4YDU A;  4W5R A;  4IDK A;  4B3M K;  3J8A A;  1T44 A;  2OAN A;  5HRR A;  1HQE A;  1KSP A;  1ITG A;  3VGM A;  2VGN A;  3M8Q A;  4H0O A;  1HNZ K;  3RMD A;  4L8R B;  4RTF D;  1XWL A;  3KK2 A;  3PX0 A;  1RTI A;  4IG3 A;  4BY9 C;  2IIR A;  4BR0 A;  3EKS A;  3LP2 A;  3QFP A;  4BR9 A;  4EZ6 A;  3V1R A;  4IJN A;  4CZF A;  4RW9 A;  4HCB A;  1SKS A;  3O9S A;  3O4W A;  5M1P A;  5I42 A;  3R9P A;  2GUI A;  4CBX A;  1RT1 A;  1BA1 A;  1Y64 A;  4LC9 B;  1C6V A;  4CK2 A;  2BUP A;  4Y0W A;  1HJR A;  2Q36 A;  2E6M A;  4DSF A;  3CCV N;  3AVL A;  3VEZ A;  5AZI A;  4JKB A;  1RGI A;  1YVN A;  3KKS A;  1NMN A;  3SAF A;  2HB5 A;  4HVJ A;  2KZM A;  3QIO A;  5AQR A;  5SWM A;  4AHU A;  2HHS A;  1LOT B;  1OH7 A;  3R6M A;  4HTU A;  3QNO A;  4I6M B;  3F73 A;  4JYA K;  4CHZ A;  1KVA A;  1I39 A;  3CCQ N;  1N32 K;  2QKB A;  1HLU A;  4FJH A;  4YOU A;  1S1V A;  3AGR A;  3GBT A;  3MK6 A;  3QET A;  2YJE A;  3D2E A;  4M7X A;  3K9K A;  1VSH A;  3MMV A;  4GW6 A;  4FJX A;  3S3N A;  5AQX A;  3MN6 A;  2P9S A;  4QOZ B;  4CZJ A;  1C0T A;  3DI6 A;  4CJ5 A;  3HST B;  4C8N A;  3SI6 A;  2ITG A;  5AQF A;  3T7Z A;  1T03 A;  1NKB A;  3OYN A;  2KQ2 A;  3OHR A;  1BA0 A;  3Q7B A;  4DR1 K;  4CK1 A;  4H4M A;  3ZSR A;  4DQ8 A;  2FBY A;  1WBD A;  2HMP A;  2ETJ A;  3A5O C;  3TSQ A;  1JLE A;  2ZJR L;  3MXM A;  5FRO A;  5HOO A;  1KQS M;  4GKK K;  3P83 D;  3ITH A;  4PHT X;  2HND A;  3SK3 A;  1HNI A;  2IDO A;  1C0G A;  2KHO A;  5CYM A;  3DXM A;  4KHY A;  1RTJ A;  1Z6R A;  3SAG A;  4FM0 A;  1NGJ A;  3OYG A;  4V19 S;  5I9E B;  5BRE A;  3KVG A;  2QWN A;  4OPK A;  4F4K A;  3O1B A;  1U48 A;  4ILJ A;  3ID8 A;  2YHY A;  4MFB A;  4QS8 A;  4B1U B;  3MWP A;  4B9V A;  2JLE A;  4X65 K;  3VES A;  3C7N A;  4DLG A;  1ESV A;  1G99 A;  2X6S A;  3QEI A;  2V7Y A;  3EE8 A;  5H1S Q;  1L3U A;  3IKM A;  4R5P A;  1BL3 A;  2KW4 A;  3T1H K;  4B1Y B;  3G6E N;  4M3Z A;  1CZ9 A;  4EFH A;  4F3T A;  4JI6 K;  4MQ3 A;  2KZZ A;  3U9D A;  3L2V A;  1RNH A;  3QO9 A;  1RT4 A;  4B9S A;  5HP1 A;  1KC8 O;  4IDH A;  4CGH A;  4ICL A;  1DT9 A;  1VQ7 N;  2IVN A;  2HOE A;  1S6P A;  2GV9 A;  3EZW A;  2PY5 A;  3QLH A;  1V4T A;  1CLQ A;  2DFF A;  3G0Z A;  1SV5 A;  2YHB A;  3HTV A;  4IXC A;  1JXE A;  3HJF A;  1WNS A;  4FJ5 