3J80S

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 21
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j80S01
3GQ3A 1K82A 3J7AS 1N33M 2UXBM 3GPXA 4DR1M 3U6OA 4JI4M 3VK8A 4JV5M 1I94M 1R2ZA 1N32M 4JI0M 4LFBM 2ZBKB 4X66M 5ITXE 2F5PA 4B3SM 1Z5CA 3VK7A 3SATA 3GP1A 4YY3M 5ITXA 1PJIA 4DUYM 4DV7M 2F5QA 3C58A 4DV0M 1N34M 5FLXS 3SAVA 4X65M 3U6PA 4NXNM 2XZFA 1L2BA 3U6SA 4DR7M 4LFCM 1Z5AA 4PDGA 3U6EA 4KHPM 5IWAM 1N36M 1K3WA 1TDZA 2F5SA 1PJJA 3SAWA 4GKJM 1TDHA 4PDIA 2VQFM 2HKJA 4DV6M 1IBKM 3SASA 2F4VM 5ITRA 1HNWM 1L1ZA 4DV4M 4G4NA 4LF6M 3T1YM 3TWKA 4DUZM 4LF5M 3GPYA 4MB7A 1L1TA 4JI3M 3GPPA 3T1HM 2EA0A 1Q39A 3JR4A 4LF9M 3DOAA 4DR4M 3GQ4A 2UXCM 4B3TM 1Q3BA 4PD2A 4DR2M 1XMQM 4LF7M 5ITUA 5ITTA 4LF4M 4X64M 3J81S 2E5LM 2HHHM 4CISA 4DV2M 3GPUA 3GO8A 4DR3M 3U6DA 4JI8M 1Q3CA 4DV5M 1IBMM 1XNQM 1IBLM 1PM5A 3TWMA 5ITQA 3A45A 3A46A 4G4QA 4G4RA 1J5EM 3U6LA 2UU9M 1HNZM 1K3XA 4JI7M 1HR0M 4X62M 1Z5BA 4DV3M 1R2YA 1MU5A 1MX0A 2VQEM 2XZUA 3JR5A 1KFVA 4NRWA 4JI2M 3OTOM 2F5NA 1XC8A 2UUAM 5BR8M 4DR5M 3GQ5A 3SARA 4JI5M 4PCZA 5LMNM 4OX9M 1XMOM 4DV1M 4JYAM 4LF8M 4GKKM 1HNXM 4AQYM 3U6CA 4YHHM 4G4OA 5IT9S 1L2DA 1EE8A 4JI1M 3SAUA 2ZM6M 1L2CA 4B3MM 4B3RM 2OQ4A 3J80S 1NNJA 4K0KM 2UUCM 4NRVA 3TWLA 5ITYA 1Z59A 3SBJA 3JAMS 5LMUM 5A2QS 4DR6M 2F5OA 1XNRM 2UXDM 4LFAM 2Q2EB 2OPFA 3U6MA 3U6QA 4ITQA 4JI6M 3A42A 3W0FA 4NXMM 2UUBM 1FJGM
chains in the Genus database with same CATH superfamily
2MROB 3GQ3A 2DKLA 1N33M 2O25A 2G3QA 3B7ZA 4M0DA 3GPXA 4DR1M 3U6OA 3THGA 1NJGA 3QAUA 2R6FA 2QCUA 1I94M 1R7RA 3RE8A 4PT5A 3VDPA 5DNYA 2KNAA 2L4FA 2JY6B 4FCVA 2FFJA 4X66M 2QQ8A 3M6AA 5FTMA 2XH9A 4FCTA 2F5PA 1Z6TA 4QOSA 1D2NA 2WSEF 4L16A 4AZFA 3LVVA 3L26A 4B3SM 4AKHA 1DV0A 4LRTA 4DUYM 2CEAA 5EXXA 4IBIA 1NJFA 3MK6A 5L8RF 4DV0M 1N34M 3LMMA 2XSZD 