3J80N

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j80N02
3RT3C 1KUQA 3F5TA 4B3SO 2UUCO 4LFCO 2UXDO 3J7AU 4X66O 2Z0AA 4JI2O 4DV7O 4LF8O 2LW7A 1XMOO 1NS1A 1FYJA 3O65A 2N74A 4X65O 5A2QN 4LF5O 4B3RO 2FKXA 2DOSA 4JI8O 4LFBO 1N33O 4DV1O 3OTOO 1FJGO 4B3MO 1A32A 2ZM6O 4DV2O 4AQYO 4JI3O 1HR0O 4NXNO 4KHPO 1R6TA 4DR1O 2UXCO 5BXZA 3T1YO 1R1BA 2UUAO 3R66A 4JI6O 4DV0O 4GKKO 1F7YA 4DUYO 5FLXN 4GKJO 2DJVA 5BR8O 1HNXO 4LF7O 1DK1A 5H5NA 1X59A 2UUBO 2E5LO 3J81N 1I94O 1D2DA 4A5UB 3J80N 1XMQO 4B3TO 1N36O 4DR7O 4OPAA 4LFAO 5BY1A 2UU9O 4DR3O 2JRIA 4DV6O 3M8AA 1IBLO 3JAMN 4DR2O 3SDLA 4JI5O 4LF4O 4DV4O 4JI4O 1N32O 4YHHO 1IBKO 1YZBA 1IBMO 1J5EO 5IT9N 4JI7O 1AB3A 2F4VO 5LMUO 4YY3O 1XNQO 2AGAA 3T1HO 4X64O 2VQEO 4DUZO 4DV5O 4OX9O 4NXMO 4JYAO 1XNRO 1XEQA 4DR6O 4DR5O 1N34O 4JV5O 4X62O 2HHHO 4K0KO 1HNZO 2UXBO 4DR4O 4DV3O 4JI0O 5IWAO 5LMNO 4JI1O 2ZKOA 4LF9O 1G1XB 2VQFO 5LL6Y 4LF6O 4OPHA 1AILA 1FKAO 1HNWO
chains in the Genus database with same CATH superfamily
4LF4B 2HJFC 3AG4B 4FK5C 5IYCO 1NQTA 5EYPA 5L3DA 4X65O 3JARA 5A2QN 2JJ1G 1BT8A 1H2GA 3HKCA 3G6BA 3P32A 4LFAB 5L3BA 4MTGA 2G38A 4X8AA 2F43G 3WB2A 4AQYO 2Q9LA 4LWSA 4H0LB 4J11A 4BW9A 5B1OA 3ZCCA 1K4DC 4QNHB 3RYIB 2Q6AA 3L71H 2RJZA 5KX5B 3L9DA 5IE9A 1THZA 4QIWF 4F6EA 3UQ8A 4E4EA 4Z2WA 4OX9B 3BAAA 1IX9A 1Q86W 4GUNA 4PJ0Z 1SF9A 1FXKC 4Z1VA 4B08A 5CB4A 4PHZA 4IYIA 5H2FZ 5K1PA 3OUSA 2AXTZ 4OPAA 3W7UA 4AI8A 4BAYA 4ZOLA 3SDLA 4EEQA 4LF4O 1QVGU 3E8GA 3JD1A 3E22B 2BOCC 4X20B 4K3AA 1H2KA 5FPOA 2EIJB 2Y69B 4X1IA 2P5OA 3K9SA 1MG1A 4PI0A 4FM0A 1FD9A 1VIBA 3CRAA 4DUZO 1QBZA 4DV1B 4R7CA 1KBHA 1Q5OA 3K06A 3C90A 4JI0O 5KHGA 2YI9A 5KA6A 3UO3A 3BPZA 2UXCB 1ORQC 1R3IC 2A0LA 2VRZA 4BR6A 1YHQV 3B8NA 1YF2A 2XASA 3J7AU 2KSDA 3RVYA 4DK0A 2L35A 3JARB 3BFRA 1GTOA 1DF4A 3A0HZ 1SESA 3CCRV 1H2SB 1QLEC 3JD0A 2XAJA 5FPRA 5A9GA 2Q0AA 3CXCU 1M5IA 4H44B 3T1CA 2W6IG 1SA0A 2ZXWC 1BZKA 2EBOA 1SQVH 4DR1O 1K4CC 1N0JA 2PYLA 3JALB 5IY5C 3GVMA 2Y4TA 4YY3B 3WG7B 4UUJC 1O9HA 3APQA 1U96A 2ZDIA 4GKKO 4DV5B 3STLC 1Y76B 2F93B 2DN9A 2QM7A 5J2UB 1MOFA 5CA1A 3I56V 2EINC 2XNDG 3DTUB 2JRIA 2XOKG 4U7NA 3TCUA 1XHZA 2NNUA 2FMLA 4J41A 1K8AW 3SPGA 2A06H 4IT5A 2VS0A 4I7ZB 5KA5A 3H1LH 4J7KA 4O2BB 1MZEA 5EBMC 2DE0X 2ZR3A 1NH2B 3VQYA 4HNAA 1YTFB 2QWOB 4J42A 2Y48A 3ABLB 3G71V 4NXMO 2C2AA 1EBOA 3A0RA 3CB2A 5CBGA 1FPOA 5IDJA 1V9PA 3WB1A 1OV9A 3OMAB 1Q7YW 4OXSA 2UU9B 1D5NA 4U3JA 3FB5C 3AG1B 1XREA 3AG4C 2ZE8A 3CC4V 3LSQA 2HKOA 2OTJV 2N74A 1I94B 1K34A 1N36B 5LOVA 3SR2C 4MVUA 4H37A 4B7EA 2WLMA 4DV2O 4ZI7A 4JYYA 1SA0B 1KKDA 1GN2A 1VQNV 3TETA 3K08A 3IGAC 4QJFB 1B04A 1BSMA 3JD2A 4XDLA 4TUYB 3W7SA 2X0LA 2ILMA 3T1YO 2FL4A 2BSKB 4JYAB 3CCVV 1CP9A 2OT5A 1SQGA 1NU1H 4H33A 2M6YA 5H5NA 1F4NA 2L6LA 2AHZA 3BHPA 1B06A 2JGDA 2ODMA 4JTAB 2UU9O 5LGTA 3GWOA 3CCQV 1QHTA 4B3SB 4TV9A 1AI6A 2YUAA 1XILA 3CSXA 5EC2C 2EULA 1VP7A 2F4VO 5HFMA 5LMUO 2HG5C 2EIJC 4IGGA 4MS2A 3U11A 1OJHA 3ABKC 2JGUA 2WLLA 3ZBHA 3QG5A 1SQFA 1BL8A 4EFBA 3CCSV 1M93A 3I55V 2QE7G 3QTCA 3JATA 2V1DA 3KKYA 3STZC 1K92A 5LL6Y 4C7UA 2AW9A 2F23A 5E79Z 4DO2A 1FS0G 5KMGA 4ZKIA 1WA8B 4P2ZA 2RMKB 5LOVB 4QGPA 1NZ6A 5JVDA 3W7WA 1AJNA 1N33O 1W59A 5JJNB 2ZE5A 3UT5A 5KUMA 2DMXA 5L3FA 1BQ0A 4DXWA 4U3FH 1Y74B 2GUZA 4X89A 3DGEA 3MDSA 4W4KA 2UUAO 1PNMA 3FFQA 2VQEB 3WG7C 1V55B 3TJTA 4CH6A 2DJVA 5JJJB 4LF7O 1URFA 2YIBA 5B1BB 3TXSA 1N8RW 4I50A 3G4SV 3SPIA 2XAQA 3LDEA 3HPLC 2QA4V 1M90W 1GK9A 4A5UB 3FB7C 5J2TB 5AG2A 4WBNA 4Q20A 1MZFA 1DLBA 3ZRSA 1KD1W 3SYCA 4TV9B 3FB8C 4LFCB 2WLJA 1N32O 1B3QA 1K33A 3ETQA 4FLZA 1IBKO 4JAUA 3HKEA 2P4VA 2WLLB 5LXTA 1UJWB 4I9WA 3IFXA 2PI4A 3FAVB 4UCRA 3ABLC 3BA9A 1Y6XA 2A79B 3RWRD 3JD4A 2HHHO 3JATB 2EX3A 1KU9A 3EHBB 4NXNB 1Q90D 3CRRA 3CJHB 1AILA 1FKAO 3EFFK 4JI4B 4IIJA 4LCUC 1TUBA 1VQ4V 2ZIOA 3CMEV 3AG1C 2UUBB 2ZINA 4AILC 4MVSA 5FNVB 2ZD9A 2ARHA 3Q4HA 3OM3B 2RNBA 3RYCA 2IBZH 2BCCH 5KAIZ 2JJ2G 2R72A 2E76B 1MSDA 1AI7A 2EIMB 3UT5B 3OT7A 1X4TA 2ITDC 2B5UA 2ZM6O 4DR2B 4LBEC 1VQMV 1LUVA 2EJ7A 4YHHB 1HR0O 4WFFA 4KHPO 1E1QG 1G4YB 3W7TA 4P9PA 3K3WA 1LR1A 1HNWB 4LH7A 1XUQA 5EZYB 2LGQA 5B1NA 2ZDIC 2Q7EA 2X6AA 4JTDB 1Y67A 1QLEB 2ZT9B 3QO8A 1N34B 1R6KA 2W6JG 2MK3A 4DRXA 3J81N 2XAFA 4I55B 2ZXWB 4JI8B 5CA3A 3PN1A 2GBOA 2LFRA 5IY5B 4GX5A 