3J80N

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
b'GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j80N02
3J81N 4JYAO 1XNQO 1FKAO 4DV7O 1HNZO 3T1YO 4LF9O 4OPHA 4B3RO 1HR0O 4DV4O 1FJGO 4JI1O 4YY3O 4DV5O 4LF7O 1J5EO 2F4VO 1I94O 1KUQA 4DUYO 1AILA 1N34O 2ZKOA 1FYJA 1N32O 1R6TA 4OPAA 4DV0O 3J7AU 4DR3O 1N36O 4DV2O 2UXDO 4AQYO 4YHHO 4DR4O 2N74A 4X66O 1AB3A 1IBKO 5LMNO 4B3TO 5BXZA 2DJVA 4A5UB 2UU9O 4OX9O 2UUBO 1X59A 2Z0AA 1HNXO 2UUAO 4JI4O 4GKKO 4GKJO 4B3MO 5A2QN 4LFBO 4DV3O 1A32A 3OTOO 3T1HO 1XMQO 1NS1A 3J80N 4JI0O 5IWAO 4X62O 4KHPO 1IBMO 4JI7O 4DV1O 4JI8O 5H5NA 5IT9N 4JI5O 4JI3O 1XMOO 1IBLO 4DR1O 1XNRO 2UXCO 4LF5O 4X64O 4NXMO 3SDLA 4JI2O 4LFCO 2UXBO 4X65O 3F5TA 4LFAO 5LL6Y 4LF6O 4JV5O 3R66A 1G1XB 1DK1A 2ZM6O 2HHHO 4K0KO 2LW7A 4DR5O 2AGAA 1N33O 1F7YA 4JI6O 5BY1A 2VQFO 2FKXA 2VQEO 4DV6O 4DR7O 5BR8O 3JAMN 2E5LO 3M8AA 2UUCO 4LF8O 2DOSA 1HNWO 5LMUO 4DUZO 4B3SO 3O65A 1D2DA 4NXNO 1R1BA 1YZBA 4LF4O 4DR6O 4DR2O 2JRIA 5FLXN 3RT3C 1XEQA
chains in the Genus database with same CATH superfamily
1Q3EA 4X65B 4K3AA 1NI8A 3JATB 1QHTA 2DWEC 5EYPB 4UV9A 5LHGA 3H01A 1V55B 4I0XB 2CAZC 2JGUA 3ABLB 5IJ0A 1V54C 4CS2A 3B8MA 1WPXA 1KUQA 2W6JG 2RNBA 3CD6V 2CTRA 4JYBA 3ZN1A 4OXSA 2KB1A 3SPCA 3WG7C 4ZBMA 1RPOA 3BFRA 3KCXA 3L73H 1XNRB 4MTOA 4QE9A 3DC6A 5B1NA 3E8FA 5BMVB 2Q7GA 3LNNA 4X66O 4CH5A 4LF6B 2F93B 4TQDA 1K3EA 2UU9O 5KHJA 1KECA 4GYCB 5DN6G 1NH2B 3SPHA 3K57A 1BHAA 1IXMA 1VQ6V 3AK3A 3OUSA 1M90W 5EZYB 4DRXB 1ENVA 2HP8A 1V55C 4GUNA 3ABLC 2WSSG 3E89A 4AHCA 2LFSA 4O4JA 2A0LA 1U97A 3L75H 4FLTA 4IYHA 3SYAA 1CXZB 2YIAA 2ZD9A 2QWNB 3AK2A 1MA1A 4F4LA 3WU2Z 3WB1A 5AG2A 3K03A 3Q4HA 2IH1C 2Q7HA 4ZHQA 1VQOV 2DE0X 2E5LO 1QVFU 1FFXB 4TUYA 1GN2A 5E79Z 1HNWO 4DUZO 1D2DA 3SYOA 1BZKA 3RYIB 2XAGA 1KKDA 3P32A 4LFCB 4TSFG 1YJWV 2P4VA 5IYCO 5KAIZ 2OT5A 1HR0O 1F4NA 5KMGB 1NTZH 2QKCA 4DV5O 3ZMZA 4FZ1A 2N05A 1PNMA 4X62B 2EULA 4DUYO 3CYOA 1GKFA 1UFIA 1URFA 3PN1A 3HKCA 1XREA 5FPRA 2MW2B 4QNHB 2CGOA 2XT9A 4LFAB 3X2QC 5BXZA 3ZHTA 3VOUA 3CC4V 1YTFB 2DMXA 2VQFB 4LFBO 4DR7B 3N2KB 4O4LA 1F51A 3ZN0A 3QF7A 2KG7A 1K9MW 1JQ0A 4MVUA 4JI3O 1HW7A 5C93A 4I55B 4JI2O 3ZX6A 3D8CA 4DV4B 4IHJB 3N2GA 1WN7A 3KZIZ 2P6JA 2LGWA 1F7YA 2ZCEA 2VQEO 4DV6O 4BW5A 2UUCO 4KXRA 1GN4A 5IE9A 3SPJA 2LFRA 3CXCU 3EFFK 3CRCA 2LW1A 1SZTA 2VWKA 2QEXV 1SF9A 3RT3C 4JI4B 3UCSC 4RQFA 4MTFA 4GKKB 3OTFA 3ASOB 3ZIAG 3QO5A 3HKDA 4FLUA 1WP7A 2ATKC 2D2CB 1FJGO 1YJ9V 2QM4A 1H2LA 3CX5F 4AI8A 4KHPB 2XHBA 5CA1A 2D3OW 1P84F 1ZSPA 3STLC 1CPYA 4X64B 4R50A 4PHZA 5JCOC 5L3CA 2Q73A 3E8GA 1P7BA 5IJ9A 4O2BA 2RCVA 3JD0A 2CTWA 4R6ZA 3AEIA 5LXTA 1KP2A 2WLLA 5GONB 4AILC 1VQ8V 1M1KW 1R6KA 4EKWA 2XUMA 3LDEA 3J80N 1GM7A 2IBZH 4HBNA 3L72H 4XDKA 1B04A 1K8AW 1WP8A 1WLEA 3UKMA 1JMKC 4U7OA 4MVMA 1XQ8A 4RUFA 3OGIB 2N04A 5CBFA 4X65O 2Q0OC 4DK1A 1KP3A 2EIJC 2L35A 2W0FC 3A8TA 1W59A 3T4DA 2HFEC 5F2VO 4D7TA 5C8YA 4G28B 3RFRA 2R9AA 1G8MA 4O2AB 5JVDA 4EB6A 4HZ3A 1NZ6A 2Y4TA 4LH6A 3C3TA 2GUZA 2YEVA 3BPZA 3LDDA 1TA8A 1S5HC 1M9NA 4LF8O 3RW0A 2Q0AA 4X66B 4RAIA 4TV8A 3ZRWB 2UU9B 4H37A 1MNGA 3HKBA 2F95B 3F7YC 2F1MA 4IGGA 4Q20A 1KBHA 4DV7O 1GN6A 1IURA 1KQSU 1YIJV 1BCCH 4B3RO 1AJNA 4JI1O 3JD1A 1M5IA 4MW3A 4O4HB 1BL8A 2ZDIC 4UXNA 3A0BZ 1GM8A 4QPJA 4ZOLA 3ETEA 2R9RB 1DLBA 1BGYH 3O9OA 4MTXA 3D3QA 5EIBD 4BIZA 4X1KB 4I4TA 1QQCA 3SJBC 4CH6A 5JJJB 4LF4B 4OX9O 5LYJA 1FS0G 1S5LZ 3IGAC 1H2SB 5JH7B 3FFQA 3A0RA 2FYUH 2EJRA 3OTOO 1JR9A 2R9IA 4BIUA 3K5OA 2E5LB 5KHKA 3JSLA 3SJAC 3E8BA 3H1JH 1HNWB 1SESA 1P4RA 4DUZB 4FIPC 3CCQV 3H1IH 3RVYA 4TQFA 3KCYA 1QBZA 3RN4A 4LFCO 2X6BA 4H44B 4WFGA 4UB8Z 1HR0B 1SA0A 4MTGA 2JS5A 4MVQA 1RPRA 4DV5B 4KUMA 2HKOA 4DUYB 3B8NA 5BY1A 1M56B 4F6RA 1JX9A 5BR8O 1VEWA 4PDVA 3SPGA 5LA6A 4GX2A 2LO1A 1YCIA 3MD0A 4FM0A 2VRZA 2JEUA 1SETA 1Q6IA 4BR6A 1YXBA 1AP6A 4O4JB 4UVAA 4DR6O 4DV1O 4DO2A 1XEQA 2K1EA 4JYAO 3F5WC 3OW2U 4LFBB 2DYRB 1XI1A 1FXVA 1G4YB 2YIDA 2P22C 4ICGA 1J5EO 3Q4HB 3RYCA 4QPKA 2ZKOA 3KKYA 2HJFC 4FFKA 1ZL8A 1PPJH 1M56C 4JI2B 4IIJA 4J11A 3QO8A 2ZXWB 4WFFA 4E2LA 2PY5A 1JOYA 1AP5A 3ZCCA 4UUJC 4UVBA 2UUAO 1FPOA 1EZVH 2WLKA 2VQEB 4NVPA 4DV6B 3K59A 3T1HO 1H2MA 3TK1A 2P06A 2DYRC 4BIOA 1LUWA 1YI2V 4PV1B 4JI7O 2M7WA 4LCUC 4L8JA 1TVKB 3HKCB 4K8ZA 4JI5O 3CWBH 3ZBHA 3MDSA 