3T6PA 1QAOA 2JY8A 4G6ZA 1D0KA 3E46A 4RNAA 3SAVA 2GNOA 1LV7A 3PNYA 4IJEA 4X65M 1S3SA 4OU7A 3U6PA 3U6SA 1Z5AA 3SMPA 2ERCA 3ZCBB 4I81A 1K3WA 2DZLA 1TDZA 2F5SA 4GKJM 2HKJA 1SXJD 1IBKM 2EUCA 1N77A 1N75A 1HNWM 1QUSA 2DENA 3VDUA 4DV4M 4G4NA 3AOGA 1OKSA 4MB7A 4UN2B 2JA2A 1DGFA 1E9RA 4BLCA 3T1HM 2K9DA 1Q39A 1VQ1A 2QPAA 3AOEC 2EA0A 3FUXA 3HHXA 4DR4M 2CWBA 1GKIA 2NQ8C 4QOZC 3GQ4A 2VIIA 2UXCM 4B3TM 2ZTDA 1Q3BA 2R4EA 3LW5F 4FD2A 2B3TA 3AJIB 7CATA 4DBGB 2OO9A 5ITUA 4LF4M 3BBZA 3GRUA 1IN5A 4HEOA 3CF0A 5FTLA 4DV2M 1YSYA 1DGBA 4DR3M 2CUZA 4AG6A 3U6DA 2HL7A 4DV5M 4GMQA 4I8OA 4P16A 2R62A 2CV0A 3WHKA 4ANRA 1OFHA 1JR3A 2LVAA 3W67A 4B7FA 3A46A 2KNVA 2Z3XA 4G4RA 1C7YA 4FWHA 3SC3A 1GABA 4LCBA 2LXEA 4X62M 1Z5BA 2R4JA 1CUKA 1MU5A 2MJ5B 1KFVA 2FH0A 4NRWA 2BWEA 2O01F 2R0IA 3OTOM 2ZTCA 1Y8GA 5KPZA 3KFUG 5IREB 3K9PA 2KXEA 2RGOA 3GLGB 1DGHB 2F5NA 4HLQA 1XC8A 2HAKA 2J7OA 1W5TA 1GL6A 3B89A 1NV8A 1TGUA 2R65A 2DXIA 4GHAA 3KS8A 1KSFX 5H37D 3ZH9B 1TH2A 3J2PB 3UK6A 2C5RA 2LWXA 3HU1A 3U6CA 3I51A 1L2DA 3M7GA 3SHFA 4GITA 3PVSA 3AFHA 3SAUA 2FE8A 3KXEC 2KW0A 2LBCA 1G41A 4RKUF 1V33A 1R4GA 1OQYA 1VDLA 1V92A 4NRVA 3FRIA 2WZJA 2H5XA 2K0BX 2OOAA 4JN6A 5JI3E 2KA6B 2LTUA 5A2QS 4LY6A 4MGZE 2F5OA 2UXDM 3MMPA 4ZPXA 5C18A 3NWLA 4ITQA 3HU2A 1SXJA 1TR8A 1PJQA 4CHTB 3TQSA 2ZANA 2AHMA 4JI4M 3EIEA 4JV5M 3A98B 1N32M 2XEPA 4LJ9A 4JI0M 3HJQA 2BWBA 3KS4A 4I4LA 3D8LA 3FRHA 3ZC7B 3GLIB 1WGNA 3CF2A 1GJSA 2QHOB 4L8RC 4IBCA 4XGIA 8CATA 1R5LA 1OJLA 2LHCA 2LVNC 1PJIA 4DV7M 3NBIA 2F5QA 3C58A 5DYIA 1WIVA 2DZNB 2QBYA 1LTMA 3FUWA 3KP0E 4QNRA 3U61A 3Q8XA 3SYLA 1G59A 2A5YB 4LFCM 2CV2A 1UM8A 2RGHA 2EKFA 4BBAA 1OFIA 2Y20A 1PJJA 5EP3A 2VQFM 4DV6M 4P17A 3I04M 5ITRA 5IZ7D 3RGSA 3K1JA 4Y28F 4LF6M 1QZEA 3UMMA 3U61B 2G5GX 2R18A 4LF5M 3GPYA 3GLFE 2D7GA 4M9ZA 3CGWA 1SXJC 