3J7Yk

Structure of the large ribosomal subunit from human mitochondria
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
b'VKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF10780 MRP_L53 39S ribosomal protein L53/MRP-L53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3j7yk00
2FLSA 2OJLA 3QPMA 3BBYA 3HKRA 4F03A 2CAQA 4PGTA 1WE0A 2YZHA 5CRWA 5JCWA 1PMTA 1OKDA 2CT6A 3GN3A 2R5GA 4EL1A 3A2VA 5D93A 2L4QA 4GXZA 3EMPA 4N10A 3W8JA 4WR4A 5KEJA 4YAVA 2IIYA 3F3RA 3FYGA 3TKQA 1K0NA 2PVOC 1J9BA 2HT9A 4NHWA 2QC7A 2C0FA 2VLTA 2B1LA 3EVIA 4NV5A 3SBCA 3LWAA 1V58A 4KSMA 5ECRB 2GDRA 2YNXA 4GSNA 1K0BA 1B9XC 3ZIVA 4OO5A 4IJIA 3US3A 2JSZA 3MDKA 3TRPA 2FWFA 6GSTA 2PUKC 1ERUA 3GTUB 1WP0A 3ZIJA 4ISDA 5ECHB 3TJFA 1QMVA 2EIOA 2TRCP 4WEYA 1N2AA 1SL2B 3EURA 2VCQA 1U88A 1RK4A 3RHBA 3QR6A 1GP1A 4QL9A 3TCOA 1UC7A 1XW5A 1QQ2A 2TRXA 3U6VA 4EE0A 4K7IA 1XIYA 4V2LA 2H30A 4CDOA 2H1BA 4GWRA 4N11A 4OO4A 3TRQA 2R3XA 1A8LA 2YV7A 2C3TA 4HUAA 3R2QA 2DMLA 4JEDA 5B6NA 3FY7A 1I9DA 2DMMA 2X8GA 3HVSA 3APSA 2A2SA 2MMOA 3D6IA 1SJ6A 1WOUA 2E2GA 4RUVA 4KGIA 1ZCPA 3UVHA 4HU7A 2QSIA 4KB3A 1OC9B 2H8LA 2O89A 5IIZA 2XPDA 3UIWA 2IMKA 18GSA 4XS6A 4XS4A 1TI3A 4PQHA 4O92A 1R5PA 5IMVA 3HXSA 4Q5NA 5DQSA 4JU5A 2HZEA 5IO2A 5HFIA 1XXUA 2N5FA 1SYXA 3GYKA 2P31A 2GQKA 2VIMA 1FHEA 4K9ZA 5E4WA 4HOJA 4PQIA 3LORA 2A4VA 2C1YA 3DKSA 1A23A 3LGCA 1Z9HA 4TVEA 5D73A 4I5QA 1T7PB 2HE3A 3IPZA 3HDCA 4GF0A 4WR5A 5HR1A 4IKHA 2V41A 3ZFLA 1M7TA 4LMWA 5A5KA 3ZVJD 3RPPA 4LL1B 1TOFA 2X64A 4HQSA 4H86A 4MP4A 3F6FA 5IMFA 1HD2A 3F63A 1M2AA 1URMA 3C1SA 2GTUA 3M3MA 4EC0A 2RM5A 1FB6A 4NHZA 4L8EA 1TU8A 3M9JA 1K0DA 1M0UA 5HQPA 3IK9A 3QCPA 4OD7A 4LL4B 2WRTA 2VLUA 3ME8A 5ECNB 4I97A 2YWIA 2KP2A 4ZILA 2V1MA 3A2XA 5HR0A 1TK8B 1AUCA 1XFLA 1YKCA 1XCCA 3FZ5A 1YJ6A 2OE1A 5CRHA 5ECLB 1IYHA 4V1Ap 1U3AA 2ZUPA 4ACSA 1MDIA 2K6VA 1X0RA 1H75A 2CQ9A 2HZEB 3QD9A 1AAZA 3GKKA 1F2EA 1GTAA 3UJ1A 1YF1A 2MMNA 3W8SA 2VM1A 4YQVA 4MJCA 2YZUA 5EPFA 2LNSA 1PX7A 1V57A 1S3CA 1LBKA 4EF0A 1UVZA 3WD6A 3TGZA 1GWCA 3CSJA 4GSSA 1KNGA 5ID2A 4POBA 1XOAA 1ERVA 3L9VA 1EV9A 1X5DA 3NIVA 1B4QA 2OE3A 2ALBA 3F6DA 2IMEA 3IAM2 4OFNA 3LG6A 1B48A 2H1AA 3WYWA 4DSQA 1PD21 2AB6A 2WB9A 4KA0A 2JSYA 3LSZA 2H19A 1WJKA 1Z6MA 1AQWA 1AIUA 1Z5YE 4NXIA 12GSA 2HSYA 2XHFA 1HQOA 5CYYA 5G5EA 2R37A 2DLXA 4PNGA 1DE1A 2LS5A 2LSTA 5D9TA 2PU9C 3G9BA 1PGTA 5JWQB 3QAGA 1XOBA 1HNCA 4KUNA 2K18A 1XBSA 5J9CA 5B6MA 2HI7A 5ECKB 5J41A 2HSHA 2JZTA 1EOHA 1BG5A 3GKNA 1W89A 5F07A 5D9WA 5DBQA 1H4OA 6GSWA 1SYRA 1OE8A 2LRNA 5IMAA 3IXRA 1V40A 2YCDA 2GT5A 2C0DA 2H73A 5ID2B 3A3TA 3DVXA 1GSQA 1PA3A 1ST9A 1X9MB 5AIXA 3FKFA 1WMJA 2GSQA 2NPBA 2YWOA 2VAFA 4IJ3A 2OE0A 1YZXA 4TR3A 1YKAA 2AHEA 3DXBA 2X8CA 1HNBA 4G2EA 4G9HA 2C8UA 3FR6A 1M99A 5A4WA 4PNFA 5EVOA 1ABAA 1O6JA 4KCAA 1FB0A 4D73A 4DVCA 4JE1A 1VF2A 1TRSA 3V1WA 4PXOA 5DDLA 3OR5A 2VCXA 1KTEA 4Q5FA 2HNLA 3MSZA 5CO3A 3CRUA 3C71A 1DE2A 3HZ4A 2AJQB 3BJ5A 5A4UA 1ON4A 5J5NA 5DJMA 4BPYA 3RHCA 3ERFA 1OVNA 1YEXA 3IDVA 4POLA 1A0RP 4MJAA 3QOUA 3MWHA 2K8VA 2REMA 3FZAA 7GSSA 3RBTA 3HVXA 3TJJA 1GSDA 1Q98A 3EWLA 3TJKA 2LQQA 3ERWA 1VGLA 2L6CA 4WBJA 1JFUA 2CX4A 1XWCA 3H93A 4N0VA 2L59A 2NVLA 1XWGA 2HRNA 2DIZA 5ELGA 1LU4A 2DJ2A 1EWXA 4MZBA 5HFKA 2RIIA 2ON5A 3F4TA 5LD0A 3DRNA 4ZB6A 3IR4A 2HLSA 2NTOA 5J4UA 1WPIA 2GT6A 5G1LA 1F9MA 4IHUA 4GSTA 2IWTA 2LTKA 4WETA 1FOVA 2C3QA 4JZQA 4IVFA 4GLTA 2A2RA 1UA5A 1GSEA 4ZBDA 3ME7A 4IBPA 1XZOA 3N5OA 4EO3A 4TKYA 3TOTA 2XPEA 5J3RA 3QAWA 1GLPA 3ZITA 1FG4A 1TXXA 2O7KA 3EE2A 1PL1A 2WZ9A 3GNJA 5HR3A 2FA8A 3E3EA 1OKTA 2JZRA 2M72A 2FCHA 4NAXA 3UBLA 3LQ7A 2DBCA 1THXA 4FH8A 3P2AA 2ZCTA 1FW1A 2V2GA 3FK8A 1T1VA 3EC3A 4MZCA 3H79A 3WGDA 4ZBBA 4YQUA 4IP1A 4PQ1A 1HNAA 4GCIA 2KLXA 4Q5QA 2B3SA 1UN2A 2FWHA 5HR2A 5JCGA 2LJKA 1G0TA 1TTZA 1SL0B 4MJBA 4TR4A 4BL7A 4OWYA 3Q19A 5D96A 5DALA 3L9UA 4KX4A 3TUEA 2WS2A 2BJXA 4F2IA 4MPGA 4F0CA 2X8HA 5EY6A 1A2LA 8GSSA 4DSSA 1U6TA 4K0NA 3VK9A 2CA8A 1R26A 2PVQA 3D4TA 2B7KA 2FD3A 4XCSA 1LJRA 4IN0A 1N8JA 20GSA 1SL1B 2GLRA 3F3QA 2EC4A 3TOUA 3KP8A 5ECMB 2FNOA 3TKPA 2VCWA 1ZL9A 1W4VA 4OCFA 5GZZB 4ZXGA 4AGSA 4X0XA 1EOGA 1Z7RA 4K2DA 2DJKA 3P8WA 1T4YA 1C72A 1CQHA 4EDYA 4AJ7A 4HQZA 1BX9A 4FYUA 4OFTA 2C80A 1YY7A 1SJIA 4TOPA 3CBUA 4XRAA 2GSSA 6GSYA 1ZOFA 4DEJA 4ID0A 2NDOA 3KZQA 4K8MA 1K0AA 3IBHA 2J23A 3DEXA 3BCIA 1M9AA 3KD0A 2C0EA 3GX0A 3MNGA 5GAPD 3HJMA 3APOA 2GVPA 1X9SB 2D2ZA 4K6XA 2L6DA 2JADA 2QKEA 1K3YA 1Q4JA 1R7HA 5C04A 2H6XA 2B5XA 2GGTA 2YPMA 4KW6A 1BYEA 1KEBA 3CYNA 1TP9A 3E0UA 4WF5A 3PH9A 3IRAA 4BWQA 2BTOT 2R2JA 2X99A 2EIRA 5C00A 3H4KA 1V9WA 2FWGA 2CZ2A 1JHBA 1AQVA 2MMZA 1THOA 1CQGA 2GZYA 19GSA 2C0GA 3GV1A 3G7IA 4IS0A 4ML6A 4O5RA 1SKRB 1X5CA 2FWEA 3D0ZA 4HZ2A 3IHQA 1RW1A 3HY2A 3KM6A 1TRWA 2G2QA 2JACA 4AJ6A 2LRCA 2H1GA 3D4MA 1VF3A 3ZMLA 5IM9A 5IMDA 1NM3A 3GL3A 3GX8A 4HZ4A 2I9HA 2L5OA 3QFBC 2YWNA 2CVKA 1EGRA 1SK2A 1ZYQB 4BVXA 2YOIA 3BCKA 4LA1A 3KP9A 1JZRA 2CVBA 1AQXA 3TKRA 3UOMA 5KN1A 1AC1A 1ZGNA 4FYCA 6GSUA 5LNKe 4F82A 1JLWA 3Q18A 2GSRA 1XW6A 3PGTA 4XS4B 4XTSA 5G1KA 1EGOA 5J9BA 1XVQA 1SD9A 4DSRA 4IGJA 1GTBA 14GSA 1F3BA 1XVWA 5FWGA 5IPGA 4TW5A 5FT3A 1JZOA 3ZTLA 2YJ7A 1ZZYA 2R6KA 3GFKA 1TK0B 2B5EA 2VD1A 6GSXA 1GTIA 2GZZA 1ACVA 2DJ3A 4GQFA 2LKUA 1GNEA 5AN1A 2JU5A 3KJYA 1ML6A 3Q6OA 5ECOB 3VFIA 2YJHA 2M80A 1WWJA 2XC2A 3CMIA 1OC8A 1U87A 1G6YA 2F8AA 2V32A 5LCZA 1EZKA 2LUSA 2VCTA 4TR1A 1GRXA 4F9ZA 4PURA 1TI1A 2CV4A 3A2WA 4IELA 2G0FA 5AIVA 1WRYA 1HYUA 3WGXA 2F51A 3CSHA 4BA7A 3FR9A 2LV3A 3EU4A 3LJRA 3IOSA 5ECQB 2AV4A 5B8BA 1FO5A 4AJ8A 1GULA 3SWLA 2PBJA 4TN8A 3G7JA 1IYIA 5KN3A 3I6AA 2N5AA 2PGTA 4PX1A 4PUAA 4MA9A 1XWAA 4XRDA 2VL9A 2E7PA 3GURA 2CZ3A 2FY6A 1NHOA 3PR8A 3DD3A 3L0HA 2GZPA 2IPAA 3TJBA 2IL3A 2O85A 5CNWA 1I5GA 3UARA 3EU3A 3JCML 1DSBA 5GSTA 3TKSE 3E9JB 5L71A 3IC4A 1TW9A 5CP1A 5ECPB 3TJGA 4O32A 1V98A 1Z6NA 2VD0A 1SK0A 4G19A 2H76A 1GSFA 3UL3A 5D8IA 2GQLA 4LMVA 4GTUA 1GUKA 1MDKA 2KOKA 4KDYA 2H74A 4ZB8A 3IK7A 3WT1A 3U5RE 4TR0A 2H70A 4QQ7A 1JZDA 4CW9A 2VO4A 2ZNMA 3KH7A 2RUEA 2F3MA 1VF4A 4WKWA 1MTCA 3D22A 4N0ZA 3P90A 2LRTA 4HU9A 2YWMA 3I9V2 3H8QA 1OAZA 4XIHA 1OE7A 3FW2A 1PSQA 3HHVA 5IPHA 4KSOA 1VRSD 5CREA 3ZVJA 5DAKA 3VWUA 4FYBA 3VWWA 2FGXA 4J56E 3J7Yb 4HJ2A 4YQMA 4ZL7A 2HZFA 3K8NA 1TU7A 1OC3A 4KAEA 1G7OA 5FHIA 3UMAA 5COHA 2O8VB 5JCUA 1O7UA 1G6WA 4LLRA 1J08A 3VLNA 1GH2A 2WFCA 4MMMA 3GH6A 5IOWA 1A24A 4HI7A 3ZYWA 2P5RA 1B9YC 2P5QA 1PKWA 4E8EA 3KIJA 3FZ4A 3CTGA 5G31A 5F05A 2XBIA 4IQAA 2PPTA 1M9BA 4OMVA 1J0FA 2DJ1A 3MAKA 1R5AA 3M9KA 5JWOB 4KCEA 4GRFA 1XWKA 2H6YA 2DIYA 3KGKA 5B7CA 1YDKA 2I3YA 4D73B 2Z9SA 3H1NA 4O7HA 2QGVA 3GTUA 2CX3A 3GA4A 2VUPA 1YQ1A 4MPFA 2B1KA 5ECIB 5AISA 4IP6A 2K9FA 1AW9A 3F0IA 2VL2C 3GSTA 4EVMA 4TXOA 4FIWA 3KCMA 2H72A 4EUYA 3BOAA 3M8NA 5KN0A 4BVYA 2GS3A 3UEMA 2MMAA 4K7NA 4EXJA 5DVBA 2HFDA 2F8FA 3Q74A 4V2MA 1EV4A 2VCVA 3ERGA 3KMNA 4ECCA 2IMDA 2I81A 2DSAA 4X43A 3HVVA 2B7JA 3VWVA 5GAND 1RQMA 1SJZA 2OBIA 3CRTA 1EP8A 4J2FA 3FZ9A 2K8SA 4EDZA 3GIXA 3G7YA 4NMUA 2NBSA 2L4CA 4WF4A 5F06A 2YANA 3M1GA 4OCEA 4E8HA 3KEBA 1OC9A 5ABRA 3O6TA 4V2NA 2VOCA 5IOXA 2AUVA 3FHKA 2OKAA 1G7EA 4JRRA 3RAZA 2V6KA 3GMFA 4YH2A 4MH2A 1T4ZA 3TRXA 3C7MA 4QL7A 5H5RA 5CRGA 1KBNA 1PN9A 2IJYA 2XBQA 3DGQA 3P7XA 2PN8A 1Z7PA 2M46A 4HEA2 3QMXA 1TK5B 3M0FA 3I43A 2E0QA 2GQMA 1O85A 4RQXA 5HFGA 2MZCA 4TXOB 1A8YA 1TDIA 1Y25A 3GHAA 4JR4A 4MF5A 5CAXA 2DJJA 1GSUA 1NW2A 3TDGA 4NPBA 3VURA 5IMCA 4J57E 3D5JA 1M2DA 1WIKA 3HD5A 3F4SA 5IO0A 4KDXA 4XS1A 2WCIA 1O8WA 4KNDA 5A4VA 3NOFA 1PL2A 1MD4A 3ISOA 16GSA 4G10A 3DVWA 1AXDA 3WT2A 1YEPA 2AYTA 1GUHA 2HYXA 1QGVA 2YP6A 4FO5A 2N5BA 4BWSA 3ED3A 3LXZA 1JZWA 3HZ8A 1XW9A 2H6ZA 4GQCA 5DALB 5F0GA 3GKMA 3EINA 5AGYA 5F8BA 2DC5A 1DBYA 4DSSB 1GUMA 3LEFA 3IAS2 4HDEA 1GSYA 2FA4A 3C8EA 4XHMA 1S3AA 3GH9A 5D9VA 2HXKA 4NV2A 2H0HA 4MH3A 1GL8A 2MBSA 2J9HA 3PINA 4RI7A 3F9UA 1DUGA 4L5OA 3LXTA 1PX6A 1SKSB 5B8AA 4L0UA 9GSSA 2VL3A 2RUFA 1GLQA 3C1RA 1ZYEA 3AY8A 13GSA 4KE3A 1F3AA 1TJDA 5G5FA 2OA7A 2FUG2 1XWBA 4TXVA 3IE3A 2RM6A 3F8UA 4N30A 2B6MA 4JBBA 4F0BA 3F4RA 1O73A 2H0IA 4MDCA 2H0GA 1ZMAA 2BMXA 3ZZXA 3CXGA 4L5LA 5DJLA 5CRDA 4L0WA 17GSA 1E6BA 3FEUA 1O8XA 2VLVA 4ZL9A 2KP1A 1V2AA 2WJUA 3KMOA 4MCUA 1GSSA 4I8BA 3TKSA 1M2BA 2E2MA 3ZMKA 1PRXA 3DMLA 1MDJA 2P0GA 2LQOA 3UAPA 1YF0A 5EL8A 3WGEA 2WGRA 5ECSA 2F9SA 4AF2A 3VPTA 2RLIA 4I2TA 3BD2A 4MZWA 1K3OA 10GSA 6GSSA 5H5SA 2EIQA 4ECBA 5INYA 2IFQA 2B5YA 3L9SA 3QFAC 1U3IA 2H66A 2V6OA 3TB2A 2VM2A 4WBRD 2TIRA 1MEKA 3EYTA 3W6GA 5E59A 1FAAA 3RPNA 2KHPA 4K0GA 4P3YB 1S3DA 2CAIA 4NWYA 1SKWB 5DCHA 2LJRA 1OYJA 3IV4A 4MF7A 4OFMA 1JLVA 3QAVA 3EMXA 5G2ZA 1VF1A 1SU9A 1K0OA 1A2JA 1BEDA 4KDUA 1PQNA 3DIEA 2O87A 1EEMA 1EP7A 2L57A 2PERA 2AAWA 4POMA 1XPVA 1A0FA 3FRCA 5IQYA 1SK1A 6GSVA 3HCZA 2C3NA 3L4NA 3CTFA 2WDUA 4ZL8A 2OADA 1BJXA 3N9JA 1R4WA 1FVJA 3DYRA 5IMZA 3HA9A 4ZBAA 2MBTA 4HJMA 1ERTA 3TKSC 2LNTA 2H75A 3GSSA 3UBKA 1PKZA 1NHYA 1GTUA 2ON7A 4Q5RA 5ENUA 3KTBA 2LEGA 1SENA 3D21A 4I6XA 2H01A 1K0CA 2WULA 2I4AA 4Z7XA 4IQ1A 1QUWA 3QDNA 4HS1A 3VPQA 1FVKA 2IFQB 4TR1B 2HRFA 5GSSA 1USBA 2C4JA 4ECIA 5ELAA 5DCGA 4ECJA 1TKDB 1F37A 2ES7A 3HYPA 4I2UA 1X9WB 3IA1A 3C73A 1A2MA 4MK3A 3CSIA 4EKZA 3GUSA 1ERWA 1E2YA 2VL2A 1TRVA 2I1UA 3GL5A 1Z3EA 2PMTA 3HJPA 3VWXA 2H1DA 2IMFA 1EEJA 4K1FA 1X5EA 2IMIA 2JL4A 2GSTA 1B8XA 3KTLA 3RDWA 4ML1A 3L78A 4WXTA 1BQ7A 4ZIJA 4MLYA 4POKA 4JR6A 4MJEA 3VI5A 1QK8A 4TRXA 22GSA 2OACA 4RI6A 3LYPA 4ULXA 1T8EB 3FR3A 3O76A 1MD3A 4MABA 4MF6A 2JZSA 2LJAA 2DJ0A 2YV9A 1QFNA 3KXOA 2L5LA 1Y6EA 3NZNA 3ZREA 1ILOA 1B4PA 4X1UA 1F6MC 5G30A 3ZFBA 3KH9A 4K7OA 4V1Ag 1K0MA 2H71A 3O3TA 3ZRDA 4CHSA 4YAPA 3LYKA 4KH7A 5KN2A 2MYGA 1GNWA 2PWJA 2CVDA 2YN1A 3LFLA 1O81A 2VCZA 3GRXA 5DQYA 2OBKA 3UVTA 3DWVA 3I69A 4RQRA 11GSA 3VI7A 1T3BA 3S9FA 2KUCA 5D9XA 4ZB9A 3ZL5A 3HJOA 1TRUA 2FHEA 1QXHA 1K3LA 3APQA 2IN3A 2R4VA 5DAKB 5H5QA 5JWRB 3J7Yk 4ILFA 1T00A 1BAYA 1SD8A 4IW9A 4PUFC 1NSWA 3GKXA 3A5WA 3ZLPA