4UCTA 1AR4A 3E2EA 3TJTA 3DXRA 5DECA 1F23A 3ETGA 5H6QA 2ZM6O 1YJNV 2ZXWC 3JALB 3JD3A 2OTLV 1QR8A 3JARB 2XNDG 1EN4A 5HFLA 4O4LB 1XL4A 4UCVA 3AG3B 1FAFA 1DF4A 3ETDA 2FL4A 3JAWA 5FL7G 3W7UA 3IFXA 1YVWA 2QKSA 1Q6HA 4B3SO 2CGNA 1Q43A 1AR1B 4DR1B 3UT5A 4ZI7A 4GZRB 3JAKA 5FLXN 4LNUB 4QJFB 1S72V 1Z5WA 1NTMH 1FXHA 2XASA 3M7MX 3N2GB 1Z5VA 1PL0A 2EIMB 2RJZA 4PJ0Z 4X1IB 3HR0A 1N34O 2B1GA 1I0HA 1ZWIC 2ITCC 2ZE6A 3AG3C 4TV9B 4YJ3A 5LGTA 3G67A 2BTQA 1S0VA 3CCVV 4MVZA 1LUVA 1Y67A 4U3JA 2X7RB 3OEEG 3TGUH 3RYFA 5LMNO 2E76B 2ZINA 1NTKH 4ZKIA 2GSMB 1NVPD 2P7TC 1GH6A 4LF9B 2EIKB 5CB4A 2P4KA 2EZOA 4YJ2B 1XMQO 4X20A 1QLEB 1NS1A 2DWDC 4X1YA 5CA1B 4LF8B 2EIMC 1JFFB 2Q8VA 2V7QG 5L3EA 4HNAB 2XAHA 5BZBA 1IBLO 3SDLA 4DV7B 4CS4A 2A7WA 5L3GA 4B3RB 4JI1B 3R66A 4I50A 4O2BB 1SQFA 4FFBB 4K0KO 3CRAA 2LW7A 3E22A 3FKSG 2UXNA 2WWWA 2PF4E 2ARHA 1Q81W 3SYPA 4PDRA 2EIKC 2JDIG 4X9QA 1IBMB 1KYOF 3U11A 3ZHUA 1QLEC 3S3XA 5IYZA 5ITZA 1ZX3A 4OX9B 2ODMA 1GAXA 1FFTB 3K58A 4LF4O 1S5JA 1SQXH 4D7SA 3BA9A 3ABTA 1VQLV 2QDOA 2ZR3A 2M6YA 2YXHA 1HNZO 4JGSA 3U10A 3OTOB 3OFNG 1VQMV 3ML0A 2MK3A 4L87A 5C8YB 1NJIW 1Y6XA 1I5YA 3X2QB 1JA8A 2ZE8A 3E8HA 3J7AU 5LHHA 3I5DA 1YF2A 2GUZB 3NXSA 1MSDA 4LH7A 1D5AA 4TV8B 5K1PA 1OZ0A 5K1XA 2A06H 1L0NH 2UUBO 1YSCA 2ETNA 2QGNA 1Y66A 3ASNC 2PI4A 4Z2WA 2IW5A 3JASA 5BR8B 1XHXA 4N23A 4JI0O 3GB7C 2LJ2A 1DTOA 3RYHB 3JCZA 4DV0B 4JPRA 3DTUB 5B3SB 4DV2B 4DR6B 4DV1B 3RVZA 5LP6B 1WPBA 4NXMO 4JYAB 1UPGA 4WBNA 1K33A 3THOA 1HP8A 1RSOB 3AG4B 1VF6C 1J5EB 1SC5B 4PI2A 3L9DA 1BE3H 1FXKA 3CC7V 1Y74B 3CCEV 1OHHG 3ETQA 4YIOA 4EFEA 3QO7A 1HDJA 3BHPA 2QWRB 2E3CA 2JJ1G 5EBLC 2WLIB 1IDSA 4DK0A 3HKEB 2H3OA 3K08A 4UV8A 2HVJC 5TISZ 2BSKB 3SJQC 2UUAB 3FAVA 1H38A 5B3SC 1AVMA 1FKAO 4Z1VA 2JGDB 2ZT9B 5LP6C 2IJKA 2EZPA 4QGPA 3T1HB 1SQPH 2H94A 5H6RA 1MZEA 3OMNB 4LC1A 1BMFG 1XL6A 4FLYA 4TT3G 1N4CA 4JI7B 3AG4C 3GWOA 4E4EA 1XUQA 1T5EA 4JI5B 4OPAA 4B7KA 5CA0B 1DF5A 4WFBV 2AXTZ 4PD4F 1NH2D 5H9CA 1TUBB 1AB3A 3CMAV 3DC5A 2ZM6B 5EC1C 1QCEA 1O9HA 4PDLA 1RM1B 1SQBH 2YXLA 2R72A 4J7JA 3JATA 1A32A 5EYPA 3QNEA 2F4VB 5IWAO 3HPLC 3RYCB 4LP8A 4CH4A 2E75B 1N32B 3OGCC 2P90A 3ZEDA 4G2KA 1VIBA 2EIJB 4B3SB 2QWQB 1XHZA 3W7WA 2LP7A 3ABMC 2WLHA 1OCOB 4DR1O 4OGQB 4IIJB 5BMVA 1IX9A 2A9HA 1QVGU 2OIEA 4DW1A 3E35A 5LGUA 1CP9A 3BVOA 2PTMA 2Y0IA 1L0LH 4XBFA 4DR5O 1VQPV 4RWUA 2HJDA 1N34B 1K73W 1YEWA 1RM1C 2FKXA 1RFYA 3CS5A 1EN5A 3K9SA 5EZYA 4DRXA 2QR4A 4FM2A 5LOVB 3EXAA 4PA7A 2DOSA 2E74B 5KUKA 1GRJA 5LMNB 3IC7A 4NXNO 3CRRA 2YSUB 2EINB 2JRIA 4P30A 2XAFA 4WFAV 5L3BA 3CSXA 4BWAA 1OCOC 1Y76A 4LF9O 2CE4A 1XMQB 3BAAA 3F7VC 3ABUA 3OE7G 4NTYA 3FB6C 1VQ7V 4NB5A 1KD1W 1K97A 2HR3A 2DW4A 5B1BB 1M93A 1R6TA 1OCZB 1IBLB 3IJ4A 1VQ5V 4LWSA 1FFXA 2O57A 4PA4A 1IVSA 4YHHO 4DR4O 1P49A 4BW9A 5B66Z 4ZI7B 4A5UB 3RYIA 4K0KB 1Q86W 1SRYA 1K4CC 1R3KC 4K8XA 3CB2A 1SERA 2BTOA 2Q5ZA 3FX7A 2EINC 2PZSA 3OEHG 2IU0A 1EBOA 1R3LC 2JIZG 4KFMA 1UJWB 1BQ0A 4J9YB 5KAFZ 5KLVH 5KMGA 1SQGA 1E1QG 1Q7YW 3I55V 1IBMO 1GO3F 1BS3A 4JYYA 4JAUA 5B1BC 4LBEC 5JQGA 5J2UA 2X0LA 1OCZC 3P30A 1RP3B 1ROPA 1HNZB 2CDYA 1QU7A 3CXHF 5IJ0B 1JJOA 4QIWF 5FPOA 3VQVA 4GKJB 2JVDA 5CB4B 2PYJA 3EHBB 1GK9A 1AJPA 3JYCA 4WF9V 5FNVA 2EBOA 5KHIA 2ZIMA 1BSMA 1MABG 2ZNJA 1I08A 2IM9A 5HFMA 1H2GA 3VQWA 1AI5A 3CHXA 2UUBB 4DR2O 4I55A 5EK0A 4J9ZB 1XNQO 1ZUQA 3H1KH 1PKXA 5EBWC 1NQTA 4I50B 2DN9A 1SS3A 4IHJA 1WB7A 4B08A 3E22B 3STZC 4JI0B 4LF7O 2XAJA 2PYLA 3K0DA 1GTOA 3EVKA 3MAQA 2KSDA 4F6EA 4DV0O 1K7DA 2R70A 5JCOA 4RQEA 4NXMB 4DV2O 1AI4A 3BY6A 2P5OA 5IYZB 5ITZB 2OWOA 3UM7A 2PGGA 4GX1A 2Z5UA 3PJSK 4HYOA 3JSNA 4JAVA 4GX5A 3IAYA 5A2QN 1NR1A 1SZXA 2A79B 3OAAG 4ZHQB 2KQXA 1ZAUA 2Y48A 2HVKC 3CCSV 4TUYB 5CMUA 5H5NA 4ASUG 1YHQV 2F66C 4JTCB 3W7XA 1XILA 2AW9A 3SPIA 5DM6V 2UXBO 1TAEA 3FB5C 1LNQA 1IBKB 5L3FA 3A2FA 2QJ1A 5E1AC 3CP1A 3ZMVA 4FLVA 2GTAA 5LBQA 5GONA 2DYSB 1M4UA 3BEHA 3B40A 3B4SA 3BCCH 5GW7A 1E79G 4Z1MG 2WA3A 1MOFA 2WPDG 1R3JC 1R6NA 1R1BA 2FTKA 1YZBA 1PD3A 4YXWG 1JJ2U 5IDJA 4JI6O 3SR2C 3K04A 5J2TA 3G6BA 3UQ8A 2AZ2A 3FB8C 2G38A 3FYIB 1SQVH 2CTQA 4NR1A 1VQ9V 2ZDIA 4PELA 2ADPA 5IWAB 4PA3A 2KG7B 4PDMA 4NTXA 2F4VO 2Z3YA 3CCMV 1FXKB 4MS2A 4MW8A 1N32O 3CCLV 5IY5B 2GBOA 1THZA 2A3QA 2ILMA 2DYSC 2UXDO 4UCOA 1VQNV 3D3IA 2ZE5A 4C7UA 2BCCH 