3J80S

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 21
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j80S01
4DV0M 3W0FA 4CISA 1K3WA 4DR2M 3SAVA 5IWAM 4DUZM 3GPUA 1L2BA 4DV5M 5LMUM 1IBMM 2F4VM 4JYAM 4KHPM 1R2ZA 1L2CA 4DR6M 3U6OA 1XMQM 4B3TM 4G4QA 3U6SA 5ITXA 5A2QS 5ITXE 3T1YM 3GQ4A 2HHHM 4LFCM 4X62M 4OX9M 5ITRA 3SASA 1Q39A 1KFVA 4JI5M 1IBLM 2UUAM 5ITYA 4JI6M 1XNRM 3TWKA 4LF4M 2VQFM 3A45A 3U6MA 1MX0A 1N34M 4PD2A 4JI2M 4K0KM 4JV5M 4LF6M 4DR5M 2F5SA 2UU9M 1HNWM 3TWLA 2VQEM 2XZUA 3GPXA 4AQYM 3VK8A 1K3XA 4B3SM 4YY3M 3U6EA 3U6DA 1XMOM 1NNJA 2UXBM 1Z5BA 4G4RA 2F5QA 1MU5A 4PDIA 3J80S 4JI0M 1EE8A 1PM5A 3J7AS 3TWMA 5ITUA 2ZM6M 1XC8A 5LMNM 3GO8A 4PDGA 3OTOM 4DR7M 3T1HM 4X64M 4DV4M 4DV6M 1PJJA 1Q3BA 1Z5CA 4GKJM 4DV3M 2F5PA 1XNQM 1HNZM 1IBKM 3DOAA 1N33M 3SARA 1TDHA 2OPFA 3SAUA 2F5OA 4JI4M 2HKJA 2OQ4A 1TDZA 4DV1M 4DR4M 4DV7M 1N32M 4B3RM 3U6PA 1HR0M 4B3MM 2EA0A 1J5EM 2UXDM 3U6QA 4G4NA 4X65M 4X66M 3A42A 3GQ5A 3GPPA 3SAWA 1N36M 3SATA 4JI7M 2Q2EB 1R2YA 4LF9M 2UXCM 4PCZA 4YHHM 1L1ZA 4LF7M 4ITQA 4LF8M 3GPYA 3C58A 1L2DA 3GQ3A 3J81S 4NRWA 5ITTA 4DR1M 4LF5M 4MB7A 1HNXM 2XZFA 5BR8M 2E5LM 2UUCM 1Z5AA 1K82A 4NXMM 1FJGM 1I94M 4NXNM 4JI1M 1Z59A 1PJIA 2UUBM 3VK7A 4DV2M 4LFBM 4JI3M 3GP1A 4G4OA 3SBJA 4LFAM 3U6CA 4GKKM 3JR5A 3JR4A 4NRVA 5ITQA 1Q3CA 4DUYM 4JI8M 5FLXS 2F5NA 4DR3M 3A46A 1L1TA 5IT9S 3JAMS 3U6LA 2ZBKB
chains in the Genus database with same CATH superfamily
1MJGM 4DV0M 2ERCA 3W0FA 4LG2A 1DGBA 1SXJB 2G3QA 3GPUA 1ZMVA 4XGIA 1IBMM 3KXEC 1QZMA 5FTNA 3FTFA 3LW5F 3FYCA 5KPTA 1GJSA 2KEBA 2VF8A 4LJ4A 1Y8GA 5FTLA 3QYBA 5EXTA 3EIEA 4AI6A 1QUSA 4IBJA 4G4QA 2J7NA 1TTEA 3KOYE 3FRIA 3SYLA 3GQ4A 4GEWA 3TQSA 4OX9M 2QQ8A 4AKIA 3FUTA 4IBGA 2DNAA 2YNMD 1QAOA 2JY7A 5EXPA 4JI5M 2RGHA 3SHFA 4JI6M 3GLGE 1IN4A 2GQFA 4LF4M 4RF1A 1GLNA 2OOAA 1MX0A 3GLFA 1OJLA 1GKIA 3R9XB 4PD2A 4JI2M 5IZ7D 1NJGA 1SXJC 4DR5M 3GPXA 1NHGC 3U60A 2Z3XA 4D82A 1E9RA 2KNZA 2L2DA 4QNMA 4YY3M 2Z4RA 4LZZA 1IM2A 3HHXA 4R7GA 2JY5A 3VKGA 2F5QA 1DGHB 1MU5A 4DBGB 4PDIA 4KT0F 2R65A 2B3TA 1W5SA 1WHCA 4CHTB 3QAUA 3E46A 4LJ6A 3KSJA 4OU7A 5LMNM 3LMMA 4PDGA 1VG5A 1MN3A 2BWBA 1QVRA 2HWJA 3SYKA 5H37D 4X64M 4DV4M 4L6V6 1Z5CA 4MM3B 4L15A 1JR3D 4FWDA 1IXRC 1AIPC 1QAMA 4I8OA 5KQ8A 1YSYA 3SARA 1TDHA 2Z7JA 1GABA 2MROB 3PNVA 3U6PA 2LNHC 3CF0A 1G59A 2EA0A 2C5RA 3UGJA 1NV8A 2HAKA 3LQRA 4G4NA 5EJCA 3KP0E 5DYIA 4B7FA 3A42A 3GQ5A 2L4EA 1VDDA 3W0LB 3HHWA 2G5GX 3SATA 1HQCA 3KW6A 4LF9M 3U61A 1OIPA 4M9SA 2UXCM 3VDUA 3VKHA 3GRYA 5KPZA 4LF8M 3GPYA 4BLCA 3C58A 2WSCF 3PVSA 3GQ3A 2Z4SA 2RGOA 2K9DA 3MJ5A 4LCBA 4MGZE 4LJ5A 4DR1M 4LF5M 1T6OA 3SC3A 2Y20A 2DWNA 3B9PA 1TR8A 4LGYA 4AKGA 4NSRA 2UUCM 2EKFA 4Z6YA 4NXNM 1Z59A 4MGIE 2UUBM 4BBAA 1R7RA 3FTEA 3IECA 3HY5A 3VK7A 3L29A 5EP2A 4AKHA 3KP1E 4LFBM 1IXSB 2X4AA 3LCUA 1RU3A 4LFAM 4G3OA 4XBOA 3JR5A 1R4GA 1OFHA 2BWEA 3JR4A 4RF0A 5ITQA 1SXJD 1Q3CA 3GLIE 4DUYM 2ZAOA 2LVQD 1G4AE 1SXJA 2DAGA 3V76A 2R6FA 5FLXS 2L09A 1C1KA 2V1UA 4L78A 3CGWA 3KS4A 1OFIA 3A46A 2DAKA 3J7BA 2DAIA 3NWLA 3T6PA 3EIHA 2JP7A 1VEKA 3U6LA 1N77A 3AL0C 2ZBKB 2J5YA 1WGLA 4L16A 3BOSA 2WSEF 3FYDA 1OAIA 4DR2M 3J27B 4GHLA 1W5TA 1L2BA 5EQTA 2DWZB 3CTWB 4KHPM 1R2ZA 3GLHB 3U6OA 1FNNA 3RE8A 4GC5A 3FUWA 5FSWA 1DGGA 7CATA 3GLFB 2KNAA 4CJ6A 3U6SA 3K1JA 3T1YM 5EXSA 4X62M 5ITRA 3GLFE 2ZANA 2VDBB 3SASA 2LWXA 3QWLA 3D8LA 5DNYA 1IY1A 3I51A 5ITYA 2R18A 2KXEA 1TH4A 3IG5A 1PGYA 2LHGA 1GVNA 3FTDA 2APLA 1JQJC 3B89A 3BXWA 3L27A 3U6MA 2CFOA 1G41A 2G8LA 1N34M 3I4VA 4HEOA 2LVPC 1GO5A 4WURA 4JN6A 2DAMA 1SXJE 2UU9M 3VFDA 2VQEM 2C99A 1HQYE 4AQYM 1SG9A 4NSOB 3I4YA 1K3XA 1QDRA 3U6DA 2L4FA 1XMOM 1Z5BA 2AHMA 4RNAA 5DYGA 1A5TA 1WJ7A 3HJQA 3TL4X 4JI0M 2C9OA 3FTCA 1PM5A 3TWMA 5ITUA 5KQDA 1TH2A 4JXJA 2CE7A 3J7AS 3PFIA 1XC8A 3GO8A 2I7PA 4I5SA 2JY6B 1NY6A 3KSXA 4DR7M 2K47A 3FUUA 3GLHE 1IXZA 3KOZE 3ZH9B 4AG5A 5L8RF 1Q3BA 4GKJM 2LVOC 2O01F 2JZ1A 3DOAA 1KYIA 1ZQ9A 5EXXA 