3JR4A 4LF9M 4WURA 4XBOA 4AKIA 1QYRA 1NVMA 1ZMVA 3FTDA 4IJFA 3GLIA 3KDSE 4NSOB 4D81A 3B7NA 3UGJA 4LF7M 1J09A 3J7BA 4X64M 2HHHM 1JQJC 3FE3A 1XWIA 2X4AA 1PJSA 4IBJA 2DAIA 4NSRA 4QHTA 4D80A 4HL4A 1IN4A 3Q8GA 3MJ5A 3FUUA 5ITQA 3TPZA 1J5EM 4OVZB 2MGWA 3V76A 3U6LA 1T43A 1GVNA 5EXSA 1D0MA 3LQQA 1IFYA 1K3XA 1HR0M 1XXHE 3R8FA 4QNMA 3KVWA 2KRKA 3L29A 4W5WA 2Z4SA 3TE6A 1DO2A 4GHLA 3VKHA 4LJ7A 2LVOC 2WSCF 2DHYA 1PJTA 4XK8F 2UUAM 5BR8M 1PRBA 2CHGA 2CHQA 3GQ5A 1NY5A 4JI5M 4Q7JA 4DV1M 1QZMA 2QSFX 4F2LA 3H4JA 4QHSA 4JYAM 4R7GA 3HGIA 4GKKM 3H4MA 1YUBA 1HNXM 4AQYM 5IT9S 2BJWA 2LHGA 1J7KA 2YQZA 1N78A 5EP2A 5EJCA 1L2CA 3LVWA 4OVZA 4B3RM 2DNAA 1AUAA 4LJ6A 4FVMA 5KQDA 4K0KM 3GLIE 5KO3A 3TWLA 2XSZA 5ITYA 3FTEA 1Z59A 3QYBA 4Z8XA 4IIWA 3SMSA 3JAMS 4IBFA 3FYDA 3KP1E 1IN6A 2R46A 2VF8A 3J27B 3K8ZA 5EP4A 4MGIE 2K6BA 5FTKA 2Y0QA 2OPFA 3GRVA 1TH3A 3W0FA 4AG5A 1T3TA 2UUBM 1XB2B 1QDTA 1K82A 4MGKE 2KRUA 2ZAOA 1OIZA 3GLHE 3VK8A 2KHHA 3HJSA 3SYKA 1R2ZA 1H6UA 1HJPA 2RRUA 4M0WA 3HX3A 5JI2E 5KPTA 3PNVA 3L27A 2N35A 5E26A 2ZBKB 4LFBM 1QVRA 2EJSA 4KT0F 4LZZA 4M9SA 3AV0A 1KYIA 2L09A 1QAMA 1T6OA 4FWGA 1IN7A 2WSFF 5E6JA 3GP1A 3GLFA 4CIZA 4YY3M 1G8PA 5ITXA 2O5RA 2V6ZM 1E9SA 1R6BX 4A3VB 2XGNA 3KOWE 1WJ7A 3BXWA 5EXTA 1NV9A 5FLXS 4LGYA 2CV1A 4BB9A 1IQPA 2APLA 1WR1B 1NNUC 3K92A 3KSJA 4NXNM 4PDGA 3U6EA 5IWAM 5FTJA 3BOSA 2QBYB 1N36M 3R9XB 2XF3A 4IBBA 2KNZA 4PDIA 4LRSA 5KQ8A 1ZMUA 1C1KA 2L2DA 1VEJA 3T15A 3SASA 1L1ZA 2DAEA 2R44A 2JZ0A 3T1YM 3TWKA 4DUZM 1IXRC 1HQCA 4AI6A 1OAOC 3DOAA 1NHWC 5KPRA 1ORYB 3HHWA 4EIWA 4FCWA 2QZ4A 1P3QQ 4MGHA 2Y21A 4D82A 3K2LA 2OOBA 3W68A 2V1UA 1AIPC 3NBXX 4PD2A 2JNHA 4FWDA 2GQFA 4FW9A 3FTCA 4NL4H 3L28A 4M9XA 4DR2M 3GRRA 2JZ1A 2VDBB 1DGGA 3J81S 4MM3B 4CGYB 4CISA 1I4WA 2LVQD 3LCUA 1JR3E 3WHLA 2DAMA 3HJ8A 3GO8A 