1XBLA 2FMLA 4KL1A 1L8DA 2Z0AA 2X6CA 4DR5B 3SYCA 4B3MO 4CS3A 4GLXA 4FK5C 4NTWA 4O4IA 4GCZA 3D36A 3KG2A 2OTJV 1O9GA 4O4HA 3CRMA 2JJ2G 1QNMA 5A9GA 4NXNB 1FXKC 4GT1A 3CCRV 1PNKA 4X1KA 3M99B 5IY5C 1PP9H 3HKDB 2WA4A 4JASA 3LNMB 1XDCA 4JV5O 4W4LA 3WB0A 4UCRA 1VQ4V 1ORQC 5JH7A 1N33O 2W0XA 4R7CA 1AJQA 1FD9A 3TXQA 1Z2GA 2BOBC 2CH7A 3N27A 4H13B 4J10A 2GV9A 2ZNIA 4YHHB 4DR4B 3I56V 2JK5C 5IJ9B 2GDSA 4G27B 5KHGA 4R8CA 2QWPB 3NR7A 4HAMA 2ITDC 4CBCA 5LXTB 2WLLB 4OPHA 2YI8A 1P7GA 2Q69A 4FLWA 4J42A 3SGIA 2PI5A 3ZHVA 2IJHA 2EJ7A 1VQKV 3FYEB 4FLZA 3G71V 2CUGA 4CH3A 4D6TH 1WJZA 4DR3O 3CJHA 1IXBA 3WB2A 2YIBD 3P3NA 3ASNB 3MHHC 2OYQA 4RO2A 3OUFA 3RGBA 5LMUB 5CA3A 1VP7A 4B3TO 1PM9A 1DGSA 2JS3A 3K5NA 3LSUA 1X59A 1US6A 1Y76B 4WCEV 3T1YB 3GVMA 4GKJO 4KP4A 5JVDB 4EB6B 2IJIA 3ZRXA 5KA6A 5IYDO 2DQ3A 5EC2C 4ABMA 2YEVB 4XDJA 2YC0A 3JD4A 4Q6GA 4J41A 4EEQA 2X6AA 4H33A 1KU9A 2RMKB 4JZGA 4W4KA 2K9PA 4LR3A 3VBBA 3W7TA 3HKBB 1N36B 4LWSB 4DR2B 4FZ0A 4J7ZA 3ICXA 1XNQB 1K92A 3ZJZA 3QTCA 4DXWA 3H1LH 5LL6Y 2NN4A 4K35A 1G1XB 3OM3B 2YIBA 4LF7B 3AG2B 2P67A 4B7EA 4U3FH 2XTAA 3G4SV 4ZOLB 4FM1A 5KX5A 4I4TB 2QTSA 1K34A 2F43G 3OMAB 4WFHA 1WA8A 3L71H 1TVKA 1F4MA 3VQXA 5CBHA 5JQGB 5J2UB 5LYJB 4LF5B 2IU3A 2OCHA 2Y4UA 4TOIA 1W2BU 3SJCC 5L3DA 2HHHB 2AHZA 3JALA 1OCCB 2NLJC 4N21A 3JARA 4X89A 4U7NA 1N0JA 1MMMA 4NKGB 4XDLA 3AG2C 5FNVB 4P9OA 2RQ6A 3GWKC 1SKVA 4RUEA 3CCJV 2QSAA 3CEIA 3JCUZ 2BOCC 2Q6AA 2UXBB 2N74A 3VQYA 1SA0B 2QWOB 1NU1H 1IBKO 4IT5A 2VS0A 3TETA 1H2KA 3B09A 4LNUA 3U0ZA 1N0NA 3ZHRA 4DV3O 4F6RB 3ABMB 1WB8A 1G6UA 5LA6B 4I5SA 1VARA 3R65A 3CRQA 2B9ZA 4X1IA 1OCCC 4JI8O 3LSQA 4MSWC 3CMEV 1XMOO 5LGNA 2UXCO 4DYLA 4J7KA 4JI6B 3SYQA 4JTAB 2RN9A 4TV9A 1BT8A 1KB9F 4PI0A 3LSSA 2WLJA 1KMIZ 2OCCB 2V4DA 2HLDG 4I0XA 1B06A 1NBMG 5EIBC 4TWKA 3ZMUA 4I7ZB 1GMGA 3FB7C 1S3JA 2Y69B 3ZRSA 2EILB 1U96A 1ZL8B 1D5NA 4YJ2A 2EX3A 5KUMA 3DGEA 3G80A 1H8EG 2UXDB 1OV9A 3OMIB 4I9WA 3H1HH 1NT2B 1JFFA 1NR7A 5LHIA 3A0HZ 4X88A 2YXYA 3AG7A 1TUEB 5JJEB 1CEZA 4HNAA 4X8AA 1ZTEA 2FB5A 5D5QA 2DQ0A 3AG1B 2QKAA 1HNXO 3J81N 2Q4PA 1J95A 4B3MB 2YUAA 4CC5A 4YY3O 4FFBA 4FMTA 2XAQA 2OCCC 2ADQB 1I94O 1AILA 3E86A 3OT7A 1FYJA 2QE7G 4CC6A 3ASOC 1YITV 5DEDA 1PV0A 4UVCA 2Y69C 1MG1A 2EILC 5CN0A 4EFBA 4AQYO 1JCHA 1I7FA 3DXRB 1R3IC 4JV5B 4MVSA 1BQZA 2DJVA 4J80A 5J2TB 1S76D 1M57B 1N33B 3BABA 2B1IA 3AG1C 3DSQA 4FPPA 3JAWB 3K9AA 5KHHA 3RWRD 5H2FZ 2PUSA 1YTFD 2UXXA 3CE2A 3UT5B 1QR9A 1XNRO 3JAKB 4JZ2A 1COWG 4QE7A 3K79A 3E83A 1JVMA 3T4ZA 2ZIOA 4LF6O 5B1AB 1VF6A 1DK1A 1X4TA 1AI6A 4FJCC 3K06A 5KA5A 2V1DA 1OCRB 2OIGA 2IH3C 1SQQH 2H8PC 4O4IB 1VMGA 1M57C 1W0KG 4DR3B 3JAMN 3M8AA 1ZLZA 5CBGA 4P2ZA 4YJ3B 2BTQB 1V9PA 2YS8A 3RYHA 3B77A 3ZMTA 4U3JB 4B3TB 3L70H 5LMUO 3RYFB 3CCUV 3K0GA 1AR5A 3ZHQA 5J9PC 1KKCA 4I9QA 5LP6A 2L6LA 4WFEA 4YIPA 3T1YO 1MZFA 1E1RG 1EZJA 3QG5A 3N2KA 5EBMC 3LUTB 4IL6Z 4X20B 1QLNA 3B2EE 4UCSA 1RSOA 1TGOA 4PA6A 1NKDA 5B1AC 4X1YB 5B1OA 1K5SA 3K5MA 1BHBA 1Q82W 1I5XA 1OCRC 3IC9A 4GX0A 1Y74A 2CH7B 4P9PA 3TCUA 5D5PA 1IZ3A 4MVOA 1N36O 2LQTA 2ZE7A 5B5EZ 3D36C 1B3QA 3ZMSA 1XOUA 2CTPA 4CZZA 2WLIA 1PNLA 1R73A 3HKEA 1OJHA 2BSKA 3ABKB 3FD9A 2JGDA 4JF3A 2ZR2A 1L1FA 3QVNA 1NVPB 3L74H 3H9VA 4X62O 1EM1A 1N8RW 3JD2A 3K5LA 1MSWD 2NNUA 4JYCA 2QM7A 3CJHB 5CA0A 4LF5O 1S77D 3W7SA 4UFZA 3ZS8C 3OR7C 1TUBA 4LFAO 2WLNA 3C3SA 3P3PA 2HHHO 2F23A 3APQA 5IYBO 1LR1A 1Q5OA 3ZRVA 2CK3G 2VQFO 3ABKC 2Q7EA 4DR7O 2NR5A 3UO3A 1YDXA 4JTDB 4JI3B 1EFRG 1B6QA 1K4DC 4FVMA 4FLXA 2B5UA 2Q68A 4DV3B 4DV4O 3JASB 2BE3A 4JAAA 3CPWU 1AROP 2YDEA 2WLMA 1Q90D 2YICA 5KX5B 4JI8B 4PA9A 3K3WA 2QM8A 1XMOB 2UUCB 2C2AA 2UXCB 1AI7A 5LOVA 1WA8B 5JWPA 1KC8W 4ZIBA 1WAZA 3MHSC 2IJJA 4WBNB 2RDCA 3HB3B 3T2MA 2YI9A 5JJNB 1Y4MA 2ZQMA 1VF7A 2KKWA 1GN3A 4JI4O 2QA4V 4BAYA 4GKKO 1FJGB 3APOA 3T1CA 3TXSA 1H2NA 4O2AA 4NYKA 1WNSA 1Q6UA 4KHPO 4UB6Z 2GHYA 1K5QA 3C90A 2WAMA 5IT9N 4MVRA 3ZRWA 2XOKG 4UCUA 2AZ0A 3OD4A 1HNXB 3AK1A 4X64O 3FAVB 2VWJA 1H8HG 3LDCA 3F5TA 4DW0A 2Y0PA 5GTHZ 1HWYA 1V54B 4MT8A 2QTOA 4YY3B 3BRCA 3UO2A 1I94B 2Q9LA 1EN6A 2AGAA 4IYIA 3RBZA 3WG7B 4H0LB 2JEXA 3S3WA 2LGQA 2AHYA 3OR6C 1W0JG 1GM9A 4AQYB 1Q8IA 2Q67A 2W6IG 3ZHSA 3G6EV 3O65A 2HG5C 1PL4A 5GTIZ 3BA8A 3CC2V 2GTSA 1VF5B 1JPXA 3WFVA 2HEPA