4CH3A 1NI8A 4I0XB 4FPPA 4JI4O 1PL4A 1QLNA 4DV0B 4X65B 1XNQO 5LXTB 5CA0A 3VOUA 3D36A 3K5MA 1MA1A 3G67A 2Q5ZA 2HP8A 3L70H 2QKSA 4MVRA 3EXAA 4AQYB 4YIPA 4DR4O 1JQ0A 5B3SB 1K7DA 2PZSA 2OIEA 3OMNB 3LDCA 3ZS8C 4LF6O 1N4CA 2PTMA 4TSFG 2QKAA 3G6EV 1AR4A 4KP4A 1HNWO 1XHXA 3I5DA 4O4IA 1SKVA 1MABG 1PL0A 1BQZA 3CS5A 2UUCO 3CE2A 1V54B 3OFNG 3AK3A 2LW7A 4GZRB 3JASA 4GCZA 1GO3F 1ZUQA 3FB6C 1VQ6V 4JI8O 2BE3A 2QGNA 2VWKA 3LDDA 3N2GA 3CX5F 2XHBA 4JAVA 1DTOA 3SJAC 1K5QA 3JAWA 3T2MA 2UXBB 1EN6A 2UXXA 5H6QA 3RYHA 4KL1A 1KECA 5LYJA 1F23A 3JD3A 2KKWA 1P84F 1W0KG 4X9QA 3H1HH 5JCOC 5L3EA 4DV0O 5CN0A 3IJ4A 2N05A 4DUZB 2Q0OC 4G27B 4KXRA 1V55C 4XDJA 4LH6A 2K9PA 5BMVB 3CPWU 4P9OA 5B1BC 2E5LO 4K8ZA 4JI0B 2E3CA 2Y0PA 2HR3A 3K03A 3OAAG 1SC5B 4FIPC 1NT2B 2X7RB 2P7TC 2Q8VA 3K5NA 2P67A 3ZHVA 2IJIA 1AP6A 4O2AA 4BIUA 2F1MA 3ASOB 4U7OA 4YJ2A 1KC8W 1ZL8B 3H1KH 1XEQA 1KQSU 3DXRA 2QTSA 4CH5A 3CD6V 2UXBO 2WLIB 2JEXA 5EK0A 4YJ3A 4DR1B 1VQ9V 2YIAA 4GKKB 2P6JA 4JASA 3ABKB 2IU0A 4FLUA 3ZRXA 4HAMA 2CH7A 4TQDA 1JX9A 3UCSC 1HWYA 1HP8A 3L73H 3N2GB 4H13B 1TA8A 2FKXA 3BY6A 4I4TB 3FD9A 4JYBA 2EIMC 4UFZA 1A32A 1F4MA 3HKDA 2R9IA 3DC6A 3U10A 4Z1MG 5LYJB 1NVPD 1ZTEA 5EIBC 2CTRA 4JI3O 1OCRB 4RQEA 1WLEA 2PUSA 2P90A 4NVPA 4BWAA 5EYPB 3ZHRA 3E8BA 4QPKA 1Q8IA 3IAYA 3F5WC 1I7FA 3HKCB 2ZNIA 3D3QA 4PA6A 1H2MA 5EBLC 4NXMB 4PA3A 3CEIA 3KG2A 2A9HA 3QO5A 1XMOB 3LNMB 5LBQA 2PI5A 4LWSB 1FXVA 5H9CA 2LP7A 4B3MB 4DR7O 4J7JA 1WPBA 1JJ2U 1IBLO 3M7MX 5KHHA 3TGUH 4FLYA 1H2LA 2HEPA 3CC7V 1EZVH 3OEEG 3K57A 4DV4O 1VMGA 3CRMA 5KUKA 5CB4B 3D3IA 1YZBA 4F6RA 4G2KA 4NR1A 3CCMV 1SETA 5DEDA 1GM7A 2QR4A 4RO2A 1Y4MA 3PJSK 4FLWA 2BTQA 4WFGA 4F4LA 1I5XA 4ZOLB 5B1AB 2Z5UA 4DV2B 5IJ9A 3HR0A 4YJ3B 3RYFA 4B3TB 5B5EZ 3E2EA 5B3SC 3P3PA 3T1YB 4DK1A 4CS4A 4X1IB 1S5HC 2KG7A 1OHHG 4D7SA 3ABTA 2ADQB 3ZHQA 1BS3A 4FLVA 4UCTA 1H2NA 1SZTA 1K73W 4X1YA 2HLDG 3E35A 1V54C 1XMOO 3SPJA 1P7BA 4FVMA 5GONA 1FYJA 3JCUZ 5JWPA 3BABA 3KZIZ 5CBFA 1COWG 1KMIZ 3FKSG 2R9RB 2XT9A 3OTOO 3SYAA 4B3MO 1P4RA 3ZRVA 4MTOA 1KP2A 2A7WA 3OGIB 3X2QB 4LR3A 3BA8A 3K9AA 4ASUG 1S5JA 2CTWA 2IH1C 1NR7A 2GV9A 2LJ2A 5LMUB 2F4VB 1WB8A 4TOIA 1EFRG 2WLHA 2UXDB 5DECA 4O4JA 4MSWC 2ZR2A 3A8TA 1ENVA 3ZMUA 2V4DA 4LP8A 1Q6UA 4FJCC 4DW0A 2ETNA 3N27A 4B3TO 2EIKB 1YCIA 1KB9F 4CC6A 2FB5A 3K59A 4JI5O 4X1KA 2MW2B 1JPXA 2WA4A 4UCOA 3NXSA 2UXNA 1TAEA 4IL6Z 3KCXA 2M7WA 2HFEC 1JR9A 5CA1B 3T1HO 3CCUV 3ASOC 2RN9A 3D36C 1N33B 2Q67A 3B4SA 1XNRO 4DR5O 1S3JA 3WU2Z 4GLXA 4DV3O 2CE4A 2ZQMA 4D6TH 5IWAO 4JI1O 2ZKOA 2QDOA 3CCJV 1DGSA 1P7GA 1I5YA 2KG7B 1QNMA 4RWUA 2WSSG 3AK2A 2UUAB 4HNAB 4MVZA 5C8YA 2UXDO 2GSMB 4LF7B 4OGQB 5GONB 1AR5A 4HZ3A 2CUGA 4JI2O 4DV7O 5CBHA 1JVMA 1NS1A 1S0VA 1BMFG 3CC2V 1WP8A 4IHJA 4DR6B 1FXKA 5LGUA 1YDXA 1PM9A 4AHCA 4U3JB 2YC0A 1VQPV 3H1IH 4N21A 4TT3G 2ADPA 1N32B 4WFHA 4GT1A 2QJ1A 1IBKB 1LUWA 1OCRC 5LHGA 5DN6G 3R66A 1JFFA 2WLNA 3A2FA 3B2EE 2DYSB 4ZBMA 2AZ0A 2XAGA 3NR7A 5JH7A 3ZRWA 4ZI7B 2HHHB 1LNQA 4NTWA 4MTXA 4CH4A 1XBLA 3AG2B 2BOBC 1FJGB 3CWBH 4UCVA 4PA7A 2YEVA 1AROP 4DV6O 1IURA 3A0BZ 3H9VA 1QVFU 2E74B 1MSWD 3IC7A 1OZ0A 1NTZH 1GH6A 1NJIW 1J5EO 1M4UA 2B1GA 3D8CA 3KCYA 5JQGA 2AGAA 4G28B 4X64O 4LNUA 1SQPH 2JGDB 3T4ZA 3VBBA 1VF6A 4DR6O 2ZM6B 2YXHA 1VQLV 2CDYA 1JJOA 3OEHG 5B1AC 1VQOV 3ASNB 4YXWG 2F95B 5LMNO 1HR0B 4KHPB 1IVSA 3SYQA 4O4LA 1W2BU 4EFEA 3AEIA 2WA3A 1L0LH 3ETEA 5LA6A 3HKBA 1Q81W 3RVZA 3GWKC 5LP6A 1KUQA 4RUEA 1K97A 5L3GA 3CRQA 2XUMA 3GB7C 3DSQA 4EB6A 4X66O 1IBMB 2CK3G 4LF8O 4HBNA 2DYRB 1G6UA 1K5SA 1J95A 5LGNA 3OD4A 4B3RO 2DOSA 3SJBC 1VQ7V 2YXYA 1FJGO 4FFBA 5D5PA 2Q69A 3OR7C 3OTFA 4WFEA 1U97A 5IJ0A 5EBWC 3B09A 3FYIB 1UFIA 4Q6GA 3FYEB 1RSOA 4MVOA 3X2QC 4RAIA 5BXZA 5KMGB 4J10A 1XNQB 3RN4A 5JVDB 1VARA 2Q68A 5JH7B 4KFMA 4DUYO 4JPRA 1PD3A 1NKDA 1M56B 1DK1A 1X59A 4J9ZB 3AG7A 4LF5B 4DR4B 2QM8A 1Z5VA 2GUZB 2OWOA 1VF5B 1RM1B 5FL7G 4WFAV 4LF6B 2YDEA 3QF7A 3OUFA 4DR3O 2Q4PA 2EIKC 3M8AA 5C93A 3MD0A 2HJDA 3QO7A 4CS2A 1T5EA 3EVKA 2UUCB 4NTXA 3CMAV 1N0NA 4I50B 1IBMO 1RP3B 1O9GA 2QWQB 4LNUB 1NR1A 3C3SA 3N2KA 5JJEB 1S77D 2QSAA 4N23A 1IXMA 4WBNB 1HNXB 4XBFA 4K0KO 1E79G 1BHAA 4O4LB 3O9OA 5KLVH 1GN3A 1MNGA 2VQFO 1KYOF 3MHHC 5LP6B 5DM6V 3HKEB 3RT3C 1L0NH 3SGIA 4XDKA 4EB6B 5KAFZ 2EILB 5IYBO 4GX0A 1BE3H 