3IHPA 4QOZC 1NO1A 4M0WA 2OPFA 2N35A 4GIPA 8CATA 2KRUA 4DV1M 5KPRA 2BNKA 4DV7M 1J09A 1VEJA 2XSZD 4B3MM 2MGWA 2RKOA 4AW4A 4G6ZA 4LGMA 5EP4A 2NQ8C 4A3VB 3B74A 3DFZA 2LVAA 3HGIA 3GRRA 1P3QQ 3GLIB 1IN7A 3SMPA 2Q2EB 4FCVA 3UZUA 3WHLA 1XXHA 2FH0A 3H4JA 2KW0A 3RGPA 4IBFA 1NNUC 1L2DA 4FCTA 4LJ8A 1KSFX 3AOEC 1D2NA 1OAOC 2XFTA 1V34A 1N78A 5GKNA 3MMPA 1Z5AA 1I4WA 2QHOB 1WGNA 1GJTA 2KZUA 1XXHB 1JB0F 1G3IA 2KHHA 1PJSA 3C3DA 4FVMA 2K6BA 1D0KA 3GLGA 3F92A 3E9SA 2ZTDA 4DV2M 3R8FA 4JI3M 5IREB 4G4OA 4NL4H 2KA6B 1TH3A 4IBEA 4NRVA 3PXGA 2I7NA 2M60A 2R0IA 1T43A 2ZAMA 2DXIA 4JI8M 5DFLA 3M6AA 3U5ZB 1TGUA 4W5WA 1IXSA 2F5NA 2CP8A 4R71A 2JWSA 3IG8A 4LRSA 1NV9A 4F1IA 2QCUA 2DZNB 2VIIA 3KDSE 4B08A 3K9OA 3FE3A 4P17A 1K3WA 5IWAM 4DUZM 3NBXX 1C7YA 3RGSA 4JYAM 1HT2E 4OW0A 2K0BX 2A5YB 1L2CA 1XMQM 4B3TM 1NVMA 4KODA 4PT5A 4M9XA 2CHQA 5FTJA 2D7GA 1WXQA 2KZSA 3ZC7B 1AUAA 4AZFA 4FW9A 4M0DA 1IBLM 2H1RA 2Y21A 2Z8YM 2UUAM 3U60B 2WZJA 2Y0QA 1LV7A 3ZCBB 1XNRM 1QANA 3TWKA 3M0EA 3B7QA 2VQFM 1VQ1A 1G71A 2EKKA 1PJTA 1NJFA 2X49A 2XSZA 3K8ZA 4K0KM 5JI3E 2F5SA 1J7KA 2FS1A 1HNWM 3TWLA 2XZUA 4RKUF 5KO3A 3W68A 2KRKA 2FOIC 1R5LA 2W82A 1EFUB 5E6JA 1JR3A 3VK8A 2Y0TA 1CUKA 1N75A 1IN8A 3UMMA 1NNJA 2DKLA 4G4RA 2WSFF 3J80S 3UK6A 1S3SA 2FE8A 2JY8A 4I81A 2DZLA 2ZM6M 3RFWA 4MGHA 2R4EA 4FCWA 3OTOM 3T1HM 2HL7A 4REZA 5C18A 4LJAA 2DWMA 2DENA 1TF0B 1E9SA 4Y28F 1HNZM 1DGHA 2LTUA 4S12A 3VDPA 3GLIA 1N33M 2F5OA 2OQ4A 3J2PB 4EIWA 1TDZA 5E26A 4DR4M 3LCVB 2EJSA 4B3RM 3CF2A 3QYEA 2MR9A 1HR0M 1N32M 2LH0A 1J5EM 1GL6A 1NSFA 3T38A 4NOOB 1IN5A 4Z8XA 4UN2B 2XH9A 4KO8A 3M7GA 1V92A 1YE9A 4LY6A 1PJQA 3B7ZA 3GPPA 2QZ4A 1OIZA 2D7EA 2GNOA 1DO2A 1V33A 4GMQA 3AFHA 1L1ZA 4IIWA 1PRBA 4KLNA 4ITQA 3HZJA 1JR3E 3PNYA 4LJ7A 5ITTA 4MB7A 2CV0A 2FFJA 1QAQA 2C96A 4NC6A 3E21A 2XZFA 1IN6A 2BJWA 2E5LM 1QZEA 1FJGM 4NXMM 3HU2A 1I94M 4GRIA 1BVSA 3B7NA 3Q8GA 2CWBA 1E32A 4QNRA 4JI1M 3U5ZA 4HLQA 5FTMA 1UM8A 3Q8XA 4CGYB 3GP1A 3SBJA 2FNAA 3L26A 3H4MA 1XB2B 3U6CA 4GKKM 1WR1B 3SMSA 2JZ0A 1Z6TA 2DHRA 3BBZA 1ORYB 3GLGB 4QOSA 1VEGA 3GLHA 2C9CA 3THGA 4DR3M 1D0MA 4R3DA 1L1TA 4GITA 3JAMS 4MH0E 3TE6A 1X37A 3HHYA 3AOEA 4CISA 3SAVA 4IBDA 1EIJA 2OOBA 4DV5M 1WIVA 2DI0A 3LVVA 5LMUM 1ZMUA 2F4VM 4MGKE 1OTRA 1IQPA 4DR6M 2LXEA 1XWIA 1YLAA 3DZDA 3SHGB 4II7A 5ITXA 5ITXE 5A2QS 2HHHM 4LFCM 1Q39A 2R62A 1YUBA 4Q7JA 4AG6A 3KOWE 1KFVA 2M5ZA 1QQWA 2EO2A 3HKPA 4F2LA 3KOXE 3VLFB 3I04M 2DVWB 4LJ9A 3HHZA 3A45A 1QDTA 2CRUA 1H6UA 1QYRA 2X8AA 4FWHA 3W67A 4CIZA 5BPVA 4IBBA 4D80A 2CHGA 1IFYA 2ZTCA 4L4UA 4JV5M 4LF6M 4IBIA 3A98B 3LVWA 2RRUA 5JI2E 4IJEA 3HU3A 4QHTA 2HCBA 3GRUA 3FD9A 1UFZA 1NHWC 2V1CA 4B3SM 3U6EA 2XEPA 4TUWA 1XHBA 2UXBM 1R6BX 1ZAEA 2KDLA 2LHCA 4GH9A 4GHAA 1EE8A 2J7OA 3L28A 4WP2A 3AJIB 5EP1A 2QENA 4WW0A 1NY5A 3NBIA 1QUTA 4FD2A 2L6OA 2XFSA 3LQQA 2H5XA 3AV0A 2QSFX 2R4JA 2EUCA 3DA1A 4DV6M 1PJJA 3HU1A 2CEAA 2XLJA 3L25A 4DV3M 2F5PA 2OO9A 1XNQM 1HT1E 1D0LA 2YR0A 1IBKM 4IBCA 1DGFA 4MGYE 1G8PA 2CV1A 2QBYA 2O25A 2QNJA 2JA2A 3SAUA 2V6ZM 2HKJA 3ZQJA 4JI4M 2R44A 3GRVA 3MHVC 1XXHE 1OQYA 3L2AA 3MK6A 4P16A 4I4LA 2UXDM 3U6QA 3AKZA 4X65M 2CHVA 2C98A 4GC9A 4X66M 3SAWA 3UJNA 4XK8F 3HJSA 1N36M 2L7IA 1OKSA 2QBYB 4BB9A 4JI7M 1R2YA 1HJPA 4L8RC 4PCZA 1LTMA 4YHHM 2QPAA 3D8BA 5FTKA 4LF7M 4HL4A 4ZPXA 4LRTA 5C1BA 3J81S 2CUZA 4NRWA 3I01M 3K92A 3FUXA 4D81A 2YQZA 3FRHA 2R45A 3FKEA 4QHSA 1HNXM 5BR8M 2L7HA 2QP9X 3HJ8A 1K82A 3KS8A 3U61B 1ZV1A 1L8QA 1PJIA 2XF3A 2P5TA 3ILKA 3HX3A 3T15A 2JNHA 3K2LA 2JXNA 2R46A 4OVZA 4ANRA 2DWLA 2LBCA 3HWSA 5F3WA 1ZMWA 5EP3A 4FWGA 2D7HA 3C9PA 2O5RA 1DO0A 1T3TA 2LVNC 2XGNA 4IBKA 4M9ZA 3FUVA 4B7HA 1E94E 2VF7A 3SFZA 2BJVA 3CF6E 3KVWA 2CV2A 2MH8A 2YFQA 3KFUG 4LZJA 1GL7A 1Q02A 1IY2A 1VDLA 3WHKA 2MJ5B 2JUJA 4B7GA 3E4RA 2DZOB 4OVZB 3K9PA 1IY0A 2KNVA 3AOGA 2DAEA 3C3EA 5IT9S 1DV0A 2DHYA 1F4IA 3TPZA 4IJFA
chains in the Genus database with same CATH topology