chains in the Genus database with same CATH topology
3J81N 4JYAO 1XNQO 1FKAO 4DV7O 1HNZO 3T1YO 4LF9O 4OPHA 4B3RO 1HR0O 4DV4O 1FJGO 4JI1O 4YY3O 4DV5O 4LF7O 1J5EO 2F4VO 1I94O 1KUQA 4DUYO 1AILA 1N34O 2ZKOA 1FYJA 1N32O 1R6TA 4OPAA 4DV0O 3J7AU 4DR3O 1N36O 4DV2O 2UXDO 4AQYO 4YHHO 4DR4O 2N74A 4X66O 1AB3A 1IBKO 5LMNO 4B3TO 5BXZA 2DJVA 4A5UB 2UU9O 4OX9O 2UUBO 1X59A 2Z0AA 1HNXO 2UUAO 4JI4O 4GKKO 4GKJO 4B3MO 5A2QN 4LFBO 4DV3O 1A32A 3OTOO 3T1HO 1XMQO 1NS1A 3J80N 4JI0O 5IWAO 4X62O 4KHPO 1IBMO 4JI7O 4DV1O 4JI8O 5H5NA 5IT9N 4JI5O 4JI3O 1XMOO 1IBLO 4DR1O 1XNRO 2UXCO 4LF5O 4X64O 4NXMO 3SDLA 4JI2O 4LFCO 2UXBO 4X65O 3F5TA 4LFAO 5LL6Y 4LF6O 4JV5O 3R66A 1G1XB 1DK1A 2ZM6O 2HHHO 4K0KO 2LW7A 4DR5O 2AGAA 1N33O 1F7YA 4JI6O 5BY1A 2VQFO 2FKXA 2VQEO 4DV6O 4DR7O 5BR8O 3JAMN 2E5LO 3M8AA 2UUCO 4LF8O 2DOSA 1HNWO 5LMUO 4DUZO 4B3SO 3O65A 1D2DA 4NXNO 1R1BA 1YZBA 4LF4O 4DR6O 4DR2O 2JRIA 5FLXN 3RT3C 1XEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 N;  4JYA O;  1XNQ O;  1FKA O;  4DV7 O;  1HNZ O;  3T1Y O;  4LF9 O;  4OPH A;  4B3R O;  1HR0 O;  4DV4 O;  1FJG O;  4JI1 O;  4YY3 O;  4DV5 O;  4LF7 O;  1J5E O;  2F4V O;  1I94 O;  1KUQ A;  4DUY O;  1AIL A;  1N34 O;  2ZKO A;  1FYJ A;  1N32 O;  1R6T A;  4OPA A;  4DV0 O;  3J7A U;  4DR3 O;  1N36 O;  4DV2 O;  2UXD O;  4AQY O;  4YHH O;  4DR4 O;  2N74 A;  4X66 O;  1AB3 A;  1IBK O;  5LMN O;  4B3T O;  5BXZ A;  2DJV A;  4A5U B;  2UU9 O;  4OX9 O;  2UUB O;  1X59 A;  2Z0A A;  1HNX O;  2UUA O;  4JI4 O;  4GKK O;  4GKJ O;  4B3M O;  5A2Q N;  4LFB O;  4DV3 O;  1A32 A;  3OTO O;  3T1H O;  1XMQ O;  1NS1 A;  3J80 N;  4JI0 O;  5IWA O;  4X62 O;  4KHP O;  1IBM O;  4JI7 O;  4DV1 O;  4JI8 O;  5H5N A;  5IT9 N;  4JI5 O;  4JI3 O;  1XMO O;  1IBL O;  4DR1 O;  1XNR O;  2UXC O;  4LF5 O;  4X64 O;  4NXM O;  3SDL A;  4JI2 O;  4LFC O;  2UXB O;  4X65 O;  3F5T A;  4LFA O;  5LL6 Y;  4LF6 O;  4JV5 O;  3R66 A;  1G1X B;  1DK1 A;  2ZM6 O;  2HHH O;  4K0K O;  2LW7 A;  4DR5 O;  2AGA A;  1N33 O;  1F7Y A;  4JI6 O;  5BY1 A;  2VQF O;  2FKX A;  2VQE O;  4DV6 O;  4DR7 O;  5BR8 O;  3JAM N;  2E5L O;  3M8A A;  2UUC O;  4LF8 O;  2DOS A;  1HNW O;  5LMU O;  4DUZ O;  4B3S O;  3O65 A;  1D2D A;  4NXN O;  1R1B A;  1YZB A;  4LF4 O;  4DR6 O;  4DR2 O;  2JRI A;  5FLX N;  3RT3 C;  1XEQ A; 
#chains in the Genus database with same CATH topology
 1Q3E A;  4X65 B;  4K3A A;  1NI8 A;  3JAT B;  1QHT A;  2DWE C;  5EYP B;  4UV9 A;  5LHG A;  3H01 A;  1V55 B;  4I0X B;  2CAZ C;  2JGU A;  3ABL B;  5IJ0 A;  1V54 C;  4CS2 A;  3B8M A;  1WPX A;  1KUQ A;  2W6J G;  2RNB A;  3CD6 V;  2CTR A;  4JYB A;  3ZN1 A;  4OXS A;  2KB1 A;  3SPC A;  3WG7 C;  4ZBM A;  1RPO A;  3BFR A;  3KCX A;  3L73 H;  1XNR B;  4MTO A;  4QE9 A;  3DC6 A;  5B1N A;  3E8F A;  5BMV B;  2Q7G A;  3LNN A;  4X66 O;  4CH5 A;  4LF6 B;  2F93 B;  4TQD A;  1K3E A;  2UU9 O;  5KHJ A;  1KEC A;  4GYC B;  5DN6 G;  1NH2 B;  3SPH A;  3K57 A;  1BHA A;  1IXM A;  1VQ6 V;  3AK3 A;  3OUS A;  1M90 W;  5EZY B;  4DRX B;  1ENV A;  2HP8 A;  1V55 C;  4GUN A;  3ABL C;  2WSS G;  3E89 A;  4AHC A;  2LFS A;  4O4J A;  2A0L A;  1U97 A;  3L75 H;  4FLT A;  4IYH A;  3SYA A;  1CXZ B;  2YIA A;  2ZD9 A;  2QWN B;  3AK2 A;  1MA1 A;  4F4L A;  3WU2 Z;  3WB1 A;  5AG2 A;  3K03 A;  3Q4H A;  2IH1 C;  2Q7H A;  4ZHQ A;  1VQO V;  2DE0 X;  2E5L O;  1QVF U;  1FFX B;  4TUY A;  1GN2 A;  5E79 Z;  1HNW O;  4DUZ O;  1D2D A;  3SYO A;  1BZK A;  3RYI B;  2XAG A;  1KKD A;  3P32 A;  4LFC B;  4TSF G;  1YJW V;  2P4V A;  5IYC O;  5KAI Z;  2OT5 A;  1HR0 O;  1F4N A;  5KMG B;  1NTZ H;  2QKC A;  4DV5 O;  3ZMZ A;  4FZ1 A;  2N05 A;  1PNM A;  4X62 B;  2EUL A;  4DUY O;  3CYO A;  1GKF A;  1UFI A;  1URF A;  3PN1 A;  3HKC A;  1XRE A;  5FPR A;  2MW2 B;  4QNH B;  2CGO A;  2XT9 A;  4LFA B;  3X2Q C;  5BXZ A;  3ZHT A;  3VOU A;  3CC4 V;  1YTF B;  2DMX A;  2VQF B;  4LFB O;  4DR7 B;  3N2K B;  4O4L A;  1F51 A;  3ZN0 A;  3QF7 A;  2KG7 A;  1K9M W;  1JQ0 A;  4MVU A;  4JI3 O;  1HW7 A;  5C93 A;  4I55 B;  4JI2 O;  3ZX6 A;  3D8C A;  4DV4 B;  4IHJ B;  3N2G A;  1WN7 A;  3KZI Z;  2P6J A;  2LGW A;  1F7Y A;  2ZCE A;  2VQE O;  4DV6 O;  4BW5 A;  2UUC O;  4KXR A;  1GN4 A;  5IE9 A;  3SPJ A;  2LFR A;  3CXC U;  3EFF K;  3CRC A;  2LW1 A;  1SZT A;  2VWK A;  2QEX V;  1SF9 A;  3RT3 