chains in the Genus database with same CATH superfamily
2FLSA 2OJLA 3QPMA 3BBYA 3HKRA 4F03A 2CAQA 4PGTA 1WE0A 2YZHA 5CRWA 2R0CA 5JCWA 1PMTA 1OKDA 2CT6A 3GN3A 2R5GA 4EL1A 3A2VA 5D93A 2L4QA 4GXZA 3EMPA 4N10A 3W8JA 4WR4A 5KEJA 4YAVA 2IIYA 3F3RA 3FYGA 3TKQA 1K0NA 2PVOC 1J9BA 3PPUA 2HT9A 4NHWA 2QC7A 2C0FA 2VLTA 2B1LA 3EVIA 4NV5A 3SBCA 3LWAA 1V58A 4KSMA 5ECRB 2GDRA 2YNXA 4GSNA 1K0BA 1B9XC 3ZIVA 4OO5A 4IJIA 1FOHA 3US3A 2JSZA 3MDKA 3TRPA 2FWFA 6GSTA 2PUKC 1ERUA 3GTUB 1WP0A 3ZIJA 4ISDA 5ECHB 3TJFA 1QMVA 2EIOA 2TRCP 4WEYA 1N2AA 1SL2B 4BVYB 3EURA 2VCQA 1U88A 4PTSA 1RK4A 3RHBA 2R0PA 3QR6A 1GP1A 4QL9A 3TCOA 4O5UA 1UC7A 1XW5A 1QQ2A 2TRXA 3U6VA 4EE0A 4K7IA 1XIYA 4V2LA 2H30A 4CDOA 2H1BA 4GWRA 4N11A 4OO4A 3TRQA 2R3XA 1A8LA 2YV7A 2C3TA 4HUAA 3R2QA 2DMLA 4JEDA 5B6NA 3FY7A 1I9DA 2DMMA 2X8GA 3HVSA 3APSA 2A2SA 2MMOA 3D6IA 1SJ6A 1WOUA 2E2GA 4RUVA 4KGIA 1ZCPA 3UVHA 4HU7A 2QSIA 4YKFA 4KB3A 1OC9B 2H8LA 2O89A 5IIZA 2XPDA 3UIWA 2IMKA 18GSA 4XS6A 4XS4A 1TI3A 4PQHA 4O92A 1R5PA 5IMVA 3HXSA 4Q5NA 5DQSA 4JU5A 2HZEA 5IO2A 5HFIA 1XXUA 2N5FA 1SYXA 3GYKA 2P31A 2GQKA 2VIMA 1FHEA 4K9ZA 5E4WA 4HOJA 4PQIA 3LORA 2A4VA 2C1YA 3DKSA 1A23A 3LGCA 1Z9HA 4TVEA 5D73A 4I5QA 1T7PB 2HE3A 3IPZA 3HDCA 4GF0A 4WR5A 5HR1A 4IKHA 2V41A 3ZFLA 1M7TA 4LMWA 5A5KA 3ZVJD 3RPPA 4LL1B 1TOFA 2X64A 4HQSA 4Z2RA 3A5IA 4H86A 4MP4A 3F6FA 5IMFA 1HD2A 3F63A 1M2AA 1URMA 3C1SA 2GTUA 3M3MA 4EC0A 2RM5A 1FB6A 4NHZA 4L8EA 1TU8A 3M9JA 1K0DA 1M0UA 5HQPA 3IK9A 2DKIA 3QCPA 4OD7A 4LL4B 2WRTA 2VLUA 3ME8A 5ECNB 4I97A 2YWIA 2KP2A 4ZILA 2V1MA 3A2XA 5HR0A 1TK8B 1AUCA 1XFLA 1YKCA 1XCCA 3FZ5A 1YJ6A 2OE1A 5CRHA 5ECLB 1IYHA 4V1Ap 1U3AA 2ZUPA 4ACSA 1MDIA 2K6VA 1X0RA 1H75A 2CQ9A 2HZEB 3QD9A 1AAZA 3GKKA 1F2EA 1GTAA 3UJ1A 1YF1A 4K5SA 2MMNA 3W8SA 2VM1A 4YQVA 4MJCA 2YZUA 5EPFA 2LNSA 1PX7A 1V57A 1S3CA 1LBKA 4EF0A 1UVZA 3WD6A 3TGZA 1GWCA 3CSJA 4GSSA 1KNGA 5ID2A 4POBA 1XOAA 1ERVA 3L9VA 1EV9A 1X5DA 3NIVA 2X49A 1B4QA 2OE3A 2ALBA 3F6DA 2IMEA 3IAM2 4OFNA 3LG6A 1B48A 2H1AA 3WYWA 4DSQA 1PD21 2AB6A 5BMUA 2WB9A 4KA0A 2JSYA 3LSZA 2H19A 1WJKA 1Z6MA 1AQWA 1AIUA 1Z5YE 4NXIA 12GSA 2HSYA 2XHFA 1HQOA 5CYYA 5G5EA 5BRTA 2R37A 2DLXA 4PNGA 1DE1A 2LS5A 2LSTA 5D9TA 2PU9C 3G9BA 1PGTA 3EPTA 5JWQB 3QAGA 1XOBA 1HNCA 4ICYA 2HSMA 4KUNA 2K18A 1XBSA 5J9CA 5B6MA 2HI7A 5ECKB 5J41A 2HSHA 2JZTA 1EOHA 1BG5A 3GKNA 1W89A 5F07A 5D9WA 5DBQA 1H4OA 6GSWA 1SYRA 1OE8A 2LRNA 5IMAA 3IXRA 1V40A 2YCDA 2GT5A 2C0DA 2H73A 5ID2B 3A3TA 3DVXA 1GSQA 1PA3A 1ST9A 1X9MB 5AIXA 3FKFA 1WMJA 2GSQA 2NPBA 2YWOA 2VAFA 4IJ3A 2OE0A 1YZXA 4TR3A 1YKAA 2AHEA 3DXBA 2X8CA 1HNBA 4G2EA 4G9HA 2C8UA 3FR6A 1M99A 5A4WA 4PNFA 5EVOA 1ABAA 1O6JA 1M3JA 4KCAA 1FB0A 4D73A 4DVCA 4JE1A 1VF2A 1TRSA 3V1WA 4PXOA 1M3IA 5DDLA 3OR5A 2VCXA 1KTEA 4Q5FA 2HNLA 3MSZA 1PFOA 5CO3A 3CRUA 3C71A 1DE2A 3HZ4A 2AJQB 3BJ5A 5A4UA 1ON4A 5J5NA 5DJMA 4BPYA 3RHCA 3ERFA 1OVNA 1YEXA 3IDVA 4POLA 1A0RP 4MJAA 3QOUA 3MWHA 2K8VA 3LW9A 4G0LA 2REMA 3FZAA 7GSSA 3RBTA 3HVXA 3TJJA 1GSDA 1Q98A 3EWLA 3TJKA 2LQQA 3ERWA 1VGLA 2L6CA 4WBJA 3FMWA 1JFUA 2CX4A 1XWCA 3H93A 4N0VA 2L59A 2NVLA 4FQUA 1XWGA 2HRNA 2DIZA 5ELGA 1LU4A 2DJ2A 1EWXA 4MZBA 5HFKA 2RIIA 2ON5A 3F4TA 5LD0A 3DRNA 4ZB6A 3IR4A 2HLSA 2NTOA 5J4UA 1WPIA 2GT6A 5G1LA 1F9MA 4IHUA 4GSTA 2IWTA 2LTKA 4WETA 1FOVA 2C3QA 4JZQA 4IVFA 4GLTA 2A2RA 1UA5A 1GSEA 4ZBDA 3ME7A 4IBPA 1XZOA 3N5OA 4EO3A 4TKYA 3TOTA 2XPEA 5J3RA 3QAWA 1GLPA 3ZITA 1FG4A 1TXXA 2O7KA 3EE2A 1PL1A 2WZ9A 3R3EA 3GNJA 5HR3A 2FA8A 3E3EA 1OKTA 2JZRA 2M72A 2FCHA 4NAXA 2QA2A 3UBLA 3LQ7A 2DBCA 1THXA 4FH8A 5KOWA 3P2AA 2ZCTA 1FW1A 2V2GA 3FK8A 1T1VA 3EC3A 4MZCA 3H79A 3WGDA 4ZBBA 4YQUA 4IP1A 4PQ1A 4KF9A 1HNAA 4GCIA 2KLXA 4Q5QA 2B3SA 4BIKA 1UN2A 2FWHA 5HR2A 5JCGA 2LJKA 1G0TA 1TTZA 1SL0B 4MJBA 4TR4A 4BL7A 4OWYA 3Q19A 5D96A 5DALA 3L9UA 4KX4A 3TUEA 3IHGA 2WS2A 2BJXA 4F2IA 4MPGA 4F0CA 2X8HA 5EY6A 1A2LA 8GSSA 4DSSA 1U6TA 4K0NA 3VK9A 2CA8A 1R26A 2PVQA 3D4TA 2B7KA 2FD3A 4XCSA 1LJRA 4IN0A 1N8JA 20GSA 1SL1B 2GLRA 3F3QA 2EC4A 3TOUA 3KP8A 5ECMB 2FNOA 3TKPA 2VCWA 1ZL9A 1W4VA 4OCFA 5GZZB 4ZXGA 4AGSA 4X0XA 4CY8A 1EOGA 1Z7RA 4K2DA 2DJKA 3P8WA 1T4YA 1C72A 1CQHA 4EDYA 4AJ7A 4HQZA 1BX9A 4FYUA 4OFTA 2C80A 1YY7A 1SJIA 4TOPA 3CBUA 4XRAA 2GSSA 6GSYA 1ZOFA 4DEJA 4ID0A 2NDOA 3KZQA 4K8MA 1K0AA 3IBHA 2J23A 3DEXA 3BCIA 1M9AA 3KD0A 1ZYNA 2C0EA 3GX0A 3MNGA 5GAPD 3HJMA 3APOA 4MNNA 2GVPA 1X9SB 2D2ZA 4K6XA 2L6DA 2JADA 2QKEA 1K3YA 1Q4JA 1R7HA 5C04A 2H6XA 4KW6A 2B5XA 2GGTA 2YPMA 1BYEA 1KEBA 3CQFA 3CYNA 1TP9A 3E0UA 4WF5A 4K2XA 3PH9A 2R0GA 4O5QA 3IRAA 4BWQA 2BTOT 2R2JA 2X99A 2EIRA 5C00A 3H4KA 1V9WA 2FWGA 2CZ2A 1JHBA 1AQVA 2MMZA 4YKGA 1THOA 1CQGA 2GZYA 19GSA 2C0GA 3GV1A 3G7IA 4IS0A 4ML6A 4O5RA 1SKRB 1X5CA 2FWEA 3D0ZA 4HZ2A 3IHQA 1RW1A 3HY2A 3KM6A 1TRWA 2G2QA 2JACA 4AJ6A 2LRCA 2H1GA 3D4MA 1VF3A 3ZMLA 5IM9A 5IMDA 1NM3A 3GL3A 3GX8A 4HZ4A 2I9HA 2L5OA 3QFBC 2YWNA 2CVKA 1EGRA 1SK2A 4Z2UA 1ZYQB 4BVXA 2YOIA 3BCKA 4LA1A 3KP9A 1JZRA 2CVBA 1AQXA 3TKRA 2DKHA 3UOMA 5KN1A 1AC1A 1ZGNA 4FYCA 6GSUA 5LNKe 4F82A 1JLWA 3Q18A 2GSRA 1XW6A 3PGTA 4XS4B 4XTSA 5G1KA 1EGOA 5J9BA 1XVQA 1SD9A 4DSRA 4IGJA 1GTBA 14GSA 1F3BA 1XVWA 5FWGA 5IPGA 4TW5A 5FT3A 1JZOA 3ZTLA 2YJ7A 1ZZYA 2R6KA 3GFKA 1TK0B 2B5EA 2VD1A 6GSXA 1GTIA 2GZZA 1ACVA 2DJ3A 4GQFA 2LKUA 1GNEA 5AN1A 2JU5A 3KJYA 1ML6A 3Q6OA 5ECOB 3VFIA 2YJHA 2M80A 1WWJA 2XC2A 3CMIA 1OC8A 1U87A 1G6YA 2F8AA 2V32A 5LCZA 1EZKA 2LUSA 2VCTA 4TR1A 1GRXA 4F9ZA 4PURA 1TI1A 2CV4A 3A2WA 4IELA 2G0FA 5AIVA 1WRYA 1HYUA 3WGXA 2F51A 3CSHA 4BA7A 3FR9A 2LV3A 3EU4A 3LJRA 3IOSA 5ECQB 2AV4A 4BVXB 5B8BA 1FO5A 4AJ8A 1GULA 3SWLA 2PBJA 4TN8A 3G7JA 1IYIA 5KN3A 3I6AA 2N5AA 2PGTA 4PX1A 4PUAA 2X4AA 4MA9A 1XWAA 4XRDA 2VL9A 2E7PA 3GURA 2CZ3A 2FY6A 1NHOA 3PR8A 3DD3A 3L0HA 2GZPA 2IPAA 3TJBA 2IL3A 2O85A 5CNWA 1I5GA 3UARA 3EU3A 3JCML 1DSBA 5GSTA 3TKSE 3E9JB 5L71A 3IC4A 2A2PA 1TW9A 5CP1A 5ECPB 3MIXA 3TJGA 4O32A 1V98A 1Z6NA 2VD0A 1SK0A 4G19A 2H76A 1GSFA 3UL3A 5D8IA 2GQLA 4LMVA 4GTUA 1GUKA 1MDKA 2KOKA 4KDYA 2H74A 4ZB8A 3IK7A 1XG8A 3WT1A 3U5RE 4TR0A 2H70A 4QQ7A 1JZDA 4CW9A 2VO4A 2ZNMA 3KH7A 2RUEA 2F3MA 1VF4A 4WKWA 1MTCA 3D22A 4N0ZA 3P90A 3HVNA 2LRTA 4HU9A 2YWMA 3I9V2 3H8QA 1OAZA 4XIHA 1OE7A 3FW2A 1PSQA 3HHVA 5IPHA 4KSOA 1VRSD 5CREA 3ZVJA 5DAKA 3VWUA 4FYBA 3VWWA 2FGXA 4J56E 3J7Yb 4HJ2A 4YQMA 4ZL7A 2HZFA 3K8NA 4Z2TA 1TU7A 1OC3A 4KAEA 1G7OA 5FHIA 3UMAA 5COHA 2O8VB 5JCUA 1O7UA 1G6WA 4LLRA 4HSCX 1J08A 3VLNA 1GH2A 2WFCA 4MMMA 2HRAA 3GH6A 5IOWA 1A24A 4HI7A 3ZYWA 2P5RA 1B9YC 2P5QA 1PKWA 4E8EA 5KOXA 3KIJA 3FZ4A 3CTGA 5G31A 5F05A 2XBIA 4IQAA 2PPTA 1M9BA 4OMVA 1J0FA 2DJ1A 3MAKA 1R5AA 3M9KA 5JWOB 4KCEA 4GRFA 1XWKA 2H6YA 2DIYA 3KGKA 5B7CA 1YDKA 2I3YA 4D73B 2Z9SA 3H1NA 4O7HA 2QGVA 3GTUA 2CX3A 3GA4A 2VUPA 1YQ1A 4MPFA 2B1KA 5ECIB 5AISA 4IP6A 2K9FA 1AW9A 3F0IA 2VL2C 3GSTA 4EVMA 4TXOA 4FIWA 3KCMA 2H72A 4EUYA 3BOAA 3M8NA 5KN0A 4BVYA 2GS3A 3UEMA 2MMAA 4K7NA 4EXJA 5DVBA 2HFDA 2F8FA 3Q74A 4V2MA 1EV4A 2VCVA 3ERGA 3KMNA 4ECCA 2IMDA 2I81A 2DSAA 4X43A 3HVVA 2B7JA 4X4JA 3VWVA 5GAND 1RQMA 1SJZA 2OBIA 3CRTA 1EP8A 4J2FA 3FZ9A 2K8SA 4EDZA 3GIXA 3G7YA 4NMUA 2NBSA 2L4CA 4WF4A 5F06A 1ZYPA 2YANA 3M1GA 4OCEA 4E8HA 3KEBA 1OC9A 5ABRA 3O6TA 4V2NA 2VOCA 5IOXA 2AUVA 3FHKA 2OKAA 1G7EA 4JRRA 3RAZA 2V6KA 3GMFA 4YH2A 4G0KA 4MH2A 1T4ZA 3TRXA 3C7MA 4QL7A 5H5RA 5CRGA 1KBNA 1PN9A 2IJYA 2XBQA 3DGQA 3P7XA 2PN8A 1Z7PA 2M46A 4HEA2 3QMXA 1TK5B 3M0FA 3I43A 2E0QA 2GQMA 1O85A 4RQXA 5HFGA 2MZCA 4TXOB 1A8YA 1TDIA 4EIQA 1Y25A 3GHAA 4JR4A 4MF5A 5CAXA 2DJJA 1GSUA 1NW2A 3TDGA 4NPBA 3VURA 5IMCA 4J57E 3D5JA 1M2DA 1WIKA 3HD5A 3F4SA 5IO0A 4KDXA 4XS1A 2WCIA 2UZ8A 1O8WA 4KNDA 5A4VA 3NOFA 1PL2A 1MD4A 3ISOA 16GSA 4G10A 3DVWA 1AXDA 3WT2A 1YEPA 2AYTA 1GUHA 2HYXA 1QGVA 2YP6A 4FO5A 2N5BA 4BWSA 3ED3A 3LXZA 1JZWA 3HZ8A 4BL7B 1XW9A 2H6ZA 4GQCA 5DALB 5F0GA 3GKMA 3EINA 5AGYA 5F8BA 2DC5A 1DBYA 4DSSB 1GUMA 3LEFA 3IAS2 4HDEA 3MYDA 1GSYA 2FA4A 3C8EA 4XHMA 1S3AA 3GH9A 5D9VA 2HXKA 4NV2A 2H0HA 4MH3A 1GL8A 2MBSA 2J9HA 3PINA 4RI7A 3F9UA 1DUGA 4L5OA 3LXTA 1PX6A 1SKSB 5B8AA 4L0UA 9GSSA 2VL3A 2RUFA 1GLQA 3C1RA 1ZYEA 3AY8A 13GSA 4KE3A 2A4HA 1F3AA 1TJDA 5G5FA 2OA7A 2FUG2 1XWBA 4TXVA 3IE3A 2RM6A 3F8UA 4N30A 2B6MA 4JBBA 4F0BA 3IC8A 3F4RA 1O73A 2H0IA 4MDCA 2H0GA 1ZMAA 2BMXA 3ZZXA 4A5PA 3CXGA 4L5LA 5DJLA 5CRDA 4L0WA 17GSA 1E6BA 3FEUA 4EIPA 1O8XA 2VLVA 4ZL9A 2KP1A 1V2AA 2WJUA 3KMOA 4MCUA 1GSSA 4I8BA 3TKSA 1M2BA 2E2MA 3ZMKA 1PRXA 3DMLA 1MDJA 2P0GA 2LQOA 3UAPA 1YF0A 5EL8A 3WGEA 2WGRA 5ECSA 2F9SA 4AF2A 3VPTA 2RLIA 4I2TA 3BD2A 4MZWA 1K3OA 10GSA 6GSSA 5H5SA 2EIQA 4ECBA 5INYA 2IFQA 2B5YA 3L9SA 3QFAC 1U3IA 2H66A 2V6OA 3TB2A 2VM2A 4WBRD 2TIRA 1MEKA 3EYTA 3W6GA 5E59A 1FAAA 3RPNA 2KHPA 4K0GA 4P3YB 1S3DA 2CAIA 4NWYA 1SKWB 5DCHA 2LJRA 1OYJA 3IV4A 4MF7A 4OFMA 1JLVA 3QAVA 3EMXA 5G2ZA 1VF1A 1SU9A 1K0OA 1A2JA 1BEDA 4KDUA 1PQNA 3DIEA 4G0IA 2O87A 1EEMA 1EP7A 2L57A 2PERA 2AAWA 4POMA 1XPVA 1A0FA 3FRCA 5IQYA 1SK1A 6GSVA 3HCZA 2C3NA 3L4NA 3CTFA 2WDUA 4ZL8A 2OADA 1BJXA 3N9JA 1R4WA 1FVJA 3DYRA 5IMZA 3HA9A 4ZBAA 2MBTA 4HJMA 1ERTA 4K5RA 2LNTA 2H75A 3GSSA 3TKSC 3UBKA 1PKZA 1NHYA 1GTUA 2ON7A 4Q5RA 5ENUA 3KTBA 2LEGA 1SENA 3D21A 4I6XA 2H01A 1K0CA 2WULA 2I4AA 4Z7XA 4IQ1A 1QUWA 3QDNA 4HS1A 3VPQA 1FVKA 2IFQB 4TR1B 2HRFA 5GSSA 1USBA 2C4JA 4ECIA 5ELAA 5DCGA 4ECJA 1TKDB 1F37A 2ES7A 3HYPA 4I2UA 1X9WB 3IA1A 3C73A 1A2MA 4MK3A 4USSA 3CSIA 4EKZA 3GUSA 1ERWA 1E2YA 2VL2A 1TRVA 2I1UA 3GL5A 1Z3EA 2PMTA 3HJPA 3VWXA 2H1DA 2IMFA 1EEJA 4K1FA 1X5EA 2IMIA 2JL4A 2GSTA 1B8XA 3KTLA 3RDWA 4ML1A 3L78A 4WXTA 1BQ7A 4ZIJA 4MLYA 4POKA 4JR6A 4MJEA 3VI5A 1QK8A 4TRXA 1S3RA 22GSA 2OACA 1PN0A 4RI6A 3LYPA 4ULXA 1T8EB 3FR3A 3O76A 1MD3A 4MABA 4MF6A 2JZSA 2HRKA 2LJAA 2DJ0A 2YV9A 1QFNA 3KXOA 2L5LA 1Y6EA 3NZNA 3ZREA 1ILOA 1B4PA 4X1UA 1F6MC 5G30A 3ZFBA 3KH9A 4K7OA 4V1Ag 1K0MA 2H71A 3O3TA 3ZRDA 4CHSA 4YAPA 3LYKA 4KH7A 5KN2A 2MYGA 1GNWA 2PWJA 2CVDA 2YN1A 3LFLA 1O81A 2VCZA 3GRXA 5DQYA 2OBKA 3UVTA 3DWVA 3I69A 4RQRA 11GSA 3VI7A 1T3BA 2QA1A 3S9FA 2KUCA 4CY6A 5D9XA 4ZB9A 3ZL5A 3HJOA 1TRUA 2FHEA 1QXHA 1K3LA 3APQA 2IN3A 2R4VA 5DAKB 5H5QA 5JWRB 3J7Yk 4ILFA 1T00A 1BAYA 1SD8A 4IW9A 4PUFC 1NSWA 3GKXA 3A5WA 3ZLPA
