3J7Yk

Structure of the large ribosomal subunit from human mitochondria
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
VKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF10780 MRP_L53 39S ribosomal protein L53/MRP-L53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3j7yk00
1G6WA 1GUHA 3I9V2 5FWGA 2NVLA 2CVBA 4TXOA 1SK0A 2E7PA 5ECHB 2I3YA 2IMFA 1J0FA 5G5EA 4KSOA 3TOTA 4WEYA 2GLRA 5FT3A 3SBCA 4IVFA 3DEXA 4L0WA 3TKPA 2GGTA 3HJOA 3RPPA 4Q5RA 1WOUA 1GSUA 1K0NA 2YOIA 3TDGA 2F9SA 2VAFA 4V2NA 3GKKA 3D6IA 3BOAA 3Q6OA 1DSBA 4X1UA 4EC0A 2H1DA 2IFQA 2XBIA 1YY7A 5EVOA 4JE1A 4IELA 5D9VA 4HQSA 4N10A 3LG6A 2VIMA 2VLTA 5CYYA 2GZPA 1OE7A 3EMXA 4O7HA 3M0FA 3CSJA 3ZZXA 4YQVA 3HVSA 3PH9A 2L59A 1S3AA 3GMFA 2K9FA 3TKRA 3DD3A 2HYXA 4K2DA 1IYHA 5J41A 5G1LA 3IE3A 4K6XA 3WGEA 2B5YA 3DVXA 1O7UA 3K8NA 1WE0A 2VD1A 1ACVA 4G2EA 1U3IA 2LRNA 4TR1A 1V58A 1MD4A 4TXVA 2H74A 2VLUA 2FHEA 3GKXA 3KMNA 1OE8A 3GYKA 1JFUA 1YZXA 1XW6A 2LQOA 1YJ6A 2B7KA 1GUKA 4FYUA 1WIKA 2OBIA 4LL1B 3HDCA 1TU7A 2HT9A 3UAPA 3ZIVA 4JEDA 4MZCA 1TDIA 1B9XC 1AQWA 2R3XA 2C0FA 1J9BA 5CAXA 2VCQA 3UOMA 1ABAA 2CVKA 2HRFA 6GSUA 1K3LA 3ZREA 3GA4A 3HKRA 3QAWA 2Z9SA 5D96A 1R26A 2V2GA 4CHSA 4HZ4A 3L9VA 2H0IA 1R4WA 2RUFA 1USBA 2PPTA 4OO4A 1U3AA 3H4KA 20GSA 4RQRA 19GSA 2OACA 1DBYA 1QK8A 2WB9A 4N11A 1Z6NA 5ECQB 3KP8A 1ERWA 5HR1A 2VCTA 5IO2A 2LJAA 1F2EA 5AGYA 1NHYA 1ZYEA 1S3CA 4IQ1A 1WJKA 2FNOA 4I97A 5DAKB 2M46A 4ILFA 3N9JA 3C1RA 4DSRA 1XPVA 6GSYA 1OAZA 2C1YA 2CAQA 5G30A 3ZTLA 5ECKB 4MCUA 4QL9A 3Q18A 1H75A 3UIWA 3PINA 4YQMA 4BWQA 3CTFA 3GRXA 2LJKA 5IM9A 1OC9A 4EDZA 1SENA 1XWKA 2AV4A 2E2GA 5AN1A 1V2AA 1F6MC 3IK9A 1DUGA 2LNTA 4JZQA 1OVNA 4ZXGA 1V40A 1X0RA 4LLRA 3GX0A 5B6MA 3CTGA 4MF6A 1LJRA 2H1BA 4ZB9A 3KM6A 4MZBA 1TKDB 1TOFA 4NPBA 4EVMA 5A5KA 1GSDA 3I43A 3G7JA 2VL2C 2C3NA 2HI7A 3HZ8A 2I81A 4ML1A 5DCGA 2L4QA 2F8AA 2I9HA 1BEDA 1UA5A 1MDJA 1EP7A 1AW9A 2KHPA 1GSEA 5GAPD 2NBSA 4NV5A 1LBKA 4EF0A 1PKZA 3HHVA 1A0RP 2P5RA 2DIYA 5H5QA 3DXBA 2A2SA 1HNBA 1TI3A 1FB6A 1SJIA 3ME8A 1SL0B 4JU5A 3IC4A 4J2FA 3MAKA 3EURA 3LFLA 4HJ2A 3HA9A 2IMDA 3ZVJD 1WWJA 1AUCA 4CW9A 2AYTA 3ZFBA 4I6XA 18GSA 2PUKC 2KP2A 2J23A 5D9XA 4PQIA 3VK9A 4ACSA 4HI7A 1HNCA 4YH2A 4OFTA 2PBJA 1KEBA 1B48A 2JL4A 2DLXA 4EXJA 2GQKA 3F3QA 2RM5A 4GWRA 4XRAA 1NHOA 4G9HA 4MK3A 3F8UA 3GKNA 3O76A 1TRUA 3ZYWA 2C80A 3GL3A 5CRHA 2JZRA 4KDYA 2YNXA 1QFNA 2GQMA 1GNEA 3HD5A 4WBRD 1TRVA 2YWNA 4J56E 4RI6A 5ECRB 4YQUA 2JZSA 1VRSD 3L78A 1EV9A 1HYUA 1RW1A 5L71A 3D21A 7GSSA 1Z9HA 4PXOA 3PGTA 2QSIA 3L9UA 5B6NA 5IQYA 1I5GA 3J7Yk 3APOA 3GH9A 3VURA 3OR5A 3GL5A 3VWWA 1RK4A 1Q98A 3WYWA 2LUSA 3F9UA 2VCXA 1VGLA 2DJKA 4GTUA 5HFKA 2K8VA 1BG5A 1BQ7A 6GSTA 3BCIA 2GSSA 1XXUA 3IDVA 5F07A 4V1Ap 3KGKA 4K7NA 2MMOA 1OC3A 2H66A 4BVYA 2HSYA 3RDWA 1T4YA 2YWOA 2CVDA 3FR3A 2N5FA 1DE2A 3GUSA 2LJRA 3APSA 3GV1A 5ENUA 2VM1A 1NSWA 1MDIA 4F9ZA 1XOBA 1GH2A 3KCMA 4JRRA 5LNKe 3VPTA 1Z3EA 4HU9A 2CV4A 1N8JA 2H1GA 2K8SA 2H72A 4HU7A 1K0BA 2B5XA 2DC5A 3PR8A 5J5NA 4TOPA 2H01A 1ERTA 2ALBA 2B3SA 4MA9A 1TP9A 1Y25A 5DALA 1F9MA 4I2TA 3MDKA 3GTUB 1TK8B 3TGZA 1GTBA 1M2AA 1JHBA 2FGXA 5EL8A 1Q4JA 4XCSA 3UJ1A 4MDCA 4K7OA 2R4VA 5AISA 1A2LA 5ID2A 2DBCA 1WP0A 2WS2A 3C73A 2AHEA 2WULA 4DSQA 2FY6A 1T1VA 5CREA 4GSTA 5DCHA 2DSAA 1MDKA 4Q5FA 4BVXA 3I6AA 1T00A 4XHMA 4IQAA 4MH2A 2WCIA 3QMXA 5DQSA 1J08A 1GWCA 5HR3A 1X5CA 4TXOB 3ZMLA 1X5DA 5B8BA 4AJ6A 1U6TA 4MPGA 2GTUA 1HQOA 3JCML 1T4ZA 2CZ3A 5AIVA 5J9BA 3HXSA 3IOSA 5DQYA 2YJHA 1VF4A 5G2ZA 2H6YA 2N5BA 3U5RE 4MJAA 1XVWA 3FW2A 1SD8A 4TR0A 2IMEA 5E4WA 3DYRA 1RQMA 2MZCA 2LNSA 4IHUA 1TW9A 3LYPA 1GSYA 3IK7A 1W4VA 4IJIA 3NIVA 2VUPA 2CZ2A 4ULXA 4HQZA 4ZL9A 1PKWA 2HZFA 3HYPA 4F0BA 2AAWA 3QPMA 2IFQB 5GAND 1E6BA 4MLYA 6GSWA 9GSSA 1ZCPA 4AJ8A 3GURA 5KEJA 5IPHA 22GSA 4TN8A 2DMMA 3C7MA 4NV2A 2QGVA 2WJUA 5B8AA 4IP1A 2FUG2 2WRTA 3LSZA 2HRNA 2MMNA 3TJKA 1PMTA 3GNJA 1O81A 3DWVA 3HVXA 3VFIA 4ZB8A 1GSQA 3GSTA 1M2BA 3HVVA 1VF1A 3TKSA 3M8NA 4MP4A 4YAVA 1A2MA 4P3YB 4TR1B 2O89A 4K7IA 1AQXA 2HFDA 4KE3A 5EY6A 1EGRA 2X8GA 2B7JA 1XWAA 3TJFA 5ELAA 1PRXA 1EWXA 1A8LA 2R6KA 1H4OA 3TB2A 2B5EA 2LS5A 5JCWA 4E8EA 1DE1A 1ZGNA 3UVTA 3FY7A 2IMIA 3QOUA 1M7TA 3US3A 4D73A 1X9SB 4BL7A 2FLSA 4GQCA 1G7OA 2K6VA 3C8EA 1EZKA 4RI7A 2G0FA 2F3MA 2GDRA 2H75A 1TTZA 3TJBA 1IYIA 3QDNA 1M9AA 3BCKA 1M9BA 1FW1A 3F4SA 2DJ0A 4O92A 1EGOA 4IGJA 1GLPA 2EIOA 4GCIA 2DMLA 2ZCTA 3FKFA 3KMOA 4RUVA 4TRXA 4G10A 3ZRDA 5JCGA 1PQNA 2FA8A 5KN1A 4FYCA 2IJYA 4XS6A 4ZBBA 2L5LA 4XS4A 4KW6A 2XPEA 5CO3A 3TKQA 3EU4A 4HJMA 4KNDA 3GKMA 3P8WA 4NMUA 3LXTA 2KLXA 1PD21 1GNWA 2VL3A 1X5EA 1U88A 1XCCA 2C4JA 2HZEA 4V2LA 4QQ7A 2BTOT 2L57A 2YWMA 2V6OA 4MF7A 2YCDA 3VWXA 2RUEA 1O85A 1K0MA 1EOGA 3S9FA 1VF2A 3GFKA 3DGQA 3D4MA 3AY8A 2MBTA 3UARA 2TIRA 1OC8A 2IPAA 2WFCA 4JBBA 2QC7A 2E2MA 4ZIJA 2TRCP 4BWSA 3D0ZA 5A4WA 2FWHA 1T8EB 2YPMA 1OC9B 2REMA 2V32A 2LQQA 1KBNA 2B1LA 1F3AA 1ERVA 2L6DA 4K0GA 1O6JA 3KXOA 5F05A 4NWYA 2YANA 4PUFC 2VD0A 3APQA 2C8UA 3CYNA 1SJ6A 4DSSA 1TRWA 5HFGA 3A3TA 1XW5A 2E0QA 1K3OA 5COHA 1X9WB 4KGIA 2CA8A 1X9MB 2LTKA 3W8JA 4PGTA 1SKRB 3A2WA 5F06A 3MNGA 2PU9C 1PL1A 2EIQA 5ECNB 2GSTA 3EWLA 3P7XA 5HQPA 1EOHA 4XRDA 4J57E 1GULA 4L5LA 2WDUA 4NAXA 3A5WA 4L5OA 4V2MA 4FYBA 3QD9A 4LMWA 3M1GA 5JWOB 1FVKA 2O7KA 4TR3A 2R2JA 3FZ5A 2LEGA 1QXHA 3O6TA 3TOUA 4Q5NA 2JSYA 3IPZA 3KZQA 5F8BA 4GSNA 5B7CA 3ME7A 5IMAA 1HD2A 2ZUPA 1YQ1A 3CSHA 1ZL9A 1K0OA 1W89A 4PQ1A 2GQLA 2KUCA 3EE2A 4OMVA 5IMCA 4K9ZA 4ML6A 1LU4A 2H76A 4I8BA 3UMAA 3WT2A 1WPIA 4PNFA 5EPFA 1A23A 1EV4A 3C1SA 4TKYA 5D9TA 4K1FA 1E2YA 3GN3A 3KP9A 3QFBC 3ISOA 2ES7A 5A4VA 3H79A 2YJ7A 3W6GA 4ECJA 2HXKA 3WGDA 4PNGA 3H1NA 4X43A 2GT5A 4HDEA 5G5FA 3L0HA 6GSSA 4MPFA 5IMVA 1XOAA 2JZTA 1B4QA 4ZBDA 2BJXA 2C0DA 2AB6A 4AJ7A 1ON4A 4F03A 1AQVA 1NM3A 4V1Ag 2GVPA 4MJEA 2M72A 5GSTA 2XC2A 1WMJA 1JZDA 2YN1A 4TVEA 2XBQA 5KN2A 2P0GA 5FHIA 4WR5A 4IN0A 4MJBA 3TRXA 1XFLA 2GT6A 2X64A 2C0GA 3IXRA 5D73A 5IMZA 3WGXA 5ECPB 4I5QA 4MMMA 3KIJA 3G9BA 4TR4A 1YKCA 1XVQA 1BAYA 4ZL8A 1YKAA 1S3DA 3FEUA 1B8XA 4IS0A 3GIXA 3MWHA 1SD9A 4OWYA 3HZ4A 3LYKA 1NW2A 3VI5A 1A24A 2O85A 1EEMA 1XWCA 2NPBA 4ZILA 3RHCA 1R7HA 2IWTA 5IMDA 4GSSA 3ERFA 4FH8A 3HY2A 4F2IA 4K0NA 1SK2A 3FR6A 2GSRA 4HEA2 2L4CA 1TK0B 1GTIA 1K0DA 2IL3A 1YF1A 1K3YA 1YEXA 1T3BA 3E0UA 4Q5QA 3I69A 1OKTA 3WD6A 3QFAC 5IIZA 2IIYA 1MD3A 5DJLA 4TW5A 3FHKA 5DALB 5GZZB 3TKSE 3D5JA 3P90A 5LD0A 4K8MA 3DRNA 4KSMA 3BBYA 3FZAA 5ID2B 1JLVA 3H8QA 2C3TA 1PGTA 1AAZA 1FG4A 1GSSA 3EYTA 1B9YC 1ZZYA 1PA3A 1V57A 3TRQA 2PGTA 1KTEA 1MEKA 1ZYQB 5HFIA 1SKWB 2VOCA 4KDXA 1GRXA 1TJDA 5J3RA 2H0GA 1UVZA 4CDOA 4ECBA 1EEJA 5G1KA 4MABA 5IPGA 1AC1A 4OD7A 2KP1A 4WBJA 5D9WA 1A0FA 1Y6EA 3ZMKA 3IRAA 1KNGA 1ZMAA 3KJYA 10GSA 5F0GA 2HSHA 4AGSA 1OKDA 2N5AA 3H93A 1QMVA 4KA0A 5HR0A 5H5RA 4Z7XA 3F4RA 1SKSB 2DJ3A 2NTOA 2P5QA 1O8XA 4OFNA 2FWEA 2BMXA 2EC4A 1FO5A 4IJ3A 2MMAA 1TI1A 4KDUA 2JACA 3DVWA 1GUMA 2H71A 2VCVA 3ERWA 4PURA 3RAZA 1PL2A 4AF2A 3QCPA 8GSSA 4ISDA 3ZIJA 4N30A 3VWUA 2DJJA 2MBSA 4JR6A 3QR6A 3LORA 1FAAA 2O87A 2YZUA 5CNWA 1QGVA 3ZVJA 2VL2A 3F0IA 5J9CA 4HOJA 4WF4A 1UC7A 3IAM2 2FCHA 1BYEA 5DDLA 3DKSA 2AJQB 3IA1A 3NZNA 5C04A 4EDYA 5LCZA 1YDKA 2XPDA 4ID0A 2CX3A 3BD2A 4KCAA 3LEFA 3Q19A 3FRCA 1N2AA 2OA7A 1XW9A 3J7Yb 5ECIB 4D73B 1MTCA 1ML6A 1XWGA 4EKZA 1A8YA 1QQ2A 2ON7A 3R2QA 1M0UA 1O8WA 4OO5A 3F3RA 3KEBA 2OE0A 2JSZA 3DMLA 4X0XA 3TUEA 5ABRA 1ILOA 4XIHA 3ZITA 2FD3A 2YWIA 4IKHA 2A2RA 2FA4A 2LRCA 4BA7A 2CT6A 4PUAA 1THXA 2QKEA 2CAIA 1TK5B 2YZHA 3VPQA 4MZWA 4XS4B 4EUYA 4POMA 2YP6A 3UBLA 5JWQB 5IOWA 1SK1A 5CRGA 1YF0A 3ED3A 4E8HA 2FWGA 3KH9A 1R5PA 2ON5A 2MYGA 1FHEA 3BJ5A 1SYXA 4GXZA 2HZEB 2H8LA 2F8FA 3GX8A 3IBHA 2WGRA 2J9HA 3EINA 3NOFA 4WR4A 1XBSA 2DIZA 1K0AA 2FWFA 4IW9A 2OKAA 2XHFA 5AIXA 2R5GA 1A2JA 2VM2A 1GSFA 3TCOA 2IN3A 3CMIA 5ELGA 2CX4A 5ECOB 3SWLA 5DAKA 4XS1A 3LXZA 5J4UA 3KTLA 4I2UA 5D93A 3VWVA 3D4TA 4FO5A 3G7IA 2AUVA 4N0ZA 1URMA 3FYGA 4KB3A 2LKUA 4LA1A 13GSA 4POLA 2L6CA 1UN2A 4KH7A 1HNAA 17GSA 2JADA 3CRTA 2OE1A 4OCFA 3F63A 1QUWA 4RQXA 2F51A 5JCUA 3UL3A 1F37A 4DSSB 1SYRA 3LGCA 4WXTA 3FZ4A 2B1KA 2PMTA 3CSIA 1YEPA 3F6DA 1Z7RA 4FIWA 3G7YA 3UBKA 5ECSA 2RM6A 5C00A 3VI7A 4ECIA 1PX7A 1C72A 2P31A 3GSSA 1BJXA 1FOVA 2X8CA 2GS3A 3CRUA 2VL9A 1XIYA 5ECMB 2O8VB 1GTUA 1GTAA 1GP1A 4L0UA 4MH3A 5CP1A 5E59A 1K0CA 5KN3A 1BX9A 5H5SA 2IMKA 3TKSC 3E3EA 2H19A 3N5OA 2PWJA 2M80A 5DBQA 3MSZA 2HLSA 3ZFLA 3M3MA 5CRDA 2OBKA 3ZLPA 16GSA 1ZOFA 3E9JB 1EP8A 1G7EA 1OYJA 4DVCA 3HJPA 1AIUA 4L8EA 5D8IA 3A2XA 14GSA 2H70A 1WRYA 1M99A 3RHBA 4HUAA 4EO3A 1Z5YE 1VF3A 1I9DA 3CXGA 3EC3A 2NDOA 4NXIA 1B4PA 1SJZA 4EL1A 1SU9A 3TJGA 3GH6A 1TRSA 3L4NA 4MF5A 2X8HA 3U6VA 3LWAA 3F6FA 2TRXA 2YV9A 1CQGA 1XWBA 2GZZA 3LQ7A 3ZL5A 2DJ1A 4F82A 4OCEA 2GZYA 2B6MA 3KD0A 4WF5A 3HCZA 2KOKA 3IR4A 3UEMA 2RIIA 2C3QA 3IAS2 2OADA 1V9WA 2I1UA 3CBUA 4GF0A 2V1MA 4PX1A 1JZOA 1JLWA 3EU3A 6GSXA 4IBPA 1PN9A 2H0HA 5ECLB 4POBA 2GSQA 1GLQA 3O3TA 5IOXA 2OJLA 1JZWA 1AXDA 3M9JA 2MMZA 5IO0A 3WT1A 2H6XA 4HS1A 1U87A 4O5RA 4ECCA 1GL8A 4POKA 3LJRA 5CRWA 5DVBA 3TJJA 2CQ9A 2DJ2A 4GQFA 1SL2B 2RLIA 2G2QA 3A2VA 2PN8A 3VLNA 3IHQA 4BPYA 3EVIA 2C0EA 2D2ZA 4YAPA 4KAEA 2H1AA 6GSVA 4QL7A 3TRPA 4NHZA 1TXXA 2H30A 2K18A 3C71A 3KTBA 3M9KA 2PERA 4JR4A 1JZRA 1Z7PA 3FR9A 4DEJA 1G0TA 3ERGA 4O32A 3IV4A 2HE3A 1R5AA 4H86A 3UVHA 2WZ9A 2OE3A 2X99A 2VCZA 1ST9A 3QAVA 5INYA 11GSA 2R37A 4KUNA 3FK8A 4F0CA 2HNLA 2PVOC 3V1WA 2ZNMA 3D22A 5A4UA 4ZB6A 4EE0A 1PSQA 1SL1B 2PVQA 12GSA 2JU5A 1ERUA 3EMPA 4WKWA 1G6YA 5KN0A 2VCWA 3GHAA 1O73A 1T7PB 5DJMA 4HZ2A 4ZBAA 4G19A 3HJMA 1TU8A 3W8SA 2H6ZA 2VLVA 1CQHA 4ZL7A 1XZOA 4IP6A 3P2AA 1V98A 4XTSA 4OFMA 2EIRA 3QAGA 1M2DA 4N0VA 1FVJA 4MJCA 4KX4A 1F3BA 3F4TA 3RPNA 1FB0A 2I4AA 2A4VA 3GTUA 4LL4B 4GRFA 2V41A 3FZ9A 5HR2A 5IMFA 4PQHA 5GSSA 3RBTA 5JWRB 2H73A 1PX6A 4LMVA 4NHWA 1THOA 3Q74A 5G31A 2LV3A 2VO4A 3DIEA 2YV7A 1Z6MA 2V6KA 2LRTA 2LSTA 2L5OA 4KCEA 4GLTA 3L9SA 4WETA 3KH7A