C;  4JI4 B;  3UCS C;  4RQF A;  4MTF A;  4GKK B;  3OTF A;  3ASO B;  3ZIA G;  3QO5 A;  3HKD A;  4FLU A;  1WP7 A;  2ATK C;  2D2C B;  1FJG O;  1YJ9 V;  2QM4 A;  1H2L A;  3CX5 F;  4AI8 A;  4KHP B;  2XHB A;  5CA1 A;  2D3O W;  1P84 F;  1ZSP A;  3STL C;  1CPY A;  4X64 B;  4R50 A;  4PHZ A;  5JCO C;  5L3C A;  2Q73 A;  3E8G A;  1P7B A;  5IJ9 A;  4O2B A;  2RCV A;  3JD0 A;  2CTW A;  4R6Z A;  3AEI A;  5LXT A;  1KP2 A;  2WLL A;  5GON B;  4AIL C;  1VQ8 V;  1M1K W;  1R6K A;  4EKW A;  2XUM A;  3LDE A;  3J80 N;  1GM7 A;  2IBZ H;  4HBN A;  3L72 H;  4XDK A;  1B04 A;  1K8A W;  1WP8 A;  1WLE A;  3UKM A;  1JMK C;  4U7O A;  4MVM A;  1XQ8 A;  4RUF A;  3OGI B;  2N04 A;  5CBF A;  4X65 O;  2Q0O C;  4DK1 A;  1KP3 A;  2EIJ C;  2L35 A;  2W0F C;  3A8T A;  1W59 A;  3T4D A;  2HFE C;  5F2V O;  4D7T A;  5C8Y A;  4G28 B;  3RFR A;  2R9A A;  1G8M A;  4O2A B;  5JVD A;  4EB6 A;  4HZ3 A;  1NZ6 A;  2Y4T A;  4LH6 A;  3C3T A;  2GUZ A;  2YEV A;  3BPZ A;  3LDD A;  1TA8 A;  1S5H C;  1M9N A;  4LF8 O;  3RW0 A;  2Q0A A;  4X66 B;  4RAI A;  4TV8 A;  3ZRW B;  2UU9 B;  4H37 A;  1MNG A;  3HKB A;  2F95 B;  3F7Y C;  2F1M A;  4IGG A;  4Q20 A;  1KBH A;  4DV7 O;  1GN6 A;  1IUR A;  1KQS U;  1YIJ V;  1BCC H;  4B3R O;  1AJN A;  4JI1 O;  3JD1 A;  1M5I A;  4MW3 A;  4O4H B;  1BL8 A;  2ZDI C;  4UXN A;  3A0B Z;  1GM8 A;  4QPJ A;  4ZOL A;  3ETE A;  2R9R B;  1DLB A;  1BGY H;  3O9O A;  4MTX A;  3D3Q A;  5EIB D;  4BIZ A;  4X1K B;  4I4T A;  1QQC A;  3SJB C;  4CH6 A;  5JJJ B;  4LF4 B;  4OX9 O;  5LYJ A;  1FS0 G;  1S5L Z;  3IGA C;  1H2S B;  5JH7 B;  3FFQ A;  3A0R A;  2FYU H;  2EJR A;  3OTO O;  1JR9 A;  2R9I A;  4BIU A;  3K5O A;  2E5L B;  5KHK A;  3JSL A;  3SJA C;  3E8B A;  3H1J H;  1HNW B;  1SES A;  1P4R A;  4DUZ B;  4FIP C;  3CCQ V;  3H1I H;  3RVY A;  4TQF A;  3KCY A;  1QBZ A;  3RN4 A;  4LFC O;  2X6B A;  4H44 B;  4WFG A;  4UB8 Z;  1HR0 B;  1SA0 A;  4MTG A;  2JS5 A;  4MVQ A;  1RPR A;  4DV5 B;  4KUM A;  2HKO A;  4DUY B;  3B8N A;  5BY1 A;  1M56 B;  4F6R A;  1JX9 A;  5BR8 O;  1VEW A;  4PDV A;  3SPG A;  5LA6 A;  4GX2 A;  2LO1 A;  1YCI A;  3MD0 A;  4FM0 A;  2VRZ A;  2JEU A;  1SET A;  1Q6I A;  4BR6 A;  1YXB A;  1AP6 A;  4O4J B;  4UVA A;  4DR6 O;  4DV1 O;  4DO2 A;  1XEQ A;  2K1E A;  4JYA O;  3F5W C;  3OW2 U;  4LFB B;  2DYR B;  1XI1 A;  1FXV A;  1G4Y B;  2YID A;  2P22 C;  4ICG A;  1J5E O;  3Q4H B;  3RYC A;  4QPK A;  2ZKO A;  3KKY A;  2HJF C;  4FFK A;  1ZL8 A;  1PPJ H;  1M56 C;  4JI2 B;  4IIJ A;  4J11 A;  3QO8 A;  2ZXW B;  4WFF A;  4E2L A;  2PY5 A;  1JOY A;  1AP5 A;  3ZCC A;  4UUJ C;  4UVB A;  2UUA O;  1FPO A;  1EZV H;  2WLK A;  2VQE B;  4NVP A;  4DV6 B;  3K59 A;  3T1H O;  1H2M A;  3TK1 A;  2P06 A;  2DYR C;  4BIO A;  1LUW A;  1YI2 V;  4PV1 B;  4JI7 O;  2M7W A;  4LCU C;  4L8J A;  1TVK B;  3HKC B;  4K8Z A;  4JI5 O;  3CWB H;  3ZBH A;  3MDS A;  4UCT A;  1AR4 A;  3E2E A;  3TJT A;  3DXR A;  5DEC A;  1F23 A;  3ETG A;  5H6Q A;  2ZM6 O;  1YJN V;  2ZXW C;  3JAL B;  3JD3 A;  2OTL V;  1QR8 A;  3JAR B;  2XND G;  1EN4 A;  5HFL A;  4O4L B;  1XL4 A;  4UCV A;  3AG3 B;  1FAF A;  1DF4 A;  3ETD A;  2FL4 A;  3JAW A;  5FL7 G;  3W7U A;  3IFX A;  1YVW A;  2QKS A;  1Q6H A;  4B3S O;  2CGN A;  1Q43 A;  1AR1 B;  4DR1 B;  3UT5 A;  4ZI7 A;  4GZR B;  3JAK A;  5FLX N;  4LNU B;  4QJF B;  1S72 V;  1Z5W A;  1NTM H;  1FXH A;  2XAS A;  3M7M X;  3N2G B;  1Z5V A;  1PL0 A;  2EIM B;  2RJZ A;  4PJ0 Z;  4X1I B;  3HR0 A;  1N34 O;  2B1G A;  1I0H A;  1ZWI C;  2ITC C;  2ZE6 A;  3AG3 C;  4TV9 B;  4YJ3 A;  5LGT A;  3G67 A;  2BTQ A;  1S0V A;  3CCV V;  4MVZ A;  1LUV A;  1Y67 A;  4U3J A;  2X7R B;  3OEE G;  3TGU H;  3RYF A;  5LMN O;  2E76 B;  2ZIN A;  1NTK H;  4ZKI A;  2GSM B;  1NVP D;  2P7T C;  1GH6 A;  4LF9 B;  2EIK B;  5CB4 A;  2P4K A;  2EZO A;  4YJ2 B;  1XMQ O;  4X20 A;  1QLE B;  1NS1 A;  2DWD C;  4X1Y A;  5CA1 B;  4LF8 B;  2EIM C;  1JFF B;  2Q8V A;  2V7Q G;  5L3E A;  4HNA B;  2XAH A;  5BZB A;  1IBL O;  3SDL A;  4DV7 B;  4CS4 A;  2A7W A;  5L3G A;  4B3R B;  4JI1 B;  3R66 A;  4I50 A;  4O2B B;  1SQF A;  4FFB B;  4K0K O;  3CRA A;  2LW7 A;  3E22 A;  3FKS G;  2UXN A;  2WWW A;  2PF4 E;  2ARH A;  1Q81 W;  3SYP A;  4PDR A;  2EIK C;  2JDI G;  4X9Q A;  1IBM B;  1KYO F;  3U11 A;  3ZHU A;  