3J7YP

Structure of the large ribosomal subunit from human mitochondria
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
138
structure length
133
Chain Sequence
AVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVSASTREWAIKKHNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3j7yP00
1IBKK 2UU9K 2UUCK 4DV3K 4DUYK 4DV2K 2HHHK 4DR2K 4JI7K 4DR3K 4LF9K 4YHHK 4CW7B 5AJ3K 4JI5K 4JI2K 5LMUK 2UXDK 4DR5K 2VQEK 3J7YP 4V19S 4LF5K 4LF7K 1FJGK 1N33K 4GKJK 4X64K 4DR1K 4B3SK 4LF6K 2UUAK 4DR6K 4JV5K 4OX9K 1J5EK 3J7AP 2UXBK 5LL6Z 4LFAK 1I94K 4KHPK 1XNQK 4LF4K 1XMOK 4YY3K 1XNRK 4X62K 1HNWK 1HNXK 4B3RK 2UXCK 1XMQK 4DR4K 1N36K 5A2QO 3JAMO 4DV6K 5FLXO 3T1YK 4B3MK 1IBMK 4CVNE 4LFCK 1HNZK 5IWAK 4DV1K 4NXNK 4AQYK 1IBLK 2UUBK 5IT9O 4GKKK 4LFBK 2E5LK 1HR0K 3T1HK 4B3TK 4JI1K 4JYAK 2VQFK 4LF8K 5BR8K 4X66K 4DV0K 4JI8K 3J81O 4DR7K 1N32K 4DUZK 4JI3K 3OTOK 4JI4K 4JI6K 4NXMK 2ZM6K 5LMNK 4X65K 4DV4K 4DV5K 4JI0K 3J80O 4DV7K 1N34K 2F4VK 4K0KK
chains in the Genus database with same CATH superfamily
3TR8A 1TL1A 3KD5E 1TUUA 2UUCK 3VOVA 1J53A 1YJNN 3VPZA 2IGIA 1JCGA 1IG9A 5TKWA 3QIOA 1D9DA 3UB5A 3SQ2A 4CEBA 3PX0A 3OBYA 2FBTA 1ZBLA 3SK3A 3U9DA 4HUEA 2OPRA 3JS6A 3O9RA 1RTHA 2F7TA 4LD0A 2ITGA 4KH5A 1HNIA 2P9SB 2GEMA 3H08A 4WYBA 1B9DA 4CJQA 3TANA 5J2MA 3RMDA 5EU7A 1OH7A 2YX6A 3ZT2A 4DU1A 3HJFA 4NLBA 4I9LA 3LWLA 3S3NA 3RR8A 1UWBA 5FDLA 5KGWA 3OYMA 1NGAA 3QEXA 1S72N 2FF3B 3PX6A 1NK9A 4JKDA 3O80A 4GVMA 4DLGA 1C0GA 3UKUA 1BISA 3E9LA 4JS4A 1S9EA 5EOYA 4BE2A 1L3UA 4CGGA 3T1YK 1VQ5N 2QA4N 4CFDA 4I2QA 4CVNE 3TSUA 1D5AA 3KLGA 2HBJA 4CJVA 5BRDA 3ULEB 3KKSA 4MLEA 4JHDA 2O8EB 2HF3A 4K25A 1HR0K 3I33A 2GWJA 4EZ9A 4JKGB 2FSKA 3GOIA 1HJOA 4E7HA 1P90A 3PY8A 3I0RA 4N56A 3UIQA 1D4XA 3RRGA 4HWIA 4AH9A 2ZQBA 4DKWA 5AQFA 4KHWA 1IKXA 4M42A 3DRRA 4E1JA 3LPTA 3AO3A 2OPPA 2NLXA 1YITN 1JXEA 5KTQA 4GW6A 1TK8A 4ISFA 4B9SA 2Q0RA 3LZIA 5KPRA 4ILGB 1Q7YO 4E89A 4FCYA 1JLGA 3C7NB 1Q8IA 4WQ4C 3PUFA 1HMVA 3HZ6A 3DLBA 4K41A 4IDHA 2D0BA 3EY1A 1EETA 4F3OA 3CYMA 1U45A 2P9LB 4B1WB 4H5WA 1A5WA 2VWKA 3OYJA 3QINA 4CHZA 2VCPA 3NF6A 3VQAA 2P9KA 3LZJA 4DS4A 3MN7A 3ZX0A 1DEJA 5FRNA 3CCSN 1Q86O 1HUXA 3D2EB 3SAGA 5M1QA 1QZ5A 1KLMA 4CERA 1HYZA 1TKDA 5AQTA 3K5MA 1E4FT 4JD2B 3QLHA 5AQLA 5LL6Z 3IFRA 3NHGA 1BGXT 4YOTA 3A0IX 3GE1A 1I94K 5DM6L 4CZJA 4FWSA 3RMAA 4M41A 4K8XA 1XMQK 3V9WA 1NK6A 4KRFA 2ITMA 3P83D 5C10A 1S1TA 3A2FA 3K5NA 1HPZA 4FZXC 3AA5X 4FJGA 3CFOA 4B1ZA 3MAQA 3L6QA 1X9WA 1EWQA 3EYZA 2GUPA 3QEPA 3HPOA 2D0CA 3DXKA 4BQZA 4B9TA 1ASUA 4JK7A 2O4GA 3MMVA 3MXMA 2FSJA 1CXUA 3VQBA 3ZYYX 4CJRA 1VAZA 4XH5A 2VG5A 4ICLA 1RBVA 4BR2A 3F9MA 3R8EA 2JWLA 1MA9B 3J81O 1GLCG 1NU0A 1HQUA 1SAZA 4DR7K 4DQIA 4O55A 2EHGA 4FLUA 4JI3K 2QWPA 3R3LA 1KVAA 2ZJQL 4KI4A 1G99A 2HHTA 3W0LA 1C0FA 1ILYA 4FPBA 4QS9A 2ZGYA 4Y1DA 4FW1A 1RBTA 1HNWK 3VA3A 4MFBA 5AQKA 3B6PA 3S41A 3DM2A 4GV9A 1BI4A 1T8EA 1VSEA 4CBWA 2HHHK 4AHVA 2OPSA 1NGEA 5FROA 1QVGM 5KGXA 1KTQA 1FKPA 3C94A 2BUPA 1FXXA 3SJJA 4JKBA 3AVFA 4FWKA 5LMUK 1TGOA 2P9NA 4YORA 4F3TA 3NF8A 3OBWA 1WSJA 1ATRA 2V7YA 4IDKA 4BRDA 4KKOA 3WNGA 3SV3A 2FC0A 4LH5A 3ENBA 3L4QA 1T05A 2NRTA 3ZLJA 3L4IA 3L0QA 1KFSA 3QB0A 3THXA 1YJ9N 4CZKA 1MU2A 3DWLA 3LPUA 4JK9A 1JCEA 1QS4A 1BDGA 2FXUA 2GWKA 3QNOA 3LDNA 1QSSA 5F1XA 5AZJB 3EKUA 4Z4FA 3MEDA 1VHXA 1BCMA 3IS9A 4BRQA 4R5PA 3AV9A 3NGZA 3V6DA 1QQNA 1F21A 2UXCK 2DFEA 3TSQA 3HP6A 5BREA 4H0YB 1NGCA 4C8NA 1OKJA 2KZMA 1N5YA 3NF7A 4BG8A 3ZSWA 4YFUA 4HTUA 4E1MA 2O4IA 4RW4A 1HNZK 3AO5A 2OPQA 4FM1A 3CCVN 1VSLA 3LP0A 3LALA 1NK5A 3NVKA 4B9NA 2G8VA 1I3AA 5EX5A 3ZSRA 5AQSA 4OGEA 3CJAA 2GX9A 3UKRB 5BR8K 3D6RA 1BO5O 3PIPL 3Q7CA 2DY4A 4LY7A 3DLLL 1ZXOA 1KAXA 3ZT4A 2CGJA 4G9ZA 4E7KA 3I0SA 4BR0A 4YDUA 2E6LA 4KHYA 4N5SA 4JRPA 2I7PA 3ISNC 5LMNK 1NG9A 2O8DB 2E20A 4PY5A 3HOTA 3BZKA 2E6MA 3ZSZA 3E01A 4FJNA 3H3NO 3NCIA 2KTQA 1U2VA 5M1OA 3VQDA 4FJXA 4E7LA 4H0VB 4NCAA 1HJRA 4Z94A 4JI7K 3EO3A 3R9PA 3LM2A 3SAFA 2V7ZA 3M1FA 3A5MC 2IAJA 2NRWA 4F8RA 3O3FA 1DT9A 5AFUA 5I42A 1J5OA 3O9SA 4FWNA 5CHIA 2VQEK 1K8KB 3JSMA 1TKZA 4F4KA 1S9GA 4M3YA 2HHVA 3SBTA 3EE8A 3TTCA 4IFVA 4LF6K 2AA4A 4CZMA 1RCHA 3MCPA 4C8KA 1NGIA 4DSJA 3AO4A 3FFKB 4KB1A 5AQYA 1EKEA 4RCHA 4BGBA 3HI0A 3V81A 1TAUA 1O1WA 4BR5A 4BC5A 3CMEN 3FR0A 1XMOK 2D0AA 3LAMA 3IG1A 3AVMA 4CK3A 5CY4A 4KTWA 1K73O 5I9EB 3NH0A 1SZ2A 3VETA 2NUBA 2HHWA 3CQXA 1JLFA 1E4GT 3HYFA 3P1GA 4BE0A 4KHNA 2W42A 2J4RA 1KD1O 2Q36A 3VESA 1YUWA 4IOXA 4H4MA 2VWJA 1LCUA 1Q82O 1L3SA 4CJ5A 2W41A 4J8FA 4JK8A 4X66K 2A42A 4DTNA 1K8AO 4BACA 3QMLA 4GV6A 2IVOA 4OPAA 4FJJA 4CK1A 5AZIB 2YNGA 4ID1A 4DSLA 2HVHA 2ZWHA 3KTQA 3KK1A 4C8OA 3V9SA 4BY9C 4CHNA 4Z4GA 1N34K 1WB9A 2P9UA 4E7JA 3WT0A 3U3YA 4B8CA 3MX2A 3P31A 4W5QA 2UU9K 1C1CA 1NGJA 4Z4EA 3AARA 3CC4N 1NBWA 2ZF5O 2QKKA 1RDWX 5JVGL 1GLAG 4PL7A 2HF4A 3WNEA 1Q9XA 4WQ5A 5F2RA 1BG3A 2XY8A 2WTUA 2P51A 4MDAA 3AAPA 4H0TB 5ADXH 3EEQA 4MO4A 4JNEA 4Z4IA 4O5FA 4N41A 3DI6A 