chains in the Genus database with same CATH superfamily
1G6WA 1GUHA 3I9V2 5FWGA 2NVLA 2CVBA 4TXOA 1SK0A 2E7PA 5ECHB 2I3YA 2IMFA 1J0FA 5G5EA 4KSOA 3TOTA 4WEYA 2GLRA 5FT3A 3SBCA 4EIPA 4IVFA 3DEXA 4L0WA 3TKPA 2GGTA 3HJOA 3RPPA 2DKIA 4Q5RA 1WOUA 1GSUA 1K0NA 2YOIA 3TDGA 2F9SA 2VAFA 4V2NA 3GKKA 3D6IA 3BOAA 3Q6OA 1DSBA 4X1UA 4EC0A 2H1DA 2IFQA 2XBIA 1YY7A 5EVOA 4JE1A 4IELA 5D9VA 4HQSA 4N10A 3LG6A 2VIMA 2VLTA 4O5QA 5CYYA 2GZPA 1OE7A 3EMXA 4O7HA 3M0FA 3CSJA 3ZZXA 4YQVA 3HVSA 3PH9A 2L59A 1S3AA 3GMFA 2K9FA 3TKRA 3DD3A 2HYXA 4K2DA 1IYHA 5J41A 5G1LA 3IE3A 4K6XA 3WGEA 2B5YA 3DVXA 1O7UA 3K8NA 1WE0A 2VD1A 1ACVA 4G2EA 1U3IA 3IC8A 2LRNA 4TR1A 1V58A 1MD4A 4TXVA 2H74A 2VLUA 2FHEA 3GKXA 3KMNA 1OE8A 3GYKA 1JFUA 1YZXA 1XW6A 2LQOA 1YJ6A 2B7KA 1GUKA 4FYUA 1WIKA 4G0IA 2OBIA 4LL1B 3HDCA 1TU7A 2HT9A 3UAPA 3ZIVA 4JEDA 4MZCA 1TDIA 1B9XC 1AQWA 5KOWA 3MYDA 2R3XA 2C0FA 1J9BA 5CAXA 2VCQA 3UOMA 1ABAA 2CVKA 2HRFA 6GSUA 1K3LA 3ZREA 3GA4A 3HKRA 3QAWA 2Z9SA 5D96A 1R26A 2V2GA 4CHSA 4HZ4A 3L9VA 2H0IA 1R4WA 2X49A 2RUFA 1USBA 2PPTA 4OO4A 1U3AA 4X4JA 3H4KA 20GSA 4RQRA 19GSA 3CQFA 2OACA 4PTSA 1DBYA 1QK8A 2WB9A 4N11A 1Z6NA 5ECQB 3KP8A 1ERWA 5HR1A 2X4AA 2VCTA 5IO2A 2LJAA 1F2EA 5AGYA 1NHYA 1ZYEA 1S3CA 4IQ1A 1WJKA 2FNOA 4I97A 5DAKB 2M46A 4ILFA 3N9JA 3C1RA 4DSRA 1XPVA 6GSYA 1OAZA 1FOHA 2C1YA 2CAQA 5G30A 3ZTLA 5ECKB 4MCUA 4QL9A 3Q18A 1H75A 3UIWA 3PINA 4YQMA 4BWQA 3CTFA 3GRXA 2LJKA 5IM9A 1OC9A 4EDZA 1SENA 1XWKA 2AV4A 2E2GA 5AN1A 1V2AA 1F6MC 3IK9A 1DUGA 2LNTA 4JZQA 1OVNA 4ZXGA 1V40A 1X0RA 4LLRA 3GX0A 5B6MA 3CTGA 4MF6A 1LJRA 2H1BA 4ZB9A 3KM6A 4MZBA 1TKDB 1TOFA 2DKHA 4NPBA 4EVMA 5A5KA 1GSDA 3I43A 3G7JA 2VL2C 2C3NA 2HI7A 3HZ8A 2I81A 4ML1A 1M3JA 4HSCX 5DCGA 2L4QA 2F8AA 2I9HA 1BEDA 1UA5A 1MDJA 1EP7A 1AW9A 2KHPA 1GSEA 5GAPD 2NBSA 4NV5A 1LBKA 4EF0A 1PKZA 3HHVA 1A0RP 2P5RA 2DIYA 5H5QA 3DXBA 2A2SA 1HNBA 1TI3A 1FB6A 1SJIA 3ME8A 1SL0B 4JU5A 3IC4A 4J2FA 3MAKA 3EURA 3LFLA 4HJ2A 3HA9A 2IMDA 3ZVJD 1WWJA 1AUCA 4CW9A 2AYTA 3ZFBA 4I6XA 18GSA 2PUKC 2KP2A 2J23A 5D9XA 4PQIA 3VK9A 4ACSA 4HI7A 1HNCA 4YH2A 4OFTA 2PBJA 1KEBA 1B48A 2JL4A 2DLXA 4EXJA 2GQKA 3F3QA 2RM5A 4GWRA 4XRAA 1NHOA 4G9HA 4MK3A 3F8UA 3GKNA 3O76A 1TRUA 3ZYWA 2C80A 3GL3A 5CRHA 2JZRA 4KDYA 4YKFA 2YNXA 1QFNA 2GQMA 1GNEA 3HD5A 4WBRD 1TRVA 2YWNA 4J56E 4RI6A 5ECRB 4YQUA 2JZSA 1VRSD 3L78A 1EV9A 1HYUA 1RW1A 5L71A 3EPTA 3D21A 7GSSA 1Z9HA 4PXOA 3PGTA 2QSIA 3L9UA 5B6NA 5IQYA 1I5GA 3J7Yk 3APOA 3GH9A 3VURA 3OR5A 3GL5A 3VWWA 1RK4A 1Q98A 3WYWA 2LUSA 3F9UA 2VCXA 1VGLA 2DJKA 4GTUA 5HFKA 2K8VA 1BG5A 1BQ7A 6GSTA 3BCIA 2GSSA 1XXUA 3IDVA 5F07A 4V1Ap 3KGKA 4K7NA 2MMOA 1OC3A 2H66A 4BVYA 2HSYA 3RDWA 1T4YA 2YWOA 2CVDA 3FR3A 2N5FA 1DE2A 3GUSA 2LJRA 3APSA 3GV1A 5ENUA 2VM1A 1NSWA 1MDIA 4F9ZA 1XOBA 1GH2A 3KCMA 4JRRA 5LNKe 3VPTA 1Z3EA 4HU9A 2CV4A 1N8JA 2H1GA 2K8SA 2H72A 4HU7A 1K0BA 2B5XA 2DC5A 3PR8A 5J5NA 4TOPA 2H01A 1ERTA 2ALBA 2B3SA 4MA9A 1TP9A 1Y25A 5DALA 1F9MA 4I2TA 3MDKA 3GTUB 1TK8B 3TGZA 1GTBA 1M2AA 1JHBA 2FGXA 5EL8A 1Q4JA 4XCSA 3UJ1A 4MDCA 4K7OA 2R4VA 5AISA 5KOXA 1A2LA 5ID2A 2DBCA 1WP0A 2WS2A 3C73A 2AHEA 2WULA 4DSQA 2FY6A 1T1VA 5CREA 4GSTA 5DCHA 2DSAA 1MDKA 4Q5FA 4BVXA 3I6AA 1T00A 4XHMA 4IQAA 4MH2A 2WCIA 3QMXA 5DQSA 1J08A 1GWCA 2A4HA 5HR3A 1X5CA 4TXOB 3ZMLA 1X5DA 5B8BA 4AJ6A 1U6TA 4MPGA 2GTUA 1HQOA 3JCML 1T4ZA 2CZ3A 5AIVA 5J9BA 3HXSA 3IOSA 5DQYA 2YJHA 1VF4A 4G0LA 5G2ZA 2H6YA 2N5BA 3U5RE 4MJAA 1XVWA 3FW2A 1S3RA 1SD8A 4TR0A 2IMEA 5E4WA 3DYRA 1RQMA 2MZCA 2LNSA 4IHUA 1TW9A 3LYPA 1GSYA 3IK7A 1W4VA 4IJIA 3NIVA 2VUPA 2CZ2A 4ULXA 4HQZA 4ZL9A 1PKWA 2HZFA 3HYPA 4F0BA 2AAWA 3QPMA 2IFQB 5GAND 1E6BA 4MLYA 6GSWA 9GSSA 1ZCPA 4AJ8A 3GURA 5KEJA 5IPHA 22GSA 4TN8A 2DMMA 3C7MA 4MNNA 4NV2A 2QGVA 2WJUA 5B8AA 4IP1A 2FUG2 2WRTA 3LSZA 2HRNA 2MMNA 3TJKA 1PMTA 3GNJA 4USSA 1O81A 3DWVA 3HVXA 3VFIA 4ZB8A 1GSQA 3GSTA 1M2BA 3HVVA 1VF1A 3TKSA 3M8NA 4MP4A 4YAVA 1A2MA 4P3YB 4TR1B 2O89A 4K7IA 2R0PA 1AQXA 2HFDA 4KE3A 5EY6A 1EGRA 2X8GA 2B7JA 1XWAA 3TJFA 5ELAA 1PRXA 1EWXA 1A8LA 2R6KA 1H4OA 3TB2A 2B5EA 2LS5A 5JCWA 4E8EA 1DE1A 1ZGNA 3UVTA 3FY7A 2IMIA 3QOUA 1M7TA 3US3A 4D73A 2R0GA 1X9SB 4BL7A 2A2PA 2FLSA 4GQCA 3R3EA 1G7OA 2K6VA 3C8EA 1EZKA 4RI7A 2G0FA 2F3MA 2GDRA 2H75A 1TTZA 3TJBA 1IYIA 3QDNA 1M9AA 3BCKA 1M9BA 1FW1A 3F4SA 2DJ0A 4O92A 1EGOA 4IGJA 1GLPA 2EIOA 5BRTA 4GCIA 2DMLA 2ZCTA 3FKFA 3KMOA 4RUVA 4TRXA 4G10A 3ZRDA 5JCGA 1PQNA 2FA8A 5KN1A 4FYCA 2IJYA 4XS6A 4ZBBA 2L5LA 4XS4A 4KW6A 2XPEA 5CO3A 3TKQA 3EU4A 4HJMA 4KNDA 3GKMA 3P8WA 4NMUA 3LXTA 2KLXA 1PD21 1GNWA 2VL3A 1X5EA 1U88A 1XCCA 2C4JA 2HZEA 4V2LA 4QQ7A 2BTOT 2L57A 2YWMA 2V6OA 4MF7A 2YCDA 3VWXA 2RUEA 1O85A 1K0MA 1EOGA 3S9FA 1VF2A 3GFKA 3DGQA 3D4MA 3AY8A 2MBTA 3UARA 2TIRA 1OC8A 2IPAA 2WFCA 4JBBA 2QC7A 2E2MA 4ZIJA 2TRCP 4BWSA 3D0ZA 5A4WA 2FWHA 1T8EB 2YPMA 1OC9B 2REMA 2V32A 3MIXA 2LQQA 1KBNA 2B1LA 1F3AA 1ERVA 2L6DA 4K0GA 1O6JA 3KXOA 5F05A 4NWYA 2YANA 4PUFC 2VD0A 3APQA 2C8UA 3CYNA 1SJ6A 4DSSA 1TRWA 5HFGA 3A3TA 1XW5A 2E0QA 1K3OA 5COHA 1X9WB 4KGIA 2CA8A 1X9MB 2LTKA 3W8JA 4PGTA 1SKRB 3A2WA 5F06A 2UZ8A 3MNGA 2PU9C 1PL1A 2EIQA 5ECNB 2GSTA 3EWLA 3P7XA 5HQPA 1EOHA 4XRDA 4J57E 1GULA 4L5LA 5BMUA 2WDUA 4NAXA 3A5WA 4L5OA 4V2MA 4KF9A 4FYBA 3QD9A 4LMWA 3M1GA 5JWOB 1FVKA 2O7KA 4TR3A 2R2JA 3FZ5A 2LEGA 1QXHA 3O6TA 3TOUA 4Q5NA 2JSYA 3IPZA 3KZQA 5F8BA 4GSNA 5B7CA 3ME7A 5IMAA 1HD2A 2ZUPA 1YQ1A 3CSHA 1ZL9A 1K0OA 1W89A 4PQ1A 2GQLA 2KUCA 3EE2A 4OMVA 4G0KA 5IMCA 4K9ZA 4ML6A 1LU4A 2H76A 4I8BA 3UMAA 3LW9A 3WT2A 1WPIA 4PNFA 5EPFA 1A23A 1EV4A 3C1SA 4TKYA 2HSMA 5D9TA 4K1FA 1E2YA 3GN3A 3KP9A 3QFBC 3ISOA 2ES7A 5A4VA 3H79A 2YJ7A 3W6GA 4ECJA 2HXKA 3WGDA 4PNGA 3H1NA 4X43A 2GT5A 4HDEA 5G5FA 3L0HA 6GSSA 4MPFA 5IMVA 1XOAA 2JZTA 1B4QA 4ZBDA 2BJXA 2C0DA 2AB6A 4AJ7A 1ON4A 4F03A 1AQVA 1NM3A 4V1Ag 2GVPA 4MJEA 2M72A 5GSTA 2XC2A 1WMJA 1JZDA 2YN1A 4TVEA 2XBQA 5KN2A 2QA1A 2P0GA 5FHIA 4WR5A 4IN0A 4MJBA 3TRXA 1XFLA 2GT6A 2X64A 2C0GA 3IXRA 5D73A 5IMZA 3WGXA 5ECPB 4I5QA 4MMMA 3KIJA 3G9BA 4TR4A 1YKCA 1XVQA 1BAYA 4ZL8A 1YKAA 1S3DA 3FEUA 1B8XA 4IS0A 3GIXA 3MWHA 1SD9A 4OWYA 3HZ4A 3LYKA 1NW2A 1PN0A 3VI5A 1A24A 2O85A 1EEMA 4BVYB 1XWCA 2NPBA 4ZILA 3RHCA 1R7HA 2IWTA 5IMDA 4GSSA 3ERFA 4FH8A 3HY2A 4F2IA 4K0NA 1SK2A 3FR6A 1ZYPA 2GSRA 4HEA2 2L4CA 4FQUA 1TK0B 1GTIA 1K0DA 2IL3A 1YF1A 1K3YA 1YEXA 1T3BA 3E0UA 4Q5QA 3I69A 1OKTA 3WD6A 3QFAC 5IIZA 2IIYA 1MD3A 5DJLA 4TW5A 3FHKA 5DALB 5GZZB 3TKSE 3D5JA 3P90A 5LD0A 4K8MA 2HRKA 3DRNA 4KSMA 3BBYA 3FZAA 5ID2B 1JLVA 3H8QA 4A5PA 2C3TA 1PGTA 1AAZA 1FG4A 1GSSA 3EYTA 1B9YC 4BVXB 1ZZYA 1PA3A 1V57A 3TRQA 2PGTA 1KTEA 1MEKA 1ZYQB 5HFIA 1SKWB 2VOCA 4KDXA 4O5UA 1GRXA 1TJDA 5J3RA 2H0GA 1UVZA 4CDOA 4ECBA 1EEJA 5G1KA 4MABA 5IPGA 1AC1A 4OD7A 2KP1A 4WBJA 5D9WA 1A0FA 1Y6EA 3ZMKA 3IRAA 1KNGA 1ZMAA 3KJYA 10GSA 5F0GA 2HSHA 4AGSA 1OKDA 2N5AA 3H93A 1QMVA 2HRAA 4KA0A 5HR0A 5H5RA 4Z7XA 3F4RA 1SKSB 2DJ3A 2NTOA 2P5QA 1O8XA 4OFNA 2FWEA 2BMXA 2EC4A 1FO5A 4IJ3A 2MMAA 1TI1A 4KDUA 2JACA 3DVWA 1GUMA 2H71A 2VCVA 3ERWA 4PURA 3RAZA 1PL2A 4AF2A 3QCPA 4CY8A 8GSSA 4ISDA 3ZIJA 4N30A 3VWUA 2DJJA 2MBSA 4JR6A 3QR6A 3LORA 1FAAA 2O87A 2YZUA 5CNWA 1QGVA 3ZVJA 2VL2A 3F0IA 1ZYNA 5J9CA 4HOJA 4WF4A 1UC7A 3IAM2 2FCHA 1BYEA 5DDLA 3DKSA 2AJQB 3IA1A 3NZNA 5C04A 4EDYA 5LCZA 1YDKA 2XPDA 4ID0A 2CX3A 3BD2A 4KCAA 3LEFA 3Q19A 3FRCA 1N2AA 2OA7A 1XW9A 3J7Yb 5ECIB 4D73B 4BL7B 1MTCA 1ML6A 1XWGA 4EKZA 1A8YA 1QQ2A 2ON7A 3R2QA 4K5SA 1M0UA 1O8WA 4OO5A 3F3RA 3KEBA 2OE0A 2JSZA 3DMLA 4X0XA 3TUEA 5ABRA 1ILOA 4XIHA 3ZITA 2FD3A 2YWIA 4IKHA 2A2RA 2FA4A 4ICYA 2LRCA 4BA7A 2CT6A 4PUAA 1THXA 2QKEA 2CAIA 1TK5B 2YZHA 4YKGA 3VPQA 4MZWA 4XS4B 4EUYA 4POMA 2YP6A 3UBLA 5JWQB 5IOWA 1SK1A 5CRGA 1YF0A 3ED3A 1PFOA 4E8HA 2FWGA 3KH9A 1R5PA 2ON5A 2MYGA 1FHEA 3BJ5A 1SYXA 4GXZA 2HZEB 2H8LA 2F8FA 3GX8A 3IBHA 2WGRA 2J9HA 3EINA 3NOFA 4Z2UA 4WR4A 1XBSA 2DIZA 1K0AA 2FWFA 4IW9A 2OKAA 2XHFA 5AIXA 2R5GA 1A2JA 2VM2A 1GSFA 3TCOA 2IN3A 3CMIA 5ELGA 2CX4A 5ECOB 3SWLA 5DAKA 4XS1A 3LXZA 5J4UA 3KTLA 4I2UA 5D93A 4EIQA 3VWVA 3D4TA 4FO5A 3G7IA 2AUVA 4N0ZA 1URMA 3FYGA 4KB3A 2LKUA 4LA1A 13GSA 4POLA 2L6CA 1UN2A 4KH7A 1HNAA 17GSA 2JADA 3CRTA 2OE1A 4OCFA 3F63A 1QUWA 4RQXA 2F51A 5JCUA 3UL3A 1F37A 4DSSB 1SYRA 3LGCA 4WXTA 3FZ4A 2B1KA 2PMTA 3CSIA 1YEPA 3F6DA 1Z7RA 4FIWA 3G7YA 3UBKA 4K2XA 5ECSA 2RM6A 5C00A 3VI7A 4ECIA 1PX7A 4K5RA 1C72A 2P31A 3GSSA 1M3IA 1BJXA 1FOVA 2R0CA 2X8CA 2GS3A 3CRUA 2VL9A 1XIYA 5ECMB 2O8VB 1GTUA 1GTAA 1GP1A 4L0UA 4MH3A 5CP1A 5E59A 1K0CA 5KN3A 1BX9A 5H5SA 2IMKA 3TKSC 3E3EA 2H19A 3N5OA 2PWJA 2M80A 5DBQA 3MSZA 2HLSA 3ZFLA 3M3MA 5CRDA 2OBKA 3ZLPA 16GSA 1ZOFA 3E9JB 1EP8A 1G7EA 1OYJA 4DVCA 3IHGA 3HJPA 1AIUA 4L8EA 5D8IA 3A2XA 14GSA 2H70A 1WRYA 1M99A 3RHBA 4HUAA 4EO3A 1Z5YE 1VF3A 1I9DA 3CXGA 3EC3A 2NDOA 4NXIA 1B4PA 1SJZA 4EL1A 1SU9A 3TJGA 3GH6A 1TRSA 3L4NA 4MF5A 2X8HA 3U6VA 3LWAA 3F6FA 2TRXA 2YV9A 1CQGA 1XWBA 2GZZA 3LQ7A 3ZL5A 3PPUA 2DJ1A 4F82A 4OCEA 2GZYA 2B6MA 3KD0A 4WF5A 3HCZA 2KOKA 3IR4A 3UEMA 2RIIA 2C3QA 3IAS2 2OADA 1V9WA 2I1UA 3CBUA 4GF0A 2V1MA 4PX1A 1JZOA 1JLWA 3EU3A 6GSXA 4IBPA 1PN9A 2H0HA 5ECLB 1XG8A 4POBA 2GSQA 1GLQA 3O3TA 5IOXA 2OJLA 1JZWA 1AXDA 3M9JA 2MMZA 5IO0A 3WT1A 2H6XA 4HS1A 1U87A 4O5RA 4ECCA 1GL8A 4POKA 3LJRA 5CRWA 5DVBA 3TJJA 2CQ9A 2DJ2A 4GQFA 1SL2B 2RLIA 2G2QA 3A2VA 2PN8A 3VLNA 3IHQA 4BPYA 3EVIA 2C0EA 2D2ZA 4YAPA 4KAEA 2H1AA 6GSVA 4QL7A 2QA2A 3TRPA 4NHZA 1TXXA 2H30A 2K18A 3C71A 3KTBA 3M9KA 2PERA 4JR4A 1JZRA 1Z7PA 3FR9A 4DEJA 1G0TA 3ERGA 4O32A 3IV4A 2HE3A 1R5AA 4H86A 3UVHA 2WZ9A 2OE3A 2X99A 2VCZA 1ST9A 3QAVA 5INYA 11GSA 2R37A 4KUNA 3FK8A 4F0CA 2HNLA 2PVOC 3V1WA 2ZNMA 3D22A 5A4UA 4ZB6A 4EE0A 1PSQA 3HVNA 1SL1B 2PVQA 12GSA 2JU5A 3FMWA 1ERUA 3EMPA 4WKWA 1G6YA 5KN0A 2VCWA 3A5IA 3GHAA 1O73A 1T7PB 5DJMA 4BIKA 4HZ2A 4ZBAA 4G19A 3HJMA 1TU8A 3W8SA 2H6ZA 2VLVA 4Z2RA 1CQHA 4ZL7A 1XZOA 4IP6A 3P2AA 1V98A 4XTSA 4OFMA 2EIRA 3QAGA 1M2DA 4N0VA 1FVJA 4MJCA 4KX4A 1F3BA 3F4TA 3RPNA 1FB0A 2I4AA 2A4VA 3GTUA 4LL4B 4GRFA 2V41A 3FZ9A 5HR2A 5IMFA 4PQHA 5GSSA 3RBTA 5JWRB 2H73A 1PX6A 4LMVA 4NHWA 4Z2TA 1THOA 3Q74A 5G31A 2LV3A 2VO4A 3DIEA 2YV7A 1Z6MA 2V6KA 2LRTA 2LSTA 2L5OA 4KCEA 4GLTA 3L9SA 4WETA 4CY6A 3KH7A