1QLE C;  3S3X A;  5IYZ A;  5ITZ A;  1ZX3 A;  4OX9 B;  2ODM A;  1GAX A;  1FFT B;  3K58 A;  4LF4 O;  1S5J A;  1SQX H;  4D7S A;  3BA9 A;  3ABT A;  1VQL V;  2QDO A;  2ZR3 A;  2M6Y A;  2YXH A;  1HNZ O;  4JGS A;  3U10 A;  3OTO B;  3OFN G;  1VQM V;  3ML0 A;  2MK3 A;  4L87 A;  5C8Y B;  1NJI W;  1Y6X A;  1I5Y A;  3X2Q B;  1JA8 A;  2ZE8 A;  3E8H A;  3J7A U;  5LHH A;  3I5D A;  1YF2 A;  2GUZ B;  3NXS A;  1MSD A;  4LH7 A;  1D5A A;  4TV8 B;  5K1P A;  1OZ0 A;  5K1X A;  2A06 H;  1L0N H;  2UUB O;  1YSC A;  2ETN A;  2QGN A;  1Y66 A;  3ASN C;  2PI4 A;  4Z2W A;  2IW5 A;  3JAS A;  5BR8 B;  1XHX A;  4N23 A;  4JI0 O;  3GB7 C;  2LJ2 A;  1DTO A;  3RYH B;  3JCZ A;  4DV0 B;  4JPR A;  3DTU B;  5B3S B;  4DV2 B;  4DR6 B;  4DV1 B;  3RVZ A;  5LP6 B;  1WPB A;  4NXM O;  4JYA B;  1UPG A;  4WBN A;  1K33 A;  3THO A;  1HP8 A;  1RSO B;  3AG4 B;  1VF6 C;  1J5E B;  1SC5 B;  4PI2 A;  3L9D A;  1BE3 H;  1FXK A;  3CC7 V;  1Y74 B;  3CCE V;  1OHH G;  3ETQ A;  4YIO A;  4EFE A;  3QO7 A;  1HDJ A;  3BHP A;  2QWR B;  2E3C A;  2JJ1 G;  5EBL C;  2WLI B;  1IDS A;  4DK0 A;  3HKE B;  2H3O A;  3K08 A;  4UV8 A;  2HVJ C;  5TIS Z;  2BSK B;  3SJQ C;  2UUA B;  3FAV A;  1H38 A;  5B3S C;  1AVM A;  1FKA O;  4Z1V A;  2JGD B;  2ZT9 B;  5LP6 C;  2IJK A;  2EZP A;  4QGP A;  3T1H B;  1SQP H;  2H94 A;  5H6R A;  1MZE A;  3OMN B;  4LC1 A;  1BMF G;  1XL6 A;  4FLY A;  4TT3 G;  1N4C A;  4JI7 B;  3AG4 C;  3GWO A;  4E4E A;  1XUQ A;  1T5E A;  4JI5 B;  4OPA A;  4B7K A;  5CA0 B;  1DF5 A;  4WFB V;  2AXT Z;  4PD4 F;  1NH2 D;  5H9C A;  1TUB B;  1AB3 A;  3CMA V;  3DC5 A;  2ZM6 B;  5EC1 C;  1QCE A;  1O9H A;  4PDL A;  1RM1 B;  1SQB H;  2YXL A;  2R72 A;  4J7J A;  3JAT A;  1A32 A;  5EYP A;  3QNE A;  2F4V B;  5IWA O;  3HPL C;  3RYC B;  4LP8 A;  4CH4 A;  2E75 B;  1N32 B;  3OGC C;  2P90 A;  3ZED A;  4G2K A;  1VIB A;  2EIJ B;  4B3S B;  2QWQ B;  1XHZ A;  3W7W A;  2LP7 A;  3ABM C;  2WLH A;  1OCO B;  4DR1 O;  4OGQ B;  4IIJ B;  5BMV A;  1IX9 A;  2A9H A;  1QVG U;  2OIE A;  4DW1 A;  3E35 A;  5LGU A;  1CP9 A;  3BVO A;  2PTM A;  2Y0I A;  1L0L H;  4XBF A;  4DR5 O;  1VQP V;  4RWU A;  2HJD A;  1N34 B;  1K73 W;  1YEW A;  1RM1 C;  2FKX A;  1RFY A;  3CS5 A;  1EN5 A;  3K9S A;  5EZY A;  4DRX A;  2QR4 A;  4FM2 A;  5LOV B;  3EXA A;  4PA7 A;  2DOS A;  2E74 B;  5KUK A;  1GRJ A;  5LMN B;  3IC7 A;  4NXN O;  3CRR A;  2YSU B;  2EIN B;  2JRI A;  4P30 A;  2XAF A;  4WFA V;  5L3B A;  3CSX A;  4BWA A;  1OCO C;  1Y76 A;  4LF9 O;  2CE4 A;  1XMQ B;  3BAA A;  3F7V C;  3ABU A;  3OE7 G;  4NTY A;  3FB6 C;  1VQ7 V;  4NB5 A;  1KD1 W;  1K97 A;  2HR3 A;  2DW4 A;  5B1B B;  1M93 A;  1R6T A;  1OCZ B;  1IBL B;  3IJ4 A;  1VQ5 V;  4LWS A;  1FFX A;  2O57 A;  4PA4 A;  1IVS A;  4YHH O;  4DR4 O;  1P49 A;  4BW9 A;  5B66 Z;  4ZI7 B;  4A5U B;  3RYI A;  4K0K B;  1Q86 W;  1SRY A;  1K4C C;  1R3K C;  4K8X A;  3CB2 A;  1SER A;  2BTO A;  2Q5Z A;  3FX7 A;  2EIN C;  2PZS A;  3OEH G;  2IU0 A;  1EBO A;  1R3L C;  2JIZ G;  4KFM A;  1UJW B;  1BQ0 A;  4J9Y B;  5KAF Z;  5KLV H;  5KMG A;  1SQG A;  1E1Q G;  1Q7Y W;  3I55 V;  1IBM O;  1GO3 F;  1BS3 A;  4JYY A;  4JAU A;  5B1B C;  4LBE C;  5JQG A;  5J2U A;  2X0L A;  1OCZ C;  3P30 A;  1RP3 B;  1ROP A;  1HNZ B;  2CDY A;  1QU7 A;  3CXH F;  5IJ0 B;  1JJO A;  4QIW F;  5FPO A;  3VQV A;  4GKJ B;  2JVD A;  5CB4 B;  2PYJ A;  3EHB B;  1GK9 A;  1AJP A;  3JYC A;  4WF9 V;  5FNV A;  2EBO A;  5KHI A;  2ZIM A;  1BSM A;  1MAB G;  2ZNJ A;  1I08 A;  2IM9 A;  5HFM A;  1H2G A;  3VQW A;  1AI5 A;  3CHX A;  2UUB B;  4DR2 O;  4I55 A;  5EK0 A;  4J9Z B;  1XNQ O;  1ZUQ A;  3H1K H;  1PKX A;  5EBW C;  1NQT A;  4I50 B;  2DN9 A;  1SS3 A;  4IHJ A;  1WB7 A;  4B08 A;  3E22 B;  3STZ C;  4JI0 B;  4LF7 O;  2XAJ A;  2PYL A;  3K0D A;  1GTO A;  3EVK A;  3MAQ A;  2KSD A;  4F6E A;  4DV0 O;  1K7D A;  2R70 A;  5JCO A;  4RQE A;  4NXM B;  4DV2 O;  1AI4 A;  3BY6 A;  2P5O A;  5IYZ B;  5ITZ B;  2OWO A;  3UM7 A;  2PGG A;  4GX1 A;  2Z5U A;  3PJS K;  4HYO A;  3JSN A;  4JAV A;  4GX5 A;  3IAY A;  5A2Q N;  1NR1 A;  1SZX A;  2A79 B;  3OAA G;  4ZHQ B;  2KQX A;  1ZAU A;  2Y48 A;  2HVK C;  3CCS V;  4TUY B;  5CMU A;  5H5N A;  4ASU G;  1YHQ V;  2F66 C;  4JTC B;  3W7X A;  1XIL A;  2AW9 A;  3SPI A;  5DM6 V;  2UXB O;  1TAE