chains in the Genus database with same CATH topology
2FLSA 2OJLA 3QPMA 3BBYA 3HKRA 4F03A 2CAQA 4PGTA 1WE0A 2YZHA 5CRWA 2R0CA 5JCWA 1PMTA 1OKDA 2CT6A 3GN3A 2R5GA 4EL1A 3A2VA 5D93A 2L4QA 4GXZA 3EMPA 4N10A 3W8JA 4WR4A 5KEJA 4YAVA 2IIYA 3F3RA 3FYGA 3TKQA 1K0NA 2PVOC 1J9BA 3PPUA 2HT9A 4NHWA 2QC7A 2C0FA 2VLTA 2B1LA 3EVIA 4NV5A 3SBCA 3LWAA 1V58A 4KSMA 5ECRB 2GDRA 2YNXA 4GSNA 1K0BA 1B9XC 3ZIVA 4OO5A 4IJIA 1FOHA 3US3A 2JSZA 3MDKA 3TRPA 2FWFA 6GSTA 2PUKC 1ERUA 3GTUB 1WP0A 3ZIJA 4ISDA 5ECHB 3TJFA 1QMVA 2EIOA 2TRCP 4WEYA 1N2AA 1SL2B 4BVYB 3EURA 2VCQA 1U88A 4PTSA 1RK4A 3RHBA 2R0PA 3QR6A 1GP1A 4QL9A 3TCOA 4O5UA 1UC7A 1XW5A 1QQ2A 2TRXA 3U6VA 4EE0A 4K7IA 1XIYA 4V2LA 2H30A 4CDOA 2H1BA 4GWRA 4N11A 4OO4A 3TRQA 2R3XA 1A8LA 2YV7A 2C3TA 4HUAA 3R2QA 2DMLA 4JEDA 5B6NA 3FY7A 1I9DA 2DMMA 2X8GA 3HVSA 3APSA 2A2SA 2MMOA 3D6IA 1SJ6A 1WOUA 2E2GA 4RUVA 4KGIA 1ZCPA 3UVHA 4HU7A 2QSIA 4YKFA 4KB3A 1OC9B 2H8LA 2O89A 5IIZA 2XPDA 3UIWA 2IMKA 18GSA 4XS6A 4XS4A 1TI3A 4PQHA 4O92A 1R5PA 5IMVA 3HXSA 4Q5NA 5DQSA 4JU5A 2HZEA 5IO2A 5HFIA 1XXUA 2N5FA 1SYXA 3GYKA 2P31A 2GQKA 2VIMA 1FHEA 4K9ZA 5E4WA 4HOJA 4PQIA 3LORA 2A4VA 2C1YA 3DKSA 1A23A 3LGCA 1Z9HA 4TVEA 5D73A 4I5QA 1T7PB 2HE3A 3IPZA 3HDCA 4GF0A 4WR5A 5HR1A 4IKHA 2V41A 3ZFLA 1M7TA 4LMWA 5A5KA 3ZVJD 3RPPA 4LL1B 1TOFA 2X64A 4HQSA 4Z2RA 3A5IA 4H86A 4MP4A 3F6FA 5IMFA 1HD2A 3F63A 1M2AA 1URMA 3C1SA 2GTUA 3M3MA 4EC0A 2RM5A 1FB6A 4NHZA 4L8EA 1TU8A 3M9JA 1K0DA 1M0UA 5HQPA 3IK9A 2DKIA 3QCPA 4OD7A 4LL4B 2WRTA 2VLUA 3ME8A 5ECNB 4I97A 2YWIA 2KP2A 4ZILA 2V1MA 3A2XA 5HR0A 1TK8B 1AUCA 1XFLA 1YKCA 1XCCA 3FZ5A 1YJ6A 2OE1A 5CRHA 5ECLB 1IYHA 4V1Ap 1U3AA 2ZUPA 4ACSA 1MDIA 2K6VA 1X0RA 1H75A 2CQ9A 2HZEB 3QD9A 1AAZA 3GKKA 1F2EA 1GTAA 3UJ1A 1YF1A 4K5SA 2MMNA 3W8SA 2VM1A 4YQVA 4MJCA 2YZUA 5EPFA 2LNSA 1PX7A 1V57A 1S3CA 1LBKA 4EF0A 1UVZA 3WD6A 3TGZA 1GWCA 3CSJA 4GSSA 1KNGA 5ID2A 4POBA 1XOAA 1ERVA 3L9VA 1EV9A 1X5DA 3NIVA 2X49A 1B4QA 2OE3A 2ALBA 3F6DA 2IMEA 3IAM2 4OFNA 3LG6A 1B48A 2H1AA 3WYWA 4DSQA 1PD21 2AB6A 5BMUA 2WB9A 4KA0A 2JSYA 3LSZA 2H19A 1WJKA 1Z6MA 1AQWA 1AIUA 1Z5YE 4NXIA 12GSA 2HSYA 2XHFA 1HQOA 5CYYA 5G5EA 5BRTA 2R37A 2DLXA 4PNGA 1DE1A 2LS5A 2LSTA 5D9TA 2PU9C 3G9BA 1PGTA 3EPTA 5JWQB 3QAGA 1XOBA 1HNCA 4ICYA 2HSMA 4KUNA 2K18A 1XBSA 5J9CA 5B6MA 2HI7A 5ECKB 5J41A 2HSHA 2JZTA 1EOHA 1BG5A 3GKNA 1W89A 5F07A 5D9WA 5DBQA 1H4OA 6GSWA 1SYRA 1OE8A 2LRNA 5IMAA 3IXRA 1V40A 2YCDA 2GT5A 2C0DA 2H73A 5ID2B 3A3TA 3DVXA 1GSQA 1PA3A 1ST9A 1X9MB 5AIXA 3FKFA 1WMJA 2GSQA 2NPBA 2YWOA 2VAFA 4IJ3A 2OE0A 1YZXA 4TR3A 1YKAA 2AHEA 3DXBA 2X8CA 1HNBA 4G2EA 4G9HA 2C8UA 3FR6A 1M99A 5A4WA 4PNFA 5EVOA 1ABAA 1O6JA 4KCAA 1FB0A 4D73A 4DVCA 4JE1A 1VF2A 1TRSA 3V1WA 4PXOA 5DDLA 3OR5A 2VCXA 1KTEA 4Q5FA 2HNLA 3MSZA 5CO3A 3CRUA 3C71A 1DE2A 3HZ4A 2AJQB 3BJ5A 5A4UA 1ON4A 5J5NA 5DJMA 4BPYA 3RHCA 3ERFA 1OVNA 1YEXA 3IDVA 4POLA 1A0RP 4MJAA 3QOUA 3MWHA 2K8VA 3LW9A 4G0LA 2REMA 3FZAA 7GSSA 3RBTA 3HVXA 3TJJA 1GSDA 1Q98A 3EWLA 3TJKA 2LQQA 3ERWA 1VGLA 2L6CA 4WBJA 3FMWA 1JFUA 2CX4A 1XWCA 3H93A 4N0VA 2L59A 2NVLA 4FQUA 1XWGA 2HRNA 2DIZA 5ELGA 1LU4A 2DJ2A 1EWXA 4MZBA 5HFKA 2RIIA 2ON5A 3F4TA 5LD0A 3DRNA 4ZB6A 3IR4A 2HLSA 2NTOA 5J4UA 1WPIA 2GT6A 5G1LA 1F9MA 4IHUA 4GSTA 2IWTA 2LTKA 4WETA 1FOVA 2C3QA 4JZQA 4IVFA 4GLTA 2A2RA 1UA5A 1GSEA 4ZBDA 3ME7A 4IBPA 1XZOA 3N5OA 4EO3A 4TKYA 3TOTA 2XPEA 5J3RA 3QAWA 1GLPA 3ZITA 1FG4A 1TXXA 2O7KA 3EE2A 1PL1A 2WZ9A 3R3EA 3GNJA 5HR3A 2FA8A 3E3EA 1OKTA 2JZRA 2M72A 2FCHA 4NAXA 2QA2A 3UBLA 3LQ7A 2DBCA 1THXA 4FH8A 5KOWA 3P2AA 2ZCTA 1FW1A 2V2GA 3FK8A 1T1VA 3EC3A 4MZCA 3H79A 3WGDA 4ZBBA 4YQUA 4IP1A 4PQ1A 4KF9A 1HNAA 4GCIA 2KLXA 4Q5QA 2B3SA 1UN2A 2FWHA 5HR2A 5JCGA 2LJKA 1G0TA 1TTZA 1SL0B 4MJBA 4TR4A 4BL7A 4OWYA 3Q19A 5D96A 5DALA 3L9UA 4KX4A 3TUEA 3IHGA 2WS2A 2BJXA 4F2IA 4MPGA 4F0CA 2X8HA 5EY6A 1A2LA 8GSSA 4DSSA 1U6TA 4K0NA 3VK9A 2CA8A 1R26A 2PVQA 3D4TA 2B7KA 2FD3A 4XCSA 1LJRA 4IN0A 1N8JA 20GSA 1SL1B 2GLRA 3F3QA 2EC4A 3TOUA 3KP8A 5ECMB 2FNOA 3TKPA 2VCWA 1ZL9A 1W4VA 4OCFA 5GZZB 4ZXGA 4AGSA 4X0XA 4CY8A 1EOGA 1Z7RA 4K2DA 2DJKA 3P8WA 1T4YA 1C72A 1CQHA 4EDYA 4AJ7A 4HQZA 1BX9A 4FYUA 4OFTA 2C80A 1YY7A 1SJIA 4TOPA 3CBUA 4XRAA 2GSSA 6GSYA 1ZOFA 4DEJA 4ID0A 2NDOA 3KZQA 4K8MA 1K0AA 3IBHA 2J23A 3DEXA 3BCIA 1M9AA 3KD0A 1ZYNA 2C0EA 3GX0A 3MNGA 5GAPD 3HJMA 3APOA 4MNNA 2GVPA 1X9SB 2D2ZA 4K6XA 2L6DA 2JADA 2QKEA 1K3YA 1Q4JA 1R7HA 5C04A 2H6XA 4KW6A 2B5XA 2GGTA 2YPMA 1BYEA 1KEBA 3CYNA 1TP9A 3E0UA 4WF5A 4K2XA 3PH9A 2R0GA 4O5QA 3IRAA 4BWQA 2BTOT 2R2JA 2X99A 2EIRA 5C00A 3H4KA 1V9WA 2FWGA 2CZ2A 1JHBA 1AQVA 2MMZA 4YKGA 1THOA 1CQGA 2GZYA 19GSA 2C0GA 3GV1A 3G7IA 4IS0A 4ML6A 4O5RA 1SKRB 1X5CA 2FWEA 3D0ZA 4HZ2A 3IHQA 1RW1A 3HY2A 3KM6A 1TRWA 2G2QA 2JACA 4AJ6A 2LRCA 2H1GA 3D4MA 1VF3A 3ZMLA 5IM9A 5IMDA 1NM3A 3GL3A 3GX8A 4HZ4A 2I9HA 2L5OA 3QFBC 2YWNA 2CVKA 1EGRA 1SK2A 4Z2UA 1ZYQB 4BVXA 2YOIA 3BCKA 4LA1A 3KP9A 1JZRA 2CVBA 1AQXA 3TKRA 2DKHA 3UOMA 5KN1A 1AC1A 1ZGNA 4FYCA 6GSUA 5LNKe 4F82A 1JLWA 3Q18A 2GSRA 1XW6A 3PGTA 4XS4B 4XTSA 5G1KA 1EGOA 5J9BA 1XVQA 1SD9A 4DSRA 4IGJA 1GTBA 14GSA 1F3BA 1XVWA 5FWGA 5IPGA 4TW5A 5FT3A 1JZOA 3ZTLA 2YJ7A 1ZZYA 2R6KA 3GFKA 1TK0B 2B5EA 2VD1A 6GSXA 1GTIA 2GZZA 1ACVA 2DJ3A 4GQFA 2LKUA 1GNEA 5AN1A 2JU5A 3KJYA 1ML6A 3Q6OA 5ECOB 3VFIA 2YJHA 2M80A 1WWJA 2XC2A 3CMIA 1OC8A 1U87A 1G6YA 2F8AA 2V32A 5LCZA 1EZKA 2LUSA 2VCTA 4TR1A 1GRXA 4F9ZA 4PURA 1TI1A 2CV4A 3A2WA 4IELA 2G0FA 5AIVA 1WRYA 1HYUA 3WGXA 2F51A 3CSHA 4BA7A 3FR9A 2LV3A 3EU4A 3LJRA 3IOSA 5ECQB 2AV4A 4BVXB 5B8BA 1FO5A 4AJ8A 1GULA 3SWLA 2PBJA 4TN8A 3G7JA 1IYIA 5KN3A 3I6AA 2N5AA 2PGTA 4PX1A 4PUAA 2X4AA 4MA9A 1XWAA 4XRDA 2VL9A 2E7PA 3GURA 2CZ3A 2FY6A 1NHOA 3PR8A 3DD3A 3L0HA 2GZPA 2IPAA 3TJBA 2IL3A 2O85A 5CNWA 1I5GA 3UARA 3EU3A 3JCML 1DSBA 5GSTA 3TKSE 3E9JB 5L71A 3IC4A 2A2PA 1TW9A 5CP1A 5ECPB 3MIXA 3TJGA 4O32A 1V98A 1Z6NA 2VD0A 1SK0A 4G19A 2H76A 1GSFA 3UL3A 5D8IA 2GQLA 4LMVA 4GTUA 1GUKA 1MDKA 2KOKA 4KDYA 2H74A 4ZB8A 3IK7A 3WT1A 3U5RE 4TR0A 2H70A 4QQ7A 1JZDA 4CW9A 2VO4A 2ZNMA 3KH7A 2RUEA 2F3MA 1VF4A 4WKWA 1MTCA 3D22A 4N0ZA 3P90A 2LRTA 4HU9A 2YWMA 3I9V2 3H8QA 1OAZA 4XIHA 1OE7A 3FW2A 1PSQA 3HHVA 5IPHA 4KSOA 1VRSD 5CREA 3ZVJA 5DAKA 3VWUA 4FYBA 3VWWA 2FGXA 4J56E 3J7Yb 4HJ2A 4YQMA 4ZL7A 2HZFA 3K8NA 4Z2TA 1TU7A 1OC3A 4KAEA 1G7OA 5FHIA 3UMAA 5COHA 2O8VB 5JCUA 1O7UA 1G6WA 4LLRA 1J08A 3VLNA 1GH2A 2WFCA 4MMMA 2HRAA 3GH6A 5IOWA 1A24A 4HI7A 3ZYWA 2P5RA 1B9YC 2P5QA 1PKWA 4E8EA 5KOXA 3KIJA 3FZ4A 3CTGA 5G31A 5F05A 2XBIA 4IQAA 2PPTA 1M9BA 4OMVA 1J0FA 2DJ1A 3MAKA 1R5AA 3M9KA 5JWOB 4KCEA 4GRFA 1XWKA 2H6YA 2DIYA 3KGKA 5B7CA 1YDKA 2I3YA 4D73B 2Z9SA 3H1NA 4O7HA 2QGVA 3GTUA 2CX3A 3GA4A 2VUPA 1YQ1A 4MPFA 2B1KA 5ECIB 5AISA 4IP6A 2K9FA 1AW9A 3F0IA 2VL2C 3GSTA 4EVMA 4TXOA 4FIWA 3KCMA 2H72A 4EUYA 3BOAA 3M8NA 5KN0A 4BVYA 2GS3A 3UEMA 2MMAA 4K7NA 4EXJA 5DVBA 2HFDA 2F8FA 3Q74A 4V2MA 1EV4A 2VCVA 3ERGA 3KMNA 4ECCA 2IMDA 2I81A 2DSAA 4X43A 3HVVA 2B7JA 4X4JA 3VWVA 5GAND 1RQMA 1SJZA 2OBIA 3CRTA 1EP8A 4J2FA 3FZ9A 2K8SA 4EDZA 3GIXA 3G7YA 4NMUA 2NBSA 2L4CA 4WF4A 5F06A 1ZYPA 2YANA 3M1GA 4OCEA 4E8HA 3KEBA 1OC9A 5ABRA 3O6TA 4V2NA 2VOCA 5IOXA 2AUVA 3FHKA 2OKAA 1G7EA 4JRRA 3RAZA 2V6KA 3GMFA 4YH2A 4G0KA 4MH2A 1T4ZA 3TRXA 3C7MA 4QL7A 5H5RA 5CRGA 1KBNA 1PN9A 2IJYA 2XBQA 3DGQA 3P7XA 2PN8A 1Z7PA 2M46A 4HEA2 3QMXA 1TK5B 3M0FA 3I43A 2E0QA 2GQMA 1O85A 4RQXA 5HFGA 2MZCA 4TXOB 1A8YA 1TDIA 4EIQA 1Y25A 3GHAA 4JR4A 4MF5A 5CAXA 2DJJA 1GSUA 1NW2A 3TDGA 4NPBA 3VURA 5IMCA 4J57E 3D5JA 1M2DA 1WIKA 3HD5A 3F4SA 5IO0A 4KDXA 4XS1A 2WCIA 2UZ8A 1O8WA 4KNDA 5A4VA 3NOFA 1PL2A 1MD4A 3ISOA 16GSA 4G10A 3DVWA 1AXDA 3WT2A 1YEPA 2AYTA 1GUHA 2HYXA 1QGVA 2YP6A 4FO5A 2N5BA 4BWSA 3ED3A 3LXZA 1JZWA 3HZ8A 4BL7B 1XW9A 2H6ZA 4GQCA 5DALB 5F0GA 3GKMA 3EINA 5AGYA 5F8BA 2DC5A 1DBYA 4DSSB 1GUMA 3LEFA 3IAS2 4HDEA 3MYDA 1GSYA 2FA4A 3C8EA 4XHMA 1S3AA 3GH9A 5D9VA 2HXKA 4NV2A 2H0HA 4MH3A 1GL8A 2MBSA 2J9HA 3PINA 4RI7A 3F9UA 1DUGA 4L5OA 3LXTA 1PX6A 1SKSB 5B8AA 4L0UA 9GSSA 2VL3A 2RUFA 1GLQA 3C1RA 1ZYEA 3AY8A 13GSA 4KE3A 