chains in the Genus database with same CATH topology
1G6WA 1GUHA 3I9V2 5FWGA 2NVLA 2CVBA 4TXOA 1SK0A 2E7PA 5ECHB 2I3YA 2IMFA 1J0FA 5G5EA 4KSOA 3TOTA 4WEYA 2GLRA 5FT3A 3SBCA 4EIPA 4IVFA 3DEXA 4L0WA 3TKPA 2GGTA 3HJOA 3RPPA 2DKIA 4Q5RA 1WOUA 1GSUA 1K0NA 2YOIA 3TDGA 2F9SA 2VAFA 4V2NA 3GKKA 3D6IA 3BOAA 3Q6OA 1DSBA 4X1UA 4EC0A 2H1DA 2IFQA 2XBIA 1YY7A 5EVOA 4JE1A 4IELA 5D9VA 4HQSA 4N10A 3LG6A 2VIMA 2VLTA 4O5QA 5CYYA 2GZPA 1OE7A 3EMXA 4O7HA 3M0FA 3CSJA 3ZZXA 4YQVA 3HVSA 3PH9A 2L59A 1S3AA 3GMFA 2K9FA 3TKRA 3DD3A 2HYXA 4K2DA 1IYHA 5J41A 5G1LA 3IE3A 4K6XA 3WGEA 2B5YA 3DVXA 1O7UA 3K8NA 1WE0A 2VD1A 1ACVA 4G2EA 1U3IA 3IC8A 2LRNA 4TR1A 1V58A 1MD4A 4TXVA 2H74A 2VLUA 2FHEA 3GKXA 3KMNA 1OE8A 3GYKA 1JFUA 1YZXA 1XW6A 2LQOA 1YJ6A 2B7KA 1GUKA 4FYUA 1WIKA 4G0IA 2OBIA 4LL1B 3HDCA 1TU7A 2HT9A 3UAPA 3ZIVA 4JEDA 4MZCA 1TDIA 1B9XC 1AQWA 5KOWA 3MYDA 2R3XA 2C0FA 1J9BA 5CAXA 2VCQA 3UOMA 1ABAA 2CVKA 2HRFA 6GSUA 1K3LA 3ZREA 3GA4A 3HKRA 3QAWA 2Z9SA 5D96A 1R26A 2V2GA 4CHSA 4HZ4A 3L9VA 2H0IA 1R4WA 2X49A 2RUFA 1USBA 2PPTA 4OO4A 1U3AA 4X4JA 3H4KA 20GSA 4RQRA 19GSA 2OACA 4PTSA 1DBYA 1QK8A 2WB9A 4N11A 1Z6NA 5ECQB 3KP8A 1ERWA 5HR1A 2X4AA 2VCTA 5IO2A 2LJAA 1F2EA 5AGYA 1NHYA 1ZYEA 1S3CA 4IQ1A 1WJKA 2FNOA 4I97A 5DAKB 2M46A 4ILFA 3N9JA 3C1RA 4DSRA 1XPVA 6GSYA 1OAZA 1FOHA 2C1YA 2CAQA 5G30A 3ZTLA 5ECKB 4MCUA 4QL9A 3Q18A 1H75A 3UIWA 3PINA 4YQMA 4BWQA 3CTFA 3GRXA 2LJKA 5IM9A 1OC9A 4EDZA 1SENA 1XWKA 2AV4A 2E2GA 5AN1A 1V2AA 1F6MC 3IK9A 1DUGA 2LNTA 4JZQA 1OVNA 4ZXGA 1V40A 1X0RA 4LLRA 3GX0A 5B6MA 3CTGA 4MF6A 1LJRA 2H1BA 4ZB9A 3KM6A 4MZBA 1TKDB 1TOFA 2DKHA 4NPBA 4EVMA 5A5KA 1GSDA 3I43A 3G7JA 2VL2C 2C3NA 2HI7A 3HZ8A 2I81A 4ML1A 5DCGA 2L4QA 2F8AA 2I9HA 1BEDA 1UA5A 1MDJA 1EP7A 1AW9A 2KHPA 1GSEA 5GAPD 2NBSA 4NV5A 1LBKA 4EF0A 1PKZA 3HHVA 1A0RP 2P5RA 2DIYA 5H5QA 3DXBA 2A2SA 1HNBA 1TI3A 1FB6A 1SJIA 3ME8A 1SL0B 4JU5A 3IC4A 4J2FA 3MAKA 3EURA 3LFLA 4HJ2A 3HA9A 2IMDA 3ZVJD 1WWJA 1AUCA 4CW9A 2AYTA 3ZFBA 4I6XA 18GSA 2PUKC 2KP2A 2J23A 5D9XA 4PQIA 3VK9A 4ACSA 4HI7A 1HNCA 4YH2A 4OFTA 2PBJA 1KEBA 1B48A 2JL4A 2DLXA 4EXJA 2GQKA 3F3QA 2RM5A 4GWRA 4XRAA 1NHOA 4G9HA 4MK3A 3F8UA 3GKNA 3O76A 1TRUA 3ZYWA 2C80A 3GL3A 5CRHA 2JZRA 4KDYA 4YKFA 2YNXA 1QFNA 2GQMA 1GNEA 3HD5A 4WBRD 1TRVA 2YWNA 4J56E 4RI6A 5ECRB 4YQUA 2JZSA 1VRSD 3L78A 1EV9A 1HYUA 1RW1A 5L71A 3EPTA 3D21A 7GSSA 1Z9HA 4PXOA 3PGTA 2QSIA 3L9UA 5B6NA 5IQYA 1I5GA 3J7Yk 3APOA 3GH9A 3VURA 3OR5A 3GL5A 3VWWA 1RK4A 1Q98A 3WYWA 2LUSA 3F9UA 2VCXA 1VGLA 2DJKA 4GTUA 5HFKA 2K8VA 1BG5A 1BQ7A 6GSTA 3BCIA 2GSSA 1XXUA 3IDVA 5F07A 4V1Ap 3KGKA 4K7NA 2MMOA 1OC3A 2H66A 4BVYA 2HSYA 3RDWA 1T4YA 2YWOA 2CVDA 3FR3A 2N5FA 1DE2A 3GUSA 2LJRA 3APSA 3GV1A 5ENUA 2VM1A 1NSWA 1MDIA 4F9ZA 1XOBA 1GH2A 3KCMA 4JRRA 5LNKe 3VPTA 1Z3EA 4HU9A 2CV4A 1N8JA 2H1GA 2K8SA 2H72A 4HU7A 1K0BA 2B5XA 2DC5A 3PR8A 5J5NA 4TOPA 2H01A 1ERTA 2ALBA 2B3SA 4MA9A 1TP9A 1Y25A 5DALA 1F9MA 4I2TA 3MDKA 3GTUB 1TK8B 3TGZA 1GTBA 1M2AA 1JHBA 2FGXA 5EL8A 1Q4JA 4XCSA 3UJ1A 4MDCA 4K7OA 2R4VA 5AISA 5KOXA 1A2LA 5ID2A 2DBCA 1WP0A 2WS2A 3C73A 2AHEA 2WULA 4DSQA 2FY6A 1T1VA 5CREA 4GSTA 5DCHA 2DSAA 1MDKA 4Q5FA 4BVXA 3I6AA 1T00A 4XHMA 4IQAA 4MH2A 2WCIA 3QMXA 5DQSA 1J08A 1GWCA 2A4HA 5HR3A 1X5CA 4TXOB 3ZMLA 1X5DA 5B8BA 4AJ6A 1U6TA 4MPGA 2GTUA 1HQOA 3JCML 1T4ZA 2CZ3A 5AIVA 5J9BA 3HXSA 3IOSA 5DQYA 2YJHA 1VF4A 4G0LA 5G2ZA 2H6YA 2N5BA 3U5RE 4MJAA 1XVWA 3FW2A 1SD8A 4TR0A 2IMEA 5E4WA 3DYRA 1RQMA 2MZCA 2LNSA 4IHUA 1TW9A 3LYPA 1GSYA 3IK7A 1W4VA 4IJIA 3NIVA 2VUPA 2CZ2A 4ULXA 4HQZA 4ZL9A 1PKWA 2HZFA 3HYPA 4F0BA 2AAWA 3QPMA 2IFQB 5GAND 1E6BA 4MLYA 6GSWA 9GSSA 1ZCPA 4AJ8A 3GURA 5KEJA 5IPHA 22GSA 4TN8A 2DMMA 3C7MA 4MNNA 4NV2A 2QGVA 2WJUA 5B8AA 4IP1A 2FUG2 2WRTA 3LSZA 2HRNA 2MMNA 3TJKA 1PMTA 3GNJA 4USSA 1O81A 3DWVA 3HVXA 3VFIA 4ZB8A 1GSQA 3GSTA 1M2BA 3HVVA 1VF1A 3TKSA 3M8NA 4MP4A 4YAVA 1A2MA 4P3YB 4TR1B 2O89A 4K7IA 2R0PA 1AQXA 2HFDA 4KE3A 5EY6A 1EGRA 2X8GA 2B7JA 1XWAA 3TJFA 5ELAA 1PRXA 1EWXA 1A8LA 2R6KA 1H4OA 3TB2A 2B5EA 2LS5A 5JCWA 4E8EA 1DE1A 1ZGNA 3UVTA 3FY7A 2IMIA 3QOUA 1M7TA 3US3A 4D73A 2R0GA 1X9SB 4BL7A 2A2PA 2FLSA 4GQCA 3R3EA 1G7OA 2K6VA 3C8EA 1EZKA 4RI7A 2G0FA 2F3MA 2GDRA 2H75A 1TTZA 3TJBA 1IYIA 3QDNA 1M9AA 3BCKA 1M9BA 1FW1A 3F4SA 2DJ0A 4O92A 1EGOA 4IGJA 1GLPA 2EIOA 5BRTA 4GCIA 2DMLA 2ZCTA 3FKFA 3KMOA 4RUVA 4TRXA 4G10A 3ZRDA 5JCGA 1PQNA 2FA8A 5KN1A 4FYCA 2IJYA 4XS6A 4ZBBA 2L5LA 4XS4A 4KW6A 2XPEA 5CO3A 3TKQA 3EU4A 4HJMA 4KNDA 3GKMA 3P8WA 4NMUA 3LXTA 2KLXA 1PD21 1GNWA 2VL3A 1X5EA 1U88A 1XCCA 2C4JA 2HZEA 4V2LA 4QQ7A 2BTOT 2L57A 2YWMA 2V6OA 4MF7A 2YCDA 3VWXA 2RUEA 1O85A 1K0MA 1EOGA 3S9FA 1VF2A 3GFKA 3DGQA 3D4MA 3AY8A 2MBTA 3UARA 2TIRA 1OC8A 2IPAA 2WFCA 4JBBA 2QC7A 2E2MA 4ZIJA 2TRCP 4BWSA 3D0ZA 5A4WA 2FWHA 1T8EB 2YPMA 1OC9B 2REMA 2V32A 3MIXA 2LQQA 1KBNA 2B1LA 1F3AA 1ERVA 2L6DA 4K0GA 1O6JA 3KXOA 5F05A 4NWYA 2YANA 4PUFC 2VD0A 3APQA 2C8UA 3CYNA 1SJ6A 4DSSA 1TRWA 5HFGA 3A3TA 1XW5A 2E0QA 1K3OA 5COHA 1X9WB 4KGIA 2CA8A 1X9MB 2LTKA 3W8JA 4PGTA 1SKRB 3A2WA 5F06A 2UZ8A 3MNGA 2PU9C 1PL1A 2EIQA 5ECNB 2GSTA 3EWLA 3P7XA 5HQPA 1EOHA 4XRDA 4J57E 1GULA 4L5LA 5BMUA 2WDUA 4NAXA 3A5WA 4L5OA 4V2MA 4KF9A 4FYBA 3QD9A 4LMWA 3M1GA 5JWOB 1FVKA 2O7KA 4TR3A 2R2JA 3FZ5A 2LEGA 1QXHA 3O6TA 3TOUA 4Q5NA 2JSYA 3IPZA 3KZQA 5F8BA 4GSNA 5B7CA 3ME7A 5IMAA 1HD2A 2ZUPA 1YQ1A 3CSHA 1ZL9A 1K0OA 1W89A 4PQ1A 2GQLA 2KUCA 3EE2A 4OMVA 4G0KA 5IMCA 4K9ZA 4ML6A 1LU4A 2H76A 4I8BA 3UMAA 3LW9A 3WT2A 1WPIA 4PNFA 5EPFA 1A23A 1EV4A 3C1SA 4TKYA 2HSMA 5D9TA 4K1FA 1E2YA 3GN3A 3KP9A 3QFBC 3ISOA 2ES7A 5A4VA 3H79A 2YJ7A 3W6GA 4ECJA 2HXKA 3WGDA 4PNGA 3H1NA 4X43A 2GT5A 4HDEA 5G5FA 3L0HA 6GSSA 4MPFA 5IMVA 1XOAA 2JZTA 1B4QA 4ZBDA 2BJXA 2C0DA 2AB6A 4AJ7A 1ON4A 4F03A 1AQVA 1NM3A 4V1Ag 2GVPA 4MJEA 2M72A 5GSTA 2XC2A 1WMJA 1JZDA 2YN1A 4TVEA 2XBQA 5KN2A 2QA1A 2P0GA 5FHIA 4WR5A 4IN0A 4MJBA 3TRXA 1XFLA 2GT6A 2X64A 2C0GA 3IXRA 5D73A 5IMZA 3WGXA 5ECPB 4I5QA 4MMMA 3KIJA 3G9BA 4TR4A 1YKCA 1XVQA 1BAYA 4ZL8A 1YKAA 1S3DA 3FEUA 1B8XA 4IS0A 3GIXA 3MWHA 1SD9A 4OWYA 3HZ4A 3LYKA 1NW2A 1PN0A 3VI5A 1A24A 2O85A 1EEMA 4BVYB 1XWCA 2NPBA 4ZILA 3RHCA 1R7HA 2IWTA 5IMDA 4GSSA 3ERFA 4FH8A 3HY2A 4F2IA 4K0NA 1SK2A 3FR6A 1ZYPA 2GSRA 4HEA2 2L4CA 4FQUA 1TK0B 1GTIA 1K0DA 2IL3A 1YF1A 1K3YA 1YEXA 1T3BA 3E0UA 4Q5QA 3I69A 1OKTA 3WD6A 3QFAC 5IIZA 2IIYA 1MD3A 5DJLA 4TW5A 3FHKA 5DALB 5GZZB 3TKSE 3D5JA 3P90A 5LD0A 4K8MA 2HRKA 3DRNA 4KSMA 3BBYA 3FZAA 5ID2B 1JLVA 3H8QA 4A5PA 2C3TA 1PGTA 1AAZA 1FG4A 1GSSA 3EYTA 1B9YC 4BVXB 1ZZYA 1PA3A 1V57A 3TRQA 2PGTA 1KTEA 1MEKA 1ZYQB 5HFIA 1SKWB 2VOCA 4KDXA 4O5UA 1GRXA 1TJDA 5J3RA 2H0GA 1UVZA 4CDOA 4ECBA 1EEJA 5G1KA 4MABA 5IPGA 1AC1A 4OD7A 2KP1A 4WBJA 5D9WA 1A0FA 1Y6EA 3ZMKA 3IRAA 1KNGA 1ZMAA 3KJYA 10GSA 5F0GA 2HSHA 4AGSA 1OKDA 2N5AA 3H93A 1QMVA 2HRAA 4KA0A 5HR0A 5H5RA 4Z7XA 3F4RA 1SKSB 2DJ3A 2NTOA 2P5QA 1O8XA 4OFNA 2FWEA 2BMXA 2EC4A 1FO5A 4IJ3A 2MMAA 1TI1A 4KDUA 2JACA 3DVWA 1GUMA 2H71A 2VCVA 3ERWA 4PURA 3RAZA 1PL2A 4AF2A 3QCPA 4CY8A 8GSSA 4ISDA 3ZIJA 4N30A 3VWUA 2DJJA 2MBSA 4JR6A 3QR6A 3LORA 1FAAA 2O87A 2YZUA 5CNWA 1QGVA 3ZVJA 2VL2A 3F0IA 1ZYNA 5J9CA 4HOJA 4WF4A 1UC7A 3IAM2 2FCHA 1BYEA 5DDLA 3DKSA 2AJQB 3IA1A 3NZNA 5C04A 4EDYA 5LCZA 1YDKA 2XPDA 4ID0A 2CX3A 3BD2A 4KCAA 3LEFA 3Q19A 3FRCA 1N2AA 2OA7A 1XW9A 3J7Yb 5ECIB 4D73B 4BL7B 1MTCA 1ML6A 1XWGA 4EKZA 1A8YA 1QQ2A 2ON7A 3R2QA 4K5SA 1M0UA 1O8WA 4OO5A 3F3RA 3KEBA 2OE0A 2JSZA 3DMLA 4X0XA 3TUEA 5ABRA 1ILOA 4XIHA 3ZITA 2FD3A 2YWIA 4IKHA 2A2RA 2FA4A 4ICYA 2LRCA 4BA7A 2CT6A 4PUAA 1THXA 2QKEA 2CAIA 1TK5B 2YZHA 4YKGA 3VPQA 4MZWA 4XS4B 4EUYA 4POMA 2YP6A 3UBLA 5JWQB 5IOWA 1SK1A 5CRGA 1YF0A 3ED3A 4E8HA 2FWGA 3KH9A 1R5PA 2ON5A 2MYGA 1FHEA 3BJ5A 1SYXA 4GXZA 2HZEB 2H8LA 2F8FA 3GX8A 3IBHA 2WGRA 2J9HA 3EINA 3NOFA 4Z2UA 4WR4A 1XBSA 2DIZA 1K0AA 2FWFA 4IW9A 2OKAA 2XHFA 5AIXA 2R5GA 1A2JA 2VM2A 1GSFA 3TCOA 2IN3A 3CMIA 5ELGA 2CX4A 5ECOB 3SWLA 5DAKA 4XS1A 3LXZA 5J4UA 3KTLA 4I2UA 5D93A 4EIQA 3VWVA 3D4TA 4FO5A 3G7IA 2AUVA 4N0ZA 1URMA 3FYGA 4KB3A 2LKUA 4LA1A 13GSA 4POLA 