A;  3FB5 C;  1LNQ A;  1IBK B;  5L3F A;  3A2F A;  2QJ1 A;  5E1A C;  3CP1 A;  3ZMV A;  4FLV A;  2GTA A;  5LBQ A;  5GON A;  2DYS B;  1M4U A;  3BEH A;  3B40 A;  3B4S A;  3BCC H;  5GW7 A;  1E79 G;  4Z1M G;  2WA3 A;  1MOF A;  2WPD G;  1R3J C;  1R6N A;  1R1B A;  2FTK A;  1YZB A;  1PD3 A;  4YXW G;  1JJ2 U;  5IDJ A;  4JI6 O;  3SR2 C;  3K04 A;  5J2T A;  3G6B A;  3UQ8 A;  2AZ2 A;  3FB8 C;  2G38 A;  3FYI B;  1SQV H;  2CTQ A;  4NR1 A;  1VQ9 V;  2ZDI A;  4PEL A;  2ADP A;  5IWA B;  4PA3 A;  2KG7 B;  4PDM A;  4NTX A;  2F4V O;  2Z3Y A;  3CCM V;  1FXK B;  4MS2 A;  4MW8 A;  1N32 O;  3CCL V;  5IY5 B;  2GBO A;  1THZ A;  2A3Q A;  2ILM A;  2DYS C;  2UXD O;  4UCO A;  1VQN V;  3D3I A;  2ZE5 A;  4C7U A;  2BCC H;  1XBL A;  2FML A;  4KL1 A;  1L8D A;  2Z0A A;  2X6C A;  4DR5 B;  3SYC A;  4B3M O;  4CS3 A;  4GLX A;  4FK5 C;  4NTW A;  4O4I A;  4GCZ A;  3D36 A;  3KG2 A;  2OTJ V;  1O9G A;  4O4H A;  3CRM A;  2JJ2 G;  1QNM A;  5A9G A;  4NXN B;  1FXK C;  4GT1 A;  3CCR V;  1PNK A;  4X1K A;  3M99 B;  5IY5 C;  1PP9 H;  3HKD B;  2WA4 A;  4JAS A;  3LNM B;  1XDC A;  4JV5 O;  4W4L A;  3WB0 A;  4UCR A;  1VQ4 V;  1ORQ C;  5JH7 A;  1N33 O;  2W0X A;  4R7C A;  1AJQ A;  1FD9 A;  3TXQ A;  1Z2G A;  2BOB C;  2CH7 A;  3N27 A;  4H13 B;  4J10 A;  2GV9 A;  2ZNI A;  4YHH B;  4DR4 B;  3I56 V;  2JK5 C;  5IJ9 B;  2GDS A;  4G27 B;  5KHG A;  4R8C A;  2QWP B;  3NR7 A;  4HAM A;  2ITD C;  4CBC A;  5LXT B;  2WLL B;  4OPH A;  2YI8 A;  1P7G A;  2Q69 A;  4FLW A;  4J42 A;  3SGI A;  2PI5 A;  3ZHV A;  2IJH A;  2EJ7 A;  1VQK V;  3FYE B;  4FLZ A;  3G71 V;  2CUG A;  4CH3 A;  4D6T H;  1WJZ A;  4DR3 O;  3CJH A;  1IXB A;  3WB2 A;  2YIB D;  3P3N A;  3ASN B;  3MHH C;  2OYQ A;  4RO2 A;  3OUF A;  3RGB A;  5LMU B;  5CA3 A;  1VP7 A;  4B3T O;  1PM9 A;  1DGS A;  2JS3 A;  3K5N A;  3LSU A;  1X59 A;  1US6 A;  1Y76 B;  4WCE V;  3T1Y B;  3GVM A;  4GKJ O;  4KP4 A;  5JVD B;  4EB6 B;  2IJI A;  3ZRX A;  5KA6 A;  5IYD O;  2DQ3 A;  5EC2 C;  4ABM A;  2YEV B;  4XDJ A;  2YC0 A;  3JD4 A;  4Q6G A;  4J41 A;  4EEQ A;  2X6A A;  4H33 A;  1KU9 A;  2RMK B;  4JZG A;  4W4K A;  2K9P A;  4LR3 A;  3VBB A;  3W7T A;  3HKB B;  1N36 B;  4LWS B;  4DR2 B;  4FZ0 A;  4J7Z A;  3ICX A;  1XNQ B;  1K92 A;  3ZJZ A;  3QTC A;  4DXW A;  3H1L H;  5LL6 Y;  2NN4 A;  4K35 A;  1G1X B;  3OM3 B;  2YIB A;  4LF7 B;  3AG2 B;  2P67 A;  4B7E A;  4U3F H;  2XTA A;  3G4S V;  4ZOL B;  4FM1 A;  5KX5 A;  4I4T B;  2QTS A;  1K34 A;  2F43 G;  3OMA B;  4WFH A;  1WA8 A;  3L71 H;  1TVK A;  1F4M A;  3VQX A;  5CBH A;  5JQG B;  5J2U B;  5LYJ B;  4LF5 B;  2IU3 A;  2OCH A;  2Y4U A;  4TOI A;  1W2B U;  3SJC C;  5L3D A;  2HHH B;  2AHZ A;  3JAL A;  1OCC B;  2NLJ C;  4N21 A;  3JAR A;  4X89 A;  4U7N A;  1N0J A;  1MMM A;  4NKG B;  4XDL A;  3AG2 C;  5FNV B;  4P9O A;  2RQ6 A;  3GWK C;  1SKV A;  4RUE A;  3CCJ V;  2QSA A;  3CEI A;  3JCU Z;  2BOC C;  2Q6A A;  2UXB B;  2N74 A;  3VQY A;  1SA0 B;  2QWO B;  1NU1 H;  1IBK O;  4IT5 A;  2VS0 A;  3TET A;  1H2K A;  3B09 A;  4LNU A;  3U0Z A;  1N0N A;  3ZHR A;  4DV3 O;  4F6R B;  3ABM B;  1WB8 A;  1G6U A;  5LA6 B;  4I5S A;  1VAR A;  3R65 A;  3CRQ A;  2B9Z A;  4X1I A;  1OCC C;  4JI8 O;  3LSQ A;  4MSW C;  3CME V;  1XMO O;  5LGN A;  2UXC O;  4DYL A;  4J7K A;  4JI6 B;  3SYQ A;  4JTA B;  2RN9 A;  4TV9 A;  1BT8 A;  1KB9 F;  4PI0 A;  3LSS A;  2WLJ A;  1KMI Z;  2OCC B;  2V4D A;  2HLD G;  4I0X A;  1B06 A;  1NBM G;  5EIB C;  4TWK A;  3ZMU A;  4I7Z B;  1GMG A;  3FB7 C;  1S3J A;  2Y69 B;  3ZRS A;  2EIL B;  1U96 A;  1ZL8 B;  1D5N A;  4YJ2 A;  2EX3 A;  5KUM A;  3DGE A;  3G80 A;  1H8E G;  2UXD B;  1OV9 A;  3OMI B;  4I9W A;  3H1H H;  1NT2 B;  1JFF A;  1NR7 A;  5LHI A;  3A0H Z;  4X88 A;  2YXY A;  3AG7 A;  1TUE B;  5JJE B;  1CEZ A;  4HNA A;  4X8A A;  1ZTE A;  2FB5 A;  5D5Q A;  2DQ0 A;  3AG1 B;  2QKA A;  1HNX O;  3J81 N;  2Q4P A;  1J95 A;  4B3M B;  2YUA A;  4CC5 A;  4YY3 O;  4FFB A;  4FMT A;  2XAQ A;  2OCC C;  2ADQ B;  1I94 O;  1AIL A;  3E86 A;  3OT7 A;  1FYJ A;  2QE7 G;  4CC6 A;  3ASO C;  1YIT V;  5DED A;  1PV0 A;  4UVC A;  2Y69 C;  1MG1 A;  2EIL C;  5CN0 A;  4EFB A;  4AQY O;  1JCH A;  1I7F A;  3DXR B;  1R3I C;  4JV5 B;  4MVS A;  1BQZ A;  2DJV A;  4J80 A;  5J2T B;  1S76 D;  1M57 B;  1N33 B;  