4JI7B 2Z0AA 3RYIA 2E5LB 1OCZC 2ZE7A 3ZHSA 2YIDA 4LF5O 3H1JH 1RPRA 4PDVA 1ZX3A 4L87A 3ZEDA 4MVQA 2QTOA 4JV5B 2OIGA 4PV1B 3CP1A 4IIJB 4DW1A 1TUBB 1JMKC 2RDCA 2H94A 2JS3A 4R8CA 4B7KA 4CBCA 3T4DA 1FFTB 2QM4A 2EJRA 1W0JG 3B8MA 3Q4HB 4I9QA 4JI6O 3RYCB 4E2LA 3ZMTA 3SPCA 3JCZA 2RQ6A 1F7YA 1FFXA 1M1KW 3E22A 4X20A 4PDRA 2DYSC 1HNXO 2YS8A 3J80N 2P22C 3ZHUA 2QWPB 2PY5A 3ETDA 1I08A 2WPDG 3AG2C 4FFKA 4ZHQA 1Y66A 4MW3A 3JAMN 5B66Z 1JOYA 3UM7A 2EZPA 4KUMA 3WFVA 4PD4F 4DRXB 2D3OW 4JI7O 2X6CA 1R3KC 1QQCA 4NB5A 1TVKA 4JV5O 2JIZG 2FTKA 4JI3B 1S76D 3ASNC 5IYZA 3IC9A 1BHBA 4LF9O 1JA8A 4W4LA 2NN4A 1E1RG 2DQ3A 4ZIBA 5GW7A 2IJKA 3FX7A 5F2VO 5CA0B 4TQFA 1SERA 3E83A 1WP7A 2PGGA 3K5LA 2ITCC 1SZXA 3JALA 1NH2D 1YTFD 2A3QA 2DYRC 1PNLA 4LFBO 4DR7B 4X88A 1DF5A 2OTLV 1Y76A 2V7QG 2LFSA 1KKCA 1IBLB 2IM9A 4O4IB 2OYQA 3JYCA 1YIJV 2BTOA 4DV4B 5J2UA 1GN6A 1RFYA 3AK1A 3JASB 3TXQA 4ABMA 1FFXB 1I0HA 4JTCB 4PA9A 1S5LZ 2QKCA 1ROPA 2KQXA 1ZAUA 2CGOA 4QPJA 3JAWB 2JK5C 1M56C 2LW1A 2JS5A 3RYHB 4NTYA 1US6A 4O2BA 4ZHQB 4NYKA 4LFAO 1EM1A 1M57B 1RM1C 1P49A 1VEWA 2YXLA 4PDLA 3OW2U 2GHYA 1WAZA 1PPJH 1GM8A 3OGCC 2QEXV 2X6BA 1Z2GA 5IT9N 1AB3A 3VQXA 4J9YB 4OX9O 1OCCB 1PP9H 1TVKB 1VF6C 3OTOB 1SQBH 4PDMA 2ZIMA 3G80A 3RBZA 2R9AA 5IYZB 1R6NA 2CGNA 5K1XA 4LC1A 4O2AB 4O4HA 1XMQB 2IH3C 2B1IA 1CEZA 1QR8A 3SJQC 4JYCA 1F51A 4YJ2B 5LP6C 3F5TA 4ICGA 5LHHA 2Q73A 3DXRB 1HW7A 1YJWV 2EILC 4TUYA 3UO2A 3ZMVA 3O65A 2IU3A 2R70A 2BSKA 1NBMG 4DV1O 4R6ZA 2D2CB 1MMMA 2JEUA 1WPXA 4L8JA 1HNZB 1BGYH 4JI5B 3CRCA 2CH7B 1R6TA 3UKMA 2UXCO 4BW5A 1YVWA 1R1BA 4EKWA 1FAFA 1K9MW 5HFLA 2XAHA 3T1HB 1SS3A 2Y4UA 5FLXN 1XNRB 2CTPA 5KHJA 4DR5B 4K35A 3HKDB 1L1FA 2N04A 4DV3B 5IWAB 4JI1B 1XMQO 3W7XA 5LHIA 3ABMB 3E8HA 3SYOA 4UCSA 4CS3A 3F7YC 2HVKC 1Q82W 5H6RA 2DWDC 4JI2B 4DV7B 4UXNA 1FXHA 3CXHF 4YY3O 4JGSA 3LSSA 1EN4A 1QR9A 4DV5O 1M9NA 1IDSA 5KHIA 3L75H 1AP5A 1VQ8V 1G8MA 4O4HB 1HNZO 1WA8A 3BVOA 2VWJA 3RW0A 1NVPB 4JZGA 3LNNA 4F6RB 4QE7A 3OR6C 2O57A 4TV8A 3BRCA 1CXZB 4OPHA 3CCEV 4FM2A 3K58A 2OCCB 1WB7A 2XTAA 2BTQB 2E75B 2F66C 1AJQA 1Y74A 4PA4A 5IJ9B 5JCOA 3JSLA 3RYFB 5EC1C 3ZX6A 4DV6B 2AZ2A 4X62B 3B77A 2Q7HA 4X1YB 5CMUA 4FMTA 5J2TA 1VF7A 4IYHA 1OCOB 1J5EB 2CAZC 1OCZB 1K3EA 5J9PC 3CHXA 4X64B 1R3LC 2YI8A 4PI2A 4UB8Z 3K0GA 4GX1A 1B6QA 3AG3B 2ATKC 3K79A 2DQ0A 2Y69C 3THOA 1I94O 1QCEA 2LGWA 5LMNB 3E86A 1ZWIC 2GTSA 1N36O 1YSCA 5BY1A 5EIBD 1XDCA 3P3NA 2NR5A 3FAVA 1L8DA 2LQTA 1M57C 1AR1B 3ZN0A 4O4JB 2YICA 5E1AC 3HB3B 3SPHA 4X66B 4JAAA 3E8FA 4LF8B 3ZMZA 5D5QA 1YI2V 2YSUB 3CJHA 3H01A 2IJHA 4B3RB 2YIBD 1Z5WA 3C3TA 5BR8B 1R3JC 4JYAO 2LO1A 1VQ5V 1OCCC 2Q7GA 3ZN1A 5GTHZ 1GM9A 4CZZA 4X1KB 2Z3YA 2IJJA 4X62O 5FNVA 1NTMH 2JVDA 1SRYA 4MTFA 4TV8B 3SJCC 3ZHTA 4RUFA 3VQVA 2K1EA 2DWEC 1PV0A 3CCLV 4DUYB 4B3SO 3MAQA 4JZ2A 4PELA 4D7TA 4GYCB 1GN4A 1YJ9V 3ZIAG 3ZJZA 5BZBA 1GMGA 4UV9A 1AVMA 1SQQH 4JF3A 3LSUA 5EZYA 4CC5A 2NLJC 2B9ZA 2WWWA 1YXBA 4DR3B 4UVBA 1XI1A 4RQFA 1IZ3A 1BCCH 3ETGA 5C8YB 4I55A 1H38A 1SQXH 3WB0A 1R73A 2PYJA 3E89A 4IHJB 4I0XA 1ZSPA 1ZLZA 1FXKB 4UVCA 1CPYA 3JSNA 5BR8O 1XQ8A 4GX2A 3K04A 4K0KB 1YJNV 1Q3EA 4TWKA 5GTIZ 2W0XA 2VQFB 4FM1A 1KP3A 5ITZA 3OMIB 5IYDO 3U0ZA 1GKFA 1JFFB 3CYOA 1WN7A 3ABMC 4UCUA 2WAMA 2WLKA 3ZRWB 5TISZ 2PF4E 3ABUA 1XL6A 2KB1A 4DYLA 3VQWA 2IW5A 3R65A 1QU7A 2VQEO 4WFBV 4K8XA 4GKJB 1Q43A 1D5AA 2YEVB 1PKXA 4UV8A 3ML0A 3JAKA 3P30A 2GDSA 3DC5A 5L3CA 4I5SA 2QWNB 1TUEB 2P06A 4FZ1A 1VQKV 5JQGB 4JI6B 1EN5A 3B40A 4QE9A 4WCEV 2OCCC 4LFCO 4BIZA 5KHKA 1H8HG 2ZNJA 1YEWA 3LUTB 1UPGA 3K0DA 1TGOA 1EZJA 1AJPA 2H3OA 2EZOA 1NTKH 1WJZA 4UB6Z 4UVAA 1GAXA 1H8EG 5LA6B 1S72V 3HKBB 1WNSA 4J80A 1JCHA 3TK1A 5BMVA 2OCHA 3RGBA 1XOUA 4NXNO 2ZCEA 3APOA 1PNKA 2P4KA 1OCOC 2RCVA 4YIOA 4NKGB 5KX5A 3BEHA 4GKJO 4FFBB 2Y0IA 3QVNA 4R50A 1YITV 3M99B 4P30A 3K5OA 5IJ0B 2UUBO 3AG3C 1D2DA 2EINB 2H8PC 3SYPA 4J7ZA 4MT8A 1RSOB 5ITZB 4LF9B 4HYOA 1ZL8A 1AI5A 4BIOA 4DR2O 3OE7G 3F7VC 4MVMA 2QWRB 2FYUH 3S3XA 2WLIA 4YHHO 1XL4A 1GRJA 2DW4A 3MHSC 1HDJA 3RFRA 2HVJC 2GTAA 4FZ0A 4LFBB 3BCCH 3L72H 4MW8A 3L74H 3ICXA 3JAKB 1N34O 4FLTA 4FLXA 2CTQA 4WF9V 1Q6IA 2JDIG 1RPOA 1AI4A 1IXBA 2ZE6A 4I4TA 1G1XB 1Q6HA 2AHYA 3ZMSA 3QNEA 3S3WA 2W0FC 3N2KB
chains in the Genus database with same CATH topology