4DV0M 2ERCA 3W0FA 4LG2A 1DGBA 1SXJB 3GPUA 4XGIA 1IBMM 3KXEC 1QZMA 5FTNA 3FTFA 3FYCA 5KPTA 2KEBA 4LJ4A 5FTLA 4AI6A 5EXTA 3EIEA 4IBJA 4G4QA 2J7NA 3KOYE 3SYLA 4OX9M 3GQ4A 3TQSA 4AKIA 3FUTA 4IBGA 2YNMD 1QAOA 5EXPA 4JI5M 2RGHA 3SHFA 4JI6M 1IN4A 4LF4M 4RF1A 1GLNA 1MX0A 3GLFA 1OJLA 1GKIA 3R9XB 4PD2A 4JI2M 5IZ7D 1NJGA 1SXJC 4DR5M 3GPXA 1NHGC 3U60A 2Z3XA 4D82A 1E9RA 4QNMA 4YY3M 2Z4RA 4LZZA 1IM2A 3HHXA 4R7GA 3VKGA 2F5QA 1DGHB 1MU5A 4PDIA 2R65A 1W5SA 4CHTB 3QAUA 4LJ6A 3KSJA 4OU7A 5LMNM 3LMMA 4PDGA 1QVRA 4X64M 3SYKA 5H37D 4DV4M 1Z5CA 4MM3B 4L15A 1JR3D 4FWDA 1QAMA 1IXRC 4I8OA 5KQ8A 1YSYA 3SARA 1TDHA 2Z7JA 3PNVA 3U6PA 2LNHC 3CF0A 1G59A 2EA0A 2C5RA 3UGJA 3LQRA 4G4NA 5EJCA 3KP0E 5DYIA 4B7FA 3A42A 3GQ5A 1VDDA 3W0LB 3HHWA 2G5GX 3SATA 1HQCA 3KW6A 4LF9M 3U61A 4M9SA 2UXCM 3VDUA 3VKHA 3GRYA 5KPZA 4LF8M 3GPYA 4BLCA 3C58A 3GQ3A 3PVSA 2Z4SA 2RGOA 4LCBA 3MJ5A 4MGZE 4DR1M 4LJ5A 4LF5M 3SC3A 2Y20A 2DWNA 3B9PA 4LGYA 4AKGA 4NSRA 2UUCM 4Z6YA 4NXNM 1Z59A 4MGIE 2UUBM 4BBAA 1R7RA 3FTEA 3VK7A 3L29A 5EP2A 4AKHA 3KP1E 4LFBM 1IXSB 2X4AA 4LFAM 4XBOA 3JR5A 3JR4A 1OFHA 4RF0A 5ITQA 1SXJD 1Q3CA 4DUYM 2ZAOA 1G4AE 1SXJA 2V1UA 5FLXS 2L09A 1C1KA 4L78A 3KS4A 1OFIA 3A46A 3J7BA 3NWLA 1N77A 3EIHA 3U6LA 3AL0C 2ZBKB 4L16A 3BOSA 3FYDA 4DR2M 3J27B 4GHLA 1W5TA 1L2BA 5EQTA 2DWZB 3CTWB 4KHPM 1R2ZA 3GLHB 3U6OA 1FNNA 3RE8A 4GC5A 3FUWA 5FSWA 1DGGA 7CATA 3GLFB 3U6SA 3K1JA 3T1YM 5EXSA 4X62M 5ITRA 2ZANA 3SASA 2LWXA 3QWLA 3D8LA 5DNYA 1IY1A 3I51A 5ITYA 2R18A 2KXEA 1TH4A 3IG5A 1GVNA 3FTDA 1JQJC 3L27A 3U6MA 2CFOA 1G41A 2G8LA 1N34M 3I4VA 4WURA 4JN6A 1SXJE 2UU9M 3VFDA 2VQEM 2C99A 1HQYE 4AQYM 4NSOB 3I4YA 1K3XA 3U6DA 1XMOM 1Z5BA 2AHMA 4RNAA 5DYGA 3HJQA 3TL4X 4JI0M 2C9OA 3FTCA 1PM5A 3TWMA 5ITUA 5KQDA 1TH2A 4JXJA 2CE7A 3J7AS 3PFIA 1XC8A 3GO8A 2I7PA 4I5SA 1NY6A 3KSXA 4DR7M 3KOZE 2K47A 3FUUA 1IXZA 3ZH9B 4AG5A 1Q3BA 4GKJM 3DOAA 1KYIA 1ZQ9A 5EXXA 4QOZC 4M0WA 2OPFA 4GIPA 8CATA 2KRUA 4DV1M 5KPRA 2BNKA 4DV7M 1J09A 2XSZD 4B3MM 2RKOA 4AW4A 4G6ZA 4LGMA 5EP4A 2NQ8C 4A3VB 3DFZA 3HGIA 3GRRA 3GLIB 1IN7A 3SMPA 2Q2EB 4FCVA 3UZUA 3WHLA 1XXHA 3RGPA 2KW0A 4IBFA 1NNUC 1L2DA 4FCTA 4LJ8A 1KSFX 3AOEC 1D2NA 2XFTA 1N78A 5GKNA 1Z5AA 1I4WA 2KZUA 1XXHB 1G3IA 4FVMA 3GLGA 3E9SA 4DV2M 3R8FA 4JI3M 5IREB 4G4OA 4NL4H 2KA6B 1TH3A 4IBEA 4NRVA 3PXGA 2I7NA 2M60A 2ZAMA 2DXIA 4JI8M 3M6AA 3U5ZB 1TGUA 4W5WA 2F5NA 3IG8A 4LRSA 2QCUA 2DZNB 2VIIA 3KDSE 4B08A 1K3WA 5IWAM 4DUZM 3RGSA 4JYAM 1HT2E 4OW0A 2A5YB 1L2CA 1XMQM 4B3TM 1NVMA 4KODA 4PT5A 4M9XA 2CHQA 5FTJA 2D7GA 1WXQA 2KZSA 3ZC7B 4AZFA 4FW9A 4M0DA 1IBLM 2H1RA 2Y21A 2UUAM 3U60B 2Y0QA 1LV7A 3ZCBB 1XNRM 1QANA 3TWKA 3M0EA 2VQFM 2X49A 1NJFA 2XSZA 3K8ZA 4K0KM 5JI3E 2F5SA 1J7KA 1HNWM 3TWLA 2XZUA 5KO3A 2KRKA 2FOIC 2W82A 3VK8A 5E6JA 1JR3A 2Y0TA 1N75A 1IN8A 3UMMA 1NNJA 4G4RA 3J80S 3UK6A 1S3SA 2FE8A 4I81A 2ZM6M 3RFWA 4MGHA 2R4EA 4FCWA 3OTOM 3T1HM 2HL7A 4REZA 5C18A 4LJAA 2DWMA 1E9SA 1HNZM 1DGHA 3VDPA 4S12A 3GLIA 1N33M 2F5OA 2OQ4A 3J2PB 4EIWA 1TDZA 5E26A 4DR4M 1N32M 4B3RM 3CF2A 1HR0M 2LH0A 1J5EM 1GL6A 1NSFA 3T38A 4NOOB 1IN5A 4Z8XA 2XH9A 4KO8A 3M7GA 4LY6A 1YE9A 3GPPA 2QZ4A 2D7EA 1DO2A 4GMQA 3AFHA 1L1ZA 4IIWA 4ITQA 4KLNA 4LJ7A 3PNYA 5ITTA 4MB7A 2CV0A 2FFJA 1QAQA 2C96A 2XZFA 2E5LM 1IN6A 2BJWA 1FJGM 4NXMM 3HU2A 1I94M 4GRIA 4JI1M 1E32A 4QNRA 3U5ZA 4HLQA 5FTMA 1UM8A 3Q8XA 4CGYB 3GP1A 3SBJA 2FNAA 3L26A 3H4MA 3U6CA 4GKKM 3SMSA 1Z6TA 2DHRA 1ORYB 3GLGB 4QOSA 3GLHA 2C9CA 3THGA 4DR3M 4R3DA 1L1TA 4GITA 3JAMS 4MH0E 3TE6A 1X37A 3HHYA 3AOEA 4CISA 3SAVA 4IBDA 2F4VM 4DV5M 5LMUM 3LVVA 4MGKE 4DR6M 1IQPA 2LXEA 1XWIA 3DZDA 3SHGB 4II7A 5ITXA 5ITXE 5A2QS 2HHHM 4LFCM 1Q39A 2R62A 1YUBA 4AG6A 1KFVA 3KOWE 2M5ZA 1QQWA 2EO2A 3HKPA 3KOXE 3VLFB 2DVWB 4LJ9A 3HHZA 3A45A 4FWHA 1H6UA 1QYRA 2X8AA 5BPVA 4IBBA 4D80A 2CHGA 4L4UA 4JV5M 4LF6M 4IBIA 3A98B 3LVWA 5JI2E 4IJEA 3HU3A 4QHTA 2HCBA 3GRUA 3FD9A 1NHWC 2V1CA 4B3SM 3U6EA 2XEPA 4TUWA 1XHBA 2UXBM 1R6BX 1ZAEA 4GH9A 4GHAA 1EE8A 2J7OA 3L28A 