A;  2ZGZ A;  4IWV A;  5GAE P;  4K41 A;  1WOQ A;  1S1U A;  4JKC A;  2W42 A;  2QWL A;  1NWK A;  3BF3 A;  5AQZ A;  4DMN A;  1H1V A;  3WNH A;  3G10 A;  4AHR A;  4O0I A;  3ZSV A;  1RBV A;  3ZEU B;  3O3F A;  1ZYQ A;  1ZBF A;  4E1N A;  1L5U A;  1OVY A;  3PV8 A;  3ULD A;  1VRU A;  4JKA A;  1UOC A;  4DR7 K;  1SZ2 A;  3SMS A;  5BN9 A;  1KLN A;  1VSE A;  4PL7 A;  3LWL A;  5SZT A;  2XO7 A;  3SUP A;  3SV4 A;  4FVM A;  4OKK A;  4BRQ A;  2QWR A;  3ATU A;  4FOE A;  3QDK A;  4ID1 A;  5CYQ A;  4U67 L;  1S22 A;  2I5J A;  4F2S A;  3U4L A;  4DG1 A;  1M1K O;  5BRH A;  1QQC A;  5EVZ A;  3KLG A;  2NRZ A;  1JLC A;  4DFJ A;  2JWL A;  2G8H A;  3HM8 A;  4BRP A;  4A59 A;  1P90 A;  3DLK A;  3FFK B;  3SAH A;  1YXQ A;  5BPN A;  4YOW A;  2HNY A;  3LZI A;  1TKX A;  1J9A A;  1KAX A;  2OYQ A;  4BE1 A;  3SLC A;  1BQM A;  2FC0 A;  4KB0 A;  2BE2 A;  3CJ9 A;  4IOA L;  3HZ6 A;  3HOS A;  5J2N A;  1QSY A;  3QEX A;  4AH9 A;  4H5N A;  4B3O A;  4A2A A;  4B8A B;  4ILG B;  4YFU A;  4NCA A;  4B3T K;  3AGK A;  3M8S A;  3P4I A;  4FLY A;  2Z1H A;  1TKT A;  4N41 A;  1TVR A;  3RWU A;  2A5X A;  1ZBH A;  4B1W B;  3TAN A;  2O8B A;  5J1E A;  2OCE A;  3T3F A;  2UXC K;  4MDA A;  3AO5 A;  4CJP A;  3RSE A;  4DSL A;  5LMU K;  1KCF A;  1JXB A;  5AQW A;  3GOI A;  1S1X A;  3ZX2 A;  2D4W A;  5AQM A;  2BAN A;  4DU3 A;  3CQ8 A;  1KFS A;  1NG9 A;  3NH0 A;  4CEA A;  4OPH A;  2P9I A;  5FPE A;  3THW B;  3VF6 A;  1HJO A;  2VWK A;  2YNG A;  3VOV A;  1YIJ N;  4NCB A;  5D3G A;  4BRK A;  3ALY A;  2P5G A;  3OJS A;  1NM1 A;  4OJR A;  4CHO A;  2QWP A;  2F96 A;  2AA4 A;  4BGB A;  3DOK A;  3TAP A;  5GIP A;  4ELU A;  2F7T A;  3O4N A;  3PX6 A;  2JWK A;  1IBM K;  3HPO A;  5C12 A;  3TTC A;  5A2Q O;  3EEQ A;  3MN9 A;  3LDN A;  4BRO A;  1EWQ A;  2FBV A;  4R79 A;  3DRR A;  2HHQ A;  2Z1G A;  5AR0 A;  4DF8 A;  3DXK A;  4LFC K;  1A5W A;  1YAG A;  4BR2 A;  2G8V A;  5BRD A;  3NF6 A;  2HHT A;  4LH4 A;  2FSK A;  3IRX A;  3KWI A;  2V7Z A;  4CEB A;  3SPZ A;  3O8M A;  3HP9 A;  2WC9 A;  4IG0 A;  5AQN A;  3OYE A;  4DUY K;  3NFA A;  5JS2 A;  2FSN A;  3A5N C;  4ISF A;  1BU6 O;  3LDO A;  3OYC A;  1DLO A;  2CGJ A;  1WAJ A;  3AVG A;  2XRI A;  3EY1 A;  1XHZ A;  4UQG A;  3KKR A;  1TAQ A;  3RMC A;  2P9K B;  1RIL