1QANA 2CHVA 1Q3CA 3QYEA 4JI8M 1XNQM 1EIJA 1IBLM 1PM5A 3TWMA 2K47A 2YFQA 4L6V6 4S12A 3KSXA 1WHCA 1OAIA 3C3DA 5BPVA 1HNZM 2D7EA 3KOYE 1WGLA 2M60A 3CF6E 4LGMA 1QQWA 4B7GA 4LJ4A 4DV3M 5EQTA 1R2YA 1MX0A 2VQEM 2XZUA 3JR5A 4LJ8A 1HQYE 3HZJA 4JI2M 3VKGA 2W82A 3B7QA 1OTRA 2J7NA 3UJNA 2X8AA 3K9OA 1GLNA 1FNNA 3SFZA 3F92A 1L8QA 2C9CA 2ZAMA 4JXJA 2LNHC 4DR5M 1F4IA 4GH9A 5LMNM 1Q02A 4IBGA 1XMOM 3ZQJA 2JY5A 1ZV1A 1QUTA 2BJVA 4GC9A 3AL0C 4LF8M 1EFUB 1IXSB 1TTEA 2CRUA 3D8BA 1NO1A 4IBEA 1PGYA 2YNMD 1SXJB 2KDLA 4L15A 4LG2A 3B9PA 2XFTA 3IHPA 3VLFB 2XFSA 3L2AA 3L25A 4CJ6A 3J80S 2P5TA 1NNJA 2DWMA 2V1CA 4GRIA 3RFWA 3TL4X 3DFZA 3SBJA 3HHYA 1GO5A 4DR6M 1DO0A 2QP9X 1GJTA 3AKZA 5LMUM 4KODA 2QNJA 1XNRM 2I7PA 1OIPA 3I01M 4WP2A 4LFAM 1G4AE 3U60A 2C99A 3U60B 3FUVA 1E32A 1G3IA 4L4UA 2RKOA 4B7HA 3U6QA 4JI6M 3FTFA 3IG8A 1FJGM 1XXHB 2L7IA 3FYCA 2DWLA 2C9OA 3J7AS 1W5SA 2UXBM 4TUWA 4GIPA 2HWJA 1VG5A 4NOOB 4RF0A 2FS1A 2JWSA 2CFOA 2R45A 1D0LA 1SXJE 1UFZA 2X49A 2Y0TA 1XHBA 4F1IA 3HU3A 4KO8A 2H1RA 4II7A 3GLHB 3GRYA 5ITXE 3U5ZA 2M5ZA 1Z5CA 3VK7A 1DGHA 1G71A 2MH8A 3E21A 3GLGA 2HCBA 2I7NA 3GLGE 1VEKA 1NSFA 2JY7A 3HY5A 3KOZE 4LJAA 5FSWA 1WXQA 2LH0A 3B74A 3E4RA 2XZFA 3KW6A 1L2BA 4DR7M 4KHPM 2G8LA 5GKNA 1JR3D 2L4EA 3SAWA 1TDHA 1BVSA 3LCVB 1GL7A 1IXZA 1QDRA 2KZSA 2F4VM 2DHRA 2EO2A 3E9SA 4IBDA 4OW0A 1MN3A 1YLAA 3QWLA 2VF7A 4JI3M 1L1TA 3GPPA 5EP1A 3I4VA 1SG9A 4AKGA 3DA1A 2BNKA 3C9PA 2L7HA 4MH0E 1JB0F 1IY2A 5C1BA 5DFLA 3GLFB 4R71A 2LVPC 3HKPA 3ILKA 2MR9A 4RF1A 4NC6A 2C98A 1XMQM 2DAKA 3PXGA 3LQRA 2KZUA 5ITTA 2E5LM 3SHGB 2DAGA 1A5TA 3CTWB 1HT1E 3GPUA 5F3WA 1IY0A 1HT2E 4KLNA 4AW4A 4GC5A 1IBMM 1IY1A 2DI0A 1IM2A 2C96A 3C3EA 1E94E 2EKKA 3M0EA 3T38A 1MJGM 3A45A 4G4QA 4Z6YA 3MHVC 1ZAEA 1NHGC 3FD9A 2UU9M 5DYGA 4JI7M 1ZQ9A 3I4YA 3IECA 5FTNA 3VFDA 