3AJIB 5EP1A 2QENA 4WW0A 1NY5A 3NBIA 4FD2A 2L6OA 2XFSA 3LQQA 3AV0A 2R4JA 2EUCA 3DA1A 4DV6M 1PJJA 3HU1A 2CEAA 2XLJA 3L25A 4DV3M 2F5PA 1XNQM 1HT1E 2YR0A 1IBKM 4IBCA 1DGFA 4MGYE 1G8PA 2CV1A 2QBYA 3SAUA 2JA2A 4JI4M 2V6ZM 2HKJA 3GRVA 3MHVC 3L2AA 3MK6A 4P16A 4I4LA 2UXDM 3U6QA 3AKZA 4X65M 2CHVA 2C98A 4GC9A 4X66M 3SAWA 3UJNA 3HJSA 1N36M 2L7IA 2QBYB 4BB9A 4JI7M 1R2YA 4L8RC 4PCZA 4YHHM 2QPAA 3D8BA 5FTKA 4LF7M 4HL4A 4ZPXA 4LRTA 5C1BA 3J81S 2CUZA 4NRWA 3K92A 3FUXA 4D81A 2YQZA 2R45A 3FKEA 4QHSA 1HNXM 5BR8M 2L7HA 2QP9X 3HJ8A 1K82A 3KS8A 3U61B 1L8QA 1PJIA 2XF3A 2P5TA 3ILKA 3T15A 3K2LA 2R46A 4OVZA 2DWLA 3HWSA 5F3WA 5EP3A 4FWGA 2D7HA 1DO0A 1T3TA 2O5RA 2XGNA 4IBKA 4M9ZA 3FUVA 4B7HA 1E94E 3SFZA 2BJVA 3CF6E 3KVWA 2CV2A 2YFQA 3KFUG 4LZJA 1GL7A 1IY2A 3WHKA 4B7GA 3E4RA 2DZOB 4OVZB 1IY0A 3AOGA 5IT9S 3TPZA 4IJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 M;  3W0F A;  4CIS A;  1K3W A;  4DR2 M;  3SAV A;  5IWA M;  4DUZ M;  3GPU A;  1L2B A;  4DV5 M;  5LMU M;  1IBM M;  2F4V M;  4JYA M;  4KHP M;  1R2Z A;  1L2C A;  4DR6 M;  3U6O A;  1XMQ M;  4B3T M;  4G4Q A;  3U6S A;  5ITX A;  5A2Q S;  5ITX E;  3T1Y M;  3GQ4 A;  2HHH M;  4LFC M;  4X62 M;  4OX9 M;  5ITR A;  3SAS A;  1Q39 A;  1KFV A;  4JI5 M;  1IBL M;  2UUA M;  5ITY A;  4JI6 M;  1XNR M;  3TWK A;  4LF4 M;  2VQF M;  3A45 A;  3U6M A;  1MX0 A;  1N34 M;  4PD2 A;  4JI2 M;  4K0K M;  4JV5 M;  4LF6 M;  4DR5 M;  2F5S A;  2UU9 M;  1HNW M;  3TWL A;  2VQE M;  2XZU A;  3GPX A;  4AQY M;  3VK8 A;  1K3X A;  4B3S M;  4YY3 M;  3U6E A;  3U6D A;  1XMO M;  1NNJ A;  2UXB M;  1Z5B A;  4G4R A;  2F5Q A;  1MU5 A;  4PDI A;  3J80 S;  4JI0 M;  1EE8 A;  1PM5 A;  3J7A S;  3TWM A;  5ITU A;  2ZM6 M;  1XC8 A;  5LMN M;  3GO8 A;  4PDG A;  3OTO M;  4DR7 M;  3T1H M;  4X64 M;  4DV4 M;  4DV6 M;  1PJJ A;  1Q3B A;  1Z5C A;  4GKJ M;  4DV3 M;  2F5P A;  1XNQ M;  1HNZ M;  1IBK M;  3DOA A;  1N33 M;  3SAR A;  1TDH A;  2OPF A;  3SAU A;  2F5O A;  4JI4 M;  2HKJ A;  2OQ4 A;  1TDZ A;  4DV1 M;  4DR4 M;  4DV7 M;  1N32 M;  4B3R M;  3U6P A;  1HR0 M;  4B3M M;  2EA0 A;  1J5E M;  2UXD M;  3U6Q A;  4G4N A;  4X65 M;  4X66 M;  3A42 A;  3GQ5 A;  3GPP A;  3SAW A;  1N36 M;  3SAT A;  4JI7 M;  2Q2E B;  1R2Y A;  4LF9 M;  2UXC M;  4PCZ A;  4YHH M;  1L1Z A;  4LF7 M;  4ITQ A;  4LF8 M;  3GPY A;  3C58 A;  1L2D A;  3GQ3 A;  3J81 S;  4NRW A;  5ITT A;  4DR1 M;  4LF5 M;  4MB7 A;  1HNX M;  2XZF A;  5BR8 M;  2E5L M;  2UUC M;  1Z5A A;  1K82 A;  4NXM M;  1FJG M;  1I94 M;  4NXN M;  4JI1 M;  1Z59 A;  1PJI A;  2UUB M;  3VK7 A;  4DV2 M;  4LFB M;  4JI3 M;  3GP1 A;  4G4O A;  3SBJ A;  4LFA M;  3U6C A;  4GKK M;  3JR5 A;  3JR4 A;  4NRV A;  5ITQ A;  1Q3C A;  4DUY M;  4JI8 M;  5FLX S;  2F5N A;  4DR3 M;  3A46 A;  1L1T A;  5IT9 S;  3JAM S;  3U6L A;  2ZBK B; 
#chains in the Genus database with same CATH topology
 1MJG M;  4DV0 M;  2ERC A;  3W0F A;  4LG2 A;  1DGB A;  1SXJ B;  2G3Q A;  3GPU A;  1ZMV A;  4XGI A;  1IBM M;  3KXE C;  1QZM A;  5FTN A;  3FTF A;  3LW5 F;  3FYC A;  5KPT A;  1GJS A;  2KEB A;  2VF8 A;  4LJ4 A;  1Y8G A;  5FTL A;  3QYB A;  5EXT A;  3EIE A;  4AI6 A;  1QUS A;  4IBJ A;  4G4Q A;  2J7N A;  1TTE A;  3KOY E;  3FRI A;  3SYL A;  3GQ4 A;  4GEW A;  3TQS A;  4OX9 M;  2QQ8 A;  4AKI A;  3FUT A;  4IBG A;  2DNA A;  2YNM D;  1QAO A;  2JY7 A;  5EXP A;  4JI5 M;  2RGH A;  3SHF A;  4JI6 M;  3GLG E;  1IN4 A;  2GQF A;  4LF4 M;  4RF1 A;  1GLN A;  2OOA A;  1MX0 A;  3GLF A;  1OJL A;  1GKI A;  3R9X B;  4PD2 A;  4JI2 M;  5IZ7 D;  1NJG A;  1SXJ C;  4DR5 M;  3GPX A;  1NHG C;  3U60 A;  2Z3X A;  4D82 A;  1E9R A;  2KNZ A;  2L2D A;  4QNM A;  4YY3 M;  2Z4R A;  4LZZ A;  1IM2 A;  3HHX A;  4R7G A;  2JY5 A;  3VKG A;  2F5Q A;  1DGH B;  1MU5 A;  4DBG B;  4PDI A;  4KT0 F;  2R65 A;  2B3T A;  1W5S A;  1WHC A;  4CHT B;  3QAU A;  3E46 A;  4LJ6 A;  3KSJ A;  4OU7 A;  5LMN M;  3LMM A;  4PDG A;  1VG5 A;  1MN3 A;  2BWB A;  1QVR A;  2HWJ A;  