2A4HA 1F3AA 1TJDA 5G5FA 2OA7A 2FUG2 1XWBA 4TXVA 3IE3A 2RM6A 3F8UA 4N30A 2B6MA 4JBBA 4F0BA 3IC8A 3F4RA 1O73A 2H0IA 4MDCA 2H0GA 1ZMAA 2BMXA 3ZZXA 4A5PA 3CXGA 4L5LA 5DJLA 5CRDA 4L0WA 17GSA 1E6BA 3FEUA 4EIPA 1O8XA 2VLVA 4ZL9A 2KP1A 1V2AA 2WJUA 3KMOA 4MCUA 1GSSA 4I8BA 3TKSA 1M2BA 2E2MA 3ZMKA 1PRXA 3DMLA 1MDJA 2P0GA 2LQOA 3UAPA 1YF0A 5EL8A 3WGEA 2WGRA 5ECSA 2F9SA 4AF2A 3VPTA 2RLIA 4I2TA 3BD2A 4MZWA 1K3OA 10GSA 6GSSA 5H5SA 2EIQA 4ECBA 5INYA 2IFQA 2B5YA 3L9SA 3QFAC 1U3IA 2H66A 2V6OA 3TB2A 2VM2A 4WBRD 2TIRA 1MEKA 3EYTA 3W6GA 5E59A 1FAAA 3RPNA 2KHPA 4K0GA 4P3YB 1S3DA 2CAIA 4NWYA 1SKWB 5DCHA 2LJRA 1OYJA 3IV4A 4MF7A 4OFMA 1JLVA 3QAVA 3EMXA 5G2ZA 1VF1A 1SU9A 1K0OA 1A2JA 1BEDA 4KDUA 1PQNA 3DIEA 4G0IA 2O87A 1EEMA 1EP7A 2L57A 2PERA 2AAWA 4POMA 1XPVA 1A0FA 3FRCA 5IQYA 1SK1A 6GSVA 3HCZA 2C3NA 3L4NA 3CTFA 2WDUA 4ZL8A 2OADA 1BJXA 3N9JA 1R4WA 1FVJA 3DYRA 5IMZA 3HA9A 4ZBAA 2MBTA 4HJMA 1ERTA 4K5RA 2LNTA 2H75A 3GSSA 3TKSC 3UBKA 1PKZA 1NHYA 1GTUA 2ON7A 4Q5RA 5ENUA 3KTBA 2LEGA 1SENA 3D21A 4I6XA 2H01A 1K0CA 2WULA 2I4AA 4Z7XA 4IQ1A 1QUWA 3QDNA 4HS1A 3VPQA 1FVKA 2IFQB 4TR1B 2HRFA 5GSSA 1USBA 2C4JA 4ECIA 5ELAA 5DCGA 4ECJA 1TKDB 1F37A 2ES7A 3HYPA 4I2UA 1X9WB 3IA1A 3C73A 1A2MA 4MK3A 4USSA 3CSIA 4EKZA 3GUSA 1ERWA 1E2YA 2VL2A 1TRVA 2I1UA 3GL5A 1Z3EA 2PMTA 3HJPA 3VWXA 2H1DA 2IMFA 1EEJA 4K1FA 1X5EA 2IMIA 2JL4A 2GSTA 1B8XA 3KTLA 3RDWA 4ML1A 3L78A 4WXTA 1BQ7A 4ZIJA 4MLYA 4POKA 4JR6A 4MJEA 3VI5A 1QK8A 4TRXA 22GSA 2OACA 1PN0A 4RI6A 3LYPA 4ULXA 1T8EB 3FR3A 3O76A 1MD3A 4MABA 4MF6A 2JZSA 2HRKA 2LJAA 2DJ0A 2YV9A 1QFNA 3KXOA 2L5LA 1Y6EA 3NZNA 3ZREA 1ILOA 1B4PA 4X1UA 1F6MC 5G30A 3ZFBA 3KH9A 4K7OA 4V1Ag 1K0MA 2H71A 3O3TA 3ZRDA 4CHSA 4YAPA 3LYKA 4KH7A 5KN2A 2MYGA 1GNWA 2PWJA 2CVDA 2YN1A 3LFLA 1O81A 2VCZA 3GRXA 5DQYA 2OBKA 3UVTA 3DWVA 3I69A 4RQRA 11GSA 3VI7A 1T3BA 2QA1A 3S9FA 2KUCA 4CY6A 5D9XA 4ZB9A 3ZL5A 3HJOA 1TRUA 2FHEA 1QXHA 1K3LA 3APQA 2IN3A 2R4VA 5DAKB 5H5QA 5JWRB 3J7Yk 4ILFA 1T00A 1BAYA 1SD8A 4IW9A 4PUFC 1NSWA 3GKXA 3A5WA 3ZLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FLS A;  2OJL A;  3QPM A;  3BBY A;  3HKR A;  4F03 A;  2CAQ A;  4PGT A;  1WE0 A;  2YZH A;  5CRW A;  5JCW A;  1PMT A;  1OKD A;  2CT6 A;  3GN3 A;  2R5G A;  4EL1 A;  3A2V A;  5D93 A;  2L4Q A;  4GXZ A;  3EMP A;  4N10 A;  3W8J A;  4WR4 A;  5KEJ A;  4YAV A;  2IIY A;  3F3R A;  3FYG A;  3TKQ A;  1K0N A;  2PVO C;  1J9B A;  2HT9 A;  4NHW A;  2QC7 A;  2C0F A;  2VLT A;  2B1L A;  3EVI A;  4NV5 A;  3SBC A;  3LWA A;  1V58 A;  4KSM A;  5ECR B;  2GDR A;  2YNX A;  4GSN A;  1K0B A;  1B9X C;  3ZIV A;  4OO5 A;  4IJI A;  3US3 A;  2JSZ A;  3MDK A;  3TRP A;  2FWF A;  6GST A;  2PUK C;  1ERU A;  3GTU B;  1WP0 A;  3ZIJ A;  4ISD A;  5ECH B;  3TJF A;  1QMV A;  2EIO A;  2TRC P;  4WEY A;  1N2A A;  1SL2 B;  3EUR A;  2VCQ A;  1U88 A;  1RK4 A;  3RHB A;  3QR6 A;  1GP1 A;  4QL9 A;  3TCO A;  1UC7 A;  1XW5 A;  1QQ2 A;  2TRX A;  3U6V A;  4EE0 A;  4K7I A;  1XIY A;  4V2L A;  2H30 A;  4CDO A;  2H1B A;  4GWR A;  4N11 A;  4OO4 A;  3TRQ A;  2R3X A;  1A8L A;  2YV7 A;  2C3T A;  4HUA A;  3R2Q A;  2DML A;  4JED A;  5B6N A;  3FY7 A;  1I9D A;  2DMM A;  2X8G A;  3HVS A;  3APS A;  2A2S A;  2MMO A;  3D6I A;  1SJ6 A;  1WOU A;  2E2G A;  4RUV A;  4KGI A;  1ZCP A;  3UVH A;  4HU7 A;  2QSI A;  4KB3 A;  1OC9 B;  2H8L A;  2O89 A;  5IIZ A;  2XPD A;  3UIW A;  2IMK A;  18GS A;  4XS6 A;  4XS4 A;  1TI3 A;  4PQH A;  4O92 A;  1R5P A;  5IMV A;  3HXS A;  4Q5N A;  5DQS A;  4JU5 A;  2HZE A;  5IO2 A;  5HFI A;  1XXU A;  2N5F A;  1SYX A;  3GYK A;  2P31 A;  2GQK A;  2VIM A;  1FHE A;  4K9Z A;  5E4W A;  4HOJ A;  4PQI A;  3LOR A;  2A4V A;  2C1Y A;  3DKS A;  1A23 A;  3LGC A;  1Z9H A;  4TVE A;  5D73 A;  4I5Q A;  1T7P B;  2HE3 A;  3IPZ A;  3HDC A;  4GF0 A;  4WR5 A;  5HR1 A;  4IKH A;  2V41 A;  3ZFL A;  1M7T A;  4LMW A;  5A5K A;  3ZVJ D;  3RPP A;  4LL1 B;  1TOF A;  2X64 A;  4HQS A;  4H86 A;  4MP4 A;  3F6F A;  5IMF A;  1HD2 A;  3F63 A;  1M2A A;  1URM A;  3C1S A;  2GTU A;  3M3M A;  4EC0 A;  2RM5 A;  1FB6 A;  4NHZ A;  4L8E A;  1TU8 A;  3M9J A;  1K0D A;  1M0U A;  5HQP A;  3IK9 A;  3QCP A;  4OD7 A;  4LL4 B;  2WRT A;  2VLU A;  3ME8 A;  5ECN B;  4I97 A;  2YWI A;  2KP2 A;  4ZIL A;  2V1M A;  3A2X A;  5HR0 A;  1TK8 B;  1AUC A;  1XFL A;  1YKC A;  1XCC A;  3FZ5 A;  1YJ6 A;  2OE1 A;  5CRH A;  5ECL B;  1IYH A;  4V1A p;  1U3A A;  2ZUP A;  4ACS A;  1MDI A;  2K6V A;  1X0R A;  1H75 A;  2CQ9 A;  2HZE B;  3QD9 A;  1AAZ A;  3GKK A;  1F2E A;  1GTA A;  3UJ1 A;  1YF1 A;  2MMN A;  3W8S A;  2VM1 A;  4YQV A;  4MJC A;  2YZU A;  5EPF A;  2LNS A;  1PX7 A;  1V57 A;  1S3C A;  1LBK A;  4EF0 A;  1UVZ A;  3WD6 A;  3TGZ A;  1GWC A;  3CSJ A;  4GSS A;  1KNG A;  5ID2 A;  4POB A;  1XOA A;  1ERV A;  3L9V A;  1EV9 A;  1X5D A;  3NIV A;  1B4Q A;  2OE3 A;  2ALB A;  3F6D A;  2IME A;  3IAM 2;  4OFN A;  3LG6 A;  1B48 A;  2H1A A;  3WYW A;  4DSQ A;  1PD2 1;  2AB6 A;  2WB9 A;  4KA0 A;  2JSY A;  3LSZ A;  2H19 A;  1WJK A;  1Z6M A;  1AQW A;  1AIU A;  1Z5Y E;  4NXI A;  12GS A;  2HSY A;  2XHF A;  1HQO A;  5CYY A;  5G5E A;  2R37 A;  2DLX A;  4PNG A;  1DE1 A;  2LS5 A;  2LST A;  5D9T A;  2PU9 C;  3G9B A;  1PGT A;  5JWQ B;  3QAG A;  1XOB A;  1HNC A;  4KUN A;  2K18 A;  1XBS A;  5J9C A;  5B6M A;  2HI7 A;  5ECK B;  5J41 A;  2HSH A;  2JZT A;  1EOH A;  1BG5 A;  3GKN A;  1W89 A;  5F07 A;  5D9W A;  5DBQ A;  1H4O A;  6GSW A;  1SYR A;  1OE8 A;  2LRN A;  5IMA A;  3IXR A;  1V40 A;  2YCD A;  2GT5 A;  2C0D A;  2H73 A;  5ID2 B;  3A3T A;  3DVX A;  1GSQ A;  1PA3 A;  1ST9 A;  1X9M B;  5AIX A;  3FKF A;  1WMJ A;  2GSQ A;  2NPB A;  2YWO A;  2VAF A;  4IJ3 A;  2OE0 A;  1YZX A;  4TR3 A;  1YKA A;  2AHE A;  3DXB A;  2X8C A;  1HNB A;  4G2E A;  4G9H A;  2C8U A;  3FR6 A;  1M99 A;  5A4W A;  4PNF A;  5EVO A;  1ABA A;  1O6J A;  4KCA A;  1FB0 A;  4D73 A;  4DVC A;  4JE1 A;  1VF2 A;  1TRS A;  3V1W A;  4PXO A;  5DDL A;  3OR5 A;  2VCX A;  1KTE A;  4Q5F A;  2HNL A;  3MSZ A;  5CO3 A;  3CRU A;  3C71 A;  1DE2 A;  3HZ4 A;  2AJQ B;  3BJ5 A;  5A4U A;  1ON4 A;  5J5N A;  5DJM A;  4BPY A;  3RHC A;  3ERF A;  1OVN A;  1YEX A;  3IDV A;  4POL A;  1A0R P;  4MJA A;  3QOU A;  3MWH A;  2K8V A;  2REM A;  3FZA A;  7GSS A;  3RBT A;  3HVX A;  3TJJ A;  1GSD A;  1Q98 A;  3EWL A;  3TJK A;  2LQQ A;  3ERW A;  1VGL A;  2L6C A;  4WBJ A;  1JFU A;  2CX4 A;  1XWC A;  3H93 A;  4N0V A;  2L59 A;  2NVL A;  1XWG A;  2HRN A;  2DIZ A;  5ELG A;  1LU4 A;  2DJ2 A;  1EWX A;  4MZB A;  5HFK A;  2RII A;  2ON5 A;  3F4T A;  5LD0 A;  3DRN A;  4ZB6 A;  3IR4 A;  2HLS A;  2NTO A;  5J4U A;  1WPI A;  2GT6 A;  5G1L A;  1F9M A;  4IHU A;  4GST A;  2IWT A;  2LTK A;  4WET A;  1FOV A;  2C3Q A;  4JZQ A;  4IVF A;  4GLT A;  2A2R A;  1UA5 A;  1GSE A;  4ZBD A;  3ME7 A;  4IBP A;  1XZO A;  3N5O A;  4EO3 A;  4TKY A;  3TOT A;  2XPE A;  5J3R A;  3QAW A;  1GLP A;  3ZIT A;  1FG4 A;  1TXX A;  2O7K A;  3EE2 A;  1PL1 A;  2WZ9 A;  3GNJ A;  5HR3 A;  2FA8 A;  3E3E A;  1OKT A;  2JZR A;  2M72 A;  2FCH A;  4NAX A;  3UBL A;  3LQ7 A;  2DBC A;  1THX A;  4FH8 A;  3P2A A;  2ZCT A;  1FW1 A;  2V2G A;  3FK8 A;  1T1V A;  3EC3 A;  4MZC A;  3H79 A;  3WGD A;  4ZBB A;  4YQU A;  4IP1 A;  4PQ1 A;  1HNA A;  4GCI A;  2KLX A;  4Q5Q A;  2B3S A;  1UN2 A;  2FWH A;  5HR2 A;  5JCG A;  2LJK A;  1G0T A;  1TTZ A;  1SL0 B;  4MJB A;  4TR4 A;  4BL7 A;  4OWY A;  3Q19 A;  5D96 A;  5DAL A;  3L9U A;  4KX4 A;  3TUE A;  2WS2 A;  2BJX A;  4F2I A;  4MPG A;  4F0C A;  2X8H A;  5EY6 A;  1A2L A;  8GSS A;  4DSS A;  1U6T A;  4K0N A;  3VK9 A;  2CA8 A;  1R26 A;  2PVQ A;  3D4T A;  2B7K A;  2FD3 A;  4XCS A;  1LJR A;  4IN0 A;  1N8J A;  20GS A;  1SL1 B;  2GLR A;  3F3Q A;  2EC4 A;  3TOU A;  3KP8 A;  5ECM B;  2FNO A;  3TKP A;  2VCW A;  1ZL9 A;  1W4V A;  4OCF A;  5GZZ B;  4ZXG A;  4AGS A;  4X0X A;  1EOG A;  1Z7R A;  4K2D A;  2DJK A;  3P8W A;  1T4Y A;  1C72 A;  1CQH A;  4EDY A;  4AJ7 A;  4HQZ A;  1BX9 A;  4FYU A;  4OFT A;  2C80 A;  1YY7 A;  1SJI A;  4TOP A;  3CBU A;  4XRA A;  2GSS A;  6GSY A;  1ZOF A;  4DEJ A;  4ID0 A;  2NDO A;  3KZQ A;  4K8M A;  1K0A A;  3IBH A;  2J23 A;  3DEX A;  3BCI A;  1M9A A;  3KD0 A;  2C0E A;  3GX0 A;  3MNG A;  5GAP D;  3HJM A;  3APO A;  2GVP A;  1X9S B;  2D2Z A;  4K6X A;  2L6D A;  2JAD A;  2QKE A;  1K3Y A;  1Q4J A;  1R7H A;  5C04 A;  2H6X A;  2B5X A;  2GGT A;  2YPM A;  4KW6 A;  1BYE A;  1KEB A;  3CYN A;  1TP9 A;  3E0U A;  4WF5 A;  3PH9 A;  3IRA A;  4BWQ A;  2BTO T;  2R2J A;  2X99 A;  2EIR A;  5C00 A;  3H4K A;  1V9W A;  2FWG A;  2CZ2 A;  1JHB A;  1AQV A;  2MMZ A;  1THO A;  1CQG A;  2GZY A;  19GS A;  2C0G A;  3GV1 A;  3G7I A;  4IS0 A;  4ML6 A;  4O5R A;  1SKR B;  1X5C A;  2FWE A;  3D0Z A;  4HZ2 A;  3IHQ A;  1RW1 A;  3HY2 A;  3KM6 A;  1TRW A;  2G2Q A;  2JAC A;  4AJ6 A;  2LRC A;  2H1G A;  3D4M A;  1VF3 A;  3ZML A;  5IM9 A;  5IMD A;  1NM3 A;  3GL3 A;  3GX8 A;  4HZ4 A;  2I9H A;  2L5O A;  3QFB C;  2YWN A;  2CVK A;  1EGR A;  1SK2 A;  1ZYQ B;  4BVX A;  2YOI A;  3BCK A;  4LA1 A;  3KP9 A;  1JZR A;  2CVB A;  1AQX A;  3TKR A;  3UOM A;  5KN1 A;  1AC1 A;  1ZGN A;  4FYC A;  6GSU A;  5LNK e;  4F82 A;  1JLW A;  3Q18 A;  2GSR A;  1XW6 A;  3PGT A;  4XS4 B;  4XTS A;  5G1K A;  1EGO A;  5J9B A;  1XVQ A;  1SD9 A;  4DSR A;  4IGJ A;  1GTB A;  14GS A;  1F3B A;  1XVW A;  5FWG A;  5IPG A;  4TW5 A;  5FT3 A;  1JZO A;  3ZTL