2L6CA 1UN2A 4KH7A 1HNAA 17GSA 2JADA 3CRTA 2OE1A 4OCFA 3F63A 1QUWA 4RQXA 2F51A 5JCUA 3UL3A 1F37A 4DSSB 1SYRA 3LGCA 4WXTA 3FZ4A 2B1KA 2PMTA 3CSIA 1YEPA 3F6DA 1Z7RA 4FIWA 3G7YA 3UBKA 4K2XA 5ECSA 2RM6A 5C00A 3VI7A 4ECIA 1PX7A 4K5RA 1C72A 2P31A 3GSSA 1BJXA 1FOVA 2R0CA 2X8CA 2GS3A 3CRUA 2VL9A 1XIYA 5ECMB 2O8VB 1GTUA 1GTAA 1GP1A 4L0UA 4MH3A 5CP1A 5E59A 1K0CA 5KN3A 1BX9A 5H5SA 2IMKA 3TKSC 3E3EA 2H19A 3N5OA 2PWJA 2M80A 5DBQA 3MSZA 2HLSA 3ZFLA 3M3MA 5CRDA 2OBKA 3ZLPA 16GSA 1ZOFA 3E9JB 1EP8A 1G7EA 1OYJA 4DVCA 3IHGA 3HJPA 1AIUA 4L8EA 5D8IA 3A2XA 14GSA 2H70A 1WRYA 1M99A 3RHBA 4HUAA 4EO3A 1Z5YE 1VF3A 1I9DA 3CXGA 3EC3A 2NDOA 4NXIA 1B4PA 1SJZA 4EL1A 1SU9A 3TJGA 3GH6A 1TRSA 3L4NA 4MF5A 2X8HA 3U6VA 3LWAA 3F6FA 2TRXA 2YV9A 1CQGA 1XWBA 2GZZA 3LQ7A 3ZL5A 3PPUA 2DJ1A 4F82A 4OCEA 2GZYA 2B6MA 3KD0A 4WF5A 3HCZA 2KOKA 3IR4A 3UEMA 2RIIA 2C3QA 3IAS2 2OADA 1V9WA 2I1UA 3CBUA 4GF0A 2V1MA 4PX1A 1JZOA 1JLWA 3EU3A 6GSXA 4IBPA 1PN9A 2H0HA 5ECLB 4POBA 2GSQA 1GLQA 3O3TA 5IOXA 2OJLA 1JZWA 1AXDA 3M9JA 2MMZA 5IO0A 3WT1A 2H6XA 4HS1A 1U87A 4O5RA 4ECCA 1GL8A 4POKA 3LJRA 5CRWA 5DVBA 3TJJA 2CQ9A 2DJ2A 4GQFA 1SL2B 2RLIA 2G2QA 3A2VA 2PN8A 3VLNA 3IHQA 4BPYA 3EVIA 2C0EA 2D2ZA 4YAPA 4KAEA 2H1AA 6GSVA 4QL7A 2QA2A 3TRPA 4NHZA 1TXXA 2H30A 2K18A 3C71A 3KTBA 3M9KA 2PERA 4JR4A 1JZRA 1Z7PA 3FR9A 4DEJA 1G0TA 3ERGA 4O32A 3IV4A 2HE3A 1R5AA 4H86A 3UVHA 2WZ9A 2OE3A 2X99A 2VCZA 1ST9A 3QAVA 5INYA 11GSA 2R37A 4KUNA 3FK8A 4F0CA 2HNLA 2PVOC 3V1WA 2ZNMA 3D22A 5A4UA 4ZB6A 4EE0A 1PSQA 1SL1B 2PVQA 12GSA 2JU5A 3FMWA 1ERUA 3EMPA 4WKWA 1G6YA 5KN0A 2VCWA 3A5IA 3GHAA 1O73A 1T7PB 5DJMA 4HZ2A 4ZBAA 4G19A 3HJMA 1TU8A 3W8SA 2H6ZA 2VLVA 4Z2RA 1CQHA 4ZL7A 1XZOA 4IP6A 3P2AA 1V98A 4XTSA 4OFMA 2EIRA 3QAGA 1M2DA 4N0VA 1FVJA 4MJCA 4KX4A 1F3BA 3F4TA 3RPNA 1FB0A 2I4AA 2A4VA 3GTUA 4LL4B 4GRFA 2V41A 3FZ9A 5HR2A 5IMFA 4PQHA 5GSSA 3RBTA 5JWRB 2H73A 1PX6A 4LMVA 4NHWA 4Z2TA 1THOA 3Q74A 5G31A 2LV3A 2VO4A 3DIEA 2YV7A 1Z6MA 2V6KA 2LRTA 2LSTA 2L5OA 4KCEA 4GLTA 3L9SA 4WETA 4CY6A 3KH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6W A;  1GUH A;  3I9V 2;  5FWG A;  2NVL A;  2CVB A;  4TXO A;  1SK0 A;  2E7P A;  5ECH B;  2I3Y A;  2IMF A;  1J0F A;  5G5E A;  4KSO A;  3TOT A;  4WEY A;  2GLR A;  5FT3 A;  3SBC A;  4IVF A;  3DEX A;  4L0W A;  3TKP A;  2GGT A;  3HJO A;  3RPP A;  4Q5R A;  1WOU A;  1GSU A;  1K0N A;  2YOI A;  3TDG A;  2F9S A;  2VAF A;  4V2N A;  3GKK A;  3D6I A;  3BOA A;  3Q6O A;  1DSB A;  4X1U A;  4EC0 A;  2H1D A;  2IFQ A;  2XBI A;  1YY7 A;  5EVO A;  4JE1 A;  4IEL A;  5D9V A;  4HQS A;  4N10 A;  3LG6 A;  2VIM A;  2VLT A;  5CYY A;  2GZP A;  1OE7 A;  3EMX A;  4O7H A;  3M0F A;  3CSJ A;  3ZZX A;  4YQV A;  3HVS A;  3PH9 A;  2L59 A;  1S3A A;  3GMF A;  2K9F A;  3TKR A;  3DD3 A;  2HYX A;  4K2D A;  1IYH A;  5J41 A;  5G1L A;  3IE3 A;  4K6X A;  3WGE A;  2B5Y A;  3DVX A;  1O7U A;  3K8N A;  1WE0 A;  2VD1 A;  1ACV A;  4G2E A;  1U3I A;  2LRN A;  4TR1 A;  1V58 A;  1MD4 A;  4TXV A;  2H74 A;  2VLU A;  2FHE A;  3GKX A;  3KMN A;  1OE8 A;  3GYK A;  1JFU A;  1YZX A;  1XW6 A;  2LQO A;  1YJ6 A;  2B7K A;  1GUK A;  4FYU A;  1WIK A;  2OBI A;  4LL1 B;  3HDC A;  1TU7 A;  2HT9 A;  3UAP A;  3ZIV A;  4JED A;  4MZC A;  1TDI A;  1B9X C;  1AQW A;  2R3X A;  2C0F A;  1J9B A;  5CAX A;  2VCQ A;  3UOM A;  1ABA A;  2CVK A;  2HRF A;  6GSU A;  1K3L A;  3ZRE A;  3GA4 A;  3HKR A;  3QAW A;  2Z9S A;  5D96 A;  1R26 A;  2V2G A;  4CHS A;  4HZ4 A;  3L9V A;  2H0I A;  1R4W A;  2RUF A;  1USB A;  2PPT A;  4OO4 A;  1U3A A;  3H4K A;  20GS A;  4RQR A;  19GS A;  2OAC A;  1DBY A;  1QK8 A;  2WB9 A;  4N11 A;  1Z6N A;  5ECQ B;  3KP8 A;  1ERW A;  5HR1 A;  2VCT A;  5IO2 A;  2LJA A;  1F2E A;  5AGY A;  1NHY A;  1ZYE A;  1S3C A;  4IQ1 A;  1WJK A;  2FNO A;  4I97 A;  5DAK B;  2M46 A;  4ILF A;  3N9J A;  3C1R A;  4DSR A;  1XPV A;  6GSY A;  1OAZ A;  2C1Y A;  2CAQ A;  5G30 A;  3ZTL A;  5ECK B;  4MCU A;  4QL9 A;  3Q18 A;  1H75 A;  3UIW A;  3PIN A;  4YQM A;  4BWQ A;  3CTF A;  3GRX A;  2LJK A;  5IM9 A;  1OC9 A;  4EDZ A;  1SEN A;  1XWK A;  2AV4 A;  2E2G A;  5AN1 A;  1V2A A;  1F6M C;  3IK9 A;  1DUG A;  2LNT A;  4JZQ A;  1OVN A;  4ZXG A;  1V40 A;  1X0R A;  4LLR A;  3GX0 A;  5B6M A;  3CTG A;  4MF6 A;  1LJR A;  2H1B A;  4ZB9 A;  3KM6 A;  4MZB A;  1TKD B;  1TOF A;  4NPB A;  4EVM A;  5A5K A;  1GSD A;  3I43 A;  3G7J A;  2VL2 C;  2C3N A;  2HI7 A;  3HZ8 A;  2I81 A;  4ML1 A;  5DCG A;  2L4Q A;  2F8A A;  2I9H A;  1BED A;  1UA5 A;  1MDJ A;  1EP7 A;  1AW9 A;  2KHP A;  1GSE A;  5GAP D;  2NBS A;  4NV5 A;  1LBK A;  4EF0 A;  1PKZ A;  3HHV A;  1A0R P;  2P5R A;  2DIY A;  5H5Q A;  3DXB A;  2A2S A;  1HNB A;  1TI3 A;  1FB6 A;  1SJI A;  3ME8 A;  1SL0 B;  4JU5 A;  3IC4 A;  4J2F A;  3MAK A;  3EUR A;  3LFL A;  4HJ2 A;  3HA9 A;  2IMD A;  3ZVJ D;  1WWJ A;  1AUC A;  4CW9 A;  2AYT A;  3ZFB A;  4I6X A;  18GS A;  2PUK C;  2KP2 A;  2J23 A;  5D9X A;  4PQI A;  3VK9 A;  4ACS A;  4HI7 A;  1HNC A;  4YH2 A;  4OFT A;  2PBJ A;  1KEB A;  1B48 A;  2JL4 A;  2DLX A;  4EXJ A;  2GQK A;  3F3Q A;  2RM5 A;  4GWR A;  4XRA A;  1NHO A;  4G9H A;  4MK3 A;  3F8U A;  3GKN A;  3O76 A;  1TRU A;  3ZYW A;  2C80 A;  3GL3 A;  5CRH A;  2JZR A;  4KDY A;  2YNX A;  1QFN A;  2GQM A;  1GNE A;  3HD5 A;  4WBR D;  1TRV A;  2YWN A;  4J56 E;  4RI6 A;  5ECR B;  4YQU A;  2JZS A;  1VRS D;  3L78 A;  1EV9 A;  1HYU A;  1RW1 A;  5L71 A;  3D21 A;  7GSS A;  1Z9H A;  4PXO A;  3PGT A;  2QSI A;  3L9U A;  5B6N A;  5IQY A;  1I5G A;  3J7Y k;  3APO A;  3GH9 A;  3VUR A;  3OR5 A;  3GL5 A;  3VWW A;  1RK4 A;  1Q98 A;  3WYW A;  2LUS A;  3F9U A;  2VCX A;  1VGL A;  2DJK A;  4GTU A;  5HFK A;  2K8V A;  1BG5 A;  1BQ7 A;  6GST A;  3BCI A;  2GSS A;  1XXU A;  3IDV A;  5F07 A;  4V1A p;  3KGK A;  4K7N A;  2MMO A;  1OC3 A;  2H66 A;  4BVY A;  2HSY A;  3RDW A;  1T4Y A;  2YWO A;  2CVD A;  3FR3 A;  2N5F A;  1DE2 A;  3GUS A;  2LJR A;  3APS A;  3GV1 A;  5ENU A;  2VM1 A;  1NSW A;  1MDI A;  4F9Z A;  1XOB A;  1GH2 A;  3KCM A;  4JRR A;  5LNK e;  3VPT A;  1Z3E A;  4HU9 A;  2CV4 A;  1N8J A;  2H1G A;  2K8S A;  2H72 A;  4HU7 A;  1K0B A;  2B5X A;  2DC5 A;  3PR8 A;  5J5N A;  4TOP A;  2H01 A;  1ERT A;  2ALB A;  2B3S A;  4MA9 A;  1TP9 A;  1Y25 A;  5DAL A;  1F9M A;  4I2T A;  3MDK A;  3GTU B;  1TK8 B;  3TGZ A;  1GTB A;  1M2A A;  1JHB A;  2FGX A;  5EL8 A;  1Q4J A;  4XCS A;  3UJ1 A;  4MDC A;  4K7O A;  2R4V A;  5AIS A;  1A2L A;  5ID2 A;  2DBC A;  1WP0 A;  2WS2 A;  3C73 A;  2AHE A;  2WUL A;  4DSQ A;  2FY6 A;  1T1V A;  5CRE A;  4GST A;  5DCH A;  2DSA A;  1MDK A;  4Q5F A;  4BVX A;  3I6A A;  1T00 A;  4XHM A;  4IQA A;  4MH2 A;  2WCI A;  3QMX A;  5DQS A;  1J08 A;  1GWC A;  5HR3 A;  1X5C A;  4TXO B;  3ZML A;  1X5D A;  5B8B A;  4AJ6 A;  1U6T A;  4MPG A;  2GTU A;  1HQO A;  3JCM L;  1T4Z A;  2CZ3 A;  5AIV A;  5J9B A;  3HXS A;  3IOS A;  5DQY A;  2YJH A;  1VF4 A;  5G2Z A;  2H6Y A;  2N5B A;  3U5R E;  4MJA A;  1XVW A;  3FW2 A;  1SD8 A;  4TR0 A;  2IME A;  5E4W A;  3DYR A;  1RQM A;  2MZC A;  2LNS A;  4IHU A;  1TW9 A;  3LYP A;  1GSY A;  3IK7 A;  1W4V A;  4IJI A;  3NIV A;  2VUP A;  2CZ2 A;  4ULX A;  4HQZ A;  4ZL9 A;  1PKW A;  2HZF A;  3HYP A;  4F0B A;  2AAW A;  3QPM A;  2IFQ B;  5GAN D;  1E6B A;  4MLY A;  6GSW A;  9GSS A;  1ZCP A;  4AJ8 A;  3GUR A;  5KEJ A;  5IPH A;  22GS A;  4TN8 A;  2DMM A;  3C7M A;  4NV2 A;  2QGV A;  2WJU A;  5B8A A;  4IP1 A;  2FUG 2;  2WRT A;  3LSZ A;  2HRN A;  2MMN A;  3TJK A;  1PMT A;  3GNJ A;  1O81 A;  3DWV A;  3HVX A;  3VFI A;  4ZB8 A;  1GSQ A;  3GST A;  1M2B A;  3HVV A;  1VF1 A;  3TKS A;  3M8N A;  4MP4 A;  4YAV A;  1A2M A;  4P3Y B;  4TR1 B;  2O89 A;  4K7I A;  1AQX A;  2HFD A;  4KE3 A;  5EY6 A;  1EGR A;  2X8G A;  2B7J A;  1XWA A;  3TJF A;  5ELA A;  1PRX A;  1EWX A;  1A8L A;  2R6K A;  1H4O A;  3TB2 A;  2B5E A;  2LS5 A;  5JCW A;  4E8E A;  1DE1 A;  1ZGN A;  3UVT A;  3FY7 A;  2IMI A;  3QOU A;  1M7T A;  3US3 A;  4D73 A;  1X9S B;  4BL7 A;  2FLS A;  4GQC A;  1G7O A;  2K6V A;  3C8E A;  1EZK A;  4RI7 A;  2G0F A;  2F3M A;  2GDR A;  2H75 A;  1TTZ A;  3TJB A;  1IYI A;  3QDN A;  1M9A A;  3BCK A;  1M9B A;  1FW1 A;  3F4S A;  2DJ0 A;  4O92 A;  1EGO A;  4IGJ A;  1GLP A;  2EIO A;  4GCI A;  2DML A;  2ZCT A;  3FKF A;  3KMO A;  4RUV A;  4TRX A;  4G10 A;  3ZRD A;  5JCG A;  1PQN A;  2FA8 A;  5KN1 A;  4FYC A;  2IJY A;  4XS6 A;  4ZBB A;  2L5L A;  4XS4 A;  4KW6 A;  2XPE A;  5CO3 A;  3TKQ A;  3EU4 A;  4HJM A;  4KND A;  3GKM A;  3P8W A;  4NMU A;  3LXT A;  2KLX A;  1PD2 1;  1GNW A;  2VL3 A;  1X5E A;  1U88 A;  1XCC A;  2C4J A;  2HZE A;  4V2L A;  4QQ7 A;  2BTO T;  2L57 A;  2YWM A;  2V6O A;  4MF7 A;  2YCD A;  3VWX A;  2RUE A;  1O85 A;  1K0M A;  1EOG A;  3S9F A;  1VF2 A;  3GFK A;  3DGQ A;  3D4M A;  3AY8 A;  2MBT A;  3UAR A;  2TIR A;  1OC8 A;  2IPA A;  2WFC A;  4JBB A;  2QC7 A;  2E2M A;  4ZIJ A;  2TRC P;  4BWS A;  3D0Z A;  5A4W A;  2FWH A;  1T8E B;  2YPM A;  1OC9 B;  2REM A;  2V32 A;  2LQQ A;  1KBN A;  2B1L A;  1F3A A;  1ERV A;  2L6D A;  4K0G A;  1O6J A;  3KXO A;  5F05 A;  4NWY A;  2YAN A;  4PUF C;  2VD0 A;  3APQ A;  2C8U A;  3CYN A;  1SJ6 A;  4DSS A;  1TRW A;  5HFG A;  3A3T A;  1XW5 A;  2E0Q A;  1K3O A;  5COH A;  1X9W B;  4KGI A;  2CA8 A;  1X9M B;  2LTK A;  3W8J A;  4PGT A;  1SKR B;  3A2W A;  5F06 A;  3MNG A;  2PU9 C;  1PL1 A;  2EIQ A;  5ECN B;  2GST A;  3EWL A;  