3KK3A 4GKJK 4F9OA 1RT3A 3NMUA 4JKCA 5AQNA 3CG7A 3L2RA 4DG1A 1X3MA 1ZYQA 1C1AA 1W9HA 1X3NA 4I6MA 4BRHA 1S5JA 4IKFA 1QQCA 3K5OA 5JMVA 5AQIA 3VQEA 4DQSA 2PZSA 1C0MA 3VEVA 2IDOA 3L3VA 2KKZA 3QESA 1YVNA 3KJVA 2P5OA 3T3FA 2HHQA 4DV6K 2X78A 3NE6A 4B3MK 1X9JA 3K58A 3C6HA 1NMNA 3OS1A 1FKOA 4DU3A 3DAWA 4JS5A 3OS0A 4CGDA 4FK2A 2FLOA 2FSNA 4CF2A 4L3QA 2ATQA 1RILA 3BY5A 3DXMA 2E88A 3L3UA 3OS2A 1KCFA 2I5JA 3ZT1A 2KQ2A 2VWBA 4CZIA 4C8MA 2O8CA 4OKEA 4JI8K 2QWOA 4LSLA 3TAEA 1XWLA 1U47A 1NJIO 4DQQA 2VG6A 4YOXA 1NKEA 2GTDA 4NYFA 1DTQA 2HNYA 3E9PA 1ZC6A 3QEIA 3ZSYA 4M3TA 2I7NA 1HLUA 4DV4K 4FJHA 4DLEA 5CR4A 3EZ5A 4BWMA 4XH4A 1CZ9A 3VQ4A 4BC3A 4IOCL 3K0SA 4XEIA 3KWIA 3HM9A 4NB4A 2HMPA 5KQ8A 3D0PA 4FK0A 5AQJA 1ZBUA 3GL1A 4Q5VA 1WBBA 1TL3A 4CHPA 4FK4A 4B9LA 3HVTA 4EP4A 2BGGA 3EKSA 4V19S 3IMXA 5CZ2A 3BDPA 3SBGA 3QFUA 3G4SN 3M3ZA 3SPZA 3THWB 1EX4A 2ZGZA 4DTOA 1T6DA 2W40A 3OYLA 1SS6A 3SUPA 3HK2A 3AVLA 5GIOA 5HOOA 3IUCA 1J5EK 1S1UA 4AHCA 4DTPA 1OH5A 3KKRA 3CPWM 2YHBA 3VEWA 2JGUA 4WFAL 3CMAN 3P38A 4IFYA 3A5LC 4CF1A 4DTSA 3QEWA 4B3RK 1EXQA 1I39A 1LWCA 3MK6A 4DSKA 4CEQA 2FBYA 2XO7A 4BROA 1CZBA 4C1NI 2AP1A 3VF2A 5EXWA 4CFAA 1RT4A 4KHQA 2BTFA 4J2EA 4DMNA 2QEXN 3L2QA 3CCMN 2WBNA 1L3TA 2XRIA 2YJFA 1SKRA 1ZBFA 2NRXA 1WNSA 4C1NK 2A41A 3AVKA 4BVPA 3D7EO 1JXBA 1VRTA 4CE9A 4CEDA 5HRPA 2FBVA 1M1KO 4BRAA 4W5OA 1N8RO 1IO2A 1CZAN 2O8BA 3ZSOA 3CJ1A 4F2SA 1GOBA 1YT3A 3PO5A 3MX5A 3FZLA 4EZ6A 4KBOA 4DWIA 4JAXA 2F4VK 2XY5A 2HBKA 1MWMA 2G8KA 4KH4A 2PYJA 1KQSM 5J1EA 3PV8A 4H0PA 3ITHA 4EP5A 4CJEA 4DV2K 3MXIA 2UYTA 4CBUA 1XUPO 4IO9L 1BCOA 4FM2A 3V9UA 3BF3A 4MO5A 4BRIA 4JI5K 2PYLA 5KPZA 4Z4HA 4H5RA 3PLAA 4IG0A 1GLJO 4IG3A 3J7YP 1SKSA 2D1KA 4J2DA 1FJGK 2O8FB 4QAGA 3O3HA 3H6EA 2OTJN 3G25A 5KPTA 1HKCA 5SWMA 4DSEA 3ZETB 4PQUA 3O6WA 1S1VA 3V9XA 1FK9A 4A59A 4DFKA 4EFHA 4BE1A 1WSEA 4FVMA 3OYEA 3F5TA 4H03B 4YY3K 5AQXA 1XNRK 4A5AA 1Z26A 4OO1J 2QXFA 4IBNA 4BVOA 4FLZA 2DFHA 5JICA 4DTXA 5CE3A 1L5UA 3DJCA 3O08A 3V9ZA 1SV5A 3D2FB 4FW2A 4K8ZA 4FO0A 1TYQA 3C6UA 4CZHA 4U67L 4DFPA 1SQKA 2P9PA 1K9MO 3TAFA 3CCJN 1UAXA 1XHXA 1NGGA 3V1OA 4LF8K 3I56N 1OVYA 5FRMA 3QBWA 3I8DA 4FJ8A 4BREA 5BN9A 4C23A 1RBUA 2RN2A 1VQKN 3AA2A 3DRPA 4CIFA 3A5OC 3THYB 5AQOA 5AQRA 5BRHA 3WQUA 3OTOK 1E3MA 3VQ6A 2Z1GA 4DV5K 4FJ5A 3J8AA 3NH2A 2RE2A 4I9QA 4EHUA 5KQDA 4CJLA 4XH1A 2E8AA 3NGIA 4IXCA 5MLCQ 4FJMA 4EAHD 4FOIA 3KK7A 5D3GA 2QI2A 3HT3A 1Q81O 2XHBA 2YNIA 4OKKA 2UXDK 3FZFA 3VENA 4FL9A 3VQQA 3CF5L 3HSTB 1BQNA 4H5VA 3CCRN 2HHUA 3H1VX 1REVA 1XI1A 4NCGA 4WQ4A 4CEAA 2ZJRL 2QXLA 3RSEB 4B3OA 1S6PA 1WSGA 2D4WA 4GMJB 4IEIA 4B08A 3A8YA 4PL8A 1KSPA 4A2AA 4FSVA 4MQ3A 4KHUA 5AQQA 4DSFA 5GAEP 1YIJN 2ZE2A 2F8SA 4CECA 1EP4A 1Y64A 4YDUC 5CYMA 3OYFA 4DF4A 3SUOA 3A5NC 4FWMA 1T6CA 4HTLA 4CHQA 4CJ4A 4J2AA 2PBDA 2YV0X 3ZEUA 4K42A 4FYDA 1S1XA 1HPMA 1KVBA 4M7XA 3K57A 3WNFA 3DLEA 2F9TA 1EQYA 3AO2A 4BRNA 2WONA 3GBTA 4DB3A 4AQYK 2KFZA 1IBLK 3N4PA 1C1BA 2HVIA 3AVIA 3Q7BA 3T1HK 2P9IA 2DTUA 1RT2A 4BG9A 3TAPA 3WXLA 2Q0UA 3JYTA 4W5NA 2VQFK 3P4IA 1V4TA 2HW3A 4RW6A 1BUPA 3LDSA 5JS1A 3WQTA 5BN8A 4MLHA 5K14A 1UA1A 1OVQA 3KD1E 1JLQA 3F2KA 3CM6A 4R79A 1U48A 4CEEA 4ELUA 4A62A 1DLOA 4B1XB 2OA8A 4M3ZA 2FF6A 4H0OA 3S3MA 3FZHA 3UKUB 3CQ8A 3P39A 3VF4A 3FZMA 4DV7K 5M1KA 3SQ4A 3LP3A 3OYDA 3ZCMA 3TTFA 3ALYA 1NK4A 5E84A 1ATNA 3O1BA 4DR2K 1GLEG 4LF9K 3SQ1A 3PSFA 3QERA 4RW8A 4KHSA 2VGMA 4JHDB 4IOAL 4CF0A 4WFNL 1NJWA 3BGRA 4YOUA 3WEEA 3VMFB 3FLCO 3M8RA 2RF2A 3WXMB 1HQEA 1YF5L 3CJ7A 3CQYA 2QM1A 1VQON 4AILC 1MWKA 4DSIA 4B9VA 3TARA 3V1QA 1SUQA 3J7AP 4Y0WA 5C2DA 1RDBA 1O13A 2E1ZA 1VQ8N 4CK2A 1TV6A 3WNHA 5HBMA 4WF9L 5DK5A 4FWQA 2HB5A 1NMDA 3OJSA 1LWFA 3EL2A 5BPMA 1IKWA 3SNNA 3S3OA 1WSFA 1C6VA 3K2PA 5HRNA 4IO8A 3CJBA 1M90O 4XIUA 3M5RA 3L2VA 3H3OB 3ZX3A 1GOAA 2RPIA 5SZTA 4GKKK 2KFNA 2P9KB 4WQ5C 5M1NA 4B3TK 1GLLO 4C8LA 1IH7A 1NK0A 2DPNA 3DMJA 5FPDA 5HP1A 4PUOA 3ATVA 3AVHA 3ENHA 3G0ZA 3W3DA 4W5TA 1CLQA 2F8TA 4JKEA 4ELVA 1LW0A 2P9SA 3MN9A 3S9HA 2OTLN 1NLVA 2XY6A 1NGHA 3BF1A 1JLEA 1NKCA 3IDHA 4DUZK 4CGJA 1ASVA 3DLKA 4BDYA 3AA4A 4G1QA 2QKBA 3C65A 2CGLA 4X65K 2E2PA 4YOVA 3DYAA 4B1UB 3G71N 3L8BA 4JI0K 4KTQA 1WSHA 1UOCA 1B92A 3F73A 3CFPA 2Z1JA 3MCAB 1JLAA 4DF8A 4BQLA 2NZTA 3DXKB 4FWLA 4DQPA 2X6NA 3ULEA 4JKFA 3ENOA 1NM1A 4LF5K 2YHAA 3VN5A 4GV3A 2DFFA 4JRQA 5AQPA 2EWSA 3OYAA 4JKGA 1VRUA 3TPQA 4B1YB 3VQ7A 3ZSVA 5HLFA 4B3SK 2NRZA 4M45A 3SAHA 3TU5A 3IKMA 2JWKA 3OHRA 3V4IA 4AM7A 1TK0A 4KV8A 4H4OA 1JCFA 3E66A 4OVLA 3SV4A 3AY9A 3NFAA 4NLCA 1VSFA 2ASPA 3T69A 1VK0A 1C0UA 4N47A 4PHTX 2B4JA 2A1SA 4X62K 5LJWA 1YHQN 1R0AA 1BI4B 1N36K 3RTVA 2W6LA 2A3ZA 4I7FA 5FLXO 2HHXA 4MDBA 4BGAA 1HX1A 1GLBG 1T3VA 2OCEA 4HVJA 4N76A 2OZSA 4H5NA 1RNHA 4BDZA 4FPAA 3OW2M 4KREA 2P9NB 3C7NA 2YNFA 3HRGA 3VEYA 2YHXA 2WUSA 2UUBK 4CGFA 3BP8A 1S22A 3U6FA 1Q18A 1VQ9N 2P9LA 2PFUA 1RT6A 1WAJA 4FM0A 2RHKA 5I3UA 1VSDA 4LSNA 3DOKA 3THXB 4CJKA 3EZWA 3MWTA 1VQ4N 2YKMA 