3RT3C 1KUQA 3F5TA 4B3SO 2UUCO 4LFCO 2UXDO 3J7AU 4X66O 2Z0AA 4JI2O 4DV7O 4LF8O 2LW7A 1XMOO 1NS1A 1FYJA 3O65A 2N74A 4X65O 5A2QN 4LF5O 4B3RO 2FKXA 2DOSA 4JI8O 4LFBO 1N33O 4DV1O 3OTOO 1FJGO 4B3MO 1A32A 2ZM6O 4DV2O 4AQYO 4JI3O 1HR0O 4NXNO 4KHPO 1R6TA 4DR1O 2UXCO 5BXZA 3T1YO 1R1BA 2UUAO 3R66A 4JI6O 4DV0O 4GKKO 1F7YA 4DUYO 5FLXN 4GKJO 2DJVA 5BR8O 1HNXO 4LF7O 1DK1A 5H5NA 1X59A 2UUBO 2E5LO 3J81N 1I94O 1D2DA 4A5UB 3J80N 1XMQO 4B3TO 1N36O 4DR7O 4OPAA 4LFAO 5BY1A 2UU9O 4DR3O 2JRIA 4DV6O 3M8AA 1IBLO 3JAMN 4DR2O 3SDLA 4JI5O 4LF4O 4DV4O 4JI4O 1N32O 4YHHO 1IBKO 1YZBA 1IBMO 1J5EO 5IT9N 4JI7O 1AB3A 2F4VO 5LMUO 4YY3O 1XNQO 2AGAA 3T1HO 4X64O 2VQEO 4DUZO 4DV5O 4OX9O 4NXMO 4JYAO 1XNRO 1XEQA 4DR6O 4DR5O 1N34O 4JV5O 4X62O 2HHHO 4K0KO 1HNZO 2UXBO 4DR4O 4DV3O 4JI0O 5IWAO 5LMNO 4JI1O 2ZKOA 4LF9O 1G1XB 2VQFO 5LL6Y 4LF6O 4OPHA 1AILA 1FKAO 1HNWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 C;  1KUQ A;  3F5T A;  4B3S O;  2UUC O;  4LFC O;  2UXD O;  3J7A U;  4X66 O;  2Z0A A;  4JI2 O;  4DV7 O;  4LF8 O;  2LW7 A;  1XMO O;  1NS1 A;  1FYJ A;  3O65 A;  2N74 A;  4X65 O;  5A2Q N;  4LF5 O;  4B3R O;  2FKX A;  2DOS A;  4JI8 O;  4LFB O;  1N33 O;  4DV1 O;  3OTO O;  1FJG O;  4B3M O;  1A32 A;  2ZM6 O;  4DV2 O;  4AQY O;  4JI3 O;  1HR0 O;  4NXN O;  4KHP O;  1R6T A;  4DR1 O;  2UXC O;  5BXZ A;  3T1Y O;  1R1B A;  2UUA O;  3R66 A;  4JI6 O;  4DV0 O;  4GKK O;  1F7Y A;  4DUY O;  5FLX N;  4GKJ O;  2DJV A;  5BR8 O;  1HNX O;  4LF7 O;  1DK1 A;  5H5N A;  1X59 A;  2UUB O;  2E5L O;  3J81 N;  1I94 O;  1D2D A;  4A5U B;  3J80 N;  1XMQ O;  4B3T O;  1N36 O;  4DR7 O;  4OPA A;  4LFA O;  5BY1 A;  2UU9 O;  4DR3 O;  2JRI A;  4DV6 O;  3M8A A;  1IBL O;  3JAM N;  4DR2 O;  3SDL A;  4JI5 O;  4LF4 O;  4DV4 O;  4JI4 O;  1N32 O;  4YHH O;  1IBK O;  1YZB A;  1IBM O;  1J5E O;  5IT9 N;  4JI7 O;  1AB3 A;  2F4V O;  5LMU O;  4YY3 O;  1XNQ O;  2AGA A;  3T1H O;  4X64 O;  2VQE O;  4DUZ O;  4DV5 O;  4OX9 O;  4NXM O;  4JYA O;  1XNR O;  1XEQ A;  4DR6 O;  4DR5 O;  1N34 O;  4JV5 O;  4X62 O;  2HHH O;  4K0K O;  1HNZ O;  2UXB O;  4DR4 O;  4DV3 O;  4JI0 O;  5IWA O;  5LMN O;  4JI1 O;  2ZKO A;  4LF9 O;  1G1X B;  2VQF O;  5LL6 Y;  4LF6 O;  4OPH A;  1AIL A;  1FKA O;  1HNW O; 
#chains in the Genus database with same CATH topology
 4LF4 B;  2HJF C;  3AG4 B;  4FK5 C;  5IYC O;  1NQT A;  5EYP A;  5L3D A;  4X65 O;  3JAR A;  5A2Q N;  2JJ1 G;  1BT8 A;  1H2G A;  3HKC A;  3G6B A;  3P32 A;  4LFA B;  5L3B A;  4MTG A;  2G38 A;  4X8A A;  2F43 G;  3WB2 A;  4AQY O;  2Q9L A;  4LWS A;  4H0L B;  4J11 A;  4BW9 A;  5B1O A;  3ZCC A;  1K4D C;  4QNH B;  3RYI B;  2Q6A A;  3L71 H;  2RJZ A;  5KX5 B;  3L9D A;  5IE9 A;  1THZ A;  4QIW F;  4F6E A;  3UQ8 A;  4E4E A;  4Z2W A;  4OX9 B;  3BAA A;  1IX9 A;  1Q86 W;  4GUN A;  4PJ0 Z;  1SF9 A;  1FXK C;  4Z1V A;  4B08 A;  5CB4 A;  4PHZ A;  4IYI A;  5H2F Z;  5K1P A;  3OUS A;  2AXT Z;  4OPA A;  3W7U A;  4AI8 A;  4BAY A;  4ZOL A;  3SDL A;  4EEQ A;  4LF4 O;  1QVG U;  3E8G A;  3JD1 A;  3E22 B;  2BOC C;  4X20 B;  4K3A A;  1H2K A;  5FPO A;  2EIJ B;  2Y69 B;  4X1I A;  2P5O A;  3K9S A;  1MG1 A;  4PI0 A;  4FM0 A;  1FD9 A;  1VIB A;  3CRA A;  4DUZ O;  1QBZ A;  4DV1 B;  4R7C A;  1KBH A;  1Q5O A;  3K06 A;  3C90 A;  4JI0 O;  5KHG A;  2YI9 A;  5KA6 A;  3UO3 A;  3BPZ A;  2UXC B;  1ORQ C;  1R3I C;  2A0L A;  2VRZ A;  4BR6 A;  1YHQ V;  3B8N A;  1YF2 A;  2XAS A;  3J7A U;  2KSD A;  3RVY A;  4DK0 A;  2L35 A;  3JAR B;  3BFR A;  1GTO A;  1DF4 A;  3A0H Z;  1SES A;  3CCR V;  1H2S B;  1QLE C;  3JD0 A;  2XAJ A;  5FPR A;  5A9G A;  2Q0A A;  3CXC U;  1M5I A;  4H44 B;  3T1C A;  2W6I G;  1SA0 A;  2ZXW C;  1BZK A;  2EBO A;  1SQV H;  4DR1 O;  1K4C C;  1N0J A;  2PYL A;  3JAL B;  5IY5 C;  3GVM A;  2Y4T A;  4YY3 B;  3WG7 B;  4UUJ C;  1O9H A;  3APQ A;  1U96 A;  2ZDI A;  4GKK O;  4DV5 B;  3STL C;  1Y76 B;  2F93 B;  2DN9 A;  2QM7 A;  5J2U B;  1MOF A;  5CA1 A;  3I56 V;  2EIN C;  2XND G;  3DTU B;  2JRI A;  2XOK G;  4U7N A;  3TCU A;  1XHZ A;  2NNU A;  2FML A;  4J41 A;  1K8A W;  3SPG A;  2A06 H;  4IT5 A;  2VS0 A;  4I7Z B;  5KA5 A;  3H1L H;  4J7K A;  4O2B B;  1MZE A;  5EBM C;  2DE0 X;  2ZR3 A;  1NH2 B;  3VQY A;  4HNA A;  1YTF B;  2QWO B;  4J42 A;  2Y48 A;  3ABL B;  3G71 