A;  3A0I X;  4NLC A;  5KPZ A;  1MU2 A;  4FJ9 A;  1SS6 A;  5KQ8 A;  4DTS A;  3T69 A;  3OYD A;  3PIO L;  3THY A;  3HK2 A;  2QXF A;  3MDQ A;  4DR3 K;  4BQL A;  4ISG A;  3HPH A;  3MN7 A;  5EXW A;  2QXL A;  1JCG A;  1W9H A;  3LP0 A;  2ZE2 A;  5GAH P;  2KKZ A;  4E89 A;  3TAG A;  2ZWH A;  1LAW A;  5LJW A;  1VSF A;  5AQV A;  3D7E O;  1YJ9 N;  4CHQ A;  1JJ2 M;  2P1J A;  5DMR A;  3NBP A;  3U3G A;  3AY9 A;  3NGZ A;  4KH4 A;  4FWQ A;  3OYA A;  1JKH A;  3OYM A;  3HXM A;  4IOX A;  4BRG A;  2O4I A;  5C15 A;  4FPB A;  1C1B A;  1CXQ A;  2UUC K;  4JI3 K;  3THW A;  5AFU H;  3PO5 A;  3CF5 L;  4A57 A;  2E2N A;  4U7B A;  2CH6 A;  1TL1 A;  1X3M A;  3LDQ A;  3SMP A;  3TSU A;  3SZ2 A;  3AO1 A;  3RR8 A;  2P5O A;  1NK4 A;  3C6T A;  1BIS A;  3IMX A;  3U3Y A;  1XC3 A;  2P9L B;  1JLQ A;  4E1J A;  4CBU A;  2YHW A;  4W5Q A;  3KK7 A;  3O9R A;  3LZJ A;  3LDL A;  1EKE A;  3F9M A;  1NJZ A;  1A5X A;  3HL8 A;  2Y1J A;  3KD1 E;  4I9Q A;  5EU7 A;  1Y97 A;  4YOT A;  1TYQ B;  3AVK A;  4CHN A;  4FYD A;  1U47 A;  3O6W A;  4CZM A;  3K9J A;  3TAQ A;  1NOZ A;  3CC4 N;  2Q0R A;  3H1V X;  4B9U A;  1Z05 A;  4L3Q A;  3LDS A;  2BGG A;  2NRH A;  2NLX A;  1UA1 A;  1RDB A;  2YI1 A;  2DFE A;  2D0P A;  1XI1 A;  4Z4C A;  2D0C A;  2RN2 A;  1VSM A;  4G9Z A;  5AZJ B;  3ASM A;  4BRM A;  4BR5 A;  4Z4G A;  2P9K A;  5AFU A;  2HBJ A;  4GV3 A;  1EXQ A;  4BC2 A;  2G8I A;  1GLB G;  5FLX O;  4XH4 A;  3CHW A;  4BC4 A;  1ZBL A;  4OGE A;  3OW2 M;  2RPI A;  1WSJ A;  5FRM A;  3CI5 A;  2HHW A;  3HSC A;  3HO1 A;  4B1V A;  4GY2 B;  4FZY A;  4J2E A;  3M8R A;  1V4S A;  2PZS A;  2D0O A;  4OPA A;  3DRP A;  1J5O A;  4B9N A;  1U45 A;  4CJU A;  3FR0 A;  4N56 A;  4DTO A;  4CE9 A;  5LL6 Z;  3CCU N;  4DR6 K;  1FXX A;  2BTF A;  2PAV A;  3CPW M;  3OYJ A;  2OA8 A;  2WBN A;  4JI2 K;  3AVB A;  4KPY A;  2DTU A;  1IG9 A;  2IGI A;  3K58 A;  3NMU A;  4IFY A;  5DK5 A;  3SUN A;  3L2Q A;  4FXD A;  2B6A A;  1HKC A;  4CGD A;  5GIN A;  3TI0 A;  1RTD A;  1RDW X;  1RBR A;  1YTA A;  5GAG P;  1DTT A;  3TPQ A;  4JEP A;  1YI2 N;  3HRG A;  2BDP A;  2IOC A;  3RMB A;  4DF4 A;  3VQ7 A;  1BDG A;  2E2O A;  4PL8 A;  5FPN A;  5JIC A;  4CJ4 A;  1T6C A;  4BQZ A;  3AVM A;  2W6L A;  1ASV A;  2ZJP L;  1I3A A;  3ZLJ A;  1TV6 A;  