3SYK A;  5H37 D;  4X64 M;  4DV4 M;  4L6V 6;  1Z5C A;  4MM3 B;  4L15 A;  1JR3 D;  4FWD A;  1IXR C;  1AIP C;  1QAM A;  4I8O A;  5KQ8 A;  1YSY A;  3SAR A;  1TDH A;  2Z7J A;  1GAB A;  2MRO B;  3PNV A;  3U6P A;  2LNH C;  3CF0 A;  1G59 A;  2EA0 A;  2C5R A;  3UGJ A;  1NV8 A;  2HAK A;  3LQR A;  4G4N A;  5EJC A;  3KP0 E;  5DYI A;  4B7F A;  3A42 A;  3GQ5 A;  2L4E A;  1VDD A;  3W0L B;  3HHW A;  2G5G X;  3SAT A;  1HQC A;  3KW6 A;  4LF9 M;  3U61 A;  1OIP A;  4M9S A;  2UXC M;  3VDU A;  3VKH A;  3GRY A;  5KPZ A;  4LF8 M;  3GPY A;  4BLC A;  3C58 A;  2WSC F;  3PVS A;  3GQ3 A;  2Z4S A;  2RGO A;  2K9D A;  3MJ5 A;  4LCB A;  4MGZ E;  4LJ5 A;  4DR1 M;  4LF5 M;  1T6O A;  3SC3 A;  2Y20 A;  2DWN A;  3B9P A;  1TR8 A;  4LGY A;  4AKG A;  4NSR A;  2UUC M;  2EKF A;  4Z6Y A;  4NXN M;  1Z59 A;  4MGI E;  2UUB M;  4BBA A;  1R7R A;  3FTE A;  3IEC A;  3HY5 A;  3VK7 A;  3L29 A;  5EP2 A;  4AKH A;  3KP1 E;  4LFB M;  1IXS B;  2X4A A;  3LCU A;  1RU3 A;  4LFA M;  4G3O A;  4XBO A;  3JR5 A;  1R4G A;  1OFH A;  2BWE A;  3JR4 A;  4RF0 A;  5ITQ A;  1SXJ D;  1Q3C A;  3GLI E;  4DUY M;  2ZAO A;  2LVQ D;  1G4A E;  1SXJ A;  2DAG A;  3V76 A;  2R6F A;  5FLX S;  2L09 A;  1C1K A;  2V1U A;  4L78 A;  3CGW A;  3KS4 A;  1OFI A;  3A46 A;  2DAK A;  3J7B A;  2DAI A;  3NWL A;  3T6P A;  3EIH A;  2JP7 A;  1VEK A;  3U6L A;  1N77 A;  3AL0 C;  2ZBK B;  2J5Y A;  1WGL A;  4L16 A;  3BOS A;  2WSE F;  3FYD A;  1OAI A;  4DR2 M;  3J27 B;  4GHL A;  1W5T A;  1L2B A;  5EQT A;  2DWZ B;  3CTW B;  4KHP M;  1R2Z A;  3GLH B;  3U6O A;  1FNN A;  3RE8 A;  4GC5 A;  3FUW A;  5FSW A;  1DGG A;  7CAT A;  3GLF B;  2KNA A;  4CJ6 A;  3U6S A;  3K1J A;  3T1Y M;  5EXS A;  4X62 M;  5ITR A;  3GLF E;  2ZAN A;  2VDB B;  3SAS A;  2LWX A;  3QWL A;  3D8L A;  5DNY A;  1IY1 A;  3I51 A;  5ITY A;  2R18 A;  2KXE A;  1TH4 A;  3IG5 A;  1PGY A;  2LHG A;  1GVN A;  3FTD A;  2APL A;  1JQJ C;  3B89 A;  3BXW A;  3L27 A;  3U6M A;  2CFO A;  1G41 A;  2G8L A;  1N34 M;  3I4V A;  4HEO A;  2LVP C;  1GO5 A;  4WUR A;  4JN6 A;  2DAM A;  1SXJ E;  2UU9 M;  3VFD A;  2VQE M;  2C99 A;  1HQY E;  4AQY M;  1SG9 A;  4NSO B;  3I4Y A;  1K3X A;  1QDR A;  3U6D A;  2L4F A;  1XMO M;  1Z5B A;  2AHM A;  4RNA A;  5DYG A;  1A5T A;  1WJ7 A;  3HJQ A;  3TL4 X;  4JI0 M;  2C9O A;  3FTC A;  1PM5 A;  3TWM A;  5ITU A;  5KQD A;  1TH2 A;  4JXJ A;  2CE7 A;  3J7A S;  3PFI A;  1XC8 A;  3GO8 A;  2I7P A;  4I5S A;  2JY6 B;  1NY6 A;  3KSX A;  4DR7 M;  2K47 A;  3FUU A;  3GLH E;  1IXZ A;  3KOZ E;  3ZH9 B;  4AG5 A;  5L8R F;  1Q3B A;  4GKJ M;  2LVO C;  2O01 F;  2JZ1 A;  3DOA A;  1KYI A;  1ZQ9 A;  5EXX A;  3IHP A;  4QOZ C;  1NO1 A;  4M0W A;  2OPF A;  2N35 A;  4GIP A;  8CAT A;  2KRU A;  4DV1 M;  5KPR A;  2BNK A;  4DV7 M;  1J09 A;  1VEJ A;  2XSZ D;  4B3M M;  2MGW A;  2RKO A;  4AW4 A;  4G6Z A;  4LGM A;  5EP4 A;  2NQ8 C;  4A3V B;  3B74 A;  3DFZ A;  2LVA A;  3HGI A;  3GRR A;  1P3Q Q;  3GLI B;  1IN7 A;  3SMP A;  2Q2E B;  4FCV A;  3UZU A;  3WHL A;  1XXH A;  2FH0 A;  3H4J A;  2KW0 A;  3RGP A;  4IBF A;  1NNU C;  1L2D A;  4FCT A;  4LJ8 A;  1KSF X;  3AOE C;  1D2N A;  1OAO C;  2XFT A;  1V34 A;  1N78 A;  5GKN A;  3MMP A;  1Z5A A;  1I4W A;  2QHO B;  1WGN A;  1GJT A;  2KZU A;  1XXH B;  1JB0 F;  1G3I A;  2KHH A;  1PJS A;  3C3D A;  4FVM A;  2K6B A;  1D0K A;  3GLG A;  3F92 A;  3E9S A;  2ZTD A;  4DV2 M;  3R8F A;  4JI3 M;  5IRE B;  4G4O A;  4NL4 H;  2KA6 B;  1TH3 A;  4IBE A;  4NRV A;  3PXG A;  2I7N A;  2M60 A;  2R0I A;  1T43 A;  2ZAM A;  2DXI A;  4JI8 M;  5DFL A;  3M6A A;  3U5Z B;  1TGU A;  4W5W A;  1IXS A;  2F5N A;  2CP8 A;  4R71 A;  2JWS A;  3IG8 A;  4LRS A;  1NV9 A;  4F1I A;  2QCU A;  2DZN B;  2VII A;  3KDS E;  4B08 A;  3K9O A;  3FE3 A;  4P17 A;  1K3W A;  5IWA M;  4DUZ M;  3NBX X;  1C7Y A;  3RGS A;  4JYA M;  1HT2 E;  4OW0 A;  2K0B X;  2A5Y B;  1L2C A;  1XMQ M;  4B3T M;  1NVM A;  4KOD A;  4PT5 A;  4M9X A;  2CHQ A;  5FTJ A;  