2LSNA 4FZZA 2PAVA 3NH1A 3D2EA 4EIAA 3O4WA 4DQ8A 4NXMK 2B5JA 4BRKA 2ZM6K 5BR9A 4JD2A 2ASMA 4CJ7A 4OPKA 1D8YA 1NGBA 1Z05A 2W6KA 3K9JA 2P1JA 5AQMA 1W97L 5JLHA 4BRLA 2IIRA 2HMIA 3ZSQA 5AQHA 4CZGA 5J2QA 2H3GX 1NKBA 1JL2A 3OYBA 3NAEA 1P8ZA 4DTRA 4YHHK 4CBXA 3RVCA 3SUNA 3TTDA 4I2PA 4KTZA 5HRRA 3VGLA 3KLFA 1VQNN 4AHTA 4DCHA 4IEEA 1HYVA 4BRCA 4YOWA 4UY8O 1TAQA 5BPNA 2B6AA 2QTDA 4RW9A 3CPEA 2FBXA 1BQMA 4ZHRA 2D0OA 4ID5A 2GBZA 3NDKA 3VQ5A 5LJVA 4LFAK 3O4QA 2ETJA 4KHPK 1ZBIA 4KH6A 1KAYA 1U2VB 5AQZA 5ADXA 3AGKA 3SPYA 4DR4K 1JLBA 3I55N 5DMRA 1BIZA 2AJQA 2CGKA 2Z1IA 3JXUA 3LDQA 4BRFA 1N6QA 2X74A 3SZ2A 2ZD1A 4DFJA 3C0BA 5IWAK 2HSTA 3ATUA 3QICA 1QZ6A 4KO0A 4WFBL 2NRRA 3PX4A 4FJKA 4ZTJA 2HHSA 1UA0A 3VEZA 4CJSA 3O9UA 1YAGA 4AF1A 2RKIA 4O44A 5GINA 3WXKA 4E19A 4Q0BA 4LC9B 3BZCA 4JKAA 2GUIA 4JKHA 3N4QA 5DM7L 4M63C 3U8XA 1QVFM 4NCBA 4HUGA 1QHAA 4FLXA 2E2NA 3NVMA 3V1RA 2GELA 2V52B 3OY9A 3LWMA 4L8RB 1U6ZA 3O1WA 5AZJA 5H1SQ 3ULDA 3L2UA 2ZJPL 3AVNA 1LOTB 5HRSA 1WBDA 1BOTO 3RR7A 4KI6A 3E9OA 3PSIA 4M3RA 3SMPA 3AVGA 4EHTA 4DUYK 2G8IA 1BL3A 1NJXA 1NK7A 1BWFO 3FFIA 4O4GA 4YOYA 2D0PA 1S6QA 5E26A 4BDPA 1DTTA 4ISEA 4DR5K 3RRHA 1H1VA 2KZZA 5FPEA 4CD1A 3QEVA 1RBRA 4FXDA 5HROA 2IVNA 4DR1K 1NGDA 3ZT0A 3QDKA 3UKRA 3BUZB 4PWDA 3CIPA 4OGCA 4ILJA 5GADP 2QWQA 4U7BA 4OX9K 2CH6A 3DRSA 1XC9A 4OLAA 4CF8A 3CETA 2P9UB 3M6GA 4OKJA 4CZLA 3CCQN 3MECA 2IC3A 3CCUN 5AR0A 2O8DA 1LAWA 2Q3SA 3OVNA 4NO7A 3RMBA 4CI6A 3HBTA 3JAMO 3E1YA 4AHSA 4E1NA 1NJZA 4CESA 5KI6A 3IAYA 1W2BM 1MDUB 1IBMK 1BU6O 1SKWA 1W0HA 3CERA 3HPGA 1RDCA 5FPNA 4Z0UA 4FOEA 4CEOA 3SCXA 3LL3A 4LFBK 4ZTFA 4A2BA 4BRPA 4CJTA 1T44A 5JS2A 2OZMA 4FWPA 3VTHA 5B8HA 4HUFA 2QWNA 3VQ9A 2HNDA 4JYAK 2HBMA 4WE1A 1K8KA 1IG8A 3TAMA 2CH5A 3FGUA 1QQMA 1WOQA 4I6MB 1KFDA 5C24A 3KLEA 3SI6A 3D45A 4CFCA 2Y1IA 4RG8A 1VQLN 3VTIA 2BANA 4FWRA 2BH1A 3ID6A 3B6OA 2YKNA 3OYCA 3WXJA 1QSYA 1J9AA 1A5VA 1NGFA 4HHTA 1S1WA 3SYZA 2A1RA 4J2BA 2E2OA 1EO1A 1NJYA 1WSIA 1KAZA 3FZKA 1IBKK 3SQ0A 1FW6A 5F0XA 3HM8A 4K43A 3I8BA 5E41A 1TK5A 1ASWA 5AJ3K 1Q9YA 3KVGA 3SJHA 3HXMA 1QHTA 2E1YA 3DXMB 3C95A 3AVJA 2GV9A 4DTUA 1YTAA 2G8FA 2JLEA 4H0XB 2A5XA 3SMSA 3T19A 1ZBSA 4M3WA 5LY3A 4BRGA 4BR4A 2XY7A 2E2QA 2O8CB 4CCHA 3QBXA 2UUAK 3AGRA 1TKXA 4DR6K 4RTFD 4O0IA 3DLHA 2QWMA 3CCLN 1RDUA 3RWUA 3AVBA 1R59O 1L3VA 5AZIA 4LF4K 2BE2A 3QETA 5EY4A 3VA0A 4DU4A 3OA9A 2Y1JA 3DLRA 4FJ7A 5FPMA 3QO9A 4DQRA 3SUQA 3R1XA 2OYQA 2WC9A 3HL8A 5CZ1A 2V51B 4CF9A 3K59A 3DOLA 3U3GA 4LFCK 4DV1K 3KLIA 2F96A 1K6YA 4BC2A 1T03A 4B9MA 4Y1CA 1YJWN 1VQMN 2E5LK 1QE1A 5AQVA 4OJRA 4PKIA 1CXQA 3ZT3A 1RTJA 1RBSA 1GLDG 2F9WA 3M8QA 1RT5A 5C42A 3VGMA 1IKVA 3MDQA 1SL0A 3H46O 5HL7L 4KB0A 1J6ZA 5GIPA 4IJNA 4DV0K 3LM9A 1VSMA 3U9ZA 4O8KA 2G8UA 1VSIA 4JI4K 2G8WA 4JI6K 5AFUH 4OPJA 1VSJA 4AM6A 1VQPN 3QNNA 1GLFO 4FLWA 1JL1A 2Q2RA 3O9TA 1YI2N 4PKHA 5JVHL 3NGYA 3LAKA 4BWJA 1JLCA 1J54A 3DLGA 1SL1A 1WUAA 4KPYA 4CGIA 1HKBA 3CC2N 1IJJA 2YJEA 5M1FA 3GDQA 1JKHA 4WCEL 4PA1A 1RT1A 4FWOA 4Z4CA 5AQUA 4IWVA 4FJ9A 4OPHA 3MWPA 3VERA 4FJLA 3C6AA 4KAZA 2Q1NA 3CD6N 1ZBHA 3M8PA 3H1QA 3UE5A 4B8AB 3KZBA 3CFRA 5TKYA 4DTJA 3VEOA 2ASOA 4H8KA 4CJFA 1HNVA 4ISGA 2O8BB 3SLCA 3LDOA 3BEXA 2KLAA 4FLVA 3AAQA 3EN9A 1XNQK 4CJUA 1T7PA 4QCLA 3VQCA 4OLBA 4AHUA 4JEPA 3AVCA 1RTDA 1KLNA 3CXCM 3MXJA 3TAGA 2QWLA 3CHWA 3OJUA 3WXIA 4M3UA 1X1PA 3LDPA 2A40A 2YHYA 1KRPA 4F2RA 1XC3A 4ELTA 1TUYA 1RGIA 4CZFA 3L2WA 1HKGA 4TSXA 3LP2A 5KRTA 3O5BA 1YXQA 1IKYA 3HOSA 5IT9O 4BRMA 1NWKA 2YCHA 1WLJA 1U49A 3ZX2A 3GG4A 3LDLA 2NNWA 4JI1K 3OYNA 1U4BA 1KVCA 4JN4A 1Z6RA 4RWTA 4CZEA 3THVA 5J2NA 3B8AX 1ITGA 3THWA 1D9FA 3C6TA 1U04A 1G15A 4M7YA 4O0JA 3OYIA 4PKGA 4DTMA 3KWGA 4RW7A 5C15A 4E0DA 4CEZA 1BA0A 5J2PA 5GAGP 4CHOA 2HOEA 2P5GA 2OANA 3CC7N 4JLHA 3K9KA 4DV3K 3NBPA 1A5XA 4CHYA 4GY2B 1X9SA 5BRFA 1BHLA 1TYQB 1RTIA 4DR3K 3EE9A 4CFBA 2IVPA 2YHWA 4JI2K 3KLHA 2P9PB 1NK8A 3ASMA 3VQ8A 4E7IA 2QK9A 1NOZA 4CJPA 3HVRA 1N33K 1GOCA 3OYKA 1YTUA 3MN6A 4FLTA 1B9FA 2VG7A 3HO1A 4IJAA 3K5LA 4FVUA 1VQ7N 3CJ9A 4LH4A 2D5RA 3VGKA 3ID8A 2YI1A 1KC8O 4DS5A 3NF9A 4M3XA 2IOCA 1KXPA 1RDAA 3P5JA 5EVZA 3PO4A 2O8EA 2IS3A 3TAQA 2HNZA 2QW9A 4W5RA 3WUHA 4A57A 4B9UA 4O5BA 4B9QA 3AVAA 2WOMA 1LV5A 5M1PA 2YNHA 5BPLA 3F9KA 1RFQA 1DGKN 3CM5A 4QOZB 4H5TA 2R7YA 4GNIA 3T7ZA 1ESVA 3R6MA 2Q97A 5CYQA 3KHYA 1VQ6N 3U4LA 4YNQA 4O8UA 1OH6A 2O8FA 1W7AA 3IRXA 2NRVA 4CJ3A 3AA3A 5C12A 4CIGA 3ZETA 1Y97A 2A6AA 3J7ZO 2HBLA 3QFPA 5AQWA 4QS7A 1LW2A 5KRSA 1V4SA 4CEFA 3VQPA 1JJ2M 4FLYA 4ILHA 1OH8A 3LP1A 3OYHA 4KFBA 3PIOL 4K0KK 3O8MA 3J80O 2KHOA 4FJIA 3ZEUB 3HP9A 4CGHA 2X6SA 4FZYA 3CJCA 3HPHA 3LANA 2PY5A 5C25A 4HCBA 1NOYA 4CIEA 3G6EN 1S3XA 4IFEA 4CW7B 3MN5A 5C0YA 3D2FA 4NYNA 2P9IB 2Q31A 3MEEA 4QS8A 1TVRA 3G10A 1LWEA 3TWHA 4LF7K 1VSHA 1XQSC 2BDPA 4E3SA 3M8SA 5GAHP 3RMCA 3FE1A 4X64K 1WAFA 5ELZA 1HRHA 1YVUA 1DKGD 3VEXA 1HYSA 1RDDA 1ATSA 4B1VA 4JV5K 5T7BA 1QSLA 4DFMA 4A5BA 3HTVA 2UXBK 5AQGA 3THYA 3AO1A 3T1AA 5C2FA 1TKTA 3VF6A 3O3GA 1LAVA 2KW4A 3TABA 1X9MA 5JLFA 2E4LA 1HNXK 1NNEA 4CJWA 3TI0A 2EX3A 5A2QO 2VYPA 1Z25A 2Z1HA 3TSPA 3ZSXA 3HSCA 1QQOA 4NXNK 3CI5A 2NRHA 2G8HA 4BC4A 3WEEB 4AHRA 3O4NA 4HCCA 2VGNA 1WN7A 3KIOA 1RT7A 4BR7A 1SL2A 1C0TA 1EWRA 1QTMA 4CD3A 4DHYA 3KK2A 1VSKA 3OYGA 3O9QA 1XHZA 4UQGA 3CCEN 3MEGA 4GVEA 3RSEA 1N32K 4BR9A 3QIPA 4A61A 1BIUA 4IZ9A 2QWRA 1IV0A 2WFBA 1BA1A 3H45C