A;  2YJ7 A;  1ZZY A;  2R6K A;  3GFK A;  1TK0 B;  2B5E A;  2VD1 A;  6GSX A;  1GTI A;  2GZZ A;  1ACV A;  2DJ3 A;  4GQF A;  2LKU A;  1GNE A;  5AN1 A;  2JU5 A;  3KJY A;  1ML6 A;  3Q6O A;  5ECO B;  3VFI A;  2YJH A;  2M80 A;  1WWJ A;  2XC2 A;  3CMI A;  1OC8 A;  1U87 A;  1G6Y A;  2F8A A;  2V32 A;  5LCZ A;  1EZK A;  2LUS A;  2VCT A;  4TR1 A;  1GRX A;  4F9Z A;  4PUR A;  1TI1 A;  2CV4 A;  3A2W A;  4IEL A;  2G0F A;  5AIV A;  1WRY A;  1HYU A;  3WGX A;  2F51 A;  3CSH A;  4BA7 A;  3FR9 A;  2LV3 A;  3EU4 A;  3LJR A;  3IOS A;  5ECQ B;  2AV4 A;  5B8B A;  1FO5 A;  4AJ8 A;  1GUL A;  3SWL A;  2PBJ A;  4TN8 A;  3G7J A;  1IYI A;  5KN3 A;  3I6A A;  2N5A A;  2PGT A;  4PX1 A;  4PUA A;  4MA9 A;  1XWA A;  4XRD A;  2VL9 A;  2E7P A;  3GUR A;  2CZ3 A;  2FY6 A;  1NHO A;  3PR8 A;  3DD3 A;  3L0H A;  2GZP A;  2IPA A;  3TJB A;  2IL3 A;  2O85 A;  5CNW A;  1I5G A;  3UAR A;  3EU3 A;  3JCM L;  1DSB A;  5GST A;  3TKS E;  3E9J B;  5L71 A;  3IC4 A;  1TW9 A;  5CP1 A;  5ECP B;  3TJG A;  4O32 A;  1V98 A;  1Z6N A;  2VD0 A;  1SK0 A;  4G19 A;  2H76 A;  1GSF A;  3UL3 A;  5D8I A;  2GQL A;  4LMV A;  4GTU A;  1GUK A;  1MDK A;  2KOK A;  4KDY A;  2H74 A;  4ZB8 A;  3IK7 A;  3WT1 A;  3U5R E;  4TR0 A;  2H70 A;  4QQ7 A;  1JZD A;  4CW9 A;  2VO4 A;  2ZNM A;  3KH7 A;  2RUE A;  2F3M A;  1VF4 A;  4WKW A;  1MTC A;  3D22 A;  4N0Z A;  3P90 A;  2LRT A;  4HU9 A;  2YWM A;  3I9V 2;  3H8Q A;  1OAZ A;  4XIH A;  1OE7 A;  3FW2 A;  1PSQ A;  3HHV A;  5IPH A;  4KSO A;  1VRS D;  5CRE A;  3ZVJ A;  5DAK A;  3VWU A;  4FYB A;  3VWW A;  2FGX A;  4J56 E;  3J7Y b;  4HJ2 A;  4YQM A;  4ZL7 A;  2HZF A;  3K8N A;  1TU7 A;  1OC3 A;  4KAE A;  1G7O A;  5FHI A;  3UMA A;  5COH A;  2O8V B;  5JCU A;  1O7U A;  1G6W A;  4LLR A;  1J08 A;  3VLN A;  1GH2 A;  2WFC A;  4MMM A;  3GH6 A;  5IOW A;  1A24 A;  4HI7 A;  3ZYW A;  2P5R A;  1B9Y C;  2P5Q A;  1PKW A;  4E8E A;  3KIJ A;  3FZ4 A;  3CTG A;  5G31 A;  5F05 A;  2XBI A;  4IQA A;  2PPT A;  1M9B A;  4OMV A;  1J0F A;  2DJ1 A;  3MAK A;  1R5A A;  3M9K A;  5JWO B;  4KCE A;  4GRF A;  1XWK A;  2H6Y A;  2DIY A;  3KGK A;  5B7C A;  1YDK A;  2I3Y A;  4D73 B;  2Z9S A;  3H1N A;  4O7H A;  2QGV A;  3GTU A;  2CX3 A;  3GA4 A;  2VUP A;  1YQ1 A;  4MPF A;  2B1K A;  5ECI B;  5AIS A;  4IP6 A;  2K9F A;  1AW9 A;  3F0I A;  2VL2 C;  3GST A;  4EVM A;  4TXO A;  4FIW A;  3KCM A;  2H72 A;  4EUY A;  3BOA A;  3M8N A;  5KN0 A;  4BVY A;  2GS3 A;  3UEM A;  2MMA A;  4K7N A;  4EXJ A;  5DVB A;  2HFD A;  2F8F A;  3Q74 A;  4V2M A;  1EV4 A;  2VCV A;  3ERG A;  3KMN A;  4ECC A;  2IMD A;  2I81 A;  2DSA A;  4X43 A;  3HVV A;  2B7J A;  3VWV A;  5GAN D;  1RQM A;  1SJZ A;  2OBI A;  3CRT A;  1EP8 A;  4J2F A;  3FZ9 A;  2K8S A;  4EDZ A;  3GIX A;  3G7Y A;  4NMU A;  2NBS A;  2L4C A;  4WF4 A;  5F06 A;  2YAN A;  3M1G A;  4OCE A;  4E8H A;  3KEB A;  1OC9 A;  5ABR A;  3O6T A;  4V2N A;  2VOC A;  5IOX A;  2AUV A;  3FHK A;  2OKA A;  1G7E A;  4JRR A;  3RAZ A;  2V6K A;  3GMF A;  4YH2 A;  4MH2 A;  1T4Z A;  3TRX A;  3C7M A;  4QL7 A;  5H5R A;  5CRG A;  1KBN A;  1PN9 A;  2IJY A;  2XBQ A;  3DGQ A;  3P7X A;  2PN8 A;  1Z7P A;  2M46 A;  4HEA 2;  3QMX A;  1TK5 B;  3M0F A;  3I43 A;  2E0Q A;  2GQM A;  1O85 A;  4RQX A;  5HFG A;  2MZC A;  4TXO B;  1A8Y A;  1TDI A;  1Y25 A;  3GHA A;  4JR4 A;  4MF5 A;  5CAX A;  2DJJ A;  1GSU A;  1NW2 A;  3TDG A;  4NPB A;  3VUR A;  5IMC A;  4J57 E;  3D5J A;  1M2D A;  1WIK A;  3HD5 A;  3F4S A;  5IO0 A;  4KDX A;  4XS1 A;  2WCI A;  1O8W A;  4KND A;  5A4V A;  3NOF A;  1PL2 A;  1MD4 A;  3ISO A;  16GS A;  4G10 A;  3DVW A;  1AXD A;  3WT2 A;  1YEP A;  2AYT A;  1GUH A;  2HYX A;  1QGV A;  2YP6 A;  4FO5 A;  2N5B A;  4BWS A;  3ED3 A;  3LXZ A;  1JZW A;  3HZ8 A;  1XW9 A;  2H6Z A;  4GQC A;  5DAL B;  5F0G A;  3GKM A;  3EIN A;  5AGY A;  5F8B A;  2DC5 A;  1DBY A;  4DSS B;  1GUM A;  3LEF A;  3IAS 2;  4HDE A;  1GSY A;  2FA4 A;  3C8E A;  4XHM A;  1S3A A;  3GH9 A;  5D9V A;  2HXK A;  4NV2 A;  2H0H A;  4MH3 A;  1GL8 A;  2MBS A;  2J9H A;  3PIN A;  4RI7 A;  3F9U A;  1DUG A;  4L5O A;  3LXT A;  1PX6 A;  1SKS B;  5B8A A;  4L0U A;  9GSS A;  2VL3 A;  2RUF A;  1GLQ A;  3C1R A;  1ZYE A;  3AY8 A;  13GS A;  4KE3 A;  1F3A A;  1TJD A;  5G5F A;  2OA7 A;  2FUG 2;  1XWB A;  4TXV A;  3IE3 A;  2RM6 A;  3F8U A;  4N30 A;  2B6M A;  4JBB A;  4F0B A;  3F4R A;  1O73 A;  2H0I A;  4MDC A;  2H0G A;  1ZMA A;  2BMX A;  3ZZX A;  3CXG A;  4L5L A;  5DJL A;  5CRD A;  4L0W A;  17GS A;  1E6B A;  3FEU A;  1O8X A;  2VLV A;  4ZL9 A;  2KP1 A;  1V2A A;  2WJU A;  3KMO A;  4MCU A;  1GSS A;  4I8B A;  3TKS A;  1M2B A;  2E2M A;  3ZMK A;  1PRX A;  3DML A;  1MDJ A;  2P0G A;  2LQO A;  3UAP A;  1YF0 A;  5EL8 A;  3WGE A;  2WGR A;  5ECS A;  2F9S A;  4AF2 A;  3VPT A;  2RLI A;  4I2T A;  3BD2 A;  4MZW A;  1K3O A;  10GS A;  6GSS A;  5H5S A;  2EIQ A;  4ECB A;  5INY A;  2IFQ A;  2B5Y A;  3L9S A;  3QFA C;  1U3I A;  2H66 A;  2V6O A;  3TB2 A;  2VM2 A;  4WBR D;  2TIR A;  1MEK A;  3EYT A;  3W6G A;  5E59 A;  1FAA A;  3RPN A;  2KHP A;  4K0G A;  4P3Y B;  1S3D A;  2CAI A;  4NWY A;  1SKW B;  5DCH A;  2LJR A;  1OYJ A;  3IV4 A;  4MF7 A;  4OFM A;  1JLV A;  3QAV A;  3EMX A;  5G2Z A;  1VF1 A;  1SU9 A;  1K0O A;  1A2J A;  1BED A;  4KDU A;  1PQN A;  3DIE A;  2O87 A;  1EEM A;  1EP7 A;  2L57 A;  2PER A;  2AAW A;  4POM A;  1XPV A;  1A0F A;  3FRC A;  5IQY A;  1SK1 A;  6GSV A;  3HCZ A;  2C3N A;  3L4N A;  3CTF A;  2WDU A;  4ZL8 A;  2OAD A;  1BJX A;  3N9J A;  1R4W A;  1FVJ A;  3DYR A;  5IMZ A;  3HA9 A;  4ZBA A;  2MBT A;  4HJM A;  1ERT A;  3TKS C;  2LNT A;  2H75 A;  3GSS A;  3UBK A;  1PKZ A;  1NHY A;  1GTU A;  2ON7 A;  4Q5R A;  5ENU A;  3KTB A;  2LEG A;  1SEN A;  3D21 A;  4I6X A;  2H01 A;  1K0C A;  2WUL A;  2I4A A;  4Z7X A;  4IQ1 A;  1QUW A;  3QDN A;  4HS1 A;  3VPQ A;  1FVK A;  2IFQ B;  4TR1 B;  2HRF A;  5GSS A;  1USB A;  2C4J A;  4ECI A;  5ELA A;  5DCG A;  4ECJ A;  1TKD B;  1F37 A;  2ES7 A;  3HYP A;  4I2U A;  1X9W B;  3IA1 A;  3C73 A;  1A2M A;  4MK3 A;  3CSI A;  4EKZ A;  3GUS A;  1ERW A;  1E2Y A;  2VL2 A;  1TRV A;  2I1U A;  3GL5 A;  1Z3E A;  2PMT A;  3HJP A;  3VWX A;  2H1D A;  2IMF A;  1EEJ A;  4K1F A;  1X5E A;  2IMI A;  2JL4 A;  2GST A;  1B8X A;  3KTL A;  3RDW A;  4ML1 A;  3L78 A;  4WXT A;  1BQ7 A;  4ZIJ A;  4MLY A;  4POK A;  4JR6 A;  4MJE A;  3VI5 A;  1QK8 A;  4TRX A;  22GS A;  2OAC A;  4RI6 A;  3LYP A;  4ULX A;  1T8E B;  3FR3 A;  3O76 A;  1MD3 A;  4MAB A;  4MF6 A;  2JZS A;  2LJA A;  2DJ0 A;  2YV9 A;  1QFN A;  3KXO A;  2L5L A;  1Y6E A;  3NZN A;  3ZRE A;  1ILO A;  1B4P A;  4X1U A;  1F6M C;  5G30 A;  3ZFB A;  3KH9 A;  4K7O A;  4V1A g;  1K0M A;  2H71 A;  3O3T A;  3ZRD A;  4CHS A;  4YAP A;  3LYK A;  4KH7 A;  5KN2 A;  2MYG A;  1GNW A;  2PWJ A;  2CVD A;  2YN1 A;  3LFL A;  1O81 A;  2VCZ A;  3GRX A;  5DQY A;  2OBK A;  3UVT A;  3DWV A;  3I69 A;  4RQR A;  11GS A;  3VI7 A;  1T3B A;  3S9F A;  2KUC A;  5D9X A;  4ZB9 A;  3ZL5 A;  3HJO A;  1TRU A;  2FHE A;  1QXH A;  1K3L A;  3APQ A;  2IN3 A;  2R4V A;  5DAK B;  5H5Q A;  5JWR B;  3J7Y k;  4ILF A;  1T00 A;  1BAY A;  1SD8 A;  4IW9 A;  4PUF C;  1NSW A;  3GKX A;  3A5W A;  3ZLP A; 
#chains in the Genus database with same CATH topology
 2FLS A;  2OJL A;  3QPM A;  3BBY A;  3HKR A;  4F03 A;  2CAQ A;  4PGT A;  1WE0 A;  2YZH A;  5CRW A;  2R0C A;  5JCW A;  1PMT A;  1OKD A;  2CT6 A;  3GN3 A;  2R5G A;  4EL1 A;  3A2V A;  5D93 A;  2L4Q A;  4GXZ A;  3EMP A;  4N10 A;  3W8J A;  4WR4 A;  5KEJ A;  4YAV A;  2IIY A;  3F3R A;  3FYG A;  3TKQ A;  1K0N A;  2PVO C;  1J9B A;  3PPU A;  2HT9 A;  4NHW A;  2QC7 A;  2C0F A;  2VLT A;  2B1L A;  3EVI A;  4NV5 A;  3SBC A;  3LWA A;  1V58 A;  4KSM A;  5ECR B;  2GDR A;  2YNX A;  4GSN A;  1K0B A;  1B9X C;  3ZIV A;  4OO5 A;  4IJI A;  1FOH A;  3US3 A;  2JSZ A;  3MDK A;  3TRP A;  2FWF A;  6GST A;  2PUK C;  1ERU A;  3GTU B;  1WP0 A;  3ZIJ A;  4ISD A;  5ECH B;  3TJF A;  1QMV A;  2EIO A;  2TRC P;  4WEY A;  1N2A A;  1SL2 B;  4BVY B;  3EUR A;  2VCQ A;  1U88 A;  4PTS A;  1RK4 A;  3RHB A;  2R0P A;  3QR6 A;  1GP1 A;  4QL9 A;  3TCO A;  4O5U A;  1UC7 A;  1XW5 A;  1QQ2 A;  2TRX A;  3U6V A;  4EE0 A;  4K7I A;  1XIY A;  4V2L A;  2H30 A;  4CDO A;  2H1B A;  4GWR A;  4N11 A;  4OO4 A;  3TRQ A;  2R3X A;  1A8L A;  2YV7 A;  2C3T A;  4HUA A;  3R2Q A;  2DML A;  4JED A;  5B6N A;  3FY7 A;  1I9D A;  2DMM A;  2X8G A;  3HVS A;  3APS A;  2A2S A;  2MMO A;  3D6I A;  1SJ6 A;  1WOU A;  2E2G A;  4RUV A;  4KGI A;  1ZCP A;  3UVH A;  4HU7 A;  2QSI A;  4YKF A;  4KB3 A;  1OC9 B;  2H8L A;  2O89 A;  5IIZ A;  2XPD A;  3UIW A;  2IMK A;  18GS A;  4XS6 A;  4XS4 A;  1TI3 A;  4PQH A;  4O92 A;  1R5P A;  5IMV A;  3HXS A;  4Q5N A;  5DQS A;  4JU5 A;  2HZE A;  5IO2 A;  5HFI A;  1XXU A;  2N5F A;  1SYX A;  3GYK A;  2P31 A;  2GQK A;  2VIM A;  1FHE A;  4K9Z A;  5E4W A;  4HOJ A;  4PQI A;  3LOR A;  2A4V A;  2C1Y A;  3DKS A;  1A23 A;  3LGC A;  1Z9H A;  4TVE A;  5D73 A;  4I5Q A;  1T7P B;  2HE3 A;  3IPZ A;  3HDC A;  4GF0 A;  4WR5 A;  5HR1 A;  4IKH A;  2V41 A;  3ZFL A;  1M7T A;  4LMW A;  5A5K A;  3ZVJ D;  3RPP A;  4LL1 B;  1TOF A;  2X64 A;  4HQS A;  4Z2R A;  3A5I A;  4H86 A;  4MP4 A;  3F6F A;  5IMF A;  1HD2 A;  3F63 A;  1M2A A;  1URM A;  3C1S A;  2GTU A;  3M3M A;  4EC0 A;  2RM5 A;  1FB6 A;  4NHZ A;  4L8E A;  1TU8 A;  3M9J A;  1K0D A;  1M0U A;  5HQP A;  3IK9 A;  