2KFN A;  4H5W A;  4M42 A;  1R59 O;  1WBB A;  3JAM O;  1KVB A;  4JI8 K;  3O1W A;  1ATN A;  1IBK K;  2DY4 A;  3J7Y P;  4BRF A;  4WFB L;  4CZG A;  4BG9 A;  1TYQ A;  1RCH A;  3VER A;  3ID6 A;  4CED A;  3P1G A;  4BRE A;  1UWB A;  3OVN A;  3ZCM A;  4EHT A;  3IDH A;  3O9Q A;  4X62 K;  1KAZ A;  1NNE A;  2ATQ A;  4H03 B;  4DR5 K;  3VQ8 A;  3PLA A;  1HUX A;  1LWC A;  5KGW A;  1G15 A;  2RKI A;  4CJK A;  2A1S A;  2B5J A;  5AQL A;  5AQG A;  2W40 A;  4LY7 A;  3RTV A;  3SJH A;  2IAJ A;  1WAF A;  3C0B A;  4RW4 A;  3J80 O;  4ILH A;  3HM9 A;  4FK2 A;  1TUU A;  4OLB A;  1MA9 B;  4I9L A;  5F2R A;  1ZBS A;  1N6Q A;  1HR0 K;  3AO4 A;  3PY8 A;  1HPM A;  4J2B A;  1JL2 A;  3O9U A;  1QQN A;  3KWG A;  1TK5 A;  1YTU A;  1ATS A;  4H0P A;  2ZQB A;  2P9P B;  4DWI A;  1TKZ A;  1Z26 A;  3N4P A;  3BGR A;  4CZL A;  3K5M A;  2ASO A;  1GLF O;  2I7P A;  2OPS A;  1WN7 A;  4M45 A;  4DTN A;  4JKE A;  3D45 A;  4WQ4 A;  1M90 O;  4M3R A;  3AV9 A;  3AVA A;  3ZSQ A;  1D8Y A;  3CC7 N;  3VQC A;  1QHA A;  2VWJ A;  2GUP A;  5HRN A;  1P8Z A;  2FSJ A;  2FF3 B;  3VET A;  5GAD P;  5M1Q A;  5C2F A;  2WTU A;  4YOY A;  5AQH A;  1UA0 A;  3FE1 A;  4HUG A;  2VG7 A;  4FLT A;  3VF2 A;  4BWJ A;  1N34 K;  4H0Y B;  2HHU A;  1GLL O;  5HLF A;  1K8K B;  4BVO A;  4CD1 A;  2GTD A;  4KHP K;  3GE1 A;  1TK0 A;  4E7I A;  1Q82 O;  5FPM A;  4DS4 A;  4LF9 K;  1X9S A;  3T19 A;  2I7N A;  3CIP A;  2O8E B;  1NK9 A;  3SQ4 A;  4DSE A;  1DTQ A;  4MDB A;  4YHH K;  3QIC A;  3OYH A;  1XQS C;  4FL9 A;  3VN5 A;  5AQS A;  4EP5 A;  3O4Q A;  4DS5 A;  4LF7 K;  3KHY A;  2HMI A;  5IWA K;  3NF9 A;  1NKE A;  4B3S K;  3B6O A;  3B6P A;  4DV6 K;  3RMA A;  1IG8 A;  3ENO A;  3OBY A;  2Y1I A;  4FJJ A;  4O8K A;  1NJX A;  4CGI A;  4YNQ A;  3ZSZ A;  3IS9 A;  1U4B A;  4DSK A;  1RFQ A;  3F5T A;  4GNI A;  3UKU B;  4YY3 K;  4C8O A;  4BC5 A;  3VEO A;  5C42 A;  3L0Q A;  4C8K A;  4LSL A;  3VTH A;  3L8B A;  4OKE A;  3SBT A;  4CGJ A;  3HPG A;  2EWS A;  3H6E A;  4GVE A;  2G8F A;  2AJQ A;  4ZHR A;  3VQE A;  3OS2 A;  1OH5 A;  3VEN A;  3FLC O;  4RW7 A;  2A1R A;  4GVM A;  4PQU A;  4FWM A;  3DLL L;  4JKF A;  4Y1D A;  4K8X A;  4QAG A;  3SQ1 A;  2P9P A;  3EN9 A;  4BR4 A;  1EO1 A;  3MX5 A;  5C2D A;  1FKO A;  1IJJ A;  2UUA K;  1NK0 