V;  4NXM O;  2C2A A;  1EBO A;  3A0R A;  3CB2 A;  5CBG A;  1FPO A;  5IDJ A;  1V9P A;  3WB1 A;  1OV9 A;  3OMA B;  1Q7Y W;  4OXS A;  2UU9 B;  1D5N A;  4U3J A;  3FB5 C;  3AG1 B;  1XRE A;  3AG4 C;  2ZE8 A;  3CC4 V;  3LSQ A;  2HKO A;  2OTJ V;  2N74 A;  1I94 B;  1K34 A;  1N36 B;  5LOV A;  3SR2 C;  4MVU A;  4H37 A;  4B7E A;  2WLM A;  4DV2 O;  4ZI7 A;  4JYY A;  1SA0 B;  1KKD A;  1GN2 A;  1VQN V;  3TET A;  3K08 A;  3IGA C;  4QJF B;  1B04 A;  1BSM A;  3JD2 A;  4XDL A;  4TUY B;  3W7S A;  2X0L A;  2ILM A;  3T1Y O;  2FL4 A;  2BSK B;  4JYA B;  3CCV V;  1CP9 A;  2OT5 A;  1SQG A;  1NU1 H;  4H33 A;  2M6Y A;  5H5N A;  1F4N A;  2L6L A;  2AHZ A;  3BHP A;  1B06 A;  2JGD A;  2ODM A;  4JTA B;  2UU9 O;  5LGT A;  3GWO A;  3CCQ V;  1QHT A;  4B3S B;  4TV9 A;  1AI6 A;  2YUA A;  1XIL A;  3CSX A;  5EC2 C;  2EUL A;  1VP7 A;  2F4V O;  5HFM A;  5LMU O;  2HG5 C;  2EIJ C;  4IGG A;  4MS2 A;  3U11 A;  1OJH A;  3ABK C;  2JGU A;  2WLL A;  3ZBH A;  3QG5 A;  1SQF A;  1BL8 A;  4EFB A;  3CCS V;  1M93 A;  3I55 V;  2QE7 G;  3QTC A;  3JAT A;  2V1D A;  3KKY A;  3STZ C;  1K92 A;  5LL6 Y;  4C7U A;  2AW9 A;  2F23 A;  5E79 Z;  4DO2 A;  1FS0 G;  5KMG A;  4ZKI A;  1WA8 B;  4P2Z A;  2RMK B;  5LOV B;  4QGP A;  1NZ6 A;  5JVD A;  3W7W A;  1AJN A;  1N33 O;  1W59 A;  5JJN B;  2ZE5 A;  3UT5 A;  5KUM A;  2DMX A;  5L3F A;  1BQ0 A;  4DXW A;  4U3F H;  1Y74 B;  2GUZ A;  4X89 A;  3DGE A;  3MDS A;  4W4K A;  2UUA O;  1PNM A;  3FFQ A;  2VQE B;  3WG7 C;  1V55 B;  3TJT A;  4CH6 A;  2DJV A;  5JJJ B;  4LF7 O;  1URF A;  2YIB A;  5B1B B;  3TXS A;  1N8R W;  4I50 A;  3G4S V;  3SPI A;  2XAQ A;  3LDE A;  3HPL C;  2QA4 V;  1M90 W;  1GK9 A;  4A5U B;  3FB7 C;  5J2T B;  5AG2 A;  4WBN A;  4Q20 A;  1MZF A;  1DLB A;  3ZRS A;  1KD1 W;  3SYC A;  4TV9 B;  3FB8 C;  4LFC B;  2WLJ A;  1N32 O;  1B3Q A;  1K33 A;  3ETQ A;  4FLZ A;  1IBK O;  4JAU A;  3HKE A;  2P4V A;  2WLL B;  5LXT A;  1UJW B;  4I9W A;  3IFX A;  2PI4 A;  3FAV B;  4UCR A;  3ABL C;  3BA9 A;  1Y6X A;  2A79 B;  3RWR D;  3JD4 A;  2HHH O;  3JAT B;  2EX3 A;  1KU9 A;  3EHB B;  4NXN B;  1Q90 D;  3CRR A;  3CJH B;  1AIL A;  1FKA O;  3EFF K;  4JI4 B;  4IIJ A;  4LCU C;  1TUB A;  1VQ4 V;  2ZIO A;  3CME V;  3AG1 C;  2UUB B;  2ZIN A;  4AIL C;  4MVS A;  5FNV B;  2ZD9 A;  2ARH A;  3Q4H A;  3OM3 B;  2RNB A;  3RYC A;  2IBZ H;  2BCC H;  5KAI Z;  2JJ2 G;  2R72 A;  2E76 B;  1MSD A;  1AI7 A;  2EIM B;  3UT5 B;  3OT7 A;  1X4T A;  2ITD C;  2B5U A;  2ZM6 O;  4DR2 B;  4LBE C;  1VQM V;  1LUV A;  2EJ7 A;  4YHH B;  1HR0 O;  4WFF A;  4KHP O;  1E1Q G;  1G4Y B;  3W7T A;  4P9P A;  3K3W A;  1LR1 A;  1HNW B;  4LH7 A;  1XUQ A;  5EZY B;  2LGQ A;  5B1N A;  2ZDI C;  2Q7E A;  2X6A A;  4JTD B;  1Y67 A;  1QLE B;  2ZT9 B;  3QO8 A;  1N34 B;  1R6K A;  2W6J G;  2MK3 A;  4DRX A;  3J81 N;  2XAF A;  4I55 B;  2ZXW B;  4JI8 B;  5CA3 A;  3PN1 A;  2GBO A;  2LFR A;  5IY5 B;  4GX5 A;  4CH3 A;  1NI8 A;  4I0X B;  4FPP A;  4JI4 O;  1PL4 A;  1QLN A;  4DV0 B;  4X65 B;  1XNQ O;  5LXT B;  5CA0 A;  3VOU A;  3D36 A;  3K5M A;  1MA1 A;  3G67 A;  2Q5Z A;  2HP8 A;  3L70 H;  2QKS A;  4MVR A;  3EXA A;  4AQY B;  4YIP A;  4DR4 O;  1JQ0 A;  5B3S B;  1K7D A;  2PZS A;  2OIE A;  3OMN B;  3LDC A;  3ZS8 C;  4LF6 O;  1N4C A;  2PTM A;  4TSF G;  2QKA A;  3G6E V;  1AR4 A;  4KP4 A;  1HNW O;  1XHX A;  3I5D A;  4O4I A;  1SKV A;  1MAB G;  1PL0 A;  1BQZ A;  3CS5 A;  2UUC O;  3CE2 A;  1V54 B;  3OFN G;  3AK3 A;  2LW7 A;  4GZR B;  3JAS A;  4GCZ A;  1GO3 F;  1ZUQ A;  3FB6 C;  1VQ6 V;  4JI8 O;  2BE3 A;  2QGN A;  2VWK A;  3LDD A;  3N2G A;  3CX5 F;  2XHB A;  4JAV A;  1DTO A;  3SJA C;  1K5Q A;  3JAW A;  3T2M A;  2UXB B;  1EN6 A;  2UXX A;  5H6Q A;  3RYH A;  4KL1 A;  1KEC A;  5LYJ A;  1F23 A;  3JD3 A;  2KKW A;  1P84 F;  1W0K G;  4X9Q A;  3H1H H;  5JCO C;  5L3E A;  4DV0 O;  5CN0 A;  3IJ4 A;  2N05 A;  4DUZ B;  2Q0O C;  4G27 B;  4KXR A;  1V55 C;  4XDJ A;  4LH6 A;  2K9P A;  5BMV B;  3CPW U;  4P9O A;  5B1B C;  2E5L O;  4K8Z A;  4JI0 B;  2E3C A;  2Y0P A;  2HR3 A;  3K03 A;  3OAA G;  1SC5 B;  4FIP C;  1NT2 B;  2X7R B;  2P7T C;  2Q8V A;  3K5N A;  2P67 A;  3ZHV A;  2IJI A;  1AP6 A;  4O2A A;  4BIU A;  2F1M A;  3ASO B;  4U7O A;  4YJ2 A;  1KC8 W;  1ZL8 B;  3H1K H;  1XEQ A;  1KQS