3P7X A;  5HQP A;  1EOH A;  4XRD A;  4J57 E;  1GUL A;  4L5L A;  2WDU A;  4NAX A;  3A5W A;  4L5O A;  4V2M A;  4FYB A;  3QD9 A;  4LMW A;  3M1G A;  5JWO B;  1FVK A;  2O7K A;  4TR3 A;  2R2J A;  3FZ5 A;  2LEG A;  1QXH A;  3O6T A;  3TOU A;  4Q5N A;  2JSY A;  3IPZ A;  3KZQ A;  5F8B A;  4GSN A;  5B7C A;  3ME7 A;  5IMA A;  1HD2 A;  2ZUP A;  1YQ1 A;  3CSH A;  1ZL9 A;  1K0O A;  1W89 A;  4PQ1 A;  2GQL A;  2KUC A;  3EE2 A;  4OMV A;  5IMC A;  4K9Z A;  4ML6 A;  1LU4 A;  2H76 A;  4I8B A;  3UMA A;  3WT2 A;  1WPI A;  4PNF A;  5EPF A;  1A23 A;  1EV4 A;  3C1S A;  4TKY A;  5D9T A;  4K1F A;  1E2Y A;  3GN3 A;  3KP9 A;  3QFB C;  3ISO A;  2ES7 A;  5A4V A;  3H79 A;  2YJ7 A;  3W6G A;  4ECJ A;  2HXK A;  3WGD A;  4PNG A;  3H1N A;  4X43 A;  2GT5 A;  4HDE A;  5G5F A;  3L0H A;  6GSS A;  4MPF A;  5IMV A;  1XOA A;  2JZT A;  1B4Q A;  4ZBD A;  2BJX A;  2C0D A;  2AB6 A;  4AJ7 A;  1ON4 A;  4F03 A;  1AQV A;  1NM3 A;  4V1A g;  2GVP A;  4MJE A;  2M72 A;  5GST A;  2XC2 A;  1WMJ A;  1JZD A;  2YN1 A;  4TVE A;  2XBQ A;  5KN2 A;  2P0G A;  5FHI A;  4WR5 A;  4IN0 A;  4MJB A;  3TRX A;  1XFL A;  2GT6 A;  2X64 A;  2C0G A;  3IXR A;  5D73 A;  5IMZ A;  3WGX A;  5ECP B;  4I5Q A;  4MMM A;  3KIJ A;  3G9B A;  4TR4 A;  1YKC A;  1XVQ A;  1BAY A;  4ZL8 A;  1YKA A;  1S3D A;  3FEU A;  1B8X A;  4IS0 A;  3GIX A;  3MWH A;  1SD9 A;  4OWY A;  3HZ4 A;  3LYK A;  1NW2 A;  3VI5 A;  1A24 A;  2O85 A;  1EEM A;  1XWC A;  2NPB A;  4ZIL A;  3RHC A;  1R7H A;  2IWT A;  5IMD A;  4GSS A;  3ERF A;  4FH8 A;  3HY2 A;  4F2I A;  4K0N A;  1SK2 A;  3FR6 A;  2GSR A;  4HEA 2;  2L4C A;  1TK0 B;  1GTI A;  1K0D A;  2IL3 A;  1YF1 A;  1K3Y A;  1YEX A;  1T3B A;  3E0U A;  4Q5Q A;  3I69 A;  1OKT A;  3WD6 A;  3QFA C;  5IIZ A;  2IIY A;  1MD3 A;  5DJL A;  4TW5 A;  3FHK A;  5DAL B;  5GZZ B;  3TKS E;  3D5J A;  3P90 A;  5LD0 A;  4K8M A;  3DRN A;  4KSM A;  3BBY A;  3FZA A;  5ID2 B;  1JLV A;  3H8Q A;  2C3T A;  1PGT A;  1AAZ A;  1FG4 A;  1GSS A;  3EYT A;  1B9Y C;  1ZZY A;  1PA3 A;  1V57 A;  3TRQ A;  2PGT A;  1KTE A;  1MEK A;  1ZYQ B;  5HFI A;  1SKW B;  2VOC A;  4KDX A;  1GRX A;  1TJD A;  5J3R A;  2H0G A;  1UVZ A;  4CDO A;  4ECB A;  1EEJ A;  5G1K A;  4MAB A;  5IPG A;  1AC1 A;  4OD7 A;  2KP1 A;  4WBJ A;  5D9W A;  1A0F A;  1Y6E A;  3ZMK A;  3IRA A;  1KNG A;  1ZMA A;  3KJY A;  10GS A;  5F0G A;  2HSH A;  4AGS A;  1OKD A;  2N5A A;  3H93 A;  1QMV A;  4KA0 A;  5HR0 A;  5H5R A;  4Z7X A;  3F4R A;  1SKS B;  2DJ3 A;  2NTO A;  2P5Q A;  1O8X A;  4OFN A;  2FWE A;  2BMX A;  2EC4 A;  1FO5 A;  4IJ3 A;  2MMA A;  1TI1 A;  4KDU A;  2JAC A;  3DVW A;  1GUM A;  2H71 A;  2VCV A;  3ERW A;  4PUR A;  3RAZ A;  1PL2 A;  4AF2 A;  3QCP A;  8GSS A;  4ISD A;  3ZIJ A;  4N30 A;  3VWU A;  2DJJ A;  2MBS A;  4JR6 A;  3QR6 A;  3LOR A;  1FAA A;  2O87 A;  2YZU A;  5CNW A;  1QGV A;  3ZVJ A;  2VL2 A;  3F0I A;  5J9C A;  4HOJ A;  4WF4 A;  1UC7 A;  3IAM 2;  2FCH A;  1BYE A;  5DDL A;  3DKS A;  2AJQ B;  3IA1 A;  3NZN A;  5C04 A;  4EDY A;  5LCZ A;  1YDK A;  2XPD A;  4ID0 A;  2CX3 A;  3BD2 A;  4KCA A;  3LEF A;  3Q19 A;  3FRC A;  1N2A A;  2OA7 A;  1XW9 A;  3J7Y b;  5ECI B;  4D73 B;  1MTC A;  1ML6 A;  1XWG A;  4EKZ A;  1A8Y A;  1QQ2 A;  2ON7 A;  3R2Q A;  1M0U A;  1O8W A;  4OO5 A;  3F3R A;  3KEB A;  2OE0 A;  2JSZ A;  3DML A;  4X0X A;  3TUE A;  5ABR A;  1ILO A;  4XIH A;  3ZIT A;  2FD3 A;  2YWI A;  4IKH A;  2A2R A;  2FA4 A;  2LRC A;  4BA7 A;  2CT6 A;  4PUA A;  1THX A;  2QKE A;  2CAI A;  1TK5 B;  2YZH A;  3VPQ A;  4MZW A;  4XS4 B;  4EUY A;  4POM A;  2YP6 A;  3UBL A;  5JWQ B;  5IOW A;  1SK1 A;  5CRG A;  1YF0 A;  3ED3 A;  4E8H A;  2FWG A;  3KH9 A;  1R5P A;  2ON5 A;  2MYG A;  1FHE A;  3BJ5 A;  1SYX A;  4GXZ A;  2HZE B;  2H8L A;  2F8F A;  3GX8 A;  3IBH A;  2WGR A;  2J9H A;  3EIN A;  3NOF A;  4WR4 A;  1XBS A;  2DIZ A;  1K0A A;  2FWF A;  4IW9 A;  2OKA A;  2XHF A;  5AIX A;  2R5G A;  1A2J A;  2VM2 A;  1GSF A;  3TCO A;  2IN3 A;  3CMI A;  5ELG A;  2CX4 A;  5ECO B;  3SWL A;  5DAK A;  4XS1 A;  3LXZ A;  5J4U A;  3KTL A;  4I2U A;  5D93 A;  3VWV A;  3D4T A;  4FO5 A;  3G7I A;  2AUV A;  4N0Z A;  1URM A;  3FYG A;  4KB3 A;  2LKU A;  4LA1 A;  13GS A;  4POL A;  2L6C A;  1UN2 A;  4KH7 A;  1HNA A;  17GS A;  2JAD A;  3CRT A;  2OE1 A;  4OCF A;  3F63 A;  1QUW A;  4RQX A;  2F51 A;  5JCU A;  3UL3 A;  1F37 A;  4DSS B;  1SYR A;  3LGC A;  4WXT A;  3FZ4 A;  2B1K A;  2PMT A;  3CSI A;  1YEP A;  3F6D A;  1Z7R A;  4FIW A;  3G7Y A;  3UBK A;  5ECS A;  2RM6 A;  5C00 A;  3VI7 A;  4ECI A;  1PX7 A;  1C72 A;  2P31 A;  3GSS A;  1BJX A;  1FOV A;  2X8C A;  2GS3 A;  3CRU A;  2VL9 A;  1XIY A;  5ECM B;  2O8V B;  1GTU A;  1GTA A;  1GP1 A;  4L0U A;  4MH3 A;  5CP1 A;  5E59 A;  1K0C A;  5KN3 A;  1BX9 A;  5H5S A;  2IMK A;  3TKS C;  3E3E A;  2H19 A;  3N5O A;  2PWJ A;  2M80 A;  5DBQ A;  3MSZ A;  2HLS A;  3ZFL A;  3M3M A;  5CRD A;  2OBK A;  3ZLP A;  16GS A;  1ZOF A;  3E9J B;  1EP8 A;  1G7E A;  1OYJ A;  4DVC A;  3HJP A;  1AIU A;  4L8E A;  5D8I A;  3A2X A;  14GS A;  2H70 A;  1WRY A;  1M99 A;  3RHB A;  4HUA A;  4EO3 A;  1Z5Y E;  1VF3 A;  1I9D A;  3CXG A;  3EC3 A;  2NDO A;  4NXI A;  1B4P A;  1SJZ A;  4EL1 A;  1SU9 A;  3TJG A;  3GH6 A;  1TRS A;  3L4N A;  4MF5 A;  2X8H A;  3U6V A;  3LWA A;  3F6F A;  2TRX A;  2YV9 A;  1CQG A;  1XWB A;  2GZZ A;  3LQ7 A;  3ZL5 A;  2DJ1 A;  4F82 A;  4OCE A;  2GZY A;  2B6M A;  3KD0 A;  4WF5 A;  3HCZ A;  2KOK A;  3IR4 A;  3UEM A;  2RII A;  2C3Q A;  3IAS 2;  2OAD A;  1V9W A;  2I1U A;  3CBU A;  4GF0 A;  2V1M A;  4PX1 A;  1JZO A;  1JLW A;  3EU3 A;  6GSX A;  4IBP A;  1PN9 A;  2H0H A;  5ECL B;  4POB A;  2GSQ A;  1GLQ A;  3O3T A;  5IOX A;  2OJL A;  1JZW A;  1AXD A;  3M9J A;  2MMZ A;  5IO0 A;  3WT1 A;  2H6X A;  4HS1 A;  1U87 A;  4O5R A;  4ECC A;  1GL8 A;  4POK A;  3LJR A;  5CRW A;  5DVB A;  3TJJ A;  2CQ9 A;  2DJ2 A;  4GQF A;  1SL2 B;  2RLI A;  2G2Q A;  3A2V A;  2PN8 A;  3VLN A;  3IHQ A;  4BPY A;  3EVI A;  2C0E A;  2D2Z A;  4YAP A;  4KAE A;  2H1A A;  6GSV A;  4QL7 A;  3TRP A;  4NHZ A;  1TXX A;  2H30 A;  2K18 A;  3C71 A;  3KTB A;  3M9K A;  2PER A;  4JR4 A;  1JZR A;  1Z7P A;  3FR9 A;  4DEJ A;  1G0T A;  3ERG A;  4O32 A;  3IV4 A;  2HE3 A;  1R5A A;  4H86 A;  3UVH A;  2WZ9 A;  2OE3 A;  2X99 A;  2VCZ A;  1ST9 A;  3QAV A;  5INY A;  11GS A;  2R37 A;  4KUN A;  3FK8 A;  4F0C A;  2HNL A;  2PVO C;  3V1W A;  2ZNM A;  3D22 A;  5A4U A;  4ZB6 A;  4EE0 A;  1PSQ A;  1SL1 B;  2PVQ A;  12GS A;  2JU5 A;  1ERU A;  3EMP A;  4WKW A;  1G6Y A;  5KN0 A;  2VCW A;  3GHA A;  1O73 A;  1T7P B;  5DJM A;  4HZ2 A;  4ZBA A;  4G19 A;  3HJM A;  1TU8 A;  3W8S A;  2H6Z A;  2VLV A;  1CQH A;  4ZL7 A;  1XZO A;  4IP6 A;  3P2A A;  1V98 A;  4XTS A;  4OFM A;  2EIR A;  3QAG A;  1M2D A;  4N0V A;  1FVJ A;  4MJC A;  4KX4 A;  1F3B A;  3F4T A;  3RPN A;  1FB0 A;  2I4A A;  2A4V A;  3GTU A;  4LL4 B;  4GRF A;  2V41 A;  3FZ9 A;  5HR2 A;  5IMF A;  4PQH A;  5GSS A;  3RBT A;  5JWR B;  2H73 A;  1PX6 A;  4LMV A;  4NHW A;  1THO A;  3Q74 A;  5G31 A;  2LV3 A;  2VO4 A;  3DIE A;  2YV7 A;  1Z6M A;  2V6K A;  2LRT A;  2LST A;  2L5O A;  4KCE A;  4GLT A;  3L9S A;  4WET A;  3KH7 A; 
#chains in the Genus database with same CATH topology
 1G6W A;  1GUH A;  3I9V 2;  5FWG A;  2NVL A;  2CVB A;  4TXO A;  1SK0 A;  2E7P A;  5ECH B;  2I3Y A;  2IMF A;  1J0F A;  5G5E A;  4KSO A;  3TOT A;  4WEY A;  2GLR A;  5FT3 A;  3SBC A;  4EIP A;  4IVF A;  3DEX A;  4L0W A;  3TKP A;  2GGT A;  3HJO A;  3RPP A;  2DKI A;  4Q5R A;  1WOU A;  1GSU A;  1K0N A;  2YOI A;  3TDG A;  2F9S A;  2VAF A;  4V2N A;  3GKK A;  3D6I A;  3BOA A;  3Q6O A;  1DSB A;  4X1U A;  4EC0 A;  2H1D A;  2IFQ A;  2XBI A;  1YY7 A;  5EVO A;  4JE1 A;  4IEL A;  5D9V A;  4HQS A;  4N10 A;  3LG6 A;  2VIM A;  2VLT A;  4O5Q A;  5CYY A;  2GZP A;  1OE7 A;  3EMX A;  4O7H A;  3M0F A;  3CSJ A;  3ZZX A;  4YQV A;  3HVS A;  3PH9 A;  2L59 A;  1S3A A;  3GMF A;  2K9F A;  3TKR A;  3DD3 A;  2HYX A;  4K2D A;  1IYH A;  5J41 A;  5G1L A;  3IE3 A;  4K6X A;  3WGE A;  2B5Y A;  3DVX A;  1O7U A;  3K8N A;  1WE0 A;  2VD1 A;  1ACV A;  4G2E A;  1U3I A;  3IC8 A;  2LRN A;  4TR1 A;  1V58 A;  1MD4 A;  4TXV A;  2H74 A;  2VLU A;  2FHE A;  3GKX A;  3KMN A;  1OE8 A;  3GYK A;  1JFU A;  1YZX A;  1XW6 A;  2LQO A;  1YJ6 A;  2B7K A;  1GUK A;  4FYU A;  1WIK A;  4G0I A;  2OBI A;  4LL1 B;  3HDC A;  1TU7 A;  2HT9 A;  3UAP A;  3ZIV A;  4JED A;  4MZC A;  1TDI A;  1B9X C;  1AQW A;  5KOW A;  3MYD A;  2R3X A;  2C0F A;  1J9B A;  5CAX A;  2VCQ A;  3UOM A;  1ABA A;  2CVK A;  2HRF A;  6GSU A;  1K3L A;  3ZRE A;  3GA4 A;  3HKR A;  3QAW A;  2Z9S A;  5D96 A;  1R26 A;  2V2G A;  4CHS A;  4HZ4 A;  3L9V A;  2H0I A;  1R4W A;  2X49 A;  2RUF A;  1USB A;  2PPT A;  4OO4 A;  1U3A A;  4X4J A;  3H4K A;  20GS A;  4RQR A;  19GS A;  3CQF A;  2OAC A;  4PTS A;  1DBY A;  1QK8 A;  2WB9 A;  4N11 A;  1Z6N A;  5ECQ B;  3KP8 A;  1ERW A;  5HR1 A;  2X4A A;  2VCT A;  5IO2 A;  2LJA A;  1F2E A;  5AGY A;  1NHY A;  1ZYE A;  1S3C A;  4IQ1 A;  1WJK A;  2FNO A;  4I97 A;  5DAK B;  2M46 A;  4ILF A;  3N9J A;  3C1R A;  4DSR A;  1XPV A;  6GSY A;  1OAZ A;  1FOH A;  2C1Y A;  2CAQ A;  5G30 A;  3ZTL A;  5ECK B;  4MCU A;  4QL9 A;  3Q18 A;  1H75 A;  3UIW A;  3PIN A;  4YQM A;  4BWQ A;  3CTF A;  3GRX A;  2LJK A;  5IM9 A;  1OC9 A;  4EDZ A;  1SEN A;  1XWK A;  2AV4 A;  2E2G A;  5AN1 A;  