2DKI A;  3QCP A;  4OD7 A;  4LL4 B;  2WRT A;  2VLU A;  3ME8 A;  5ECN B;  4I97 A;  2YWI A;  2KP2 A;  4ZIL A;  2V1M A;  3A2X A;  5HR0 A;  1TK8 B;  1AUC A;  1XFL A;  1YKC A;  1XCC A;  3FZ5 A;  1YJ6 A;  2OE1 A;  5CRH A;  5ECL B;  1IYH A;  4V1A p;  1U3A A;  2ZUP A;  4ACS A;  1MDI A;  2K6V A;  1X0R A;  1H75 A;  2CQ9 A;  2HZE B;  3QD9 A;  1AAZ A;  3GKK A;  1F2E A;  1GTA A;  3UJ1 A;  1YF1 A;  4K5S A;  2MMN A;  3W8S A;  2VM1 A;  4YQV A;  4MJC A;  2YZU A;  5EPF A;  2LNS A;  1PX7 A;  1V57 A;  1S3C A;  1LBK A;  4EF0 A;  1UVZ A;  3WD6 A;  3TGZ A;  1GWC A;  3CSJ A;  4GSS A;  1KNG A;  5ID2 A;  4POB A;  1XOA A;  1ERV A;  3L9V A;  1EV9 A;  1X5D A;  3NIV A;  2X49 A;  1B4Q A;  2OE3 A;  2ALB A;  3F6D A;  2IME A;  3IAM 2;  4OFN A;  3LG6 A;  1B48 A;  2H1A A;  3WYW A;  4DSQ A;  1PD2 1;  2AB6 A;  5BMU A;  2WB9 A;  4KA0 A;  2JSY A;  3LSZ A;  2H19 A;  1WJK A;  1Z6M A;  1AQW A;  1AIU A;  1Z5Y E;  4NXI A;  12GS A;  2HSY A;  2XHF A;  1HQO A;  5CYY A;  5G5E A;  5BRT A;  2R37 A;  2DLX A;  4PNG A;  1DE1 A;  2LS5 A;  2LST A;  5D9T A;  2PU9 C;  3G9B A;  1PGT A;  3EPT A;  5JWQ B;  3QAG A;  1XOB A;  1HNC A;  4ICY A;  2HSM A;  4KUN A;  2K18 A;  1XBS A;  5J9C A;  5B6M A;  2HI7 A;  5ECK B;  5J41 A;  2HSH A;  2JZT A;  1EOH A;  1BG5 A;  3GKN A;  1W89 A;  5F07 A;  5D9W A;  5DBQ A;  1H4O A;  6GSW A;  1SYR A;  1OE8 A;  2LRN A;  5IMA A;  3IXR A;  1V40 A;  2YCD A;  2GT5 A;  2C0D A;  2H73 A;  5ID2 B;  3A3T A;  3DVX A;  1GSQ A;  1PA3 A;  1ST9 A;  1X9M B;  5AIX A;  3FKF A;  1WMJ A;  2GSQ A;  2NPB A;  2YWO A;  2VAF A;  4IJ3 A;  2OE0 A;  1YZX A;  4TR3 A;  1YKA A;  2AHE A;  3DXB A;  2X8C A;  1HNB A;  4G2E A;  4G9H A;  2C8U A;  3FR6 A;  1M99 A;  5A4W A;  4PNF A;  5EVO A;  1ABA A;  1O6J A;  1M3J A;  4KCA A;  1FB0 A;  4D73 A;  4DVC A;  4JE1 A;  1VF2 A;  1TRS A;  3V1W A;  4PXO A;  1M3I A;  5DDL A;  3OR5 A;  2VCX A;  1KTE A;  4Q5F A;  2HNL A;  3MSZ A;  1PFO A;  5CO3 A;  3CRU A;  3C71 A;  1DE2 A;  3HZ4 A;  2AJQ B;  3BJ5 A;  5A4U A;  1ON4 A;  5J5N A;  5DJM A;  4BPY A;  3RHC A;  3ERF A;  1OVN A;  1YEX A;  3IDV A;  4POL A;  1A0R P;  4MJA A;  3QOU A;  3MWH A;  2K8V A;  3LW9 A;  4G0L A;  2REM A;  3FZA A;  7GSS A;  3RBT A;  3HVX A;  3TJJ A;  1GSD A;  1Q98 A;  3EWL A;  3TJK A;  2LQQ A;  3ERW A;  1VGL A;  2L6C A;  4WBJ A;  3FMW A;  1JFU A;  2CX4 A;  1XWC A;  3H93 A;  4N0V A;  2L59 A;  2NVL A;  4FQU A;  1XWG A;  2HRN A;  2DIZ A;  5ELG A;  1LU4 A;  2DJ2 A;  1EWX A;  4MZB A;  5HFK A;  2RII A;  2ON5 A;  3F4T A;  5LD0 A;  3DRN A;  4ZB6 A;  3IR4 A;  2HLS A;  2NTO A;  5J4U A;  1WPI A;  2GT6 A;  5G1L A;  1F9M A;  4IHU A;  4GST A;  2IWT A;  2LTK A;  4WET A;  1FOV A;  2C3Q A;  4JZQ A;  4IVF A;  4GLT A;  2A2R A;  1UA5 A;  1GSE A;  4ZBD A;  3ME7 A;  4IBP A;  1XZO A;  3N5O A;  4EO3 A;  4TKY A;  3TOT A;  2XPE A;  5J3R A;  3QAW A;  1GLP A;  3ZIT A;  1FG4 A;  1TXX A;  2O7K A;  3EE2 A;  1PL1 A;  2WZ9 A;  3R3E A;  3GNJ A;  5HR3 A;  2FA8 A;  3E3E A;  1OKT A;  2JZR A;  2M72 A;  2FCH A;  4NAX A;  2QA2 A;  3UBL A;  3LQ7 A;  2DBC A;  1THX A;  4FH8 A;  5KOW A;  3P2A A;  2ZCT A;  1FW1 A;  2V2G A;  3FK8 A;  1T1V A;  3EC3 A;  4MZC A;  3H79 A;  3WGD A;  4ZBB A;  4YQU A;  4IP1 A;  4PQ1 A;  4KF9 A;  1HNA A;  4GCI A;  2KLX A;  4Q5Q A;  2B3S A;  4BIK A;  1UN2 A;  2FWH A;  5HR2 A;  5JCG A;  2LJK A;  1G0T A;  1TTZ A;  1SL0 B;  4MJB A;  4TR4 A;  4BL7 A;  4OWY A;  3Q19 A;  5D96 A;  5DAL A;  3L9U A;  4KX4 A;  3TUE A;  3IHG A;  2WS2 A;  2BJX A;  4F2I A;  4MPG A;  4F0C A;  2X8H A;  5EY6 A;  1A2L A;  8GSS A;  4DSS A;  1U6T A;  4K0N A;  3VK9 A;  2CA8 A;  1R26 A;  2PVQ A;  3D4T A;  2B7K A;  2FD3 A;  4XCS A;  1LJR A;  4IN0 A;  1N8J A;  20GS A;  1SL1 B;  2GLR A;  3F3Q A;  2EC4 A;  3TOU A;  3KP8 A;  5ECM B;  2FNO A;  3TKP A;  2VCW A;  1ZL9 A;  1W4V A;  4OCF A;  5GZZ B;  4ZXG A;  4AGS A;  4X0X A;  4CY8 A;  1EOG A;  1Z7R A;  4K2D A;  2DJK A;  3P8W A;  1T4Y A;  1C72 A;  1CQH A;  4EDY A;  4AJ7 A;  4HQZ A;  1BX9 A;  4FYU A;  4OFT A;  2C80 A;  1YY7 A;  1SJI A;  4TOP A;  3CBU A;  4XRA A;  2GSS A;  6GSY A;  1ZOF A;  4DEJ A;  4ID0 A;  2NDO A;  3KZQ A;  4K8M A;  1K0A A;  3IBH A;  2J23 A;  3DEX A;  3BCI A;  1M9A A;  3KD0 A;  1ZYN A;  2C0E A;  3GX0 A;  3MNG A;  5GAP D;  3HJM A;  3APO A;  4MNN A;  2GVP A;  1X9S B;  2D2Z A;  4K6X A;  2L6D A;  2JAD A;  2QKE A;  1K3Y A;  1Q4J A;  1R7H A;  5C04 A;  2H6X A;  4KW6 A;  2B5X A;  2GGT A;  2YPM A;  1BYE A;  1KEB A;  3CQF A;  3CYN A;  1TP9 A;  3E0U A;  4WF5 A;  4K2X A;  3PH9 A;  2R0G A;  4O5Q A;  3IRA A;  4BWQ A;  2BTO T;  2R2J A;  2X99 A;  2EIR A;  5C00 A;  3H4K A;  1V9W A;  2FWG A;  2CZ2 A;  1JHB A;  1AQV A;  2MMZ A;  4YKG A;  1THO A;  1CQG A;  2GZY A;  19GS A;  2C0G A;  3GV1 A;  3G7I A;  4IS0 A;  4ML6 A;  4O5R A;  1SKR B;  1X5C A;  2FWE A;  3D0Z A;  4HZ2 A;  3IHQ A;  1RW1 A;  3HY2 A;  3KM6 A;  1TRW A;  2G2Q A;  2JAC A;  4AJ6 A;  2LRC A;  2H1G A;  3D4M A;  1VF3 A;  3ZML A;  5IM9 A;  5IMD A;  1NM3 A;  3GL3 A;  3GX8 A;  4HZ4 A;  2I9H A;  2L5O A;  3QFB C;  2YWN A;  2CVK A;  1EGR A;  1SK2 A;  4Z2U A;  1ZYQ B;  4BVX A;  2YOI A;  3BCK A;  4LA1 A;  3KP9 A;  1JZR A;  2CVB A;  1AQX A;  3TKR A;  2DKH A;  3UOM A;  5KN1 A;  1AC1 A;  1ZGN A;  4FYC A;  6GSU A;  5LNK e;  4F82 A;  1JLW A;  3Q18 A;  2GSR A;  1XW6 A;  3PGT A;  4XS4 B;  4XTS A;  5G1K A;  1EGO A;  5J9B A;  1XVQ A;  1SD9 A;  4DSR A;  4IGJ A;  1GTB A;  14GS A;  1F3B A;  1XVW A;  5FWG A;  5IPG A;  4TW5 A;  5FT3 A;  1JZO A;  3ZTL A;  2YJ7 A;  1ZZY A;  2R6K A;  3GFK A;  1TK0 B;  2B5E A;  2VD1 A;  6GSX A;  1GTI A;  2GZZ A;  1ACV A;  2DJ3 A;  4GQF A;  2LKU A;  1GNE A;  5AN1 A;  2JU5 A;  3KJY A;  1ML6 A;  3Q6O A;  5ECO B;  3VFI A;  2YJH A;  2M80 A;  1WWJ A;  2XC2 A;  3CMI A;  1OC8 A;  1U87 A;  1G6Y A;  2F8A A;  2V32 A;  5LCZ A;  1EZK A;  2LUS A;  2VCT A;  4TR1 A;  1GRX A;  4F9Z A;  4PUR A;  1TI1 A;  2CV4 A;  3A2W A;  4IEL A;  2G0F A;  5AIV A;  1WRY A;  1HYU A;  3WGX A;  2F51 A;  3CSH A;  4BA7 A;  3FR9 A;  2LV3 A;  3EU4 A;  3LJR A;  3IOS A;  5ECQ B;  2AV4 A;  4BVX B;  5B8B A;  1FO5 A;  4AJ8 A;  1GUL A;  3SWL A;  2PBJ A;  4TN8 A;  3G7J A;  1IYI A;  5KN3 A;  3I6A A;  2N5A A;  2PGT A;  4PX1 A;  4PUA A;  2X4A A;  4MA9 A;  1XWA A;  4XRD A;  2VL9 A;  2E7P A;  3GUR A;  2CZ3 A;  2FY6 A;  1NHO A;  3PR8 A;  3DD3 A;  3L0H A;  2GZP A;  2IPA A;  3TJB A;  2IL3 A;  2O85 A;  5CNW A;  1I5G A;  3UAR A;  3EU3 A;  3JCM L;  1DSB A;  5GST A;  3TKS E;  3E9J B;  5L71 A;  3IC4 A;  2A2P A;  1TW9 A;  5CP1 A;  5ECP B;  3MIX A;  3TJG A;  4O32 A;  1V98 A;  1Z6N A;  2VD0 A;  1SK0 A;  4G19 A;  2H76 A;  1GSF A;  3UL3 A;  5D8I A;  2GQL A;  4LMV A;  4GTU A;  1GUK A;  1MDK A;  2KOK A;  4KDY A;  2H74 A;  4ZB8 A;  3IK7 A;  1XG8 A;  3WT1 A;  3U5R E;  4TR0 A;  2H70 A;  4QQ7 A;  1JZD A;  4CW9 A;  2VO4 A;  2ZNM A;  3KH7 A;  2RUE A;  2F3M A;  1VF4 A;  4WKW A;  1MTC A;  3D22 A;  4N0Z A;  3P90 A;  3HVN A;  2LRT A;  4HU9 A;  2YWM A;  3I9V 2;  3H8Q A;  1OAZ A;  4XIH A;  1OE7 A;  3FW2 A;  1PSQ A;  3HHV A;  5IPH A;  4KSO A;  1VRS D;  5CRE A;  3ZVJ A;  5DAK A;  3VWU A;  4FYB A;  3VWW A;  2FGX A;  4J56 E;  3J7Y b;  4HJ2 A;  4YQM A;  4ZL7 A;  2HZF A;  3K8N A;  4Z2T A;  1TU7 A;  1OC3 A;  4KAE A;  1G7O A;  5FHI A;  3UMA A;  5COH A;  2O8V B;  5JCU A;  1O7U A;  1G6W A;  4LLR A;  4HSC X;  1J08 A;  3VLN A;  1GH2 A;  2WFC A;  4MMM A;  2HRA A;  3GH6 A;  5IOW A;  1A24 A;  4HI7 A;  3ZYW A;  2P5R A;  1B9Y C;  2P5Q A;  1PKW A;  4E8E A;  5KOX A;  3KIJ A;  3FZ4 A;  3CTG A;  5G31 A;  5F05 A;  2XBI A;  4IQA A;  2PPT A;  1M9B A;  4OMV A;  1J0F A;  2DJ1 A;  3MAK A;  1R5A A;  3M9K A;  5JWO B;  4KCE A;  4GRF A;  1XWK A;  2H6Y A;  2DIY A;  3KGK A;  5B7C A;  1YDK A;  2I3Y A;  4D73 B;  2Z9S A;  3H1N A;  4O7H A;  2QGV A;  3GTU A;  2CX3 A;  3GA4 A;  2VUP A;  1YQ1 A;  4MPF A;  2B1K A;  5ECI B;  5AIS A;  4IP6 A;  2K9F A;  1AW9 A;  3F0I A;  2VL2 C;  3GST A;  4EVM A;  4TXO A;  4FIW A;  3KCM A;  2H72 A;  4EUY A;  3BOA A;  3M8N A;  5KN0 A;  4BVY A;  2GS3 A;  3UEM A;  2MMA A;  4K7N A;  4EXJ A;  5DVB A;  2HFD A;  2F8F A;  3Q74 A;  4V2M A;  1EV4 A;  2VCV A;  3ERG A;  3KMN A;  4ECC A;  2IMD A;  2I81 A;  2DSA A;  4X43 A;  3HVV A;  2B7J A;  4X4J A;  3VWV A;  5GAN D;  1RQM A;  1SJZ A;  2OBI A;  3CRT A;  1EP8 A;  4J2F A;  3FZ9 A;  2K8S A;  4EDZ A;  3GIX A;  3G7Y A;  4NMU A;  2NBS A;  2L4C A;  4WF4 A;  5F06 A;  1ZYP A;  2YAN A;  3M1G A;  4OCE A;  4E8H A;  3KEB A;  1OC9 A;  5ABR A;  3O6T A;  4V2N A;  2VOC A;  5IOX A;  2AUV A;  3FHK A;  2OKA A;  1G7E A;  4JRR A;  3RAZ A;  2V6K A;  3GMF A;  4YH2 A;  4G0K A;  4MH2 A;  1T4Z A;  3TRX A;  3C7M A;  4QL7 A;  5H5R A;  5CRG A;  1KBN A;  1PN9 A;  2IJY A;  2XBQ A;  3DGQ A;  3P7X A;  2PN8 A;  1Z7P A;  2M46 A;  4HEA 2;  3QMX A;  1TK5 B;  3M0F A;  3I43 A;  2E0Q A;  2GQM A;  1O85 A;  4RQX A;  5HFG A;  2MZC A;  4TXO B;  1A8Y A;  1TDI A;  4EIQ A;  1Y25 A;  3GHA A;  4JR4 A;  4MF5 A;  5CAX A;  2DJJ A;  1GSU A;  1NW2 A;  3TDG A;  4NPB A;  3VUR A;  5IMC A;  4J57 E;  3D5J A;  1M2D A;  1WIK A;  3HD5 A;  3F4S A;  5IO0 A;  4KDX A;  4XS1 A;  2WCI A;  2UZ8 A;  1O8W A;  4KND A;  5A4V A;  3NOF A;  1PL2 A;  1MD4 A;  3ISO A;  16GS A;  4G10 A;  3DVW A;  1AXD A;  3WT2 A;  1YEP A;  2AYT A;  1GUH A;  2HYX A;  1QGV A;  2YP6 A;  4FO5 A;  2N5B A;  4BWS A;  