2D7G A;  1WXQ A;  2KZS A;  3ZC7 B;  1AUA A;  4AZF A;  4FW9 A;  4M0D A;  1IBL M;  2H1R A;  2Y21 A;  2Z8Y M;  2UUA M;  3U60 B;  2WZJ A;  2Y0Q A;  1LV7 A;  3ZCB B;  1XNR M;  1QAN A;  3TWK A;  3M0E A;  3B7Q A;  2VQF M;  1VQ1 A;  1G71 A;  2EKK A;  1PJT A;  1NJF A;  2X49 A;  2XSZ A;  3K8Z A;  4K0K M;  5JI3 E;  2F5S A;  1J7K A;  2FS1 A;  1HNW M;  3TWL A;  2XZU A;  4RKU F;  5KO3 A;  3W68 A;  2KRK A;  2FOI C;  1R5L A;  2W82 A;  1EFU B;  5E6J A;  1JR3 A;  3VK8 A;  2Y0T A;  1CUK A;  1N75 A;  1IN8 A;  3UMM A;  1NNJ A;  2DKL A;  4G4R A;  2WSF F;  3J80 S;  3UK6 A;  1S3S A;  2FE8 A;  2JY8 A;  4I81 A;  2DZL A;  2ZM6 M;  3RFW A;  4MGH A;  2R4E A;  4FCW A;  3OTO M;  3T1H M;  2HL7 A;  4REZ A;  5C18 A;  4LJA A;  2DWM A;  2DEN A;  1TF0 B;  1E9S A;  4Y28 F;  1HNZ M;  1DGH A;  2LTU A;  4S12 A;  3VDP A;  3GLI A;  1N33 M;  2F5O A;  2OQ4 A;  3J2P B;  4EIW A;  1TDZ A;  5E26 A;  4DR4 M;  3LCV B;  2EJS A;  4B3R M;  3CF2 A;  3QYE A;  2MR9 A;  1HR0 M;  1N32 M;  2LH0 A;  1J5E M;  1GL6 A;  1NSF A;  3T38 A;  4NOO B;  1IN5 A;  4Z8X A;  4UN2 B;  2XH9 A;  4KO8 A;  3M7G A;  1V92 A;  1YE9 A;  4LY6 A;  1PJQ A;  3B7Z A;  3GPP A;  2QZ4 A;  1OIZ A;  2D7E A;  2GNO A;  1DO2 A;  1V33 A;  4GMQ A;  3AFH A;  1L1Z A;  4IIW A;  1PRB A;  4KLN A;  4ITQ A;  3HZJ A;  1JR3 E;  3PNY A;  4LJ7 A;  5ITT A;  4MB7 A;  2CV0 A;  2FFJ A;  1QAQ A;  2C96 A;  4NC6 A;  3E21 A;  2XZF A;  1IN6 A;  2BJW A;  2E5L M;  1QZE A;  1FJG M;  4NXM M;  3HU2 A;  1I94 M;  4GRI A;  1BVS A;  3B7N A;  3Q8G A;  2CWB A;  1E32 A;  4QNR A;  4JI1 M;  3U5Z A;  4HLQ A;  5FTM A;  1UM8 A;  3Q8X A;  4CGY B;  3GP1 A;  3SBJ A;  2FNA A;  3L26 A;  3H4M A;  1XB2 B;  3U6C A;  4GKK M;  1WR1 B;  3SMS A;  2JZ0 A;  1Z6T A;  2DHR A;  3BBZ A;  1ORY B;  3GLG B;  4QOS A;  1VEG A;  3GLH A;  2C9C A;  3THG A;  4DR3 M;  1D0M A;  4R3D A;  1L1T A;  4GIT A;  3JAM S;  4MH0 E;  3TE6 A;  1X37 A;  3HHY A;  3AOE A;  4CIS A;  3SAV A;  4IBD A;  1EIJ A;  2OOB A;  4DV5 M;  1WIV A;  2DI0 A;  3LVV A;  5LMU M;  1ZMU A;  2F4V M;  4MGK E;  1OTR A;  1IQP A;  4DR6 M;  2LXE A;  1XWI A;  1YLA A;  3DZD A;  3SHG B;  4II7 A;  5ITX A;  5ITX E;  5A2Q S;  2HHH M;  4LFC M;  1Q39 A;  2R62 A;  1YUB A;  4Q7J A;  4AG6 A;  3KOW E;  1KFV A;  2M5Z A;  1QQW A;  2EO2 A;  3HKP A;  4F2L A;  3KOX E;  3VLF B;  3I04 M;  2DVW B;  4LJ9 A;  3HHZ A;  3A45 A;  1QDT A;  2CRU A;  1H6U A;  1QYR A;  2X8A A;  4FWH A;  3W67 A;  4CIZ A;  5BPV A;  4IBB A;  4D80 A;  2CHG A;  1IFY A;  2ZTC A;  4L4U A;  4JV5 M;  4LF6 M;  4IBI A;  3A98 B;  3LVW A;  2RRU A;  5JI2 E;  4IJE A;  3HU3 A;  4QHT A;  2HCB A;  3GRU A;  3FD9 A;  1UFZ A;  1NHW C;  2V1C A;  4B3S M;  3U6E A;  2XEP A;  4TUW A;  1XHB A;  2UXB M;  1R6B X;  1ZAE A;  2KDL A;  2LHC A;  4GH9 A;  4GHA A;  1EE8 A;  2J7O A;  3L28 A;  4WP2 A;  3AJI B;  5EP1 A;  2QEN A;  4WW0 A;  1NY5 A;  3NBI A;  1QUT A;  4FD2 A;  2L6O A;  2XFS A;  3LQQ A;  2H5X A;  3AV0 A;  2QSF X;  2R4J A;  2EUC A;  3DA1 A;  4DV6 M;  1PJJ A;  3HU1 A;  2CEA A;  2XLJ A;  3L25 A;  4DV3 M;  2F5P A;  2OO9 A;  1XNQ M;  1HT1 E;  1D0L A;  2YR0 A;  1IBK M;  4IBC A;  1DGF A;  4MGY E;  1G8P A;  2CV1 A;  2QBY A;  2O25 A;  2QNJ A;  2JA2 A;  3SAU A;  2V6Z M;  2HKJ A;  3ZQJ A;  4JI4 M;  2R44 A;  3GRV A;  3MHV C;  1XXH E;  1OQY A;  3L2A A;  3MK6 A;  4P16 A;  4I4L A;  2UXD M;  3U6Q A;  3AKZ A;  4X65 M;  2CHV A;  2C98 A;  4GC9 A;  4X66 M;  3SAW A;  3UJN A;  4XK8 F;  3HJS A;  1N36 M;  2L7I A;  1OKS A;  2QBY B;  4BB9 A;  4JI7 M;  1R2Y A;  1HJP A;  4L8R C;  4PCZ A;  1LTM A;  4YHH M;  2QPA A;  3D8B A;  5FTK A;  4LF7 M;  4HL4 A;  4ZPX A;  4LRT A;  5C1B A;  3J81 S;  2CUZ A;  4NRW A;  3I01 M;  3K92 A;  3FUX A;  4D81 A;  2YQZ A;  3FRH A;  2R45 A;  3FKE A;  4QHS A;  1HNX M;  5BR8 M;  2L7H A;  2QP9 X;  3HJ8 A;  1K82 A;  3KS8 A;  3U61 B;  1ZV1 A;  1L8Q A;  1PJI A;  2XF3 A;  2P5T A;  3ILK A;  3HX3 A;  3T15 A;  2JNH A;  3K2L A;  2JXN A;  2R46 A;  4OVZ A;  4ANR A;  2DWL A;  2LBC A;  3HWS A;  5F3W A;  1ZMW A;  5EP3 A;  4FWG A;  2D7H A;  3C9P A;  2O5R A;  1DO0 A;  1T3T A;  2LVN C;  2XGN A;  4IBK A;  4M9Z A;  3FUV A;  4B7H A;  1E94 E;  2VF7 A;  3SFZ A;  2BJV A;  3CF6 E;  3KVW A;  2CV2 A;  2MH8 A;  2YFQ A;  3KFU G;  4LZJ A;  1GL7 A;  1Q02 A;  1IY2 A;  1VDL A;  3WHK A;  2MJ5 B;  2JUJ A;  4B7G A;  3E4R A;  2DZO B;  4OVZ B;  3K9P A;  1IY0 A;  2KNV A;  3AOG A;  2DAE A;  3C3E A;  5IT9 S;  1DV0 A;  2DHY A;  1F4I A;  3TPZ A;  4IJF A; 