3BAB A;  2B1I A;  3AG1 C;  3DSQ A;  4FPP A;  3JAW B;  3K9A A;  5KHH A;  3RWR D;  5H2F Z;  2PUS A;  1YTF D;  2UXX A;  3CE2 A;  3UT5 B;  1QR9 A;  1XNR O;  3JAK B;  4JZ2 A;  1COW G;  4QE7 A;  3K79 A;  3E83 A;  1JVM A;  3T4Z A;  2ZIO A;  4LF6 O;  5B1A B;  1VF6 A;  1DK1 A;  1X4T A;  1AI6 A;  4FJC C;  3K06 A;  5KA5 A;  2V1D A;  1OCR B;  2OIG A;  2IH3 C;  1SQQ H;  2H8P C;  4O4I B;  1VMG A;  1M57 C;  1W0K G;  4DR3 B;  3JAM N;  3M8A A;  1ZLZ A;  5CBG A;  4P2Z A;  4YJ3 B;  2BTQ B;  1V9P A;  2YS8 A;  3RYH A;  3B77 A;  3ZMT A;  4U3J B;  4B3T B;  3L70 H;  5LMU O;  3RYF B;  3CCU V;  3K0G A;  1AR5 A;  3ZHQ A;  5J9P C;  1KKC A;  4I9Q A;  5LP6 A;  2L6L A;  4WFE A;  4YIP A;  3T1Y O;  1MZF A;  1E1R G;  1EZJ A;  3QG5 A;  3N2K A;  5EBM C;  3LUT B;  4IL6 Z;  4X20 B;  1QLN A;  3B2E E;  4UCS A;  1RSO A;  1TGO A;  4PA6 A;  1NKD A;  5B1A C;  4X1Y B;  5B1O A;  1K5S A;  3K5M A;  1BHB A;  1Q82 W;  1I5X A;  1OCR C;  3IC9 A;  4GX0 A;  1Y74 A;  2CH7 B;  4P9P A;  3TCU A;  5D5P A;  1IZ3 A;  4MVO A;  1N36 O;  2LQT A;  2ZE7 A;  5B5E Z;  3D36 C;  1B3Q A;  3ZMS A;  1XOU A;  2CTP A;  4CZZ A;  2WLI A;  1PNL A;  1R73 A;  3HKE A;  1OJH A;  2BSK A;  3ABK B;  3FD9 A;  2JGD A;  4JF3 A;  2ZR2 A;  1L1F A;  3QVN A;  1NVP B;  3L74 H;  3H9V A;  4X62 O;  1EM1 A;  1N8R W;  3JD2 A;  3K5L A;  1MSW D;  2NNU A;  4JYC A;  2QM7 A;  3CJH B;  5CA0 A;  4LF5 O;  1S77 D;  3W7S A;  4UFZ A;  3ZS8 C;  3OR7 C;  1TUB A;  4LFA O;  2WLN A;  3C3S A;  3P3P A;  2HHH O;  2F23 A;  3APQ A;  5IYB O;  1LR1 A;  1Q5O A;  3ZRV A;  2CK3 G;  2VQF O;  3ABK C;  2Q7E A;  4DR7 O;  2NR5 A;  3UO3 A;  1YDX A;  4JTD B;  4JI3 B;  1EFR G;  1B6Q A;  1K4D C;  4FVM A;  4FLX A;  2B5U A;  2Q68 A;  4DV3 B;  4DV4 O;  3JAS B;  2BE3 A;  4JAA A;  3CPW U;  1ARO P;  2YDE A;  2WLM A;  1Q90 D;  2YIC A;  5KX5 B;  4JI8 B;  4PA9 A;  3K3W A;  2QM8 A;  1XMO B;  2UUC B;  2C2A A;  2UXC B;  1AI7 A;  5LOV A;  1WA8 B;  5JWP A;  1KC8 W;  4ZIB A;  1WAZ A;  3MHS C;  2IJJ A;  4WBN B;  2RDC A;  3HB3 B;  3T2M A;  2YI9 A;  5JJN B;  1Y4M A;  2ZQM A;  1VF7 A;  2KKW A;  1GN3 A;  4JI4 O;  2QA4 V;  4BAY A;  4GKK O;  1FJG B;  3APO A;  3T1C A;  3TXS A;  1H2N A;  4O2A A;  4NYK A;  1WNS A;  1Q6U A;  4KHP O;  4UB6 Z;  2GHY A;  1K5Q A;  3C90 A;  2WAM A;  5IT9 N;  4MVR A;  3ZRW A;  2XOK G;  4UCU A;  2AZ0 A;  3OD4 A;  1HNX B;  3AK1 A;  4X64 O;  3FAV B;  2VWJ A;  1H8H G;  3LDC A;  3F5T A;  4DW0 A;  2Y0P A;  5GTH Z;  1HWY A;  1V54 B;  4MT8 A;  2QTO A;  4YY3 B;  3BRC A;  3UO2 A;  1I94 B;  2Q9L A;  1EN6 A;  2AGA A;  4IYI A;  3RBZ A;  3WG7 B;  4H0L B;  2JEX A;  3S3W A;  2LGQ A;  2AHY A;  3OR6 C;  1W0J G;  1GM9 A;  4AQY B;  1Q8I A;  2Q67 A;  2W6I G;  3ZHS A;  3G6E V;  3O65 A;  2HG5 C;  1PL4 A;  5GTI Z;  3BA8 A;  3CC2 V;  2GTS A;  1VF5 B;  1JPX A;  3WFV A;  2HEP A; 
#chains in the Genus database with same CATH homology
 3J81 N;  4JYA O;  1XNQ O;  1FKA O;  4DV7 O;  1HNZ O;  3T1Y O;  4LF9 O;  4OPH A;  4B3R O;  1HR0 O;  4DV4 O;  1FJG O;  4JI1 O;  4YY3 O;  4DV5 O;  4LF7 O;  1J5E O;  2F4V O;  1I94 O;  1KUQ A;  4DUY O;  1AIL A;  1N34 O;  2ZKO A;  1FYJ A;  1N32 O;  1R6T A;  4OPA A;  4DV0 O;  3J7A U;  4DR3 O;  1N36 O;  4DV2 O;  2UXD O;  4AQY O;  4YHH O;  4DR4 O;  2N74 A;  4X66 O;  1AB3 A;  1IBK O;  5LMN O;  4B3T O;  5BXZ A;  2DJV A;  4A5U B;  2UU9 O;  4OX9 O;  2UUB O;  1X59 A;  2Z0A A;  1HNX O;  2UUA O;  4JI4 O;  4GKK O;  4GKJ O;  4B3M O;  5A2Q N;  4LFB O;  4DV3 O;  1A32 A;  3OTO O;  3T1H O;  1XMQ O;  1NS1 A;  3J80 N;  4JI0 O;  5IWA O;  4X62 O;  4KHP O;  1IBM O;  4JI7 O;  4DV1 O;  4JI8 O;  5H5N A;  5IT9 N;  4JI5 O;  4JI3 O;  1XMO O;  1IBL O;  4DR1 O;  1XNR O;  2UXC O;  4LF5 O;  4X64 O;  4NXM O;  3SDL A;  4JI2 O;  4LFC O;  2UXB O;  4X65 O;  3F5T A;  4LFA O;  5LL6 Y;  4LF6 O;  4JV5 O;  3R66 A;  1G1X B;  1DK1 A;  2ZM6 O;  2HHH O;  4K0K O;  2LW7 A;  4DR5 O;  2AGA A;  1N33 O;  1F7Y A;  4JI6 O;  5BY1 A;  2VQF O;  2FKX A;  2VQE O;  4DV6 O;  4DR7 O;  5BR8 O;  3JAM N;  2E5L O;  3M8A A;  2UUC O;  4LF8 O;  2DOS A;  1HNW O;  5LMU O;  4DUZ O;  4B3S O;  3O65 A;  1D2D A;  4NXN O;  1R1B A;  1YZB A;  4LF4 O;  4DR6 O;  4DR2 O;  2JRI A;  5FLX N;  3RT3 C;  1XEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...