1V2A A;  1F6M C;  3IK9 A;  1DUG A;  2LNT A;  4JZQ A;  1OVN A;  4ZXG A;  1V40 A;  1X0R A;  4LLR A;  3GX0 A;  5B6M A;  3CTG A;  4MF6 A;  1LJR A;  2H1B A;  4ZB9 A;  3KM6 A;  4MZB A;  1TKD B;  1TOF A;  2DKH A;  4NPB A;  4EVM A;  5A5K A;  1GSD A;  3I43 A;  3G7J A;  2VL2 C;  2C3N A;  2HI7 A;  3HZ8 A;  2I81 A;  4ML1 A;  1M3J A;  4HSC X;  5DCG A;  2L4Q A;  2F8A A;  2I9H A;  1BED A;  1UA5 A;  1MDJ A;  1EP7 A;  1AW9 A;  2KHP A;  1GSE A;  5GAP D;  2NBS A;  4NV5 A;  1LBK A;  4EF0 A;  1PKZ A;  3HHV A;  1A0R P;  2P5R A;  2DIY A;  5H5Q A;  3DXB A;  2A2S A;  1HNB A;  1TI3 A;  1FB6 A;  1SJI A;  3ME8 A;  1SL0 B;  4JU5 A;  3IC4 A;  4J2F A;  3MAK A;  3EUR A;  3LFL A;  4HJ2 A;  3HA9 A;  2IMD A;  3ZVJ D;  1WWJ A;  1AUC A;  4CW9 A;  2AYT A;  3ZFB A;  4I6X A;  18GS A;  2PUK C;  2KP2 A;  2J23 A;  5D9X A;  4PQI A;  3VK9 A;  4ACS A;  4HI7 A;  1HNC A;  4YH2 A;  4OFT A;  2PBJ A;  1KEB A;  1B48 A;  2JL4 A;  2DLX A;  4EXJ A;  2GQK A;  3F3Q A;  2RM5 A;  4GWR A;  4XRA A;  1NHO A;  4G9H A;  4MK3 A;  3F8U A;  3GKN A;  3O76 A;  1TRU A;  3ZYW A;  2C80 A;  3GL3 A;  5CRH A;  2JZR A;  4KDY A;  4YKF A;  2YNX A;  1QFN A;  2GQM A;  1GNE A;  3HD5 A;  4WBR D;  1TRV A;  2YWN A;  4J56 E;  4RI6 A;  5ECR B;  4YQU A;  2JZS A;  1VRS D;  3L78 A;  1EV9 A;  1HYU A;  1RW1 A;  5L71 A;  3EPT A;  3D21 A;  7GSS A;  1Z9H A;  4PXO A;  3PGT A;  2QSI A;  3L9U A;  5B6N A;  5IQY A;  1I5G A;  3J7Y k;  3APO A;  3GH9 A;  3VUR A;  3OR5 A;  3GL5 A;  3VWW A;  1RK4 A;  1Q98 A;  3WYW A;  2LUS A;  3F9U A;  2VCX A;  1VGL A;  2DJK A;  4GTU A;  5HFK A;  2K8V A;  1BG5 A;  1BQ7 A;  6GST A;  3BCI A;  2GSS A;  1XXU A;  3IDV A;  5F07 A;  4V1A p;  3KGK A;  4K7N A;  2MMO A;  1OC3 A;  2H66 A;  4BVY A;  2HSY A;  3RDW A;  1T4Y A;  2YWO A;  2CVD A;  3FR3 A;  2N5F A;  1DE2 A;  3GUS A;  2LJR A;  3APS A;  3GV1 A;  5ENU A;  2VM1 A;  1NSW A;  1MDI A;  4F9Z A;  1XOB A;  1GH2 A;  3KCM A;  4JRR A;  5LNK e;  3VPT A;  1Z3E A;  4HU9 A;  2CV4 A;  1N8J A;  2H1G A;  2K8S A;  2H72 A;  4HU7 A;  1K0B A;  2B5X A;  2DC5 A;  3PR8 A;  5J5N A;  4TOP A;  2H01 A;  1ERT A;  2ALB A;  2B3S A;  4MA9 A;  1TP9 A;  1Y25 A;  5DAL A;  1F9M A;  4I2T A;  3MDK A;  3GTU B;  1TK8 B;  3TGZ A;  1GTB A;  1M2A A;  1JHB A;  2FGX A;  5EL8 A;  1Q4J A;  4XCS A;  3UJ1 A;  4MDC A;  4K7O A;  2R4V A;  5AIS A;  5KOX A;  1A2L A;  5ID2 A;  2DBC A;  1WP0 A;  2WS2 A;  3C73 A;  2AHE A;  2WUL A;  4DSQ A;  2FY6 A;  1T1V A;  5CRE A;  4GST A;  5DCH A;  2DSA A;  1MDK A;  4Q5F A;  4BVX A;  3I6A A;  1T00 A;  4XHM A;  4IQA A;  4MH2 A;  2WCI A;  3QMX A;  5DQS A;  1J08 A;  1GWC A;  2A4H A;  5HR3 A;  1X5C A;  4TXO B;  3ZML A;  1X5D A;  5B8B A;  4AJ6 A;  1U6T A;  4MPG A;  2GTU A;  1HQO A;  3JCM L;  1T4Z A;  2CZ3 A;  5AIV A;  5J9B A;  3HXS A;  3IOS A;  5DQY A;  2YJH A;  1VF4 A;  4G0L A;  5G2Z A;  2H6Y A;  2N5B A;  3U5R E;  4MJA A;  1XVW A;  3FW2 A;  1S3R A;  1SD8 A;  4TR0 A;  2IME A;  5E4W A;  3DYR A;  1RQM A;  2MZC A;  2LNS A;  4IHU A;  1TW9 A;  3LYP A;  1GSY A;  3IK7 A;  1W4V A;  4IJI A;  3NIV A;  2VUP A;  2CZ2 A;  4ULX A;  4HQZ A;  4ZL9 A;  1PKW A;  2HZF A;  3HYP A;  4F0B A;  2AAW A;  3QPM A;  2IFQ B;  5GAN D;  1E6B A;  4MLY A;  6GSW A;  9GSS A;  1ZCP A;  4AJ8 A;  3GUR A;  5KEJ A;  5IPH A;  22GS A;  4TN8 A;  2DMM A;  3C7M A;  4MNN A;  4NV2 A;  2QGV A;  2WJU A;  5B8A A;  4IP1 A;  2FUG 2;  2WRT A;  3LSZ A;  2HRN A;  2MMN A;  3TJK A;  1PMT A;  3GNJ A;  4USS A;  1O81 A;  3DWV A;  3HVX A;  3VFI A;  4ZB8 A;  1GSQ A;  3GST A;  1M2B A;  3HVV A;  1VF1 A;  3TKS A;  3M8N A;  4MP4 A;  4YAV A;  1A2M A;  4P3Y B;  4TR1 B;  2O89 A;  4K7I A;  2R0P A;  1AQX A;  2HFD A;  4KE3 A;  5EY6 A;  1EGR A;  2X8G A;  2B7J A;  1XWA A;  3TJF A;  5ELA A;  1PRX A;  1EWX A;  1A8L A;  2R6K A;  1H4O A;  3TB2 A;  2B5E A;  2LS5 A;  5JCW A;  4E8E A;  1DE1 A;  1ZGN A;  3UVT A;  3FY7 A;  2IMI A;  3QOU A;  1M7T A;  3US3 A;  4D73 A;  2R0G A;  1X9S B;  4BL7 A;  2A2P A;  2FLS A;  4GQC A;  3R3E A;  1G7O A;  2K6V A;  3C8E A;  1EZK A;  4RI7 A;  2G0F A;  2F3M A;  2GDR A;  2H75 A;  1TTZ A;  3TJB A;  1IYI A;  3QDN A;  1M9A A;  3BCK A;  1M9B A;  1FW1 A;  3F4S A;  2DJ0 A;  4O92 A;  1EGO A;  4IGJ A;  1GLP A;  2EIO A;  5BRT A;  4GCI A;  2DML A;  2ZCT A;  3FKF A;  3KMO A;  4RUV A;  4TRX A;  4G10 A;  3ZRD A;  5JCG A;  1PQN A;  2FA8 A;  5KN1 A;  4FYC A;  2IJY A;  4XS6 A;  4ZBB A;  2L5L A;  4XS4 A;  4KW6 A;  2XPE A;  5CO3 A;  3TKQ A;  3EU4 A;  4HJM A;  4KND A;  3GKM A;  3P8W A;  4NMU A;  3LXT A;  2KLX A;  1PD2 1;  1GNW A;  2VL3 A;  1X5E A;  1U88 A;  1XCC A;  2C4J A;  2HZE A;  4V2L A;  4QQ7 A;  2BTO T;  2L57 A;  2YWM A;  2V6O A;  4MF7 A;  2YCD A;  3VWX A;  2RUE A;  1O85 A;  1K0M A;  1EOG A;  3S9F A;  1VF2 A;  3GFK A;  3DGQ A;  3D4M A;  3AY8 A;  2MBT A;  3UAR A;  2TIR A;  1OC8 A;  2IPA A;  2WFC A;  4JBB A;  2QC7 A;  2E2M A;  4ZIJ A;  2TRC P;  4BWS A;  3D0Z A;  5A4W A;  2FWH A;  1T8E B;  2YPM A;  1OC9 B;  2REM A;  2V32 A;  3MIX A;  2LQQ A;  1KBN A;  2B1L A;  1F3A A;  1ERV A;  2L6D A;  4K0G A;  1O6J A;  3KXO A;  5F05 A;  4NWY A;  2YAN A;  4PUF C;  2VD0 A;  3APQ A;  2C8U A;  3CYN A;  1SJ6 A;  4DSS A;  1TRW A;  5HFG A;  3A3T A;  1XW5 A;  2E0Q A;  1K3O A;  5COH A;  1X9W B;  4KGI A;  2CA8 A;  1X9M B;  2LTK A;  3W8J A;  4PGT A;  1SKR B;  3A2W A;  5F06 A;  2UZ8 A;  3MNG A;  2PU9 C;  1PL1 A;  2EIQ A;  5ECN B;  2GST A;  3EWL A;  3P7X A;  5HQP A;  1EOH A;  4XRD A;  4J57 E;  1GUL A;  4L5L A;  5BMU A;  2WDU A;  4NAX A;  3A5W A;  4L5O A;  4V2M A;  4KF9 A;  4FYB A;  3QD9 A;  4LMW A;  3M1G A;  5JWO B;  1FVK A;  2O7K A;  4TR3 A;  2R2J A;  3FZ5 A;  2LEG A;  1QXH A;  3O6T A;  3TOU A;  4Q5N A;  2JSY A;  3IPZ A;  3KZQ A;  5F8B A;  4GSN A;  5B7C A;  3ME7 A;  5IMA A;  1HD2 A;  2ZUP A;  1YQ1 A;  3CSH A;  1ZL9 A;  1K0O A;  1W89 A;  4PQ1 A;  2GQL A;  2KUC A;  3EE2 A;  4OMV A;  4G0K A;  5IMC A;  4K9Z A;  4ML6 A;  1LU4 A;  2H76 A;  4I8B A;  3UMA A;  3LW9 A;  3WT2 A;  1WPI A;  4PNF A;  5EPF A;  1A23 A;  1EV4 A;  3C1S A;  4TKY A;  2HSM A;  5D9T A;  4K1F A;  1E2Y A;  3GN3 A;  3KP9 A;  3QFB C;  3ISO A;  2ES7 A;  5A4V A;  3H79 A;  2YJ7 A;  3W6G A;  4ECJ A;  2HXK A;  3WGD A;  4PNG A;  3H1N A;  4X43 A;  2GT5 A;  4HDE A;  5G5F A;  3L0H A;  6GSS A;  4MPF A;  5IMV A;  1XOA A;  2JZT A;  1B4Q A;  4ZBD A;  2BJX A;  2C0D A;  2AB6 A;  4AJ7 A;  1ON4 A;  4F03 A;  1AQV A;  1NM3 A;  4V1A g;  2GVP A;  4MJE A;  2M72 A;  5GST A;  2XC2 A;  1WMJ A;  1JZD A;  2YN1 A;  4TVE A;  2XBQ A;  5KN2 A;  2QA1 A;  2P0G A;  5FHI A;  4WR5 A;  4IN0 A;  4MJB A;  3TRX A;  1XFL A;  2GT6 A;  2X64 A;  2C0G A;  3IXR A;  5D73 A;  5IMZ A;  3WGX A;  5ECP B;  4I5Q A;  4MMM A;  3KIJ A;  3G9B A;  4TR4 A;  1YKC A;  1XVQ A;  1BAY A;  4ZL8 A;  1YKA A;  1S3D A;  3FEU A;  1B8X A;  4IS0 A;  3GIX A;  3MWH A;  1SD9 A;  4OWY A;  3HZ4 A;  3LYK A;  1NW2 A;  1PN0 A;  3VI5 A;  1A24 A;  2O85 A;  1EEM A;  4BVY B;  1XWC A;  2NPB A;  4ZIL A;  3RHC A;  1R7H A;  2IWT A;  5IMD A;  4GSS A;  3ERF A;  4FH8 A;  3HY2 A;  4F2I A;  4K0N A;  1SK2 A;  3FR6 A;  1ZYP A;  2GSR A;  4HEA 2;  2L4C A;  4FQU A;  1TK0 B;  1GTI A;  1K0D A;  2IL3 A;  1YF1 A;  1K3Y A;  1YEX A;  1T3B A;  3E0U A;  4Q5Q A;  3I69 A;  1OKT A;  3WD6 A;  3QFA C;  5IIZ A;  2IIY A;  1MD3 A;  5DJL A;  4TW5 A;  3FHK A;  5DAL B;  5GZZ B;  3TKS E;  3D5J A;  3P90 A;  5LD0 A;  4K8M A;  2HRK A;  3DRN A;  4KSM A;  3BBY A;  3FZA A;  5ID2 B;  1JLV A;  3H8Q A;  4A5P A;  2C3T A;  1PGT A;  1AAZ A;  1FG4 A;  1GSS A;  3EYT A;  1B9Y C;  4BVX B;  1ZZY A;  1PA3 A;  1V57 A;  3TRQ A;  2PGT A;  1KTE A;  1MEK A;  1ZYQ B;  5HFI A;  1SKW B;  2VOC A;  4KDX A;  4O5U A;  1GRX A;  1TJD A;  5J3R A;  2H0G A;  1UVZ A;  4CDO A;  4ECB A;  1EEJ A;  5G1K A;  4MAB A;  5IPG A;  1AC1 A;  4OD7 A;  2KP1 A;  4WBJ A;  5D9W A;  1A0F A;  1Y6E A;  3ZMK A;  3IRA A;  1KNG A;  1ZMA A;  3KJY A;  10GS A;  5F0G A;  2HSH A;  4AGS A;  1OKD A;  2N5A A;  3H93 A;  1QMV A;  2HRA A;  4KA0 A;  5HR0 A;  5H5R A;  4Z7X A;  3F4R A;  1SKS B;  2DJ3 A;  2NTO A;  2P5Q A;  1O8X A;  4OFN A;  2FWE A;  2BMX A;  2EC4 A;  1FO5 A;  4IJ3 A;  2MMA A;  1TI1 A;  4KDU A;  2JAC A;  3DVW A;  1GUM A;  2H71 A;  2VCV A;  3ERW A;  4PUR A;  3RAZ A;  1PL2 A;  4AF2 A;  3QCP A;  4CY8 A;  8GSS A;  4ISD A;  3ZIJ A;  4N30 A;  3VWU A;  2DJJ A;  2MBS A;  4JR6 A;  3QR6 A;  3LOR A;  1FAA A;  2O87 A;  2YZU A;  5CNW A;  1QGV A;  3ZVJ A;  2VL2 A;  3F0I A;  1ZYN A;  5J9C A;  4HOJ A;  4WF4 A;  1UC7 A;  3IAM 2;  2FCH A;  1BYE A;  5DDL A;  3DKS A;  2AJQ B;  3IA1 A;  3NZN A;  5C04 A;  4EDY A;  5LCZ A;  1YDK A;  2XPD A;  4ID0 A;  2CX3 A;  3BD2 A;  4KCA A;  3LEF A;  3Q19 A;  3FRC A;  1N2A A;  2OA7 A;  1XW9 A;  3J7Y b;  5ECI B;  4D73 B;  4BL7 B;  1MTC A;  1ML6 A;  1XWG A;  4EKZ A;  1A8Y A;  1QQ2 A;  2ON7 A;  3R2Q A;  4K5S A;  1M0U A;  1O8W A;  4OO5 A;  3F3R A;  3KEB A;  2OE0 A;  2JSZ A;  3DML A;  4X0X A;  3TUE A;  5ABR A;  1ILO A;  4XIH A;  3ZIT A;  2FD3 A;  2YWI A;  4IKH A;  2A2R A;  2FA4 A;  4ICY A;  2LRC A;  4BA7 A;  2CT6 A;  4PUA A;  1THX A;  2QKE A;  2CAI A;  1TK5 B;  2YZH A;  4YKG A;  3VPQ A;  4MZW A;  4XS4 B;  4EUY A;  4POM A;  2YP6 A;  3UBL A;  5JWQ B;  5IOW A;  1SK1 A;  5CRG A;  1YF0 A;  3ED3 A;  1PFO A;  4E8H A;  2FWG A;  3KH9 A;  1R5P A;  2ON5 A;  2MYG A;  1FHE A;  3BJ5 A;  1SYX A;  