U;  3DXR A;  2QTS A;  4CH5 A;  3CD6 V;  2UXB O;  2WLI B;  2JEX A;  5EK0 A;  4YJ3 A;  4DR1 B;  1VQ9 V;  2YIA A;  4GKK B;  2P6J A;  4JAS A;  3ABK B;  2IU0 A;  4FLU A;  3ZRX A;  4HAM A;  2CH7 A;  4TQD A;  1JX9 A;  3UCS C;  1HWY A;  1HP8 A;  3L73 H;  3N2G B;  4H13 B;  1TA8 A;  2FKX A;  3BY6 A;  4I4T B;  3FD9 A;  4JYB A;  2EIM C;  4UFZ A;  1A32 A;  1F4M A;  3HKD A;  2R9I A;  3DC6 A;  3U10 A;  4Z1M G;  5LYJ B;  1NVP D;  1ZTE A;  5EIB C;  2CTR A;  4JI3 O;  1OCR B;  4RQE A;  1WLE A;  2PUS A;  2P90 A;  4NVP A;  4BWA A;  5EYP B;  3ZHR A;  3E8B A;  4QPK A;  1Q8I A;  3IAY A;  3F5W C;  1I7F A;  3HKC B;  2ZNI A;  3D3Q A;  4PA6 A;  1H2M A;  5EBL C;  4NXM B;  4PA3 A;  3CEI A;  3KG2 A;  2A9H A;  3QO5 A;  1XMO B;  3LNM B;  5LBQ A;  2PI5 A;  4LWS B;  1FXV A;  5H9C A;  2LP7 A;  4B3M B;  4DR7 O;  4J7J A;  1WPB A;  1JJ2 U;  1IBL O;  3M7M X;  5KHH A;  3TGU H;  4FLY A;  1H2L A;  2HEP A;  3CC7 V;  1EZV H;  3OEE G;  3K57 A;  4DV4 O;  1VMG A;  3CRM A;  5KUK A;  5CB4 B;  3D3I A;  1YZB A;  4F6R A;  4G2K A;  4NR1 A;  3CCM V;  1SET A;  5DED A;  1GM7 A;  2QR4 A;  4RO2 A;  1Y4M A;  3PJS K;  4FLW A;  2BTQ A;  4WFG A;  4F4L A;  1I5X A;  4ZOL B;  5B1A B;  2Z5U A;  4DV2 B;  5IJ9 A;  3HR0 A;  4YJ3 B;  3RYF A;  4B3T B;  5B5E Z;  3E2E A;  5B3S C;  3P3P A;  3T1Y B;  4DK1 A;  4CS4 A;  4X1I B;  1S5H C;  2KG7 A;  1OHH G;  4D7S A;  3ABT A;  2ADQ B;  3ZHQ A;  1BS3 A;  4FLV A;  4UCT A;  1H2N A;  1SZT A;  1K73 W;  4X1Y A;  2HLD G;  3E35 A;  1V54 C;  1XMO O;  3SPJ A;  1P7B A;  4FVM A;  5GON A;  1FYJ A;  3JCU Z;  5JWP A;  3BAB A;  3KZI Z;  5CBF A;  1COW G;  1KMI Z;  3FKS G;  2R9R B;  2XT9 A;  3OTO O;  3SYA A;  4B3M O;  1P4R A;  3ZRV A;  4MTO A;  1KP2 A;  2A7W A;  3OGI B;  3X2Q B;  4LR3 A;  3BA8 A;  3K9A A;  4ASU G;  1S5J A;  2CTW A;  2IH1 C;  1NR7 A;  2GV9 A;  2LJ2 A;  5LMU B;  2F4V B;  1WB8 A;  4TOI A;  1EFR G;  2WLH A;  2UXD B;  5DEC A;  4O4J A;  4MSW C;  2ZR2 A;  3A8T A;  1ENV A;  3ZMU A;  2V4D A;  4LP8 A;  1Q6U A;  4FJC C;  4DW0 A;  2ETN A;  3N27 A;  4B3T O;  2EIK B;  1YCI A;  1KB9 F;  4CC6 A;  2FB5 A;  3K59 A;  4JI5 O;  4X1K A;  2MW2 B;  1JPX A;  2WA4 A;  4UCO A;  3NXS A;  2UXN A;  1TAE A;  4IL6 Z;  3KCX A;  2M7W A;  2HFE C;  1JR9 A;  5CA1 B;  3T1H O;  3CCU V;  3ASO C;  2RN9 A;  3D36 C;  1N33 B;  2Q67 A;  3B4S A;  1XNR O;  4DR5 O;  1S3J A;  3WU2 Z;  4GLX A;  4DV3 O;  2CE4 A;  2ZQM A;  4D6T H;  5IWA O;  4JI1 O;  2ZKO A;  2QDO A;  3CCJ V;  1DGS A;  1P7G A;  1I5Y A;  2KG7 B;  1QNM A;  4RWU A;  2WSS G;  3AK2 A;  2UUA B;  4HNA B;  4MVZ A;  5C8Y A;  2UXD O;  2GSM B;  4LF7 B;  4OGQ B;  5GON B;  1AR5 A;  4HZ3 A;  2CUG A;  4JI2 O;  4DV7 O;  5CBH A;  1JVM A;  1NS1 A;  1S0V A;  1BMF G;  3CC2 V;  1WP8 A;  4IHJ A;  4DR6 B;  1FXK A;  5LGU A;  1YDX A;  1PM9 A;  4AHC A;  4U3J B;  2YC0 A;  1VQP V;  3H1I H;  4N21 A;  4TT3 G;  2ADP A;  1N32 B;  4WFH A;  4GT1 A;  2QJ1 A;  1IBK B;  1LUW A;  1OCR C;  5LHG A;  5DN6 G;  3R66 A;  1JFF A;  2WLN A;  3A2F A;  3B2E E;  2DYS B;  4ZBM A;  2AZ0 A;  2XAG A;  3NR7 A;  5JH7 A;  3ZRW A;  4ZI7 B;  2HHH B;  1LNQ A;  4NTW A;  4MTX A;  4CH4 A;  1XBL A;  3AG2 B;  2BOB C;  1FJG B;  3CWB H;  4UCV A;  4PA7 A;  2YEV A;  1ARO P;  4DV6 O;  1IUR A;  3A0B Z;  3H9V A;  1QVF U;  2E74 B;  1MSW D;  3IC7 A;  1OZ0 A;  1NTZ H;  1GH6 A;  1NJI W;  1J5E O;  1M4U A;  2B1G A;  3D8C A;  3KCY A;  5JQG A;  2AGA A;  4G28 B;  4X64 O;  4LNU A;  1SQP H;  2JGD B;  3T4Z A;  3VBB A;  1VF6 A;  4DR6 O;  2ZM6 B;  2YXH A;  1VQL V;  2CDY A;  1JJO A;  3OEH G;  5B1A C;  1VQO V;  3ASN B;  4YXW G;  2F95 B;  5LMN O;  1HR0 B;  4KHP B;  1IVS A;  3SYQ A;  4O4L A;  1W2B U;  4EFE A;  3AEI A;  2WA3 A;  1L0L H;  3ETE A;  5LA6 A;  3HKB A;  1Q81 W;  3RVZ A;  3GWK C;  5LP6 A;  1KUQ A;  4RUE A;  1K97 A;  5L3G A;  3CRQ A;  2XUM A;  3GB7 C;  3DSQ A;  4EB6 A;  4X66 O;  1IBM B;  2CK3 G;  4LF8 O;  4HBN A;  2DYR B;  1G6U A;  1K5S A;  1J95 A;  5LGN A;  3OD4 A;  4B3R O;  2DOS A;  3SJB C;  1VQ7 V;  2YXY A;  1FJG O;  4FFB A;  5D5P A;  2Q69 A;  3OR7 C;  3OTF A;  4WFE A;  1U97 A;  5IJ0 A;  5EBW C;  3B09 A;  3FYI B;  1UFI A;  4Q6G A;  3FYE B;  1RSO A;  4MVO A;  3X2Q C;  4RAI A;  5BXZ A;  5KMG B;  4J10 A;  1XNQ B;  3RN4 A;  5JVD B;  