2XLJA 2J5YA 1VEGA 4LZJA 4IBKA 1NY6A 1TF0B 3HWSA 4MGYE 2FOIC 2D7HA 3FUTA 5EXPA 3SATA 2Z7JA 4R3DA 3RGPA 3U5ZB 3SARA 1IXSA 4PCZA 2DVWB 2QENA 3EIHA 4OX9M 1ZMWA 3HHZA 3PFIA 4LJ5A 4GEWA 1X37A 2Z4RA 2L6OA 2DWZB 3KOXE 3GLHA 1XXHA 2Z8YM 3UZUA 2YR0A 1VDDA 3DZDA 2FNAA 4YHHM 4G4OA 3W0LB 1EE8A 4JI1M 2ZM6M 2JP7A 1YE9A 2CP8A 4I5SA 4B3MM 2OQ4A 4B08A 3FKEA 2UUCM 4REZA 2DZOB 4G3OA 2CE7A 1V34A 1RU3A 4L78A 4WW0A 2Q2EB 1TH4A 2KEBA 1QAQA 3IG5A 3U6MA 3A42A 4NXMM 2JUJA 2DWNA 1IN8A 2JXNA 3AOEA
chains in the Genus database with same CATH topology
3GQ3A 1N33M 4M0DA 3GPXA 4DR1M 3U6OA 3THGA 1NJGA 3QAUA 2QCUA 1I94M 1R7RA 3RE8A 4PT5A 3VDPA 5DNYA 4FCVA 2FFJA 4X66M 3M6AA 2F5PA 5FTMA 2XH9A 4FCTA 1Z6TA 4QOSA 1D2NA 4L16A 4AZFA 3L26A 3LVVA 4B3SM 4AKHA 4LRTA 4DUYM 2CEAA 5EXXA 4IBIA 1NJFA 3MK6A 4DV0M 1N34M 3LMMA 2XSZD 1QAOA 4G6ZA 3SAVA 4RNAA 3PNYA 1LV7A 4IJEA 4X65M 4OU7A 1S3SA 3U6PA 3U6SA 1Z5AA 3SMPA 2ERCA 3ZCBB 4I81A 1K3WA 1TDZA 2F5SA 4GKJM 2HKJA 1SXJD 1IBKM 2EUCA 1N77A 1N75A 1HNWM 3VDUA 4DV4M 4G4NA 3AOGA 4MB7A 2JA2A 1DGFA 1E9RA 4BLCA 3T1HM 2QPAA 1Q39A 2EA0A 3AOEC 4DR4M 3FUXA 3HHXA 4QOZC 1GKIA 2NQ8C 3GQ4A 2VIIA 2UXCM 4B3TM 1Q3BA 2R4EA 4FD2A 3AJIB 7CATA 5ITUA 4LF4M 3GRUA 1IN5A 3CF0A 5FTLA 4DV2M 1YSYA 1DGBA 4DR3M 2CUZA 4AG6A 3U6DA 2HL7A 4DV5M 4GMQA 4I8OA 4P16A 2R62A 2CV0A 3WHKA 1OFHA 1JR3A 4B7FA 3A46A 2Z3XA 4G4RA 4FWHA 3SC3A 4LCBA 2LXEA 4X62M 1Z5BA 2R4JA 1MU5A 1KFVA 4NRWA 3OTOM 5KPZA 3KFUG 5IREB 2KXEA 2RGOA 3GLGB 1DGHB 2F5NA 4HLQA 1XC8A 2J7OA 1W5TA 1GL6A 1TGUA 2R65A 2DXIA 4GHAA 3KS8A 1KSFX 5H37D 3ZH9B 1TH2A 3J2PB 3UK6A 2C5RA 2LWXA 3HU1A 3U6CA 3I51A 1L2DA 3M7GA 3SHFA 4GITA 3PVSA 3AFHA 3SAUA 2FE8A 3KXEC 2KW0A 1G41A 4NRVA 5JI3E 4JN6A 2KA6B 5A2QS 4LY6A 4MGZE 2F5OA 2UXDM 4ZPXA 5C18A 3NWLA 4ITQA 3HU2A 1SXJA 4CHTB 3TQSA 2ZANA 2AHMA 