4GXZ A;  2HZE B;  2H8L A;  2F8F A;  3GX8 A;  3IBH A;  2WGR A;  2J9H A;  3EIN A;  3NOF A;  4Z2U A;  4WR4 A;  1XBS A;  2DIZ A;  1K0A A;  2FWF A;  4IW9 A;  2OKA A;  2XHF A;  5AIX A;  2R5G A;  1A2J A;  2VM2 A;  1GSF A;  3TCO A;  2IN3 A;  3CMI A;  5ELG A;  2CX4 A;  5ECO B;  3SWL A;  5DAK A;  4XS1 A;  3LXZ A;  5J4U A;  3KTL A;  4I2U A;  5D93 A;  4EIQ A;  3VWV A;  3D4T A;  4FO5 A;  3G7I A;  2AUV A;  4N0Z A;  1URM A;  3FYG A;  4KB3 A;  2LKU A;  4LA1 A;  13GS A;  4POL A;  2L6C A;  1UN2 A;  4KH7 A;  1HNA A;  17GS A;  2JAD A;  3CRT A;  2OE1 A;  4OCF A;  3F63 A;  1QUW A;  4RQX A;  2F51 A;  5JCU A;  3UL3 A;  1F37 A;  4DSS B;  1SYR A;  3LGC A;  4WXT A;  3FZ4 A;  2B1K A;  2PMT A;  3CSI A;  1YEP A;  3F6D A;  1Z7R A;  4FIW A;  3G7Y A;  3UBK A;  4K2X A;  5ECS A;  2RM6 A;  5C00 A;  3VI7 A;  4ECI A;  1PX7 A;  4K5R A;  1C72 A;  2P31 A;  3GSS A;  1M3I A;  1BJX A;  1FOV A;  2R0C A;  2X8C A;  2GS3 A;  3CRU A;  2VL9 A;  1XIY A;  5ECM B;  2O8V B;  1GTU A;  1GTA A;  1GP1 A;  4L0U A;  4MH3 A;  5CP1 A;  5E59 A;  1K0C A;  5KN3 A;  1BX9 A;  5H5S A;  2IMK A;  3TKS C;  3E3E A;  2H19 A;  3N5O A;  2PWJ A;  2M80 A;  5DBQ A;  3MSZ A;  2HLS A;  3ZFL A;  3M3M A;  5CRD A;  2OBK A;  3ZLP A;  16GS A;  1ZOF A;  3E9J B;  1EP8 A;  1G7E A;  1OYJ A;  4DVC A;  3IHG A;  3HJP A;  1AIU A;  4L8E A;  5D8I A;  3A2X A;  14GS A;  2H70 A;  1WRY A;  1M99 A;  3RHB A;  4HUA A;  4EO3 A;  1Z5Y E;  1VF3 A;  1I9D A;  3CXG A;  3EC3 A;  2NDO A;  4NXI A;  1B4P A;  1SJZ A;  4EL1 A;  1SU9 A;  3TJG A;  3GH6 A;  1TRS A;  3L4N A;  4MF5 A;  2X8H A;  3U6V A;  3LWA A;  3F6F A;  2TRX A;  2YV9 A;  1CQG A;  1XWB A;  2GZZ A;  3LQ7 A;  3ZL5 A;  3PPU A;  2DJ1 A;  4F82 A;  4OCE A;  2GZY A;  2B6M A;  3KD0 A;  4WF5 A;  3HCZ A;  2KOK A;  3IR4 A;  3UEM A;  2RII A;  2C3Q A;  3IAS 2;  2OAD A;  1V9W A;  2I1U A;  3CBU A;  4GF0 A;  2V1M A;  4PX1 A;  1JZO A;  1JLW A;  3EU3 A;  6GSX A;  4IBP A;  1PN9 A;  2H0H A;  5ECL B;  1XG8 A;  4POB A;  2GSQ A;  1GLQ A;  3O3T A;  5IOX A;  2OJL A;  1JZW A;  1AXD A;  3M9J A;  2MMZ A;  5IO0 A;  3WT1 A;  2H6X A;  4HS1 A;  1U87 A;  4O5R A;  4ECC A;  1GL8 A;  4POK A;  3LJR A;  5CRW A;  5DVB A;  3TJJ A;  2CQ9 A;  2DJ2 A;  4GQF A;  1SL2 B;  2RLI A;  2G2Q A;  3A2V A;  2PN8 A;  3VLN A;  3IHQ A;  4BPY A;  3EVI A;  2C0E A;  2D2Z A;  4YAP A;  4KAE A;  2H1A A;  6GSV A;  4QL7 A;  2QA2 A;  3TRP A;  4NHZ A;  1TXX A;  2H30 A;  2K18 A;  3C71 A;  3KTB A;  3M9K A;  2PER A;  4JR4 A;  1JZR A;  1Z7P A;  3FR9 A;  4DEJ A;  1G0T A;  3ERG A;  4O32 A;  3IV4 A;  2HE3 A;  1R5A A;  4H86 A;  3UVH A;  2WZ9 A;  2OE3 A;  2X99 A;  2VCZ A;  1ST9 A;  3QAV A;  5INY A;  11GS A;  2R37 A;  4KUN A;  3FK8 A;  4F0C A;  2HNL A;  2PVO C;  3V1W A;  2ZNM A;  3D22 A;  5A4U A;  4ZB6 A;  4EE0 A;  1PSQ A;  3HVN A;  1SL1 B;  2PVQ A;  12GS A;  2JU5 A;  3FMW A;  1ERU A;  3EMP A;  4WKW A;  1G6Y A;  5KN0 A;  2VCW A;  3A5I A;  3GHA A;  1O73 A;  1T7P B;  5DJM A;  4BIK A;  4HZ2 A;  4ZBA A;  4G19 A;  3HJM A;  1TU8 A;  3W8S A;  2H6Z A;  2VLV A;  4Z2R A;  1CQH A;  4ZL7 A;  1XZO A;  4IP6 A;  3P2A A;  1V98 A;  4XTS A;  4OFM A;  2EIR A;  3QAG A;  1M2D A;  4N0V A;  1FVJ A;  4MJC A;  4KX4 A;  1F3B A;  3F4T A;  3RPN A;  1FB0 A;  2I4A A;  2A4V A;  3GTU A;  4LL4 B;  4GRF A;  2V41 A;  3FZ9 A;  5HR2 A;  5IMF A;  4PQH A;  5GSS A;  3RBT A;  5JWR B;  2H73 A;  1PX6 A;  4LMV A;  4NHW A;  4Z2T A;  1THO A;  3Q74 A;  5G31 A;  2LV3 A;  2VO4 A;  3DIE A;  2YV7 A;  1Z6M A;  2V6K A;  2LRT A;  2LST A;  2L5O A;  4KCE A;  4GLT A;  3L9S A;  4WET A;  4CY6 A;  3KH7 A; 
#chains in the Genus database with same CATH homology
 1G6W A;  1GUH A;  3I9V 2;  5FWG A;  2NVL A;  2CVB A;  4TXO A;  1SK0 A;  2E7P A;  5ECH B;  2I3Y A;  2IMF A;  1J0F A;  5G5E A;  4KSO A;  3TOT A;  4WEY A;  2GLR A;  5FT3 A;  3SBC A;  4EIP A;  4IVF A;  3DEX A;  4L0W A;  3TKP A;  2GGT A;  3HJO A;  3RPP A;  2DKI A;  4Q5R A;  1WOU A;  1GSU A;  1K0N A;  2YOI A;  3TDG A;  2F9S A;  2VAF A;  4V2N A;  3GKK A;  3D6I A;  3BOA A;  3Q6O A;  1DSB A;  4X1U A;  4EC0 A;  2H1D A;  2IFQ A;  2XBI A;  1YY7 A;  5EVO A;  4JE1 A;  4IEL A;  5D9V A;  4HQS A;  4N10 A;  3LG6 A;  2VIM A;  2VLT A;  4O5Q A;  5CYY A;  2GZP A;  1OE7 A;  3EMX A;  4O7H A;  3M0F A;  3CSJ A;  3ZZX A;  4YQV A;  3HVS A;  3PH9 A;  2L59 A;  1S3A A;  3GMF A;  2K9F A;  3TKR A;  3DD3 A;  2HYX A;  4K2D A;  1IYH A;  5J41 A;  5G1L A;  3IE3 A;  4K6X A;  3WGE A;  2B5Y A;  3DVX A;  1O7U A;  3K8N A;  1WE0 A;  2VD1 A;  1ACV A;  4G2E A;  1U3I A;  3IC8 A;  2LRN A;  4TR1 A;  1V58 A;  1MD4 A;  4TXV A;  2H74 A;  2VLU A;  2FHE A;  3GKX A;  3KMN A;  1OE8 A;  3GYK A;  1JFU A;  1YZX A;  1XW6 A;  2LQO A;  1YJ6 A;  2B7K A;  1GUK A;  4FYU A;  1WIK A;  4G0I A;  2OBI A;  4LL1 B;  3HDC A;  1TU7 A;  2HT9 A;  3UAP A;  3ZIV A;  4JED A;  4MZC A;  1TDI A;  1B9X C;  1AQW A;  5KOW A;  3MYD A;  2R3X A;  2C0F A;  1J9B A;  5CAX A;  2VCQ A;  3UOM A;  1ABA A;  2CVK A;  2HRF A;  6GSU A;  1K3L A;  3ZRE A;  3GA4 A;  3HKR A;  3QAW A;  2Z9S A;  5D96 A;  1R26 A;  2V2G A;  4CHS A;  4HZ4 A;  3L9V A;  2H0I A;  1R4W A;  2X49 A;  2RUF A;  1USB A;  2PPT A;  4OO4 A;  1U3A A;  4X4J A;  3H4K A;  20GS A;  4RQR A;  19GS A;  2OAC A;  4PTS A;  1DBY A;  1QK8 A;  2WB9 A;  4N11 A;  1Z6N A;  5ECQ B;  3KP8 A;  1ERW A;  5HR1 A;  2X4A A;  2VCT A;  5IO2 A;  2LJA A;  1F2E A;  5AGY A;  1NHY A;  1ZYE A;  1S3C A;  4IQ1 A;  1WJK A;  2FNO A;  4I97 A;  5DAK B;  2M46 A;  4ILF A;  3N9J A;  3C1R A;  4DSR A;  1XPV A;  6GSY A;  1OAZ A;  1FOH A;  2C1Y A;  2CAQ A;  5G30 A;  3ZTL A;  5ECK B;  4MCU A;  4QL9 A;  3Q18 A;  1H75 A;  3UIW A;  3PIN A;  4YQM A;  4BWQ A;  3CTF A;  3GRX A;  2LJK A;  5IM9 A;  1OC9 A;  4EDZ A;  1SEN A;  1XWK A;  2AV4 A;  2E2G A;  5AN1 A;  1V2A A;  1F6M C;  3IK9 A;  1DUG A;  2LNT A;  4JZQ A;  1OVN A;  4ZXG A;  1V40 A;  1X0R A;  4LLR A;  3GX0 A;  5B6M A;  3CTG A;  4MF6 A;  1LJR A;  2H1B A;  4ZB9 A;  3KM6 A;  4MZB A;  1TKD B;  1TOF A;  2DKH A;  4NPB A;  4EVM A;  5A5K A;  1GSD A;  3I43 A;  3G7J A;  2VL2 C;  2C3N A;  2HI7 A;  3HZ8 A;  2I81 A;  4ML1 A;  5DCG A;  2L4Q A;  2F8A A;  2I9H A;  1BED A;  1UA5 A;  1MDJ A;  1EP7 A;  1AW9 A;  2KHP A;  1GSE A;  5GAP D;  2NBS A;  4NV5 A;  1LBK A;  4EF0 A;  1PKZ A;  3HHV A;  1A0R P;  2P5R A;  2DIY A;  5H5Q A;  3DXB A;  2A2S A;  1HNB A;  1TI3 A;  1FB6 A;  1SJI A;  3ME8 A;  1SL0 B;  4JU5 A;  3IC4 A;  4J2F A;  3MAK A;  3EUR A;  3LFL A;  4HJ2 A;  3HA9 A;  2IMD A;  3ZVJ D;  1WWJ A;  1AUC A;  4CW9 A;  2AYT A;  3ZFB A;  4I6X A;  18GS A;  2PUK C;  2KP2 A;  2J23 A;  5D9X A;  4PQI A;  3VK9 A;  4ACS A;  4HI7 A;  1HNC A;  4YH2 A;  4OFT A;  2PBJ A;  1KEB A;  1B48 A;  2JL4 A;  2DLX A;  4EXJ A;  2GQK A;  3F3Q A;  2RM5 A;  4GWR A;  4XRA A;  1NHO A;  4G9H A;  4MK3 A;  3F8U A;  3GKN A;  3O76 A;  1TRU A;  3ZYW A;  2C80 A;  3GL3 A;  5CRH A;  2JZR A;  4KDY A;  4YKF A;  2YNX A;  1QFN A;  2GQM A;  1GNE A;  3HD5 A;  4WBR D;  1TRV A;  2YWN A;  4J56 E;  4RI6 A;  5ECR B;  4YQU A;  2JZS A;  1VRS D;  3L78 A;  1EV9 A;  1HYU A;  1RW1 A;  5L71 A;  3EPT A;  3D21 A;  7GSS A;  1Z9H A;  4PXO A;  3PGT A;  2QSI A;  3L9U A;  5B6N A;  5IQY A;  1I5G A;  3J7Y k;  3APO A;  3GH9 A;  3VUR A;  3OR5 A;  3GL5 A;  3VWW A;  1RK4 A;  1Q98 A;  3WYW A;  2LUS A;  3F9U A;  2VCX A;  1VGL A;  2DJK A;  4GTU A;  5HFK A;  2K8V A;  1BG5 A;  1BQ7 A;  6GST A;  3BCI A;  2GSS A;  1XXU A;  3IDV A;  5F07 A;  4V1A p;  3KGK A;  4K7N A;  2MMO A;  1OC3 A;  2H66 A;  4BVY A;  2HSY A;  3RDW A;  1T4Y A;  2YWO A;  2CVD A;  3FR3 A;  2N5F A;  1DE2 A;  3GUS A;  2LJR A;  3APS A;  3GV1 A;  5ENU A;  2VM1 A;  1NSW A;  1MDI A;  4F9Z A;  1XOB A;  1GH2 A;  3KCM A;  4JRR A;  5LNK e;  3VPT A;  1Z3E A;  4HU9 A;  2CV4 A;  1N8J A;  2H1G A;  2K8S A;  2H72 A;  4HU7 A;  1K0B A;  2B5X A;  2DC5 A;  3PR8 A;  5J5N A;  4TOP A;  2H01 A;  1ERT A;  2ALB A;  2B3S A;  4MA9 A;  1TP9 A;  1Y25 A;  5DAL A;  1F9M A;  4I2T A;  3MDK A;  3GTU B;  1TK8 B;  3TGZ A;  1GTB A;  1M2A A;  1JHB A;  2FGX A;  5EL8 A;  1Q4J A;  4XCS A;  3UJ1 A;  4MDC A;  4K7O A;  2R4V A;  5AIS A;  5KOX A;  1A2L A;  5ID2 A;  2DBC A;  1WP0 A;  2WS2 A;  3C73 A;  2AHE A;  2WUL A;  4DSQ A;  2FY6 A;  1T1V A;  5CRE A;  4GST A;  5DCH A;  2DSA A;  1MDK A;  4Q5F A;  4BVX A;  3I6A A;  1T00 A;  4XHM A;  4IQA A;  4MH2 A;  2WCI A;  3QMX A;  5DQS A;  1J08 A;  1GWC A;  2A4H A;  5HR3 A;  1X5C A;  4TXO B;  3ZML A;  1X5D A;  5B8B A;  4AJ6 A;  1U6T A;  4MPG A;  2GTU A;  1HQO A;  3JCM L;  1T4Z A;  2CZ3 A;  5AIV A;  5J9B A;  3HXS A;  3IOS A;  5DQY A;  2YJH A;  1VF4 A;  4G0L A;  5G2Z A;  2H6Y A;  2N5B A;  3U5R E;  4MJA A;  1XVW A;  3FW2 A;  1SD8 A;  4TR0 A;  2IME A;  5E4W A;  3DYR A;  1RQM A;  2MZC A;  2LNS A;  4IHU A;  1TW9 A;  3LYP A;  1GSY A;  3IK7 A;  1W4V A;  4IJI A;  3NIV A;  2VUP A;  2CZ2 A;  4ULX A;  4HQZ A;  4ZL9 A;  1PKW A;  2HZF A;  3HYP A;  4F0B A;  2AAW A;  3QPM A;  2IFQ B;  5GAN D;  1E6B A;  4MLY A;  6GSW A;  9GSS A;  1ZCP A;  4AJ8 A;  3GUR A;  5KEJ A;  5IPH A;  22GS A;  4TN8 A;  2DMM A;  3C7M A;  4MNN A;  4NV2 A;  2QGV A;  2WJU A;  5B8A A;  4IP1 A;  2FUG 2;  2WRT A;  3LSZ A;  2HRN A;  2MMN A;  3TJK A;  1PMT A;  3GNJ A;  4USS A;  1O81 A;  3DWV A;  3HVX A;  3VFI A;  4ZB8 A;  1GSQ A;  3GST A;  1M2B A;  3HVV A;  1VF1 A;  3TKS A;  3M8N A;  4MP4 A;  4YAV