1VAR A;  2Q68 A;  5JH7 B;  4KFM A;  4DUY O;  4JPR A;  1PD3 A;  1NKD A;  1M56 B;  1DK1 A;  1X59 A;  4J9Z B;  3AG7 A;  4LF5 B;  4DR4 B;  2QM8 A;  1Z5V A;  2GUZ B;  2OWO A;  1VF5 B;  1RM1 B;  5FL7 G;  4WFA V;  4LF6 B;  2YDE A;  3QF7 A;  3OUF A;  4DR3 O;  2Q4P A;  2EIK C;  3M8A A;  5C93 A;  3MD0 A;  2HJD A;  3QO7 A;  4CS2 A;  1T5E A;  3EVK A;  2UUC B;  4NTX A;  3CMA V;  1N0N A;  4I50 B;  1IBM O;  1RP3 B;  1O9G A;  2QWQ B;  4LNU B;  1NR1 A;  3C3S A;  3N2K A;  5JJE B;  1S77 D;  2QSA A;  4N23 A;  1IXM A;  4WBN B;  1HNX B;  4XBF A;  4K0K O;  1E79 G;  1BHA A;  4O4L B;  3O9O A;  5KLV H;  1GN3 A;  1MNG A;  2VQF O;  1KYO F;  3MHH C;  5LP6 B;  5DM6 V;  3HKE B;  3RT3 C;  1L0N H;  3SGI A;  4XDK A;  4EB6 B;  5KAF Z;  2EIL B;  5IYB O;  4GX0 A;  1BE3 H;  4JI7 B;  2Z0A A;  3RYI A;  2E5L B;  1OCZ C;  2ZE7 A;  3ZHS A;  2YID A;  4LF5 O;  3H1J H;  1RPR A;  4PDV A;  1ZX3 A;  4L87 A;  3ZED A;  4MVQ A;  2QTO A;  4JV5 B;  2OIG A;  4PV1 B;  3CP1 A;  4IIJ B;  4DW1 A;  1TUB B;  1JMK C;  2RDC A;  2H94 A;  2JS3 A;  4R8C A;  4B7K A;  4CBC A;  3T4D A;  1FFT B;  2QM4 A;  2EJR A;  1W0J G;  3B8M A;  3Q4H B;  4I9Q A;  4JI6 O;  3RYC B;  4E2L A;  3ZMT A;  3SPC A;  3JCZ A;  2RQ6 A;  1F7Y A;  1FFX A;  1M1K W;  3E22 A;  4X20 A;  4PDR A;  2DYS C;  1HNX O;  2YS8 A;  3J80 N;  2P22 C;  3ZHU A;  2QWP B;  2PY5 A;  3ETD A;  1I08 A;  2WPD G;  3AG2 C;  4FFK A;  4ZHQ A;  1Y66 A;  4MW3 A;  3JAM N;  5B66 Z;  1JOY A;  3UM7 A;  2EZP A;  4KUM A;  3WFV A;  4PD4 F;  4DRX B;  2D3O W;  4JI7 O;  2X6C A;  1R3K C;  1QQC A;  4NB5 A;  1TVK A;  4JV5 O;  2JIZ G;  2FTK A;  4JI3 B;  1S76 D;  3ASN C;  5IYZ A;  3IC9 A;  1BHB A;  4LF9 O;  1JA8 A;  4W4L A;  2NN4 A;  1E1R G;  2DQ3 A;  4ZIB A;  5GW7 A;  2IJK A;  3FX7 A;  5F2V O;  5CA0 B;  4TQF A;  1SER A;  3E83 A;  1WP7 A;  2PGG A;  3K5L A;  2ITC C;  1SZX A;  3JAL A;  1NH2 D;  1YTF D;  2A3Q A;  2DYR C;  1PNL A;  4LFB O;  4DR7 B;  4X88 A;  1DF5 A;  2OTL V;  1Y76 A;  2V7Q G;  2LFS A;  1KKC A;  1IBL B;  2IM9 A;  4O4I B;  2OYQ A;  3JYC A;  1YIJ V;  2BTO A;  4DV4 B;  5J2U A;  1GN6 A;  1RFY A;  3AK1 A;  3JAS B;  3TXQ A;  4ABM A;  1FFX B;  1I0H A;  4JTC B;  4PA9 A;  1S5L Z;  2QKC A;  1ROP A;  2KQX A;  1ZAU A;  2CGO A;  4QPJ A;  3JAW B;  2JK5 C;  1M56 C;  2LW1 A;  2JS5 A;  3RYH B;  4NTY A;  1US6 A;  4O2B A;  4ZHQ B;  4NYK A;  4LFA O;  1EM1 A;  1M57 B;  1RM1 C;  1P49 A;  1VEW A;  2YXL A;  4PDL A;  3OW2 U;  2GHY A;  1WAZ A;  1PPJ H;  1GM8 A;  3OGC C;  2QEX V;  2X6B A;  1Z2G A;  5IT9 N;  1AB3 A;  3VQX A;  4J9Y B;  4OX9 O;  1OCC B;  1PP9 H;  1TVK B;  1VF6 C;  3OTO B;  1SQB H;  4PDM A;  2ZIM A;  3G80 A;  3RBZ A;  2R9A A;  5IYZ B;  1R6N A;  2CGN A;  5K1X A;  4LC1 A;  4O2A B;  4O4H A;  1XMQ B;  2IH3 C;  2B1I A;  1CEZ A;  1QR8 A;  3SJQ C;  4JYC A;  1F51 A;  4YJ2 B;  5LP6 C;  3F5T A;  4ICG A;  5LHH A;  2Q73 A;  3DXR B;  1HW7 A;  1YJW V;  2EIL C;  4TUY A;  3UO2 A;  3ZMV A;  3O65 A;  2IU3 A;  2R70 A;  2BSK A;  1NBM G;  4DV1 O;  4R6Z A;  2D2C B;  1MMM A;  2JEU A;  1WPX A;  4L8J A;  1HNZ B;  1BGY H;  4JI5 B;  3CRC A;  2CH7 B;  1R6T A;  3UKM A;  2UXC O;  4BW5 A;  1YVW A;  1R1B A;  4EKW A;  1FAF A;  1K9M W;  5HFL A;  2XAH A;  3T1H B;  1SS3 A;  2Y4U A;  5FLX N;  1XNR B;  2CTP A;  5KHJ A;  4DR5 B;  4K35 A;  3HKD B;  1L1F A;  2N04 A;  4DV3 B;  5IWA B;  4JI1 B;  1XMQ O;  3W7X A;  5LHI A;  3ABM B;  3E8H A;  3SYO A;  4UCS A;  4CS3 A;  3F7Y C;  2HVK C;  1Q82 W;  5H6R A;  2DWD C;  4JI2 B;  4DV7 B;  4UXN A;  1FXH A;  3CXH F;  4YY3 O;  4JGS A;  3LSS A;  1EN4 A;  1QR9 A;  4DV5 O;  1M9N A;  1IDS A;  5KHI A;  3L75 H;  1AP5 A;  1VQ8 V;  1G8M A;  4O4H B;  1HNZ O;  1WA8 A;  3BVO A;  2VWJ A;  3RW0 A;  1NVP B;  4JZG A;  3LNN A;  4F6R B;  4QE7 A;  3OR6 C;  2O57 A;  4TV8 A;  3BRC A;  1CXZ B;  4OPH A;  3CCE V;  4FM2 A;  3K58 A;  2OCC B;  1WB7 A;  2XTA A;  2BTQ B;  2E75 B;  2F66 C;  1AJQ A;  1Y74 A;  4PA4 A;  5IJ9 B;  5JCO A;  3JSL A;  3RYF B;  5EC1 C;  3ZX6 A;  4DV6 B;  2AZ2 A;  4X62 B;  3B77 A;  2Q7H A;  4X1Y B;  5CMU A;  4FMT A;  5J2T A;  1VF7 A;  4IYH A;  1OCO B;  1J5E B;  2CAZ C;  1OCZ B;  1K3E A;  5J9P C;  3CHX A;  4X64 B;  1R3L C;  2YI8 A;  4PI2 A;  4UB8 Z;  3K0G A;  4GX1 A;  1B6Q A;  3AG3 B;  2ATK C;  