chains in the Genus database with same CATH topology
1IBKK 2UU9K 2UUCK 4DV3K 4DUYK 4DV2K 2HHHK 4DR2K 4JI7K 4DR3K 4LF9K 4YHHK 4CW7B 5AJ3K 4JI5K 4JI2K 5LMUK 2UXDK 4DR5K 2VQEK 3J7YP 4V19S 4LF5K 4LF7K 1FJGK 1N33K 4GKJK 4X64K 4DR1K 4B3SK 4LF6K 2UUAK 4DR6K 4JV5K 4OX9K 1J5EK 3J7AP 2UXBK 5LL6Z 4LFAK 1I94K 4KHPK 1XNQK 4LF4K 1XMOK 4YY3K 1XNRK 4X62K 1HNWK 1HNXK 4B3RK 2UXCK 1XMQK 4DR4K 1N36K 5A2QO 3JAMO 4DV6K 5FLXO 3T1YK 4B3MK 1IBMK 4CVNE 4LFCK 1HNZK 5IWAK 4DV1K 4NXNK 4AQYK 1IBLK 2UUBK 5IT9O 4GKKK 4LFBK 2E5LK 1HR0K 3T1HK 4B3TK 4JI1K 4JYAK 2VQFK 4LF8K 5BR8K 4X66K 4DV0K 4JI8K 3J81O 4DR7K 1N32K 4DUZK 4JI3K 3OTOK 4JI4K 4JI6K 4NXMK 2ZM6K 5LMNK 4X65K 4DV4K 4DV5K 4JI0K 3J80O 4DV7K 1N34K 2F4VK 4K0KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK K;  2UU9 K;  2UUC K;  4DV3 K;  4DUY K;  4DV2 K;  2HHH K;  4DR2 K;  4JI7 K;  4DR3 K;  4LF9 K;  4YHH K;  4CW7 B;  5AJ3 K;  4JI5 K;  4JI2 K;  5LMU K;  2UXD K;  4DR5 K;  2VQE K;  3J7Y P;  4V19 S;  4LF5 K;  4LF7 K;  1FJG K;  1N33 K;  4GKJ K;  4X64 K;  4DR1 K;  4B3S K;  4LF6 K;  2UUA K;  4DR6 K;  4JV5 K;  4OX9 K;  1J5E K;  3J7A P;  2UXB K;  5LL6 Z;  4LFA K;  1I94 K;  4KHP K;  1XNQ K;  4LF4 K;  1XMO K;  4YY3 K;  1XNR K;  4X62 K;  1HNW K;  1HNX K;  4B3R K;  2UXC K;  1XMQ K;  4DR4 K;  1N36 K;  5A2Q O;  3JAM O;  4DV6 K;  5FLX O;  3T1Y K;  4B3M K;  1IBM K;  4CVN E;  4LFC K;  1HNZ K;  5IWA K;  4DV1 K;  4NXN K;  4AQY K;  1IBL K;  2UUB K;  5IT9 O;  4GKK K;  4LFB K;  2E5L K;  1HR0 K;  3T1H K;  4B3T K;  4JI1 K;  4JYA K;  2VQF K;  4LF8 K;  5BR8 K;  4X66 K;  4DV0 K;  4JI8 K;  3J81 O;  4DR7 K;  1N32 K;  4DUZ K;  4JI3 K;  3OTO K;  4JI4 K;  4JI6 K;  4NXM K;  2ZM6 K;  5LMN K;  4X65 K;  4DV4 K;  4DV5 K;  4JI0 K;  3J80 O;  4DV7 K;  1N34 K;  2F4V K;  4K0K K; 
#chains in the Genus database with same CATH topology
 3TR8 A;  1TL1 A;  3KD5 E;  1TUU A;  2UUC K;  3VOV A;  1J53 A;  1YJN N;  3VPZ A;  2IGI A;  1JCG A;  1IG9 A;  5TKW A;  3QIO A;  1D9D A;  3UB5 A;  3SQ2 A;  4CEB A;  3PX0 A;  3OBY A;  2FBT A;  1ZBL A;  3SK3 A;  3U9D A;  4HUE A;  2OPR A;  3JS6 A;  3O9R A;  1RTH A;  2F7T A;  4LD0 A;  2ITG A;  4KH5 A;  1HNI A;  2P9S B;  2GEM A;  3H08 A;  4WYB A;  1B9D A;  4CJQ A;  3TAN A;  5J2M A;  3RMD A;  5EU7 A;  1OH7 A;  2YX6 A;  3ZT2 A;  4DU1 A;  3HJF A;  4NLB A;  4I9L A;  3LWL A;  3S3N A;  3RR8 A;  1UWB A;  5FDL A;  5KGW A;  3OYM A;  1NGA A;  3QEX A;  1S72 N;  2FF3 B;  3PX6 A;  1NK9 A;  4JKD A;  3O80 A;  4GVM A;  4DLG A;  1C0G A;  3UKU A;  1BIS A;  3E9L A;  4JS4 A;  1S9E A;  5EOY A;  4BE2 A;  1L3U A;  4CGG A;  3T1Y K;  1VQ5 N;  2QA4 N;  4CFD A;  4I2Q A;  4CVN E;  3TSU A;  1D5A A;  3KLG A;  2HBJ A;  4CJV A;  5BRD A;  3ULE B;  3KKS A;  4MLE A;  4JHD A;  2O8E B;  2HF3 A;  4K25 A;  1HR0 K;  3I33 A;  2GWJ A;  4EZ9 A;  4JKG B;  2FSK A;  3GOI A;  1HJO A;  4E7H A;  1P90 A;  3PY8 A;  3I0R A;  4N56 A;  3UIQ A;  1D4X A;  3RRG A;  4HWI A;  4AH9 A;  2ZQB A;  4DKW A;  5AQF A;  4KHW A;  1IKX A;  4M42 A;  3DRR A;  4E1J A;  3LPT A;  3AO3 A;  2OPP A;  2NLX A;  1YIT N;  1JXE A;  5KTQ A;  4GW6 A;  1TK8 A;  4ISF A;  4B9S A;  2Q0R A;  3LZI A;  5KPR A;  4ILG B;  1Q7Y O;  4E89 A;  4FCY A;  1JLG A;  3C7N B;  1Q8I A;  4WQ4 C;  3PUF A;  1HMV A;  3HZ6 A;  3DLB A;  4K41 A;  4IDH A;  2D0B A;  3EY1 A;  1EET A;  4F3O A;  3CYM A;  1U45 A;  2P9L B;  4B1W B;  4H5W A;  1A5W A;  2VWK A;  3OYJ A;  3QIN A;  4CHZ A;  2VCP A;  3NF6 A;  3VQA A;  2P9K A;  3LZJ A;  4DS4 A;  3MN7 A;  3ZX0 A;  1DEJ A;  5FRN A;  3CCS N;  1Q86 O;  1HUX A;  3D2E B;  3SAG A;  5M1Q A;  1QZ5 A;  1KLM A;  4CER A;  1HYZ A;  1TKD A;  5AQT A;  3K5M A;  1E4F T;  4JD2 B;  3QLH A;  5AQL A;  5LL6 Z;  3IFR A;  3NHG A;  1BGX T;  4YOT A;  3A0I X;  3GE1 A;  1I94 K;  5DM6 L;  4CZJ A;  4FWS A;  3RMA A;  4M41 A;  4K8X A;  1XMQ K;  3V9W A;  1NK6 A;  4KRF A;  2ITM A;  3P83 D;  5C10 A;  1S1T A;  3A2F A;  3K5N A;  1HPZ A;  4FZX C;  3AA5 X;  4FJG A;  3CFO A;  4B1Z A;  3MAQ A;  3L6Q A;  1X9W A;  1EWQ A;  3EYZ A;  2GUP A;  3QEP A;  3HPO A;  2D0C A;  3DXK A;  4BQZ A;  4B9T A;  1ASU A;  4JK7 A;  2O4G A;  3MMV A;  3MXM A;  2FSJ A;  1CXU A;  3VQB A;  3ZYY X;  4CJR A;  1VAZ A;  4XH5 A;  2VG5 A;  4ICL A;  1RBV A;  4BR2 A;  3F9M A;  3R8E A;  2JWL A;  1MA9 B;  3J81 O;  1GLC G;  1NU0 A;  1HQU A;  1SAZ A;  4DR7 K;  4DQI A;  4O55 A;  2EHG A;  4FLU A;  4JI3 K;  2QWP A;  3R3L A;  1KVA A;  2ZJQ L;  4KI4 A;  1G99 A;  2HHT A;  3W0L A;  1C0F A;  1ILY A;  4FPB A;  4QS9 A;  2ZGY