#chains in the Genus database with same CATH homology
 4DV0 M;  2ERC A;  3W0F A;  4LG2 A;  1DGB A;  1SXJ B;  3GPU A;  4XGI A;  1IBM M;  3KXE C;  1QZM A;  5FTN A;  3FTF A;  3FYC A;  5KPT A;  2KEB A;  4LJ4 A;  5FTL A;  4AI6 A;  5EXT A;  3EIE A;  4IBJ A;  4G4Q A;  2J7N A;  3KOY E;  3SYL A;  4OX9 M;  3GQ4 A;  3TQS A;  4AKI A;  3FUT A;  4IBG A;  2YNM D;  1QAO A;  5EXP A;  4JI5 M;  2RGH A;  3SHF A;  4JI6 M;  1IN4 A;  4LF4 M;  4RF1 A;  1GLN A;  1MX0 A;  3GLF A;  1OJL A;  1GKI A;  3R9X B;  4PD2 A;  4JI2 M;  5IZ7 D;  1NJG A;  1SXJ C;  4DR5 M;  3GPX A;  1NHG C;  3U60 A;  2Z3X A;  4D82 A;  1E9R A;  4QNM A;  4YY3 M;  2Z4R A;  4LZZ A;  1IM2 A;  3HHX A;  4R7G A;  3VKG A;  2F5Q A;  1DGH B;  1MU5 A;  4PDI A;  2R65 A;  1W5S A;  4CHT B;  3QAU A;  4LJ6 A;  3KSJ A;  4OU7 A;  5LMN M;  3LMM A;  4PDG A;  1QVR A;  4X64 M;  3SYK A;  5H37 D;  4DV4 M;  1Z5C A;  4MM3 B;  4L15 A;  1JR3 D;  4FWD A;  1QAM A;  1IXR C;  4I8O A;  5KQ8 A;  1YSY A;  3SAR A;  1TDH A;  2Z7J A;  3PNV A;  3U6P A;  2LNH C;  3CF0 A;  1G59 A;  2EA0 A;  2C5R A;  3UGJ A;  3LQR A;  4G4N A;  5EJC A;  3KP0 E;  5DYI A;  4B7F A;  3A42 A;  3GQ5 A;  1VDD A;  3W0L B;  3HHW A;  2G5G X;  3SAT A;  1HQC A;  3KW6 A;  4LF9 M;  3U61 A;  4M9S A;  2UXC M;  3VDU A;  3VKH A;  3GRY A;  5KPZ A;  4LF8 M;  3GPY A;  4BLC A;  3C58 A;  3GQ3 A;  3PVS A;  2Z4S A;  2RGO A;  4LCB A;  3MJ5 A;  4MGZ E;  4DR1 M;  4LJ5 A;  4LF5 M;  3SC3 A;  2Y20 A;  2DWN A;  3B9P A;  4LGY A;  4AKG A;  4NSR A;  2UUC M;  4Z6Y A;  4NXN M;  1Z59 A;  4MGI E;  2UUB M;  4BBA A;  1R7R A;  3FTE A;  3VK7 A;  3L29 A;  5EP2 A;  4AKH A;  3KP1 E;  4LFB M;  1IXS B;  2X4A A;  4LFA M;  4XBO A;  3JR5 A;  3JR4 A;  1OFH A;  4RF0 A;  5ITQ A;  1SXJ D;  1Q3C A;  4DUY M;  2ZAO A;  1G4A E;  1SXJ A;  2V1U A;  5FLX S;  2L09 A;  1C1K A;  4L78 A;  3KS4 A;  1OFI A;  3A46 A;  3J7B A;  3NWL A;  1N77 A;  3EIH A;  3U6L A;  3AL0 C;  2ZBK B;  4L16 A;  3BOS A;  3FYD A;  4DR2 M;  3J27 B;  4GHL A;  1W5T A;  1L2B A;  5EQT A;  2DWZ B;  3CTW B;  4KHP M;  1R2Z A;  3GLH B;  3U6O A;  1FNN A;  3RE8 A;  4GC5 A;  3FUW A;  5FSW A;  1DGG A;  7CAT A;  3GLF B;  3U6S A;  3K1J A;  3T1Y M;  5EXS A;  4X62 M;  5ITR A;  2ZAN A;  3SAS A;  2LWX A;  3QWL A;  3D8L A;  5DNY A;  1IY1 A;  3I51 A;  5ITY A;  2R18 A;  2KXE A;  1TH4 A;  3IG5 A;  1GVN A;  3FTD A;  1JQJ C;  3L27 A;  3U6M A;  2CFO A;  1G41 A;  2G8L A;  1N34 M;  3I4V A;  4WUR A;  4JN6 A;  1SXJ E;  2UU9 M;  3VFD A;  2VQE M;  2C99 A;  1HQY E;  4AQY M;  4NSO B;  3I4Y A;  1K3X A;  3U6D A;  1XMO M;  1Z5B A;  2AHM A;  4RNA A;  5DYG A;  3HJQ A;  3TL4 X;  4JI0 M;  2C9O A;  3FTC A;  1PM5 A;  3TWM A;  5ITU A;  5KQD A;  1TH2 A;  4JXJ A;  2CE7 A;  3J7A S;  3PFI A;  1XC8 A;  3GO8 A;  2I7P A;  4I5S A;  1NY6 A;  3KSX A;  4DR7 M;  3KOZ E;  2K47 A;  3FUU A;  1IXZ A;  3ZH9 B;  4AG5 A;  1Q3B A;  4GKJ M;  3DOA A;  1KYI A;  1ZQ9 A;  5EXX A;  4QOZ C;  4M0W A;  2OPF A;  4GIP A;  8CAT A;  2KRU A;  4DV1 M;  5KPR A;  2BNK A;  4DV7 M;  1J09 A;  2XSZ D;  4B3M M;  2RKO A;  4AW4 A;  4G6Z A;  4LGM A;  5EP4 A;  2NQ8 C;  4A3V B;  3DFZ A;  3HGI A;  3GRR A;  3GLI B;  1IN7 A;  3SMP A;  2Q2E B;  4FCV A;  3UZU A;  3WHL A;  1XXH A;  3RGP A;  2KW0 A;  4IBF A;  1NNU C;  1L2D A;  4FCT A;  4LJ8 A;  1KSF X;  3AOE C;  1D2N A;  2XFT A;  1N78 A;  5GKN A;  1Z5A A;  1I4W A;  2KZU A;  1XXH B;  1G3I A;  4FVM