3K79 A;  2DQ0 A;  2Y69 C;  3THO A;  1I94 O;  1QCE A;  2LGW A;  5LMN B;  3E86 A;  1ZWI C;  2GTS A;  1N36 O;  1YSC A;  5BY1 A;  5EIB D;  1XDC A;  3P3N A;  2NR5 A;  3FAV A;  1L8D A;  2LQT A;  1M57 C;  1AR1 B;  3ZN0 A;  4O4J B;  2YIC A;  5E1A C;  3HB3 B;  3SPH A;  4X66 B;  4JAA A;  3E8F A;  4LF8 B;  3ZMZ A;  5D5Q A;  1YI2 V;  2YSU B;  3CJH A;  3H01 A;  2IJH A;  4B3R B;  2YIB D;  1Z5W A;  3C3T A;  5BR8 B;  1R3J C;  4JYA O;  2LO1 A;  1VQ5 V;  1OCC C;  2Q7G A;  3ZN1 A;  5GTH Z;  1GM9 A;  4CZZ A;  4X1K B;  2Z3Y A;  2IJJ A;  4X62 O;  5FNV A;  1NTM H;  2JVD A;  1SRY A;  4MTF A;  4TV8 B;  3SJC C;  3ZHT A;  4RUF A;  3VQV A;  2K1E A;  2DWE C;  1PV0 A;  3CCL V;  4DUY B;  4B3S O;  3MAQ A;  4JZ2 A;  4PEL A;  4D7T A;  4GYC B;  1GN4 A;  1YJ9 V;  3ZIA G;  3ZJZ A;  5BZB A;  1GMG A;  4UV9 A;  1AVM A;  1SQQ H;  4JF3 A;  3LSU A;  5EZY A;  4CC5 A;  2NLJ C;  2B9Z A;  2WWW A;  1YXB A;  4DR3 B;  4UVB A;  1XI1 A;  4RQF A;  1IZ3 A;  1BCC H;  3ETG A;  5C8Y B;  4I55 A;  1H38 A;  1SQX H;  3WB0 A;  1R73 A;  2PYJ A;  3E89 A;  4IHJ B;  4I0X A;  1ZSP A;  1ZLZ A;  1FXK B;  4UVC A;  1CPY A;  3JSN A;  5BR8 O;  1XQ8 A;  4GX2 A;  3K04 A;  4K0K B;  1YJN V;  1Q3E A;  4TWK A;  5GTI Z;  2W0X A;  2VQF B;  4FM1 A;  1KP3 A;  5ITZ A;  3OMI B;  5IYD O;  3U0Z A;  1GKF A;  1JFF B;  3CYO A;  1WN7 A;  3ABM C;  4UCU A;  2WAM A;  2WLK A;  3ZRW B;  5TIS Z;  2PF4 E;  3ABU A;  1XL6 A;  2KB1 A;  4DYL A;  3VQW A;  2IW5 A;  3R65 A;  1QU7 A;  2VQE O;  4WFB V;  4K8X A;  4GKJ B;  1Q43 A;  1D5A A;  2YEV B;  1PKX A;  4UV8 A;  3ML0 A;  3JAK A;  3P30 A;  2GDS A;  3DC5 A;  5L3C A;  4I5S A;  2QWN B;  1TUE B;  2P06 A;  4FZ1 A;  1VQK V;  5JQG B;  4JI6 B;  1EN5 A;  3B40 A;  4QE9 A;  4WCE V;  2OCC C;  4LFC O;  4BIZ A;  5KHK A;  1H8H G;  2ZNJ A;  1YEW A;  3LUT B;  1UPG A;  3K0D A;  1TGO A;  1EZJ A;  1AJP A;  2H3O A;  2EZO A;  1NTK H;  1WJZ A;  4UB6 Z;  4UVA A;  1GAX A;  1H8E G;  5LA6 B;  1S72 V;  3HKB B;  1WNS A;  4J80 A;  1JCH A;  3TK1 A;  5BMV A;  2OCH A;  3RGB A;  1XOU A;  4NXN O;  2ZCE A;  3APO A;  1PNK A;  2P4K A;  1OCO C;  2RCV A;  4YIO A;  4NKG B;  5KX5 A;  3BEH A;  4GKJ O;  4FFB B;  2Y0I A;  3QVN A;  4R50 A;  1YIT V;  3M99 B;  4P30 A;  3K5O A;  5IJ0 B;  2UUB O;  3AG3 C;  1D2D A;  2EIN B;  2H8P C;  3SYP A;  4J7Z A;  4MT8 A;  1RSO B;  5ITZ B;  4LF9 B;  4HYO A;  1ZL8 A;  1AI5 A;  4BIO A;  4DR2 O;  3OE7 G;  3F7V C;  4MVM A;  2QWR B;  2FYU H;  3S3X A;  2WLI A;  4YHH O;  1XL4 A;  1GRJ A;  2DW4 A;  3MHS C;  1HDJ A;  3RFR A;  2HVJ C;  2GTA A;  4FZ0 A;  4LFB B;  3BCC H;  3L72 H;  4MW8 A;  3L74 H;  3ICX A;  3JAK B;  1N34 O;  4FLT A;  4FLX A;  2CTQ A;  4WF9 V;  1Q6I A;  2JDI G;  1RPO A;  1AI4 A;  1IXB A;  2ZE6 A;  4I4T A;  1G1X B;  1Q6H A;  2AHY A;  3ZMS A;  3QNE A;  3S3W A;  2W0F C;  3N2K B; 
#chains in the Genus database with same CATH homology
 3RT3 C;  1KUQ A;  3F5T A;  4B3S O;  2UUC O;  4LFC O;  2UXD O;  3J7A U;  4X66 O;  2Z0A A;  4JI2 O;  4DV7 O;  4LF8 O;  2LW7 A;  1XMO O;  1NS1 A;  1FYJ A;  3O65 A;  2N74 A;  4X65 O;  5A2Q N;  4LF5 O;  4B3R O;  2FKX A;  2DOS A;  4JI8 O;  4LFB O;  1N33 O;  4DV1 O;  3OTO O;  1FJG O;  4B3M O;  1A32 A;  2ZM6 O;  4DV2 O;  4AQY O;  4JI3 O;  1HR0 O;  4NXN O;  4KHP O;  1R6T A;  4DR1 O;  2UXC O;  5BXZ A;  3T1Y O;  1R1B A;  2UUA O;  3R66 A;  4JI6 O;  4DV0 O;  4GKK O;  1F7Y A;  4DUY O;  5FLX N;  4GKJ O;  2DJV A;  5BR8 O;  1HNX O;  4LF7 O;  1DK1 A;  5H5N A;  1X59 A;  2UUB O;  2E5L O;  3J81 N;  1I94 O;  1D2D A;  4A5U B;  3J80 N;  1XMQ O;  4B3T O;  1N36 O;  4DR7 O;  4OPA A;  4LFA O;  5BY1 A;  2UU9 O;  4DR3 O;  2JRI A;  4DV6 O;  3M8A A;  1IBL O;  3JAM N;  4DR2 O;  3SDL A;  4JI5 O;  4LF4 O;  4DV4 O;  4JI4 O;  1N32 O;  4YHH O;  1IBK O;  1YZB A;  1IBM O;  1J5E O;  5IT9 N;  4JI7 O;  1AB3 A;  2F4V O;  5LMU O;  4YY3 O;  1XNQ O;  2AGA A;  3T1H O;  4X64 O;  2VQE O;  4DUZ O;  4DV5 O;  4OX9 O;  4NXM O;  4JYA O;  1XNR O;  1XEQ A;  4DR6 O;  4DR5 O;  1N34 O;  4JV5 O;  4X62 O;  2HHH O;  4K0K O;  1HNZ O;  2UXB O;  4DR4 O;  4DV3 O;  4JI0 O;  5IWA O;  5LMN O;  4JI1 O;  2ZKO A;  4LF9 O;  1G1X B;  2VQF O;  5LL6 Y;  4LF6 O;  4OPH A;  1AIL A;  1FKA O;  1HNW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...