A;  4Y1D A;  4FW1 A;  1RBT A;  1HNW K;  3VA3 A;  4MFB A;  5AQK A;  3B6P A;  3S41 A;  3DM2 A;  4GV9 A;  1BI4 A;  1T8E A;  1VSE A;  4CBW A;  2HHH K;  4AHV A;  2OPS A;  1NGE A;  5FRO A;  1QVG M;  5KGX A;  1KTQ A;  1FKP A;  3C94 A;  2BUP A;  1FXX A;  3SJJ A;  4JKB A;  3AVF A;  4FWK A;  5LMU K;  1TGO A;  2P9N A;  4YOR A;  4F3T A;  3NF8 A;  3OBW A;  1WSJ A;  1ATR A;  2V7Y A;  4IDK A;  4BRD A;  4KKO A;  3WNG A;  3SV3 A;  2FC0 A;  4LH5 A;  3ENB A;  3L4Q A;  1T05 A;  2NRT A;  3ZLJ A;  3L4I A;  3L0Q A;  1KFS A;  3QB0 A;  3THX A;  1YJ9 N;  4CZK A;  1MU2 A;  3DWL A;  3LPU A;  4JK9 A;  1JCE A;  1QS4 A;  1BDG A;  2FXU A;  2GWK A;  3QNO A;  3LDN A;  1QSS A;  5F1X A;  5AZJ B;  3EKU A;  4Z4F A;  3MED A;  1VHX A;  1BCM A;  3IS9 A;  4BRQ A;  4R5P A;  3AV9 A;  3NGZ A;  3V6D A;  1QQN A;  1F21 A;  2UXC K;  2DFE A;  3TSQ A;  3HP6 A;  5BRE A;  4H0Y B;  1NGC A;  4C8N A;  1OKJ A;  2KZM A;  1N5Y A;  3NF7 A;  4BG8 A;  3ZSW A;  4YFU A;  4HTU A;  4E1M A;  2O4I A;  4RW4 A;  1HNZ K;  3AO5 A;  2OPQ A;  4FM1 A;  3CCV N;  1VSL A;  3LP0 A;  3LAL A;  1NK5 A;  3NVK A;  4B9N A;  2G8V A;  1I3A A;  5EX5 A;  3ZSR A;  5AQS A;  4OGE A;  3CJA A;  2GX9 A;  3UKR B;  5BR8 K;  3D6R A;  1BO5 O;  3PIP L;  3Q7C A;  2DY4 A;  4LY7 A;  3DLL L;  1ZXO A;  1KAX A;  3ZT4 A;  2CGJ A;  4G9Z A;  4E7K A;  3I0S A;  4BR0 A;  4YDU A;  2E6L A;  4KHY A;  4N5S A;  4JRP A;  2I7P A;  3ISN C;  5LMN K;  1NG9 A;  2O8D B;  2E20 A;  4PY5 A;  3HOT A;  3BZK A;  2E6M A;  3ZSZ A;  3E01 A;  4FJN A;  3H3N O;  3NCI A;  2KTQ A;  1U2V A;  5M1O A;  3VQD A;  4FJX A;  4E7L A;  4H0V B;  4NCA A;  1HJR A;  4Z94 A;  4JI7 K;  3EO3 A;  3R9P A;  3LM2 A;  3SAF A;  2V7Z A;  3M1F A;  3A5M C;  2IAJ A;  2NRW A;  4F8R A;  3O3F A;  1DT9 A;  5AFU A;  5I42 A;  1J5O A;  3O9S A;  4FWN A;  5CHI A;  2VQE K;  1K8K B;  3JSM A;  1TKZ A;  4F4K A;  1S9G A;  4M3Y A;  2HHV A;  3SBT A;  3EE8 A;  3TTC A;  4IFV A;  4LF6 K;  2AA4 A;  4CZM A;  1RCH A;  3MCP A;  4C8K A;  1NGI A;  4DSJ A;  3AO4 A;  3FFK B;  4KB1 A;  5AQY A;  1EKE A;  4RCH A;  4BGB A;  3HI0 A;  3V81 A;  1TAU A;  1O1W A;  4BR5 A;  4BC5 A;  3CME N;  3FR0 A;  1XMO K;  2D0A A;  3LAM A;  3IG1 A;  3AVM A;  4CK3 A;  5CY4 A;  4KTW A;  1K73 O;  5I9E B;  3NH0 A;  1SZ2 A;  3VET A;  2NUB A;  2HHW A;  3CQX A;  1JLF A;  1E4G T;  3HYF A;  3P1G A;  4BE0 A;  4KHN A;  2W42 A;  2J4R A;  1KD1 O;  2Q36 A;  3VES A;  1YUW A;  4IOX A;  4H4M A;  2VWJ A;  1LCU A;  1Q82 O;  1L3S A;  4CJ5 A;  2W41 A;  4J8F A;  4JK8 A;  4X66 K;  2A42 A;  4DTN A;  1K8A O;  4BAC A;  3QML A;  4GV6 A;  2IVO A;  4OPA A;  4FJJ A;  4CK1 A;  5AZI B;  2YNG A;  4ID1 A;  4DSL A;  2HVH A;  2ZWH A;  3KTQ A;  3KK1 A;  4C8O A;  3V9S A;  4BY9 C;  4CHN A;  4Z4G A;  1N34 K;  1WB9 A;  2P9U A;  4E7J A;  3WT0 A;  3U3Y A;  4B8C A;  3MX2 A;  3P31 A;  4W5Q A;  2UU9 K;  1C1C A;  1NGJ A;  4Z4E A;  3AAR A;  3CC4 N;  1NBW A;  2ZF5 O;  2QKK A;  1RDW X;  5JVG L;  1GLA G;  4PL7 A;  2HF4 A;  3WNE A;  1Q9X A;  4WQ5 A;  5F2R A;  1BG3 A;  2XY8 A;  2WTU A;  2P51 A;  4MDA A;  3AAP A;  4H0T B;  5ADX H;  3EEQ A;  4MO4 A;  4JNE A;  4Z4I A;  4O5F A;  4N41 A;  3DI6 A;  3KK3 A;  4GKJ K;  4F9O A;  1RT3 A;  3NMU A;  4JKC A;  5AQN A;  3CG7 A;  3L2R A;  4DG1 A;  1X3M A;  1ZYQ A;  1C1A A;  1W9H A;  1X3N A;  4I6M A;  4BRH A;  1S5J A;  4IKF A;  1QQC A;  3K5O A;  5JMV A;  5AQI A;  3VQE A;  4DQS A;  2PZS A;  1C0M A;  3VEV A;  2IDO A;  3L3V A;  2KKZ A;  3QES A;  1YVN A;  3KJV A;  2P5O A;  3T3F A;  2HHQ A;  4DV6 K;  2X78 A;  3NE6 A;  4B3M K;  1X9J A;  3K58 A;  3C6H A;  1NMN A;  3OS1 A;  1FKO A;  4DU3 A;  3DAW A;  4JS5 A;  3OS0 A;  4CGD A;  4FK2 A;  2FLO A;  2FSN A;  4CF2 A;  4L3Q A;  2ATQ A;  1RIL A;  3BY5 A;  3DXM A;  2E88 A;  3L3U A;  3OS2 A;  1KCF A;  2I5J A;  3ZT1 A;  2KQ2 A;  2VWB A;  4CZI A;  4C8M A;  2O8C A;  4OKE A;  4JI8 K;  2QWO A;  4LSL A;  3TAE A;  1XWL A;  1U47 A;  1NJI O;  4DQQ A;  2VG6 A;  4YOX A;  1NKE A;  2GTD A;  4NYF A;  1DTQ A;  2HNY A;  3E9P A;  1ZC6 A;  3QEI A;  3ZSY A;  4M3T A;  2I7N A;  1HLU A;  4DV4 K;  4FJH A;  4DLE A;  5CR4 A;  3EZ5 A;  4BWM A;  4XH4 A;  1CZ9 A;  3VQ4 A;  4BC3 A;  4IOC L;  3K0S A;  4XEI A;  3KWI A;  3HM9 A;  4NB4 A;  2HMP A;  5KQ8 A;  3D0P A;  4FK0 A;  5AQJ A;  1ZBU A;  3GL1 A;  4Q5V A;  1WBB A;  1TL3 A;  4CHP A;  4FK4 A;  4B9L A;  3HVT A;  4EP4 A;  2BGG A;  3EKS A;  4V19 S;  3IMX A;  5CZ2 A;  3BDP A;  3SBG A;  3QFU A;  3G4S N;  3M3Z A;  3SPZ A;  3THW B;  1EX4 A;  2ZGZ A;  4DTO A;  1T6D A;  2W40 A;  3OYL A;  1SS6 A;  3SUP A;  3HK2 A;  3AVL A;  5GIO A;  5HOO A;  3IUC A;  1J5E K;  1S1U A;  4AHC A;  4DTP A;  1OH5 A;  3KKR A;  3CPW M;  2YHB A;  3VEW A;  2JGU A;  4WFA L;  3CMA N;  3P38 A;  4IFY A;  3A5L C;  4CF1 A;  4DTS A;  3QEW A;  4B3R K;  1EXQ A;  1I39 A;  1LWC A;  3MK6 A;  4DSK A;  4CEQ A;  2FBY A;  2XO7 A;  4BRO A;  1CZB A;  4C1N I;  2AP1 A;  3VF2 A;  5EXW A;  4CFA