A;  1A2M A;  4P3Y B;  4TR1 B;  2O89 A;  4K7I A;  2R0P A;  1AQX A;  2HFD A;  4KE3 A;  5EY6 A;  1EGR A;  2X8G A;  2B7J A;  1XWA A;  3TJF A;  5ELA A;  1PRX A;  1EWX A;  1A8L A;  2R6K A;  1H4O A;  3TB2 A;  2B5E A;  2LS5 A;  5JCW A;  4E8E A;  1DE1 A;  1ZGN A;  3UVT A;  3FY7 A;  2IMI A;  3QOU A;  1M7T A;  3US3 A;  4D73 A;  2R0G A;  1X9S B;  4BL7 A;  2A2P A;  2FLS A;  4GQC A;  3R3E A;  1G7O A;  2K6V A;  3C8E A;  1EZK A;  4RI7 A;  2G0F A;  2F3M A;  2GDR A;  2H75 A;  1TTZ A;  3TJB A;  1IYI A;  3QDN A;  1M9A A;  3BCK A;  1M9B A;  1FW1 A;  3F4S A;  2DJ0 A;  4O92 A;  1EGO A;  4IGJ A;  1GLP A;  2EIO A;  5BRT A;  4GCI A;  2DML A;  2ZCT A;  3FKF A;  3KMO A;  4RUV A;  4TRX A;  4G10 A;  3ZRD A;  5JCG A;  1PQN A;  2FA8 A;  5KN1 A;  4FYC A;  2IJY A;  4XS6 A;  4ZBB A;  2L5L A;  4XS4 A;  4KW6 A;  2XPE A;  5CO3 A;  3TKQ A;  3EU4 A;  4HJM A;  4KND A;  3GKM A;  3P8W A;  4NMU A;  3LXT A;  2KLX A;  1PD2 1;  1GNW A;  2VL3 A;  1X5E A;  1U88 A;  1XCC A;  2C4J A;  2HZE A;  4V2L A;  4QQ7 A;  2BTO T;  2L57 A;  2YWM A;  2V6O A;  4MF7 A;  2YCD A;  3VWX A;  2RUE A;  1O85 A;  1K0M A;  1EOG A;  3S9F A;  1VF2 A;  3GFK A;  3DGQ A;  3D4M A;  3AY8 A;  2MBT A;  3UAR A;  2TIR A;  1OC8 A;  2IPA A;  2WFC A;  4JBB A;  2QC7 A;  2E2M A;  4ZIJ A;  2TRC P;  4BWS A;  3D0Z A;  5A4W A;  2FWH A;  1T8E B;  2YPM A;  1OC9 B;  2REM A;  2V32 A;  3MIX A;  2LQQ A;  1KBN A;  2B1L A;  1F3A A;  1ERV A;  2L6D A;  4K0G A;  1O6J A;  3KXO A;  5F05 A;  4NWY A;  2YAN A;  4PUF C;  2VD0 A;  3APQ A;  2C8U A;  3CYN A;  1SJ6 A;  4DSS A;  1TRW A;  5HFG A;  3A3T A;  1XW5 A;  2E0Q A;  1K3O A;  5COH A;  1X9W B;  4KGI A;  2CA8 A;  1X9M B;  2LTK A;  3W8J A;  4PGT A;  1SKR B;  3A2W A;  5F06 A;  2UZ8 A;  3MNG A;  2PU9 C;  1PL1 A;  2EIQ A;  5ECN B;  2GST A;  3EWL A;  3P7X A;  5HQP A;  1EOH A;  4XRD A;  4J57 E;  1GUL A;  4L5L A;  5BMU A;  2WDU A;  4NAX A;  3A5W A;  4L5O A;  4V2M A;  4KF9 A;  4FYB A;  3QD9 A;  4LMW A;  3M1G A;  5JWO B;  1FVK A;  2O7K A;  4TR3 A;  2R2J A;  3FZ5 A;  2LEG A;  1QXH A;  3O6T A;  3TOU A;  4Q5N A;  2JSY A;  3IPZ A;  3KZQ A;  5F8B A;  4GSN A;  5B7C A;  3ME7 A;  5IMA A;  1HD2 A;  2ZUP A;  1YQ1 A;  3CSH A;  1ZL9 A;  1K0O A;  1W89 A;  4PQ1 A;  2GQL A;  2KUC A;  3EE2 A;  4OMV A;  4G0K A;  5IMC A;  4K9Z A;  4ML6 A;  1LU4 A;  2H76 A;  4I8B A;  3UMA A;  3LW9 A;  3WT2 A;  1WPI A;  4PNF A;  5EPF A;  1A23 A;  1EV4 A;  3C1S A;  4TKY A;  2HSM A;  5D9T A;  4K1F A;  1E2Y A;  3GN3 A;  3KP9 A;  3QFB C;  3ISO A;  2ES7 A;  5A4V A;  3H79 A;  2YJ7 A;  3W6G A;  4ECJ A;  2HXK A;  3WGD A;  4PNG A;  3H1N A;  4X43 A;  2GT5 A;  4HDE A;  5G5F A;  3L0H A;  6GSS A;  4MPF A;  5IMV A;  1XOA A;  2JZT A;  1B4Q A;  4ZBD A;  2BJX A;  2C0D A;  2AB6 A;  4AJ7 A;  1ON4 A;  4F03 A;  1AQV A;  1NM3 A;  4V1A g;  2GVP A;  4MJE A;  2M72 A;  5GST A;  2XC2 A;  1WMJ A;  1JZD A;  2YN1 A;  4TVE A;  2XBQ A;  5KN2 A;  2QA1 A;  2P0G A;  5FHI A;  4WR5 A;  4IN0 A;  4MJB A;  3TRX A;  1XFL A;  2GT6 A;  2X64 A;  2C0G A;  3IXR A;  5D73 A;  5IMZ A;  3WGX A;  5ECP B;  4I5Q A;  4MMM A;  3KIJ A;  3G9B A;  4TR4 A;  1YKC A;  1XVQ A;  1BAY A;  4ZL8 A;  1YKA A;  1S3D A;  3FEU A;  1B8X A;  4IS0 A;  3GIX A;  3MWH A;  1SD9 A;  4OWY A;  3HZ4 A;  3LYK A;  1NW2 A;  1PN0 A;  3VI5 A;  1A24 A;  2O85 A;  1EEM A;  4BVY B;  1XWC A;  2NPB A;  4ZIL A;  3RHC A;  1R7H A;  2IWT A;  5IMD A;  4GSS A;  3ERF A;  4FH8 A;  3HY2 A;  4F2I A;  4K0N A;  1SK2 A;  3FR6 A;  1ZYP A;  2GSR A;  4HEA 2;  2L4C A;  4FQU A;  1TK0 B;  1GTI A;  1K0D A;  2IL3 A;  1YF1 A;  1K3Y A;  1YEX A;  1T3B A;  3E0U A;  4Q5Q A;  3I69 A;  1OKT A;  3WD6 A;  3QFA C;  5IIZ A;  2IIY A;  1MD3 A;  5DJL A;  4TW5 A;  3FHK A;  5DAL B;  5GZZ B;  3TKS E;  3D5J A;  3P90 A;  5LD0 A;  4K8M A;  2HRK A;  3DRN A;  4KSM A;  3BBY A;  3FZA A;  5ID2 B;  1JLV A;  3H8Q A;  4A5P A;  2C3T A;  1PGT A;  1AAZ A;  1FG4 A;  1GSS A;  3EYT A;  1B9Y C;  4BVX B;  1ZZY A;  1PA3 A;  1V57 A;  3TRQ A;  2PGT A;  1KTE A;  1MEK A;  1ZYQ B;  5HFI A;  1SKW B;  2VOC A;  4KDX A;  4O5U A;  1GRX A;  1TJD A;  5J3R A;  2H0G A;  1UVZ A;  4CDO A;  4ECB A;  1EEJ A;  5G1K A;  4MAB A;  5IPG A;  1AC1 A;  4OD7 A;  2KP1 A;  4WBJ A;  5D9W A;  1A0F A;  1Y6E A;  3ZMK A;  3IRA A;  1KNG A;  1ZMA A;  3KJY A;  10GS A;  5F0G A;  2HSH A;  4AGS A;  1OKD A;  2N5A A;  3H93 A;  1QMV A;  2HRA A;  4KA0 A;  5HR0 A;  5H5R A;  4Z7X A;  3F4R A;  1SKS B;  2DJ3 A;  2NTO A;  2P5Q A;  1O8X A;  4OFN A;  2FWE A;  2BMX A;  2EC4 A;  1FO5 A;  4IJ3 A;  2MMA A;  1TI1 A;  4KDU A;  2JAC A;  3DVW A;  1GUM A;  2H71 A;  2VCV A;  3ERW A;  4PUR A;  3RAZ A;  1PL2 A;  4AF2 A;  3QCP A;  4CY8 A;  8GSS A;  4ISD A;  3ZIJ A;  4N30 A;  3VWU A;  2DJJ A;  2MBS A;  4JR6 A;  3QR6 A;  3LOR A;  1FAA A;  2O87 A;  2YZU A;  5CNW A;  1QGV A;  3ZVJ A;  2VL2 A;  3F0I A;  1ZYN A;  5J9C A;  4HOJ A;  4WF4 A;  1UC7 A;  3IAM 2;  2FCH A;  1BYE A;  5DDL A;  3DKS A;  2AJQ B;  3IA1 A;  3NZN A;  5C04 A;  4EDY A;  5LCZ A;  1YDK A;  2XPD A;  4ID0 A;  2CX3 A;  3BD2 A;  4KCA A;  3LEF A;  3Q19 A;  3FRC A;  1N2A A;  2OA7 A;  1XW9 A;  3J7Y b;  5ECI B;  4D73 B;  4BL7 B;  1MTC A;  1ML6 A;  1XWG A;  4EKZ A;  1A8Y A;  1QQ2 A;  2ON7 A;  3R2Q A;  4K5S A;  1M0U A;  1O8W A;  4OO5 A;  3F3R A;  3KEB A;  2OE0 A;  2JSZ A;  3DML A;  4X0X A;  3TUE A;  5ABR A;  1ILO A;  4XIH A;  3ZIT A;  2FD3 A;  2YWI A;  4IKH A;  2A2R A;  2FA4 A;  4ICY A;  2LRC A;  4BA7 A;  2CT6 A;  4PUA A;  1THX A;  2QKE A;  2CAI A;  1TK5 B;  2YZH A;  4YKG A;  3VPQ A;  4MZW A;  4XS4 B;  4EUY A;  4POM A;  2YP6 A;  3UBL A;  5JWQ B;  5IOW A;  1SK1 A;  5CRG A;  1YF0 A;  3ED3 A;  4E8H A;  2FWG A;  3KH9 A;  1R5P A;  2ON5 A;  2MYG A;  1FHE A;  3BJ5 A;  1SYX A;  4GXZ A;  2HZE B;  2H8L A;  2F8F A;  3GX8 A;  3IBH A;  2WGR A;  2J9H A;  3EIN A;  3NOF A;  4Z2U A;  4WR4 A;  1XBS A;  2DIZ A;  1K0A A;  2FWF A;  4IW9 A;  2OKA A;  2XHF A;  5AIX A;  2R5G A;  1A2J A;  2VM2 A;  1GSF A;  3TCO A;  2IN3 A;  3CMI A;  5ELG A;  2CX4 A;  5ECO B;  3SWL A;  5DAK A;  4XS1 A;  3LXZ A;  5J4U A;  3KTL A;  4I2U A;  5D93 A;  4EIQ A;  3VWV A;  3D4T A;  4FO5 A;  3G7I A;  2AUV A;  4N0Z A;  1URM A;  3FYG A;  4KB3 A;  2LKU A;  4LA1 A;  13GS A;  4POL A;  2L6C A;  1UN2 A;  4KH7 A;  1HNA A;  17GS A;  2JAD A;  3CRT A;  2OE1 A;  4OCF A;  3F63 A;  1QUW A;  4RQX A;  2F51 A;  5JCU A;  3UL3 A;  1F37 A;  4DSS B;  1SYR A;  3LGC A;  4WXT A;  3FZ4 A;  2B1K A;  2PMT A;  3CSI A;  1YEP A;  3F6D A;  1Z7R A;  4FIW A;  3G7Y A;  3UBK A;  4K2X A;  5ECS A;  2RM6 A;  5C00 A;  3VI7 A;  4ECI A;  1PX7 A;  4K5R A;  1C72 A;  2P31 A;  3GSS A;  1BJX A;  1FOV A;  2R0C A;  2X8C A;  2GS3 A;  3CRU A;  2VL9 A;  1XIY A;  5ECM B;  2O8V B;  1GTU A;  1GTA A;  1GP1 A;  4L0U A;  4MH3 A;  5CP1 A;  5E59 A;  1K0C A;  5KN3 A;  1BX9 A;  5H5S A;  2IMK A;  3TKS C;  3E3E A;  2H19 A;  3N5O A;  2PWJ A;  2M80 A;  5DBQ A;  3MSZ A;  2HLS A;  3ZFL A;  3M3M A;  5CRD A;  2OBK A;  3ZLP A;  16GS A;  1ZOF A;  3E9J B;  1EP8 A;  1G7E A;  1OYJ A;  4DVC A;  3IHG A;  3HJP A;  1AIU A;  4L8E A;  5D8I A;  3A2X A;  14GS A;  2H70 A;  1WRY A;  1M99 A;  3RHB A;  4HUA A;  4EO3 A;  1Z5Y E;  1VF3 A;  1I9D A;  3CXG A;  3EC3 A;  2NDO A;  4NXI A;  1B4P A;  1SJZ A;  4EL1 A;  1SU9 A;  3TJG A;  3GH6 A;  1TRS A;  3L4N A;  4MF5 A;  2X8H A;  3U6V A;  3LWA A;  3F6F A;  2TRX A;  2YV9 A;  1CQG A;  1XWB A;  2GZZ A;  3LQ7 A;  3ZL5 A;  3PPU A;  2DJ1 A;  4F82 A;  4OCE A;  2GZY A;  2B6M A;  3KD0 A;  4WF5 A;  3HCZ A;  2KOK A;  3IR4 A;  3UEM A;  2RII A;  2C3Q A;  3IAS 2;  2OAD A;  1V9W A;  2I1U A;  3CBU A;  4GF0 A;  2V1M A;  4PX1 A;  1JZO A;  1JLW A;  3EU3 A;  6GSX A;  4IBP A;  1PN9 A;  2H0H A;  5ECL B;  4POB A;  2GSQ A;  1GLQ A;  3O3T A;  5IOX A;  2OJL A;  1JZW A;  1AXD A;  3M9J A;  2MMZ A;  5IO0 A;  3WT1 A;  2H6X A;  4HS1 A;  1U87 A;  4O5R A;  4ECC A;  1GL8 A;  4POK A;  3LJR A;  5CRW A;  5DVB A;  3TJJ A;  2CQ9 A;  2DJ2 A;  4GQF A;  1SL2 B;  2RLI A;  2G2Q A;  3A2V A;  2PN8 A;  3VLN A;  3IHQ A;  4BPY A;  3EVI A;  2C0E A;  2D2Z A;  4YAP A;  4KAE A;  2H1A A;  6GSV A;  4QL7 A;  2QA2 A;  3TRP A;  4NHZ A;  1TXX A;  2H30 A;  2K18 A;  3C71 A;  3KTB A;  3M9K A;  2PER A;  4JR4 A;  1JZR A;  1Z7P A;  3FR9 A;  4DEJ A;  1G0T A;  3ERG A;  4O32 A;  3IV4 A;  2HE3 A;  1R5A A;  4H86 A;  3UVH A;  2WZ9 A;  2OE3 A;  2X99 A;  2VCZ A;  1ST9 A;  3QAV A;  5INY A;  11GS A;  2R37 A;  4KUN A;  3FK8 A;  4F0C A;  2HNL A;  2PVO C;  3V1W A;  2ZNM A;  3D22 A;  5A4U A;  4ZB6 A;  4EE0 A;  1PSQ A;  1SL1 B;  2PVQ A;  12GS A;  2JU5 A;  3FMW A;  1ERU A;  3EMP A;  4WKW A;  1G6Y A;  5KN0 A;  2VCW A;  3A5I A;  3GHA A;  1O73 A;  1T7P B;  5DJM A;  4HZ2 A;  4ZBA A;  4G19 A;  3HJM A;  1TU8 A;  3W8S A;  2H6Z A;  2VLV A;  4Z2R A;  1CQH A;  4ZL7 A;  1XZO A;  4IP6 A;  3P2A A;  1V98 A;  4XTS A;  4OFM A;  2EIR A;  3QAG A;  1M2D A;  4N0V A;  1FVJ A;  4MJC A;  4KX4 A;  1F3B A;  3F4T A;  3RPN A;  1FB0 A;  2I4A A;  2A4V A;  3GTU A;  4LL4 B;  4GRF A;  2V41 A;  3FZ9 A;  5HR2 A;  5IMF A;  4PQH A;  5GSS A;  3RBT A;  5JWR B;  2H73 A;  1PX6 A;  4LMV A;  4NHW A;  4Z2T A;  1THO A;  3Q74 A;  5G31 A;  2LV3 A;  2VO4 A;  3DIE A;  2YV7 A;  1Z6M A;  2V6K A;  2LRT A;  2LST A;  2L5O A;  4KCE A;  4GLT A;  3L9S A;  4WET A;  4CY6 A;  3KH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...