A;  4PA1 A;  4LF8 K;  4JRQ A;  1D9D A;  2A3Z A;  4PWD A;  2PFU A;  1TGO A;  3A2F A;  3M6G A;  1O13 A;  4DFP A;  4I6M A;  4CF2 A;  3A5L C;  3R1X A;  1SQK A;  2F4V K;  3H1Q A;  2Q0U A;  1IKV A;  4CFD A;  1C0F A;  4IO9 L;  4CJR A;  4CER A;  3O9T A;  3J81 O;  4Z0U A;  4I2P A;  4Q0B A;  3K5N A;  3KLE A;  1KTQ A;  1LW2 A;  2QA4 N;  1VQ6 N;  2V51 B;  4YOX A;  4B9T A;  2O8C B;  1X9M A;  1WSI A;  1X3N A;  1BCM A;  4M3W A;  3PIP L;  3VPZ A;  4JI4 K;  1RT7 A;  3WNE A;  4E19 A;  3H3N O;  4PKI A;  4CF1 A;  3CXC M;  1Z25 A;  2O8E A;  3NHG A;  1OH6 A;  4OO1 J;  1BCO A;  3VA0 A;  4O55 A;  1C0M A;  4H4O A;  2HHX A;  4M3T A;  3P5J A;  1XC9 A;  3KD5 E;  5KRT A;  1EET A;  4KFB A;  3NGY A;  3HVT A;  3FZK A;  4FLZ A;  1QQO A;  4JKD A;  3DWL A;  2FLO A;  3CCS N;  4MO4 A;  3KJV A;  3AVJ A;  3L2R A;  4A61 A;  3OYK A;  5EX5 A;  1HYZ A;  3DRS A;  2F8S A;  1W0H A;  3O08 A;  4OKJ A;  4GV9 A;  4DV2 K;  4CF9 A;  3DLH A;  3FFI A;  4JI0 K;  3JXU A;  4JK8 A;  3W3D A;  4UY8 O;  3HP6 A;  2E2P A;  2QWM A;  4X66 K;  4KRE A;  3MCA B;  1NGF A;  1ZBU A;  4BRI A;  1U2V B;  4JS5 A;  2HF4 A;  2IVP A;  3VF4 A; 
#chains in the Genus database with same CATH homology
 4AQY K;  4LF6 K;  1IBL K;  1XNR K;  4DV5 K;  4DV4 K;  5LL6 Z;  4DR6 K;  2UUA K;  4LF8 K;  1XNQ K;  2UXB K;  4JI2 K;  2HHH K;  2UUC K;  4JI3 K;  2F4V K;  4DR2 K;  4DUZ K;  1FJG K;  4DR1 K;  1N34 K;  2E5L K;  1HNW K;  4B3M K;  4DR7 K;  3OTO K;  1IBM K;  3J81 O;  4CVN E;  5A2Q O;  1J5E K;  1HNZ K;  4KHP K;  3T1Y K;  4GKK K;  4LF9 K;  1HNX K;  1N33 K;  4LFC K;  4NXN K;  2VQF K;  4LFB K;  4JI4 K;  3JAM O;  4JI5 K;  4JI8 K;  1XMQ K;  4YHH K;  4V19 S;  2UUB K;  1IBK K;  5AJ3 K;  4DUY K;  4LF5 K;  1I94 K;  3J7Y P;  5IT9 O;  4DV0 K;  4LFA K;  4JI7 K;  2UXD K;  4LF7 K;  5IWA K;  2VQE K;  5LMN K;  4X65 K;  4X62 K;  4JI1 K;  4B3S K;  4DV6 K;  4DR4 K;  1N36 K;  4DR5 K;  1XMO K;  4LF4 K;  2ZM6 K;  4YY3 K;  3T1H K;  4X64 K;  4DV2 K;  4JI6 K;  2UU9 K;  5FLX O;  4DR3 K;  4B3T K;  4JI0 K;  5BR8 K;  3J80 O;  4B3R K;  3J7A P;  4CW7 B;  4X66 K;  4DV3 K;  4DV1 K;  1HR0 K;  4GKJ K;  4JYA K;  4DV7 K;  4K0K K;  4OX9 K;  4NXM K;  1N32 K;  2UXC K;  4JV5 K;  5LMU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...