A;  1RT4 A;  4KHQ A;  2BTF A;  4J2E A;  4DMN A;  2QEX N;  3L2Q A;  3CCM N;  2WBN A;  1L3T A;  2XRI A;  2YJF A;  1SKR A;  1ZBF A;  2NRX A;  1WNS A;  4C1N K;  2A41 A;  3AVK A;  4BVP A;  3D7E O;  1JXB A;  1VRT A;  4CE9 A;  4CED A;  5HRP A;  2FBV A;  1M1K O;  4BRA A;  4W5O A;  1N8R O;  1IO2 A;  1CZA N;  2O8B A;  3ZSO A;  3CJ1 A;  4F2S A;  1GOB A;  1YT3 A;  3PO5 A;  3MX5 A;  3FZL A;  4EZ6 A;  4KBO A;  4DWI A;  4JAX A;  2F4V K;  2XY5 A;  2HBK A;  1MWM A;  2G8K A;  4KH4 A;  2PYJ A;  1KQS M;  5J1E A;  3PV8 A;  4H0P A;  3ITH A;  4EP5 A;  4CJE A;  4DV2 K;  3MXI A;  2UYT A;  4CBU A;  1XUP O;  4IO9 L;  1BCO A;  4FM2 A;  3V9U A;  3BF3 A;  4MO5 A;  4BRI A;  4JI5 K;  2PYL A;  5KPZ A;  4Z4H A;  4H5R A;  3PLA A;  4IG0 A;  1GLJ O;  4IG3 A;  3J7Y P;  1SKS A;  2D1K A;  4J2D A;  1FJG K;  2O8F B;  4QAG A;  3O3H A;  3H6E A;  2OTJ N;  3G25 A;  5KPT A;  1HKC A;  5SWM A;  4DSE A;  3ZET B;  4PQU A;  3O6W A;  1S1V A;  3V9X A;  1FK9 A;  4A59 A;  4DFK A;  4EFH A;  4BE1 A;  1WSE A;  4FVM A;  3OYE A;  3F5T A;  4H03 B;  4YY3 K;  5AQX A;  1XNR K;  4A5A A;  1Z26 A;  4OO1 J;  2QXF A;  4IBN A;  4BVO A;  4FLZ A;  2DFH A;  5JIC A;  4DTX A;  5CE3 A;  1L5U A;  3DJC A;  3O08 A;  3V9Z A;  1SV5 A;  3D2F B;  4FW2 A;  4K8Z A;  4FO0 A;  1TYQ A;  3C6U A;  4CZH A;  4U67 L;  4DFP A;  1SQK A;  2P9P A;  1K9M O;  3TAF A;  3CCJ N;  1UAX A;  1XHX A;  1NGG A;  3V1O A;  4LF8 K;  3I56 N;  1OVY A;  5FRM A;  3QBW A;  3I8D A;  4FJ8 A;  4BRE A;  5BN9 A;  4C23 A;  1RBU A;  2RN2 A;  1VQK N;  3AA2 A;  3DRP A;  4CIF A;  3A5O C;  3THY B;  5AQO A;  5AQR A;  5BRH A;  3WQU A;  3OTO K;  1E3M A;  3VQ6 A;  2Z1G A;  4DV5 K;  4FJ5 A;  3J8A A;  3NH2 A;  2RE2 A;  4I9Q A;  4EHU A;  5KQD A;  4CJL A;  4XH1 A;  2E8A A;  3NGI A;  4IXC A;  5MLC Q;  4FJM A;  4EAH D;  4FOI A;  3KK7 A;  5D3G A;  2QI2 A;  3HT3 A;  1Q81 O;  2XHB A;  2YNI A;  4OKK A;  2UXD K;  3FZF A;  3VEN A;  4FL9 A;  3VQQ A;  3CF5 L;  3HST B;  1BQN A;  4H5V A;  3CCR N;  2HHU A;  3H1V X;  1REV A;  1XI1 A;  4NCG A;  4WQ4 A;  4CEA A;  2ZJR L;  2QXL A;  3RSE B;  4B3O A;  1S6P A;  1WSG A;  2D4W A;  4GMJ B;  4IEI A;  4B08 A;  3A8Y A;  4PL8 A;  1KSP A;  4A2A A;  4FSV A;  4MQ3 A;  4KHU A;  5AQQ A;  4DSF A;  5GAE P;  1YIJ N;  2ZE2 A;  2F8S A;  4CEC A;  1EP4 A;  1Y64 A;  4YDU C;  5CYM A;  3OYF A;  4DF4 A;  3SUO A;  3A5N C;  4FWM A;  1T6C A;  4HTL A;  4CHQ A;  4CJ4 A;  4J2A A;  2PBD A;  2YV0 X;  3ZEU A;  4K42 A;  4FYD A;  1S1X A;  1HPM A;  1KVB A;  4M7X A;  3K57 A;  3WNF A;  3DLE A;  2F9T A;  1EQY A;  3AO2 A;  4BRN A;  2WON A;  3GBT A;  4DB3 A;  4AQY K;  2KFZ A;  1IBL K;  3N4P A;  1C1B A;  2HVI A;  3AVI A;  3Q7B A;  3T1H K;  2P9I A;  2DTU A;  1RT2 A;  4BG9 A;  3TAP A;  3WXL A;  2Q0U A;  3JYT A;  4W5N A;  2VQF K;  3P4I A;  1V4T A;  2HW3 A;  4RW6 A;  1BUP A;  3LDS A;  5JS1 A;  3WQT A;  5BN8 A;  4MLH A;  5K14 A;  1UA1 A;  1OVQ A;  3KD1 E;  1JLQ A;  3F2K A;  3CM6 A;  4R79 A;  1U48 A;  4CEE A;  4ELU A;  4A62 A;  1DLO A;  4B1X B;  2OA8 A;  4M3Z A;  2FF6 A;  4H0O A;  3S3M A;  3FZH A;  3UKU B;  3CQ8 A;  3P39 A;  3VF4 A;  3FZM A;  4DV7 K;  5M1K A;  3SQ4 A;  3LP3 A;  3OYD A;  3ZCM A;  3TTF A;  3ALY A;  1NK4 A;  5E84 A;  1ATN A;  3O1B A;  4DR2 K;  1GLE G;  4LF9 K;  3SQ1 A;  3PSF A;  3QER A;  4RW8 A;  4KHS A;  2VGM A;  4JHD B;  4IOA L;  4CF0 A;  4WFN L;  1NJW A;  3BGR A;  4YOU A;  3WEE A;  3VMF B;  3FLC O;  3M8R A;  2RF2 A;  3WXM B;  1HQE A;  1YF5 L;  3CJ7 A;  3CQY A;  2QM1 A;  1VQO N;  4AIL C;  1MWK A;  4DSI A;  4B9V A;  3TAR A;  3V1Q A;  1SUQ A;  3J7A P;  4Y0W A;  5C2D A;  1RDB A;  1O13 A;  2E1Z A;  1VQ8 N;  4CK2 A;  1TV6 A;  3WNH A;  5HBM A;  4WF9 L;  5DK5 A;  4FWQ A;  2HB5 A;  1NMD A;  3OJS A;  1LWF A;  3EL2 A;  5BPM A;  1IKW A;  3SNN A;  3S3O A;  1WSF A;  1C6V A;  3K2P A;  5HRN A;  4IO8 A;  3CJB A;  1M90 O;  4XIU A;  3M5R A;  3L2V A;  3H3O B;  3ZX3 A;  1GOA A;  2RPI A;  5SZT A;  4GKK K;  2KFN A;  2P9K B;  4WQ5 C;  5M1N A;  4B3T K;  1GLL O;  4C8L A;  1IH7 A;  1NK0 A;  2DPN A;  3DMJ A;  5FPD A;  5HP1 A;  4PUO A;  3ATV A;  3AVH A;  3ENH A;  3G0Z A;  3W3D A;  4W5T A;  1CLQ A;  2F8T A;  4JKE A;  4ELV A;  1LW0 A;  2P9S A;  3MN9 A;  3S9H A;  2OTL N;  1NLV A;  2XY6 A;  1NGH A;  3BF1 A;  1JLE A;  1NKC A;  3IDH A;  4DUZ K;  4CGJ A;  1ASV A;  3DLK A;  4BDY A;  3AA4 A;  4G1Q A;  2QKB A;  3C65 A;  2CGL A;  4X65 K;  2E2P A;  4YOV A;  3DYA A;  4B1U B;  3G71 N;  3L8B A;  4JI0 K;  4KTQ A;  1WSH A;  1UOC A;  1B92 A;  3F73 A;  3CFP A;  2Z1J A;  3MCA B;  1JLA A;  4DF8 A;  4BQL A;  2NZT A;  3DXK B;  4FWL A;  4DQP A;  2X6N A;  3ULE A;  4JKF A;  3ENO A;  1NM1 A;  4LF5 K;  2YHA A;  3VN5 A;  4GV3 A;  2DFF A;  4JRQ A;  5AQP A;  2EWS A;  3OYA A;  4JKG A;  1VRU A;  3TPQ A;  4B1Y B;  3VQ7 A;  3ZSV A;  5HLF A;  4B3S K;  2NRZ A;  4M45 A;  3SAH A;  3TU5 A;  3IKM A;  2JWK A;  3OHR A;  3V4I A;  4AM7 A;  1TK0 A;  4KV8 A;  4H4O