A;  3GLG A;  3E9S A;  4DV2 M;  3R8F A;  4JI3 M;  5IRE B;  4G4O A;  4NL4 H;  2KA6 B;  1TH3 A;  4IBE A;  4NRV A;  3PXG A;  2I7N A;  2M60 A;  2ZAM A;  2DXI A;  4JI8 M;  3M6A A;  3U5Z B;  1TGU A;  4W5W A;  2F5N A;  3IG8 A;  4LRS A;  2QCU A;  2DZN B;  2VII A;  3KDS E;  4B08 A;  1K3W A;  5IWA M;  4DUZ M;  3RGS A;  4JYA M;  1HT2 E;  4OW0 A;  2A5Y B;  1L2C A;  1XMQ M;  4B3T M;  1NVM A;  4KOD A;  4PT5 A;  4M9X A;  2CHQ A;  5FTJ A;  2D7G A;  1WXQ A;  2KZS A;  3ZC7 B;  4AZF A;  4FW9 A;  4M0D A;  1IBL M;  2H1R A;  2Y21 A;  2UUA M;  3U60 B;  2Y0Q A;  1LV7 A;  3ZCB B;  1XNR M;  1QAN A;  3TWK A;  3M0E A;  2VQF M;  2X49 A;  1NJF A;  2XSZ A;  3K8Z A;  4K0K M;  5JI3 E;  2F5S A;  1J7K A;  1HNW M;  3TWL A;  2XZU A;  5KO3 A;  2KRK A;  2FOI C;  2W82 A;  3VK8 A;  5E6J A;  1JR3 A;  2Y0T A;  1N75 A;  1IN8 A;  3UMM A;  1NNJ A;  4G4R A;  3J80 S;  3UK6 A;  1S3S A;  2FE8 A;  4I81 A;  2ZM6 M;  3RFW A;  4MGH A;  2R4E A;  4FCW A;  3OTO M;  3T1H M;  2HL7 A;  4REZ A;  5C18 A;  4LJA A;  2DWM A;  1E9S A;  1HNZ M;  1DGH A;  3VDP A;  4S12 A;  3GLI A;  1N33 M;  2F5O A;  2OQ4 A;  3J2P B;  4EIW A;  1TDZ A;  5E26 A;  4DR4 M;  1N32 M;  4B3R M;  3CF2 A;  1HR0 M;  2LH0 A;  1J5E M;  1GL6 A;  1NSF A;  3T38 A;  4NOO B;  1IN5 A;  4Z8X A;  2XH9 A;  4KO8 A;  3M7G A;  4LY6 A;  1YE9 A;  3GPP A;  2QZ4 A;  2D7E A;  1DO2 A;  4GMQ A;  3AFH A;  1L1Z A;  4IIW A;  4ITQ A;  4KLN A;  4LJ7 A;  3PNY A;  5ITT A;  4MB7 A;  2CV0 A;  2FFJ A;  1QAQ A;  2C96 A;  2XZF A;  2E5L M;  1IN6 A;  2BJW A;  1FJG M;  4NXM M;  3HU2 A;  1I94 M;  4GRI A;  4JI1 M;  1E32 A;  4QNR A;  3U5Z A;  4HLQ A;  5FTM A;  1UM8 A;  3Q8X A;  4CGY B;  3GP1 A;  3SBJ A;  2FNA A;  3L26 A;  3H4M A;  3U6C A;  4GKK M;  3SMS A;  1Z6T A;  2DHR A;  1ORY B;  3GLG B;  4QOS A;  3GLH A;  2C9C A;  3THG A;  4DR3 M;  4R3D A;  1L1T A;  4GIT A;  3JAM S;  4MH0 E;  3TE6 A;  1X37 A;  3HHY A;  3AOE A;  4CIS A;  3SAV A;  4IBD A;  2F4V M;  4DV5 M;  5LMU M;  3LVV A;  4MGK E;  4DR6 M;  1IQP A;  2LXE A;  1XWI A;  3DZD A;  3SHG B;  4II7 A;  5ITX A;  5ITX E;  5A2Q S;  2HHH M;  4LFC M;  1Q39 A;  2R62 A;  1YUB A;  4AG6 A;  1KFV A;  3KOW E;  2M5Z A;  1QQW A;  2EO2 A;  3HKP A;  3KOX E;  3VLF B;  2DVW B;  4LJ9 A;  3HHZ A;  3A45 A;  4FWH A;  1H6U A;  1QYR A;  2X8A A;  5BPV A;  4IBB A;  4D80 A;  2CHG A;  4L4U A;  4JV5 M;  4LF6 M;  4IBI A;  3A98 B;  3LVW A;  5JI2 E;  4IJE A;  3HU3 A;  4QHT A;  2HCB A;  3GRU A;  3FD9 A;  1NHW C;  2V1C A;  4B3S M;  3U6E A;  2XEP A;  4TUW A;  1XHB A;  2UXB M;  1R6B X;  1ZAE A;  4GH9 A;  4GHA A;  1EE8 A;  2J7O A;  3L28 A;  3AJI B;  5EP1 A;  2QEN A;  4WW0 A;  1NY5 A;  3NBI A;  4FD2 A;  2L6O A;  2XFS A;  3LQQ A;  3AV0 A;  2R4J A;  2EUC A;  3DA1 A;  4DV6 M;  1PJJ A;  3HU1 A;  2CEA A;  2XLJ A;  3L25 A;  4DV3 M;  2F5P A;  1XNQ M;  1HT1 E;  2YR0 A;  1IBK M;  4IBC A;  1DGF A;  4MGY E;  1G8P A;  2CV1 A;  2QBY A;  3SAU A;  2JA2 A;  4JI4 M;  2V6Z M;  2HKJ A;  3GRV A;  3MHV C;  3L2A A;  3MK6 A;  4P16 A;  4I4L A;  2UXD M;  3U6Q A;  3AKZ A;  4X65 M;  2CHV A;  2C98 A;  4GC9 A;  4X66 M;  3SAW A;  3UJN A;  3HJS A;  1N36 M;  2L7I A;  2QBY B;  4BB9 A;  4JI7 M;  1R2Y A;  4L8R C;  4PCZ A;  4YHH M;  2QPA A;  3D8B A;  5FTK A;  4LF7 M;  4HL4 A;  4ZPX A;  4LRT A;  5C1B A;  3J81 S;  2CUZ A;  4NRW A;  3K92 A;  3FUX A;  4D81 A;  2YQZ A;  2R45 A;  3FKE A;  4QHS A;  1HNX M;  5BR8 M;  2L7H A;  2QP9 X;  3HJ8 A;  1K82 A;  3KS8 A;  3U61 B;  1L8Q A;  1PJI A;  2XF3 A;  2P5T A;  3ILK A;  3T15 A;  3K2L A;  2R46 A;  4OVZ A;  2DWL A;  3HWS A;  5F3W A;  5EP3 A;  4FWG A;  2D7H A;  1DO0 A;  1T3T A;  2O5R A;  2XGN A;  4IBK A;  4M9Z A;  3FUV A;  4B7H A;  1E94 E;  3SFZ A;  2BJV A;  3CF6 E;  3KVW A;  2CV2 A;  2YFQ A;  3KFU G;  4LZJ A;  1GL7 A;  1IY2 A;  3WHK A;  4B7G A;  3E4R A;  2DZO B;  4OVZ B;  1IY0 A;  3AOG A;  5IT9 S;  3TPZ A;  4IJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...