3ED3 A;  3LXZ A;  1JZW A;  3HZ8 A;  4BL7 B;  1XW9 A;  2H6Z A;  4GQC A;  5DAL B;  5F0G A;  3GKM A;  3EIN A;  5AGY A;  5F8B A;  2DC5 A;  1DBY A;  4DSS B;  1GUM A;  3LEF A;  3IAS 2;  4HDE A;  3MYD A;  1GSY A;  2FA4 A;  3C8E A;  4XHM A;  1S3A A;  3GH9 A;  5D9V A;  2HXK A;  4NV2 A;  2H0H A;  4MH3 A;  1GL8 A;  2MBS A;  2J9H A;  3PIN A;  4RI7 A;  3F9U A;  1DUG A;  4L5O A;  3LXT A;  1PX6 A;  1SKS B;  5B8A A;  4L0U A;  9GSS A;  2VL3 A;  2RUF A;  1GLQ A;  3C1R A;  1ZYE A;  3AY8 A;  13GS A;  4KE3 A;  2A4H A;  1F3A A;  1TJD A;  5G5F A;  2OA7 A;  2FUG 2;  1XWB A;  4TXV A;  3IE3 A;  2RM6 A;  3F8U A;  4N30 A;  2B6M A;  4JBB A;  4F0B A;  3IC8 A;  3F4R A;  1O73 A;  2H0I A;  4MDC A;  2H0G A;  1ZMA A;  2BMX A;  3ZZX A;  4A5P A;  3CXG A;  4L5L A;  5DJL A;  5CRD A;  4L0W A;  17GS A;  1E6B A;  3FEU A;  4EIP A;  1O8X A;  2VLV A;  4ZL9 A;  2KP1 A;  1V2A A;  2WJU A;  3KMO A;  4MCU A;  1GSS A;  4I8B A;  3TKS A;  1M2B A;  2E2M A;  3ZMK A;  1PRX A;  3DML A;  1MDJ A;  2P0G A;  2LQO A;  3UAP A;  1YF0 A;  5EL8 A;  3WGE A;  2WGR A;  5ECS A;  2F9S A;  4AF2 A;  3VPT A;  2RLI A;  4I2T A;  3BD2 A;  4MZW A;  1K3O A;  10GS A;  6GSS A;  5H5S A;  2EIQ A;  4ECB A;  5INY A;  2IFQ A;  2B5Y A;  3L9S A;  3QFA C;  1U3I A;  2H66 A;  2V6O A;  3TB2 A;  2VM2 A;  4WBR D;  2TIR A;  1MEK A;  3EYT A;  3W6G A;  5E59 A;  1FAA A;  3RPN A;  2KHP A;  4K0G A;  4P3Y B;  1S3D A;  2CAI A;  4NWY A;  1SKW B;  5DCH A;  2LJR A;  1OYJ A;  3IV4 A;  4MF7 A;  4OFM A;  1JLV A;  3QAV A;  3EMX A;  5G2Z A;  1VF1 A;  1SU9 A;  1K0O A;  1A2J A;  1BED A;  4KDU A;  1PQN A;  3DIE A;  4G0I A;  2O87 A;  1EEM A;  1EP7 A;  2L57 A;  2PER A;  2AAW A;  4POM A;  1XPV A;  1A0F A;  3FRC A;  5IQY A;  1SK1 A;  6GSV A;  3HCZ A;  2C3N A;  3L4N A;  3CTF A;  2WDU A;  4ZL8 A;  2OAD A;  1BJX A;  3N9J A;  1R4W A;  1FVJ A;  3DYR A;  5IMZ A;  3HA9 A;  4ZBA A;  2MBT A;  4HJM A;  1ERT A;  4K5R A;  2LNT A;  2H75 A;  3GSS A;  3TKS C;  3UBK A;  1PKZ A;  1NHY A;  1GTU A;  2ON7 A;  4Q5R A;  5ENU A;  3KTB A;  2LEG A;  1SEN A;  3D21 A;  4I6X A;  2H01 A;  1K0C A;  2WUL A;  2I4A A;  4Z7X A;  4IQ1 A;  1QUW A;  3QDN A;  4HS1 A;  3VPQ A;  1FVK A;  2IFQ B;  4TR1 B;  2HRF A;  5GSS A;  1USB A;  2C4J A;  4ECI A;  5ELA A;  5DCG A;  4ECJ A;  1TKD B;  1F37 A;  2ES7 A;  3HYP A;  4I2U A;  1X9W B;  3IA1 A;  3C73 A;  1A2M A;  4MK3 A;  4USS A;  3CSI A;  4EKZ A;  3GUS A;  1ERW A;  1E2Y A;  2VL2 A;  1TRV A;  2I1U A;  3GL5 A;  1Z3E A;  2PMT A;  3HJP A;  3VWX A;  2H1D A;  2IMF A;  1EEJ A;  4K1F A;  1X5E A;  2IMI A;  2JL4 A;  2GST A;  1B8X A;  3KTL A;  3RDW A;  4ML1 A;  3L78 A;  4WXT A;  1BQ7 A;  4ZIJ A;  4MLY A;  4POK A;  4JR6 A;  4MJE A;  3VI5 A;  1QK8 A;  4TRX A;  1S3R A;  22GS A;  2OAC A;  1PN0 A;  4RI6 A;  3LYP A;  4ULX A;  1T8E B;  3FR3 A;  3O76 A;  1MD3 A;  4MAB A;  4MF6 A;  2JZS A;  2HRK A;  2LJA A;  2DJ0 A;  2YV9 A;  1QFN A;  3KXO A;  2L5L A;  1Y6E A;  3NZN A;  3ZRE A;  1ILO A;  1B4P A;  4X1U A;  1F6M C;  5G30 A;  3ZFB A;  3KH9 A;  4K7O A;  4V1A g;  1K0M A;  2H71 A;  3O3T A;  3ZRD A;  4CHS A;  4YAP A;  3LYK A;  4KH7 A;  5KN2 A;  2MYG A;  1GNW A;  2PWJ A;  2CVD A;  2YN1 A;  3LFL A;  1O81 A;  2VCZ A;  3GRX A;  5DQY A;  2OBK A;  3UVT A;  3DWV A;  3I69 A;  4RQR A;  11GS A;  3VI7 A;  1T3B A;  2QA1 A;  3S9F A;  2KUC A;  4CY6 A;  5D9X A;  4ZB9 A;  3ZL5 A;  3HJO A;  1TRU A;  2FHE A;  1QXH A;  1K3L A;  3APQ A;  2IN3 A;  2R4V A;  5DAK B;  5H5Q A;  5JWR B;  3J7Y k;  4ILF A;  1T00 A;  1BAY A;  1SD8 A;  4IW9 A;  4PUF C;  1NSW A;  3GKX A;  3A5W A;  3ZLP A; 
#chains in the Genus database with same CATH homology
 2FLS A;  2OJL A;  3QPM A;  3BBY A;  3HKR A;  4F03 A;  2CAQ A;  4PGT A;  1WE0 A;  2YZH A;  5CRW A;  2R0C A;  5JCW A;  1PMT A;  1OKD A;  2CT6 A;  3GN3 A;  2R5G A;  4EL1 A;  3A2V A;  5D93 A;  2L4Q A;  4GXZ A;  3EMP A;  4N10 A;  3W8J A;  4WR4 A;  5KEJ A;  4YAV A;  2IIY A;  3F3R A;  3FYG A;  3TKQ A;  1K0N A;  2PVO C;  1J9B A;  3PPU A;  2HT9 A;  4NHW A;  2QC7 A;  2C0F A;  2VLT A;  2B1L A;  3EVI A;  4NV5 A;  3SBC A;  3LWA A;  1V58 A;  4KSM A;  5ECR B;  2GDR A;  2YNX A;  4GSN A;  1K0B A;  1B9X C;  3ZIV A;  4OO5 A;  4IJI A;  1FOH A;  3US3 A;  2JSZ A;  3MDK A;  3TRP A;  2FWF A;  6GST A;  2PUK C;  1ERU A;  3GTU B;  1WP0 A;  3ZIJ A;  4ISD A;  5ECH B;  3TJF A;  1QMV A;  2EIO A;  2TRC P;  4WEY A;  1N2A A;  1SL2 B;  4BVY B;  3EUR A;  2VCQ A;  1U88 A;  4PTS A;  1RK4 A;  3RHB A;  2R0P A;  3QR6 A;  1GP1 A;  4QL9 A;  3TCO A;  4O5U A;  1UC7 A;  1XW5 A;  1QQ2 A;  2TRX A;  3U6V A;  4EE0 A;  4K7I A;  1XIY A;  4V2L A;  2H30 A;  4CDO A;  2H1B A;  4GWR A;  4N11 A;  4OO4 A;  3TRQ A;  2R3X A;  1A8L A;  2YV7 A;  2C3T A;  4HUA A;  3R2Q A;  2DML A;  4JED A;  5B6N A;  3FY7 A;  1I9D A;  2DMM A;  2X8G A;  3HVS A;  3APS A;  2A2S A;  2MMO A;  3D6I A;  1SJ6 A;  1WOU A;  2E2G A;  4RUV A;  4KGI A;  1ZCP A;  3UVH A;  4HU7 A;  2QSI A;  4YKF A;  4KB3 A;  1OC9 B;  2H8L A;  2O89 A;  5IIZ A;  2XPD A;  3UIW A;  2IMK A;  18GS A;  4XS6 A;  4XS4 A;  1TI3 A;  4PQH A;  4O92 A;  1R5P A;  5IMV A;  3HXS A;  4Q5N A;  5DQS A;  4JU5 A;  2HZE A;  5IO2 A;  5HFI A;  1XXU A;  2N5F A;  1SYX A;  3GYK A;  2P31 A;  2GQK A;  2VIM A;  1FHE A;  4K9Z A;  5E4W A;  4HOJ A;  4PQI A;  3LOR A;  2A4V A;  2C1Y A;  3DKS A;  1A23 A;  3LGC A;  1Z9H A;  4TVE A;  5D73 A;  4I5Q A;  1T7P B;  2HE3 A;  3IPZ A;  3HDC A;  4GF0 A;  4WR5 A;  5HR1 A;  4IKH A;  2V41 A;  3ZFL A;  1M7T A;  4LMW A;  5A5K A;  3ZVJ D;  3RPP A;  4LL1 B;  1TOF A;  2X64 A;  4HQS A;  4Z2R A;  3A5I A;  4H86 A;  4MP4 A;  3F6F A;  5IMF A;  1HD2 A;  3F63 A;  1M2A A;  1URM A;  3C1S A;  2GTU A;  3M3M A;  4EC0 A;  2RM5 A;  1FB6 A;  4NHZ A;  4L8E A;  1TU8 A;  3M9J A;  1K0D A;  1M0U A;  5HQP A;  3IK9 A;  2DKI A;  3QCP A;  4OD7 A;  4LL4 B;  2WRT A;  2VLU A;  3ME8 A;  5ECN B;  4I97 A;  2YWI A;  2KP2 A;  4ZIL A;  2V1M A;  3A2X A;  5HR0 A;  1TK8 B;  1AUC A;  1XFL A;  1YKC A;  1XCC A;  3FZ5 A;  1YJ6 A;  2OE1 A;  5CRH A;  5ECL B;  1IYH A;  4V1A p;  1U3A A;  2ZUP A;  4ACS A;  1MDI A;  2K6V A;  1X0R A;  1H75 A;  2CQ9 A;  2HZE B;  3QD9 A;  1AAZ A;  3GKK A;  1F2E A;  1GTA A;  3UJ1 A;  1YF1 A;  4K5S A;  2MMN A;  3W8S A;  2VM1 A;  4YQV A;  4MJC A;  2YZU A;  5EPF A;  2LNS A;  1PX7 A;  1V57 A;  1S3C A;  1LBK A;  4EF0 A;  1UVZ A;  3WD6 A;  3TGZ A;  1GWC A;  3CSJ A;  4GSS A;  1KNG A;  5ID2 A;  4POB A;  1XOA A;  1ERV A;  3L9V A;  1EV9 A;  1X5D A;  3NIV A;  2X49 A;  1B4Q A;  2OE3 A;  2ALB A;  3F6D A;  2IME A;  3IAM 2;  4OFN A;  3LG6 A;  1B48 A;  2H1A A;  3WYW A;  4DSQ A;  1PD2 1;  2AB6 A;  5BMU A;  2WB9 A;  4KA0 A;  2JSY A;  3LSZ A;  2H19 A;  1WJK A;  1Z6M A;  1AQW A;  1AIU A;  1Z5Y E;  4NXI A;  12GS A;  2HSY A;  2XHF A;  1HQO A;  5CYY A;  5G5E A;  5BRT A;  2R37 A;  2DLX A;  4PNG A;  1DE1 A;  2LS5 A;  2LST A;  5D9T A;  2PU9 C;  3G9B A;  1PGT A;  3EPT A;  5JWQ B;  3QAG A;  1XOB A;  1HNC A;  4ICY A;  2HSM A;  4KUN A;  2K18 A;  1XBS A;  5J9C A;  5B6M A;  2HI7 A;  5ECK B;  5J41 A;  2HSH A;  2JZT A;  1EOH A;  1BG5 A;  3GKN A;  1W89 A;  5F07 A;  5D9W A;  5DBQ A;  1H4O A;  6GSW A;  1SYR A;  1OE8 A;  2LRN A;  5IMA A;  3IXR A;  1V40 A;  2YCD A;  2GT5 A;  2C0D A;  2H73 A;  5ID2 B;  3A3T A;  3DVX A;  1GSQ A;  1PA3 A;  1ST9 A;  1X9M B;  5AIX A;  3FKF A;  1WMJ A;  2GSQ A;  2NPB A;  2YWO A;  2VAF A;  4IJ3 A;  2OE0 A;  1YZX A;  4TR3 A;  1YKA A;  2AHE A;  3DXB A;  2X8C A;  1HNB A;  4G2E A;  4G9H A;  2C8U A;  3FR6 A;  1M99 A;  5A4W A;  4PNF A;  5EVO A;  1ABA A;  1O6J A;  4KCA A;  1FB0 A;  4D73 A;  4DVC A;  4JE1 A;  1VF2 A;  1TRS A;  3V1W A;  4PXO A;  5DDL A;  3OR5 A;  2VCX A;  1KTE A;  4Q5F A;  2HNL A;  3MSZ A;  5CO3 A;  3CRU A;  3C71 A;  1DE2 A;  3HZ4 A;  2AJQ B;  3BJ5 A;  5A4U A;  1ON4 A;  5J5N A;  5DJM A;  4BPY A;  3RHC A;  3ERF A;  1OVN A;  1YEX A;  3IDV A;  4POL A;  1A0R P;  4MJA A;  3QOU A;  3MWH A;  2K8V A;  3LW9 A;  4G0L A;  2REM A;  3FZA A;  7GSS A;  3RBT A;  3HVX A;  3TJJ A;  1GSD A;  1Q98 A;  3EWL A;  3TJK A;  2LQQ A;  3ERW A;  1VGL A;  2L6C A;  4WBJ A;  3FMW A;  1JFU A;  2CX4 A;  1XWC A;  3H93 A;  4N0V A;  2L59 A;  2NVL A;  4FQU A;  1XWG A;  2HRN A;  2DIZ A;  5ELG A;  1LU4 A;  2DJ2 A;  1EWX A;  4MZB A;  5HFK A;  2RII A;  2ON5 A;  3F4T A;  5LD0 A;  3DRN A;  4ZB6 A;  3IR4 A;  2HLS A;  2NTO A;  5J4U A;  1WPI A;  2GT6 A;  5G1L A;  1F9M A;  4IHU A;  4GST A;  2IWT A;  2LTK A;  4WET A;  1FOV A;  2C3Q A;  4JZQ A;  4IVF A;  4GLT A;  2A2R A;  1UA5 A;  1GSE A;  4ZBD A;  3ME7 A;  4IBP A;  1XZO A;  3N5O A;  4EO3 A;  4TKY A;  3TOT A;  2XPE A;  5J3R A;  3QAW A;  1GLP A;  3ZIT A;  1FG4 A;  1TXX A;  2O7K A;  3EE2 A;  1PL1 A;  2WZ9 A;  3R3E A;  3GNJ A;  5HR3 A;  2FA8 A;  3E3E A;  1OKT A;  2JZR A;  2M72 A;  2FCH A;  4NAX A;  2QA2 A;  3UBL A;  3LQ7 A;  2DBC A;  1THX A;  4FH8 A;  5KOW A;  3P2A A;  2ZCT A;  1FW1 A;  2V2G A;  3FK8 A;  1T1V A;  3EC3 A;  4MZC A;  3H79 A;  3WGD A;  4ZBB A;  4YQU A;  4IP1 A;  4PQ1 A;  4KF9 A;  1HNA A;  4GCI A;  2KLX A;  4Q5Q A;  2B3S A;  1UN2 A;  2FWH A;  5HR2 A;  5JCG A;  2LJK A;  1G0T A;  1TTZ A;  1SL0 B;  4MJB A;  4TR4 A;  4BL7 A;  4OWY A;  3Q19 A;  5D96 A;  5DAL A;  3L9U A;  4KX4 A;  3TUE A;  3IHG A;  2WS2 A;  2BJX A;  4F2I A;  4MPG A;  4F0C A;  2X8H A;  5EY6 A;  1A2L A;  8GSS A;  4DSS A;  1U6T A;  4K0N