A;  1JCF A;  3E66 A;  4OVL A;  3SV4 A;  3AY9 A;  3NFA A;  4NLC A;  1VSF A;  2ASP A;  3T69 A;  1VK0 A;  1C0U A;  4N47 A;  4PHT X;  2B4J A;  2A1S A;  4X62 K;  5LJW A;  1YHQ N;  1R0A A;  1BI4 B;  1N36 K;  3RTV A;  2W6L A;  2A3Z A;  4I7F A;  5FLX O;  2HHX A;  4MDB A;  4BGA A;  1HX1 A;  1GLB G;  1T3V A;  2OCE A;  4HVJ A;  4N76 A;  2OZS A;  4H5N A;  1RNH A;  4BDZ A;  4FPA A;  3OW2 M;  4KRE A;  2P9N B;  3C7N A;  2YNF A;  3HRG A;  3VEY A;  2YHX A;  2WUS A;  2UUB K;  4CGF A;  3BP8 A;  1S22 A;  3U6F A;  1Q18 A;  1VQ9 N;  2P9L A;  2PFU A;  1RT6 A;  1WAJ A;  4FM0 A;  2RHK A;  5I3U A;  1VSD A;  4LSN A;  3DOK A;  3THX B;  4CJK A;  3EZW A;  3MWT A;  1VQ4 N;  2YKM A;  2LSN A;  4FZZ A;  2PAV A;  3NH1 A;  3D2E A;  4EIA A;  3O4W A;  4DQ8 A;  4NXM K;  2B5J A;  4BRK A;  2ZM6 K;  5BR9 A;  4JD2 A;  2ASM A;  4CJ7 A;  4OPK A;  1D8Y A;  1NGB A;  1Z05 A;  2W6K A;  3K9J A;  2P1J A;  5AQM A;  1W97 L;  5JLH A;  4BRL A;  2IIR A;  2HMI A;  3ZSQ A;  5AQH A;  4CZG A;  5J2Q A;  2H3G X;  1NKB A;  1JL2 A;  3OYB A;  3NAE A;  1P8Z A;  4DTR A;  4YHH K;  4CBX A;  3RVC A;  3SUN A;  3TTD A;  4I2P A;  4KTZ A;  5HRR A;  3VGL A;  3KLF A;  1VQN N;  4AHT A;  4DCH A;  4IEE A;  1HYV A;  4BRC A;  4YOW A;  4UY8 O;  1TAQ A;  5BPN A;  2B6A A;  2QTD A;  4RW9 A;  3CPE A;  2FBX A;  1BQM A;  4ZHR A;  2D0O A;  4ID5 A;  2GBZ A;  3NDK A;  3VQ5 A;  5LJV A;  4LFA K;  3O4Q A;  2ETJ A;  4KHP K;  1ZBI A;  4KH6 A;  1KAY A;  1U2V B;  5AQZ A;  5ADX A;  3AGK A;  3SPY A;  4DR4 K;  1JLB A;  3I55 N;  5DMR A;  1BIZ A;  2AJQ A;  2CGK A;  2Z1I A;  3JXU A;  3LDQ A;  4BRF A;  1N6Q A;  2X74 A;  3SZ2 A;  2ZD1 A;  4DFJ A;  3C0B A;  5IWA K;  2HST A;  3ATU A;  3QIC A;  1QZ6 A;  4KO0 A;  4WFB L;  2NRR A;  3PX4 A;  4FJK A;  4ZTJ A;  2HHS A;  1UA0 A;  3VEZ A;  4CJS A;  3O9U A;  1YAG A;  4AF1 A;  2RKI A;  4O44 A;  5GIN A;  3WXK A;  4E19 A;  4Q0B A;  4LC9 B;  3BZC A;  4JKA A;  2GUI A;  4JKH A;  3N4Q A;  5DM7 L;  4M63 C;  3U8X A;  1QVF M;  4NCB A;  4HUG A;  1QHA A;  4FLX A;  2E2N A;  3NVM A;  3V1R A;  2GEL A;  2V52 B;  3OY9 A;  3LWM A;  4L8R B;  1U6Z A;  3O1W A;  5AZJ A;  5H1S Q;  3ULD A;  3L2U A;  2ZJP L;  3AVN A;  1LOT B;  5HRS A;  1WBD A;  1BOT O;  3RR7 A;  4KI6 A;  3E9O A;  3PSI A;  4M3R A;  3SMP A;  3AVG A;  4EHT A;  4DUY K;  2G8I A;  1BL3 A;  1NJX A;  1NK7 A;  1BWF O;  3FFI A;  4O4G A;  4YOY A;  2D0P A;  1S6Q A;  5E26 A;  4BDP A;  1DTT A;  4ISE A;  4DR5 K;  3RRH A;  1H1V A;  2KZZ A;  5FPE A;  4CD1 A;  3QEV A;  1RBR A;  4FXD A;  5HRO A;  2IVN A;  4DR1 K;  1NGD A;  3ZT0 A;  3QDK A;  3UKR A;  3BUZ B;  4PWD A;  3CIP A;  4OGC A;  4ILJ A;  5GAD P;  2QWQ A;  4U7B A;  4OX9 K;  2CH6 A;  3DRS A;  1XC9 A;  4OLA A;  4CF8 A;  3CET A;  2P9U B;  3M6G A;  4OKJ A;  4CZL A;  3CCQ N;  3MEC A;  2IC3 A;  3CCU N;  5AR0 A;  2O8D A;  1LAW A;  2Q3S A;  3OVN A;  4NO7 A;  3RMB A;  4CI6 A;  3HBT A;  3JAM O;  3E1Y A;  4AHS A;  4E1N A;  1NJZ A;  4CES A;  5KI6 A;  3IAY A;  1W2B M;  1MDU B;  1IBM K;  1BU6 O;  1SKW A;  1W0H A;  3CER A;  3HPG A;  1RDC A;  5FPN A;  4Z0U A;  4FOE A;  4CEO A;  3SCX A;  3LL3 A;  4LFB K;  4ZTF A;  4A2B A;  4BRP A;  4CJT A;  1T44 A;  5JS2 A;  2OZM A;  4FWP A;  3VTH A;  5B8H A;  4HUF A;  2QWN A;  3VQ9 A;  2HND A;  4JYA K;  2HBM A;  4WE1 A;  1K8K A;  1IG8 A;  3TAM A;  2CH5 A;  3FGU A;  1QQM A;  1WOQ A;  4I6M B;  1KFD A;  5C24 A;  3KLE A;  3SI6 A;  3D45 A;  4CFC A;  2Y1I A;  4RG8 A;  1VQL N;  3VTI A;  2BAN A;  4FWR A;  2BH1 A;  3ID6 A;  3B6O A;  2YKN A;  3OYC A;  3WXJ A;  1QSY A;  1J9A A;  1A5V A;  1NGF A;  4HHT A;  1S1W A;  3SYZ A;  2A1R A;  4J2B A;  2E2O A;  1EO1 A;  1NJY A;  1WSI A;  1KAZ A;  3FZK A;  1IBK K;  3SQ0 A;  1FW6 A;  5F0X A;  3HM8 A;  4K43 A;  3I8B A;  5E41 A;  1TK5 A;  1ASW A;  5AJ3 K;  1Q9Y A;  3KVG A;  3SJH A;  3HXM A;  1QHT A;  2E1Y A;  3DXM B;  3C95 A;  3AVJ A;  2GV9 A;  4DTU A;  1YTA A;  2G8F A;  2JLE A;  4H0X B;  2A5X A;  3SMS A;  3T19 A;  1ZBS A;  4M3W A;  5LY3 A;  4BRG A;  4BR4 A;  2XY7 A;  2E2Q A;  2O8C B;  4CCH A;  3QBX A;  2UUA K;  3AGR A;  1TKX A;  4DR6 K;  4RTF D;  4O0I A;  3DLH A;  2QWM A;  3CCL N;  1RDU A;  3RWU A;  3AVB A;  1R59 O;  1L3V A;  5AZI A;  4LF4 K;  2BE2 A;  3QET A;  5EY4 A;  3VA0 A;  4DU4 A;  3OA9 A;  2Y1J A;  3DLR A;  4FJ7 A;  5FPM A;  3QO9 A;  4DQR A;  3SUQ A;  3R1X A;  2OYQ A;  2WC9 A;  3HL8 A;  5CZ1 A;  2V51 B;  4CF9 A;  3K59 A;  3DOL A;  3U3G A;  4LFC K;  4DV1 K;  3KLI A;  2F96 A;  1K6Y A;  4BC2 A;  1T03 A;  4B9M A;  4Y1C A;  1YJW N;  1VQM N;  2E5L K;  1QE1 A;  5AQV A;  4OJR A;  4PKI A;  1CXQ A;  3ZT3 A;  1RTJ A;  1RBS A;  1GLD G;  2F9W A;  3M8Q A;  1RT5 A;  5C42 A;  3VGM A;  1IKV A;  3MDQ A;  1SL0 A;  3H46 O;  5HL7 L;  4KB0 A;  1J6Z A;  5GIP A;  4IJN A;  4DV0 K;  3LM9 A;  1VSM A;  3U9Z A;  4O8K A;  2G8U A;  1VSI A;  4JI4 K;  2G8W A;  4JI6 K;  5AFU H;  4OPJ A;  1VSJ A;  4AM6 A;  1VQP N;  3QNN A;  1GLF O;  4FLW A;  1JL1 A;  2Q2R A;  3O9T A;  1YI2 N;  4PKH A;  5JVH L;  3NGY A;  3LAK A;  4BWJ A;  1JLC A;  1J54 A;  3DLG A;  1SL1 A;  1WUA A;  4KPY A;  4CGI A;  1HKB A;  3CC2 N;  1IJJ A;  2YJE A;  5M1F A;  3GDQ A;  1JKH A;  4WCE L;  4PA1 A;  1RT1 A;  4FWO A;  4Z4C A;  5AQU A;  4IWV A;  4FJ9 A;  4OPH A;  3MWP A;  3VER A;  4FJL A;  3C6A A;  4KAZ A;  2Q1N A;  3CD6 N;  1ZBH A;  3M8P A;  3H1Q A;  3UE5 A;  4B8A B;  3KZB A;  3CFR A;  5TKY A;  4DTJ A;  3VEO A;  2ASO A;  4H8K A;  4CJF A;  1HNV A;  4ISG A;  2O8B B;  3SLC A;  3LDO A;  3BEX A;  2KLA A;  4FLV A;  3AAQ A;  3EN9 A;  1XNQ K;  4CJU A;  1T7P A;  4QCL A;  3VQC A;  4OLB A;  4AHU A;  4JEP A;  3AVC A;  1RTD A;  1KLN A;  3CXC M;  3MXJ A;  3TAG A;  2QWL A;  3CHW A;  3OJU A;  3WXI A;  4M3U A;  1X1P A;  3LDP A;  2A40 A;  2YHY A;  1KRP A;  4F2R A;  1XC3 A;  4ELT A;  1TUY A;  1RGI A;  4CZF A;  3L2W A;  1HKG A;  4TSX A;  3LP2 A;  5KRT A;  3O5B A;  1YXQ A;  1IKY A;  3HOS A;  5IT9 O;  4BRM A;  1NWK A;  2YCH A;  1WLJ A;  1U49 A;  3ZX2 A;  3GG4 A;  3LDL A;  2NNW A;  4JI1 K;  3OYN A;  1U4B A;  1KVC A;  4JN4 A;  1Z6R A;  4RWT A;  4CZE A;  3THV A;  5J2N A;  3B8A X;  1ITG A;  3THW A;  1D9F A;  3C6T A;  1U04 A;  1G15 A;  4M7Y A;  4O0J A;  3OYI A;  4PKG A;  4DTM A;  3KWG A;  4RW7 A;  5C15 A;  4E0D A;  4CEZ A;  1BA0 A;  5J2P A;  5GAG P;  4CHO A;  2HOE A;  2P5G A;  2OAN A;  3CC7 N;  4JLH A;  3K9K A;  4DV3 K;  3NBP A;  1A5X A;  4CHY A;  4GY2 B;  1X9S A;  5BRF A;  1BHL A;  1TYQ B;  1RTI A;  4DR3 K;  3EE9 A;  4CFB A;  2IVP A;  2YHW A;  4JI2 K;  3KLH A;  2P9P B;  1NK8 A;  3ASM A;  3VQ8 A;  4E7I A;  2QK9 A;  1NOZ A;  4CJP A;  3HVR A;  1N33 K;  1GOC A;  3OYK A;  1YTU A;  3MN6 A;  4FLT A;  1B9F A;  2VG7 A;  3HO1 A;  4IJA A;  3K5L A;  4FVU A;  1VQ7 N;  3CJ9 A;  4LH4 A;  2D5R A;  3VGK A;  3ID8 A;  2YI1 A;  1KC8 O;  4DS5 A;  3NF9 A;  4M3X A;  2IOC A;  1KXP A;  1RDA A;  3P5J A;  5EVZ A;  3PO4 A;  2O8E A;  2IS3 A;  3TAQ A;  2HNZ A;  2QW9 A;  4W5R A;  3WUH A;  4A57 A;  4B9U A;  4O5B A;  4B9Q A;  3AVA A;  2WOM A;  1LV5 A;  5M1P A;  2YNH A;  5BPL A;  3F9K A;  1RFQ A;  1DGK N;  3CM5 A;  4QOZ B;  4H5T A;  2R7Y A;  4GNI A;  3T7Z A;  1ESV A;  3R6M A;  2Q97 A;  5CYQ A;  3KHY A;  1VQ6 N;  3U4L A;  4YNQ A;  4O8U A;  1OH6 A;  2O8F A;  1W7A A;  3IRX A;  2NRV A;  4CJ3 A;  3AA3 A;  5C12 A;  4CIG A;  3ZET A;  1Y97 A;  2A6A A;  3J7Z O;  2HBL A;  3QFP A;  5AQW A;  4QS7 A;  1LW2 A;  5KRS A;  1V4S A;  4CEF A;  3VQP A;  1JJ2 M;  4FLY A;  4ILH A;  1OH8 A;  3LP1 A;  3OYH A;  4KFB A;  3PIO L;  4K0K K;  3O8M A;  3J80 O;  2KHO A;  4FJI A;  3ZEU B;  3HP9 A;  4CGH A;  2X6S A;  4FZY A;  3CJC A;  3HPH A;  3LAN A;  2PY5 A;  5C25 A;  4HCB A;  1NOY A;  4CIE A;  3G6E N;  1S3X A;  4IFE A;  4CW7 B;  3MN5 A;  5C0Y A;  3D2F A;  4NYN A;  2P9I B;  2Q31 A;  3MEE A;  4QS8 A;  1TVR A;  3G10 A;  1LWE A;  3TWH A;  4LF7 K;  1VSH A;  1XQS C;  2BDP A;  4E3S A;  3M8S A;  5GAH P;  3RMC A;  3FE1 A;  4X64 K;  1WAF A;  5ELZ A;  1HRH A;  1YVU A;  1DKG D;  3VEX A;  1HYS A;  1RDD A;  1ATS A;  4B1V A;  4JV5 K;  5T7B A;  1QSL A;  4DFM A;  4A5B A;  3HTV A;  2UXB K;  5AQG A;  3THY A;  3AO1 A;  3T1A A;  5C2F A;  1TKT A;  3VF6 A;  3O3G A;  1LAV A;  2KW4 A;  3TAB A;  1X9M A;  5JLF A;  2E4L A;  1HNX K;  1NNE A;  4CJW A;  3TI0 A;  2EX3 A;  5A2Q O;  2VYP A;  1Z25 A;  2Z1H A;  3TSP A;  3ZSX A;  3HSC A;  1QQO A;  4NXN K;  3CI5 A;  2NRH A;  2G8H A;  4BC4 A;  3WEE B;  4AHR A;  3O4N A;  4HCC A;  2VGN A;  1WN7 A;  3KIO A;  1RT7 A;  4BR7 A;  1SL2 A;  1C0T A;  1EWR A;  1QTM A;  4CD3 A;  4DHY A;  3KK2 A;  1VSK A;  3OYG A;  3O9Q A;  1XHZ A;  4UQG A;  3CCE N;  3MEG A;  4GVE A;  3RSE A;  1N32 K;  4BR9 A;  3QIP A;  4A61 A;  1BIU A;  4IZ9 A;  2QWR A;  1IV0 A;  2WFB A;  1BA1 A;  3H45 C; 
#chains in the Genus database with same CATH homology
 1IBK K;  2UU9 K;  2UUC K;  4DV3 K;  4DUY K;  4DV2 K;  2HHH K;  4DR2 K;  4JI7 K;  4DR3 K;  4LF9 K;  4YHH K;  4CW7 B;  5AJ3 K;  4JI5 K;  4JI2 K;  5LMU K;  2UXD K;  4DR5 K;  2VQE K;  3J7Y P;  4V19 S;  4LF5 K;  4LF7 K;  1FJG K;  1N33 K;  4GKJ K;  4X64 K;  4DR1 K;  4B3S K;  4LF6 K;  2UUA K;  4DR6 K;  4JV5 K;  4OX9 K;  1J5E K;  3J7A P;  2UXB K;  5LL6 Z;  4LFA K;  1I94 K;  4KHP K;  1XNQ K;  4LF4 K;  1XMO K;  4YY3 K;  1XNR K;  4X62 K;  1HNW K;  1HNX K;  4B3R K;  2UXC K;  1XMQ K;  4DR4 K;  1N36 K;  5A2Q O;  3JAM O;  4DV6 K;  5FLX O;  3T1Y K;  4B3M K;  1IBM K;  4CVN E;  4LFC K;  1HNZ K;  5IWA K;  4DV1 K;  4NXN K;  4AQY K;  1IBL K;  2UUB K;  5IT9 O;  4GKK K;  4LFB K;  2E5L K;  1HR0 K;  3T1H K;  4B3T K;  4JI1 K;  4JYA K;  2VQF K;  4LF8 K;  5BR8 K;  4X66 K;  4DV0 K;  4JI8 K;  3J81 O;  4DR7 K;  1N32 K;  4DUZ K;  4JI3 K;  3OTO K;  4JI4 K;  4JI6 K;  4NXM K;  2ZM6 K;  5LMN K;  4X65 K;  4DV4 K;  4DV5 K;  4JI0 K;  3J80 O;  4DV7 K;  1N34 K;  2F4V K;  4K0K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...