A;  3VK9 A;  2CA8 A;  1R26 A;  2PVQ A;  3D4T A;  2B7K A;  2FD3 A;  4XCS A;  1LJR A;  4IN0 A;  1N8J A;  20GS A;  1SL1 B;  2GLR A;  3F3Q A;  2EC4 A;  3TOU A;  3KP8 A;  5ECM B;  2FNO A;  3TKP A;  2VCW A;  1ZL9 A;  1W4V A;  4OCF A;  5GZZ B;  4ZXG A;  4AGS A;  4X0X A;  4CY8 A;  1EOG A;  1Z7R A;  4K2D A;  2DJK A;  3P8W A;  1T4Y A;  1C72 A;  1CQH A;  4EDY A;  4AJ7 A;  4HQZ A;  1BX9 A;  4FYU A;  4OFT A;  2C80 A;  1YY7 A;  1SJI A;  4TOP A;  3CBU A;  4XRA A;  2GSS A;  6GSY A;  1ZOF A;  4DEJ A;  4ID0 A;  2NDO A;  3KZQ A;  4K8M A;  1K0A A;  3IBH A;  2J23 A;  3DEX A;  3BCI A;  1M9A A;  3KD0 A;  1ZYN A;  2C0E A;  3GX0 A;  3MNG A;  5GAP D;  3HJM A;  3APO A;  4MNN A;  2GVP A;  1X9S B;  2D2Z A;  4K6X A;  2L6D A;  2JAD A;  2QKE A;  1K3Y A;  1Q4J A;  1R7H A;  5C04 A;  2H6X A;  4KW6 A;  2B5X A;  2GGT A;  2YPM A;  1BYE A;  1KEB A;  3CYN A;  1TP9 A;  3E0U A;  4WF5 A;  4K2X A;  3PH9 A;  2R0G A;  4O5Q A;  3IRA A;  4BWQ A;  2BTO T;  2R2J A;  2X99 A;  2EIR A;  5C00 A;  3H4K A;  1V9W A;  2FWG A;  2CZ2 A;  1JHB A;  1AQV A;  2MMZ A;  4YKG A;  1THO A;  1CQG A;  2GZY A;  19GS A;  2C0G A;  3GV1 A;  3G7I A;  4IS0 A;  4ML6 A;  4O5R A;  1SKR B;  1X5C A;  2FWE A;  3D0Z A;  4HZ2 A;  3IHQ A;  1RW1 A;  3HY2 A;  3KM6 A;  1TRW A;  2G2Q A;  2JAC A;  4AJ6 A;  2LRC A;  2H1G A;  3D4M A;  1VF3 A;  3ZML A;  5IM9 A;  5IMD A;  1NM3 A;  3GL3 A;  3GX8 A;  4HZ4 A;  2I9H A;  2L5O A;  3QFB C;  2YWN A;  2CVK A;  1EGR A;  1SK2 A;  4Z2U A;  1ZYQ B;  4BVX A;  2YOI A;  3BCK A;  4LA1 A;  3KP9 A;  1JZR A;  2CVB A;  1AQX A;  3TKR A;  2DKH A;  3UOM A;  5KN1 A;  1AC1 A;  1ZGN A;  4FYC A;  6GSU A;  5LNK e;  4F82 A;  1JLW A;  3Q18 A;  2GSR A;  1XW6 A;  3PGT A;  4XS4 B;  4XTS A;  5G1K A;  1EGO A;  5J9B A;  1XVQ A;  1SD9 A;  4DSR A;  4IGJ A;  1GTB A;  14GS A;  1F3B A;  1XVW A;  5FWG A;  5IPG A;  4TW5 A;  5FT3 A;  1JZO A;  3ZTL A;  2YJ7 A;  1ZZY A;  2R6K A;  3GFK A;  1TK0 B;  2B5E A;  2VD1 A;  6GSX A;  1GTI A;  2GZZ A;  1ACV A;  2DJ3 A;  4GQF A;  2LKU A;  1GNE A;  5AN1 A;  2JU5 A;  3KJY A;  1ML6 A;  3Q6O A;  5ECO B;  3VFI A;  2YJH A;  2M80 A;  1WWJ A;  2XC2 A;  3CMI A;  1OC8 A;  1U87 A;  1G6Y A;  2F8A A;  2V32 A;  5LCZ A;  1EZK A;  2LUS A;  2VCT A;  4TR1 A;  1GRX A;  4F9Z A;  4PUR A;  1TI1 A;  2CV4 A;  3A2W A;  4IEL A;  2G0F A;  5AIV A;  1WRY A;  1HYU A;  3WGX A;  2F51 A;  3CSH A;  4BA7 A;  3FR9 A;  2LV3 A;  3EU4 A;  3LJR A;  3IOS A;  5ECQ B;  2AV4 A;  4BVX B;  5B8B A;  1FO5 A;  4AJ8 A;  1GUL A;  3SWL A;  2PBJ A;  4TN8 A;  3G7J A;  1IYI A;  5KN3 A;  3I6A A;  2N5A A;  2PGT A;  4PX1 A;  4PUA A;  2X4A A;  4MA9 A;  1XWA A;  4XRD A;  2VL9 A;  2E7P A;  3GUR A;  2CZ3 A;  2FY6 A;  1NHO A;  3PR8 A;  3DD3 A;  3L0H A;  2GZP A;  2IPA A;  3TJB A;  2IL3 A;  2O85 A;  5CNW A;  1I5G A;  3UAR A;  3EU3 A;  3JCM L;  1DSB A;  5GST A;  3TKS E;  3E9J B;  5L71 A;  3IC4 A;  2A2P A;  1TW9 A;  5CP1 A;  5ECP B;  3MIX A;  3TJG A;  4O32 A;  1V98 A;  1Z6N A;  2VD0 A;  1SK0 A;  4G19 A;  2H76 A;  1GSF A;  3UL3 A;  5D8I A;  2GQL A;  4LMV A;  4GTU A;  1GUK A;  1MDK A;  2KOK A;  4KDY A;  2H74 A;  4ZB8 A;  3IK7 A;  3WT1 A;  3U5R E;  4TR0 A;  2H70 A;  4QQ7 A;  1JZD A;  4CW9 A;  2VO4 A;  2ZNM A;  3KH7 A;  2RUE A;  2F3M A;  1VF4 A;  4WKW A;  1MTC A;  3D22 A;  4N0Z A;  3P90 A;  2LRT A;  4HU9 A;  2YWM A;  3I9V 2;  3H8Q A;  1OAZ A;  4XIH A;  1OE7 A;  3FW2 A;  1PSQ A;  3HHV A;  5IPH A;  4KSO A;  1VRS D;  5CRE A;  3ZVJ A;  5DAK A;  3VWU A;  4FYB A;  3VWW A;  2FGX A;  4J56 E;  3J7Y b;  4HJ2 A;  4YQM A;  4ZL7 A;  2HZF A;  3K8N A;  4Z2T A;  1TU7 A;  1OC3 A;  4KAE A;  1G7O A;  5FHI A;  3UMA A;  5COH A;  2O8V B;  5JCU A;  1O7U A;  1G6W A;  4LLR A;  1J08 A;  3VLN A;  1GH2 A;  2WFC A;  4MMM A;  2HRA A;  3GH6 A;  5IOW A;  1A24 A;  4HI7 A;  3ZYW A;  2P5R A;  1B9Y C;  2P5Q A;  1PKW A;  4E8E A;  5KOX A;  3KIJ A;  3FZ4 A;  3CTG A;  5G31 A;  5F05 A;  2XBI A;  4IQA A;  2PPT A;  1M9B A;  4OMV A;  1J0F A;  2DJ1 A;  3MAK A;  1R5A A;  3M9K A;  5JWO B;  4KCE A;  4GRF A;  1XWK A;  2H6Y A;  2DIY A;  3KGK A;  5B7C A;  1YDK A;  2I3Y A;  4D73 B;  2Z9S A;  3H1N A;  4O7H A;  2QGV A;  3GTU A;  2CX3 A;  3GA4 A;  2VUP A;  1YQ1 A;  4MPF A;  2B1K A;  5ECI B;  5AIS A;  4IP6 A;  2K9F A;  1AW9 A;  3F0I A;  2VL2 C;  3GST A;  4EVM A;  4TXO A;  4FIW A;  3KCM A;  2H72 A;  4EUY A;  3BOA A;  3M8N A;  5KN0 A;  4BVY A;  2GS3 A;  3UEM A;  2MMA A;  4K7N A;  4EXJ A;  5DVB A;  2HFD A;  2F8F A;  3Q74 A;  4V2M A;  1EV4 A;  2VCV A;  3ERG A;  3KMN A;  4ECC A;  2IMD A;  2I81 A;  2DSA A;  4X43 A;  3HVV A;  2B7J A;  4X4J A;  3VWV A;  5GAN D;  1RQM A;  1SJZ A;  2OBI A;  3CRT A;  1EP8 A;  4J2F A;  3FZ9 A;  2K8S A;  4EDZ A;  3GIX A;  3G7Y A;  4NMU A;  2NBS A;  2L4C A;  4WF4 A;  5F06 A;  1ZYP A;  2YAN A;  3M1G A;  4OCE A;  4E8H A;  3KEB A;  1OC9 A;  5ABR A;  3O6T A;  4V2N A;  2VOC A;  5IOX A;  2AUV A;  3FHK A;  2OKA A;  1G7E A;  4JRR A;  3RAZ A;  2V6K A;  3GMF A;  4YH2 A;  4G0K A;  4MH2 A;  1T4Z A;  3TRX A;  3C7M A;  4QL7 A;  5H5R A;  5CRG A;  1KBN A;  1PN9 A;  2IJY A;  2XBQ A;  3DGQ A;  3P7X A;  2PN8 A;  1Z7P A;  2M46 A;  4HEA 2;  3QMX A;  1TK5 B;  3M0F A;  3I43 A;  2E0Q A;  2GQM A;  1O85 A;  4RQX A;  5HFG A;  2MZC A;  4TXO B;  1A8Y A;  1TDI A;  4EIQ A;  1Y25 A;  3GHA A;  4JR4 A;  4MF5 A;  5CAX A;  2DJJ A;  1GSU A;  1NW2 A;  3TDG A;  4NPB A;  3VUR A;  5IMC A;  4J57 E;  3D5J A;  1M2D A;  1WIK A;  3HD5 A;  3F4S A;  5IO0 A;  4KDX A;  4XS1 A;  2WCI A;  2UZ8 A;  1O8W A;  4KND A;  5A4V A;  3NOF A;  1PL2 A;  1MD4 A;  3ISO A;  16GS A;  4G10 A;  3DVW A;  1AXD A;  3WT2 A;  1YEP A;  2AYT A;  1GUH A;  2HYX A;  1QGV A;  2YP6 A;  4FO5 A;  2N5B A;  4BWS A;  3ED3 A;  3LXZ A;  1JZW A;  3HZ8 A;  4BL7 B;  1XW9 A;  2H6Z A;  4GQC A;  5DAL B;  5F0G A;  3GKM A;  3EIN A;  5AGY A;  5F8B A;  2DC5 A;  1DBY A;  4DSS B;  1GUM A;  3LEF A;  3IAS 2;  4HDE A;  3MYD A;  1GSY A;  2FA4 A;  3C8E A;  4XHM A;  1S3A A;  3GH9 A;  5D9V A;  2HXK A;  4NV2 A;  2H0H A;  4MH3 A;  1GL8 A;  2MBS A;  2J9H A;  3PIN A;  4RI7 A;  3F9U A;  1DUG A;  4L5O A;  3LXT A;  1PX6 A;  1SKS B;  5B8A A;  4L0U A;  9GSS A;  2VL3 A;  2RUF A;  1GLQ A;  3C1R A;  1ZYE A;  3AY8 A;  13GS A;  4KE3 A;  2A4H A;  1F3A A;  1TJD A;  5G5F A;  2OA7 A;  2FUG 2;  1XWB A;  4TXV A;  3IE3 A;  2RM6 A;  3F8U A;  4N30 A;  2B6M A;  4JBB A;  4F0B A;  3IC8 A;  3F4R A;  1O73 A;  2H0I A;  4MDC A;  2H0G A;  1ZMA A;  2BMX A;  3ZZX A;  4A5P A;  3CXG A;  4L5L A;  5DJL A;  5CRD A;  4L0W A;  17GS A;  1E6B A;  3FEU A;  4EIP A;  1O8X A;  2VLV A;  4ZL9 A;  2KP1 A;  1V2A A;  2WJU A;  3KMO A;  4MCU A;  1GSS A;  4I8B A;  3TKS A;  1M2B A;  2E2M A;  3ZMK A;  1PRX A;  3DML A;  1MDJ A;  2P0G A;  2LQO A;  3UAP A;  1YF0 A;  5EL8 A;  3WGE A;  2WGR A;  5ECS A;  2F9S A;  4AF2 A;  3VPT A;  2RLI A;  4I2T A;  3BD2 A;  4MZW A;  1K3O A;  10GS A;  6GSS A;  5H5S A;  2EIQ A;  4ECB A;  5INY A;  2IFQ A;  2B5Y A;  3L9S A;  3QFA C;  1U3I A;  2H66 A;  2V6O A;  3TB2 A;  2VM2 A;  4WBR D;  2TIR A;  1MEK A;  3EYT A;  3W6G A;  5E59 A;  1FAA A;  3RPN A;  2KHP A;  4K0G A;  4P3Y B;  1S3D A;  2CAI A;  4NWY A;  1SKW B;  5DCH A;  2LJR A;  1OYJ A;  3IV4 A;  4MF7 A;  4OFM A;  1JLV A;  3QAV A;  3EMX A;  5G2Z A;  1VF1 A;  1SU9 A;  1K0O A;  1A2J A;  1BED A;  4KDU A;  1PQN A;  3DIE A;  4G0I A;  2O87 A;  1EEM A;  1EP7 A;  2L57 A;  2PER A;  2AAW A;  4POM A;  1XPV A;  1A0F A;  3FRC A;  5IQY A;  1SK1 A;  6GSV A;  3HCZ A;  2C3N A;  3L4N A;  3CTF A;  2WDU A;  4ZL8 A;  2OAD A;  1BJX A;  3N9J A;  1R4W A;  1FVJ A;  3DYR A;  5IMZ A;  3HA9 A;  4ZBA A;  2MBT A;  4HJM A;  1ERT A;  4K5R A;  2LNT A;  2H75 A;  3GSS A;  3TKS C;  3UBK A;  1PKZ A;  1NHY A;  1GTU A;  2ON7 A;  4Q5R A;  5ENU A;  3KTB A;  2LEG A;  1SEN A;  3D21 A;  4I6X A;  2H01 A;  1K0C A;  2WUL A;  2I4A A;  4Z7X A;  4IQ1 A;  1QUW A;  3QDN A;  4HS1 A;  3VPQ A;  1FVK A;  2IFQ B;  4TR1 B;  2HRF A;  5GSS A;  1USB A;  2C4J A;  4ECI A;  5ELA A;  5DCG A;  4ECJ A;  1TKD B;  1F37 A;  2ES7 A;  3HYP A;  4I2U A;  1X9W B;  3IA1 A;  3C73 A;  1A2M A;  4MK3 A;  4USS A;  3CSI A;  4EKZ A;  3GUS A;  1ERW A;  1E2Y A;  2VL2 A;  1TRV A;  2I1U A;  3GL5 A;  1Z3E A;  2PMT A;  3HJP A;  3VWX A;  2H1D A;  2IMF A;  1EEJ A;  4K1F A;  1X5E A;  2IMI A;  2JL4 A;  2GST A;  1B8X A;  3KTL A;  3RDW A;  4ML1 A;  3L78 A;  4WXT A;  1BQ7 A;  4ZIJ A;  4MLY A;  4POK A;  4JR6 A;  4MJE A;  3VI5 A;  1QK8 A;  4TRX A;  22GS A;  2OAC A;  1PN0 A;  4RI6 A;  3LYP A;  4ULX A;  1T8E B;  3FR3 A;  3O76 A;  1MD3 A;  4MAB A;  4MF6 A;  2JZS A;  2HRK A;  2LJA A;  2DJ0 A;  2YV9 A;  1QFN A;  3KXO A;  2L5L A;  1Y6E A;  3NZN A;  3ZRE A;  1ILO A;  1B4P A;  4X1U A;  1F6M C;  5G30 A;  3ZFB A;  3KH9 A;  4K7O A;  4V1A g;  1K0M A;  2H71 A;  3O3T A;  3ZRD A;  4CHS A;  4YAP A;  3LYK A;  4KH7 A;  5KN2 A;  2MYG A;  1GNW A;  2PWJ A;  2CVD A;  2YN1 A;  3LFL A;  1O81 A;  2VCZ A;  3GRX A;  5DQY A;  2OBK A;  3UVT A;  3DWV A;  3I69 A;  4RQR A;  11GS A;  3VI7 A;  1T3B A;  2QA1 A;  3S9F A;  2KUC A;  4CY6 A;  5D9X A;  4ZB9 A;  3ZL5 A;  3HJO A;  1TRU A;  2FHE A;  1QXH A;  1K3L A;  3APQ A;  2IN3 A;  2R4V A;  5DAK B;  5H5Q A;  5JWR B;  3J7Y k;  4ILF A;  1T00 A;  1BAY A;  1SD8 A;  4IW9 A;  4PUF C;  1NSW A;  3GKX A;  3A5W A;  3ZLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...