4JI4M 3EIEA 4JV5M 3A98B 1N32M 2XEPA 4LJ9A 4JI0M 3HJQA 3KS4A 4I4LA 3D8LA 3ZC7B 3GLIB 3CF2A 4L8RC 4IBCA 4XGIA 8CATA 1OJLA 1PJIA 4DV7M 3NBIA 2F5QA 3C58A 5DYIA 2DZNB 2QBYA 3FUWA 3KP0E 4QNRA 3U61A 3Q8XA 3SYLA 1G59A 2A5YB 4LFCM 2CV2A 1UM8A 2RGHA 4BBAA 1OFIA 2Y20A 1PJJA 5EP3A 2VQFM 4DV6M 5ITRA 5IZ7D 3RGSA 3K1JA 4LF6M 3UMMA 3U61B 2G5GX 2R18A 4LF5M 3GPYA 2D7GA 4M9ZA 1SXJC 3JR4A 4LF9M 4WURA 4XBOA 4AKIA 1QYRA 1NVMA 3FTDA 4IJFA 3GLIA 3KDSE 4NSOB 4D81A 3UGJA 4LF7M 1J09A 3J7BA 4X64M 2HHHM 1JQJC 1XWIA 2X4AA 4IBJA 4NSRA 4QHTA 4D80A 4HL4A 1IN4A 3MJ5A 3FUUA 5ITQA 3TPZA 1J5EM 4OVZB 3U6LA 1GVNA 5EXSA 3LQQA 1K3XA 1HR0M 3R8FA 4QNMA 3KVWA 2KRKA 3L29A 4W5WA 2Z4SA 3TE6A 1DO2A 4GHLA 3VKHA 4LJ7A 2UUAM 5BR8M 2CHGA 2CHQA 3GQ5A 1NY5A 4JI5M 4DV1M 1QZMA 4QHSA 4JYAM 4R7GA 3HGIA 4GKKM 3H4MA 1YUBA 1HNXM 4AQYM 5IT9S 2BJWA 1J7KA 2YQZA 1N78A 5EP2A 5EJCA 1L2CA 3LVWA 4OVZA 4B3RM 4LJ6A 4FVMA 5KQDA 4K0KM 5KO3A 3TWLA 2XSZA 5ITYA 3FTEA 1Z59A 4Z8XA 4IIWA 3SMSA 3JAMS 4IBFA 3FYDA 3KP1E 1IN6A 2R46A 3J27B 3K8ZA 5EP4A 4MGIE 5FTKA 2OPFA 2Y0QA 3GRVA 1TH3A 3W0FA 4AG5A 1T3TA 2UUBM 1K82A 4MGKE 2KRUA 2ZAOA 3VK8A 3HJSA 3SYKA 1R2ZA 1H6UA 5JI2E 4M0WA 5KPTA 3PNVA 3L27A 4LFBM 5E26A 2ZBKB 1QVRA 4LZZA 4M9SA 3AV0A 1KYIA 2L09A 1QAMA 4FWGA 5E6JA 1IN7A 3GLFA 3SATA 3GP1A 4YY3M 1G8PA 5ITXA 2O5RA 2V6ZM 1E9SA 1R6BX 4A3VB 2XGNA 3KOWE 5EXTA 5FLXS 4LGYA 2CV1A 4BB9A 1IQPA 4NXNM 1NNUC 3K92A 3KSJA 4PDGA 3U6EA 5IWAM 5FTJA 3BOSA 2QBYB 1N36M 3R9XB 2XF3A 4IBBA 4PDIA 4LRSA 5KQ8A 3T15A 1C1KA 3SASA 1L1ZA 3T1YM 3TWKA 4DUZM 1IXRC 1HQCA 4AI6A 3DOAA 1NHWC 5KPRA 1ORYB 3HHWA 4EIWA 4FCWA 2QZ4A 4MGHA 2Y21A 4D82A 3K2LA 2V1UA 4PD2A 4FWDA 4FW9A 3FTCA 4NL4H 3L28A 4M9XA 4DR2M 3GRRA 3J81S 1DGGA 4MM3B 4CGYB 4CISA 1I4WA 3WHLA 3HJ8A 3GO8A 4JI8M 1QANA 2CHVA 1Q3CA 1XNQM 1IBLM 1PM5A 3TWMA 2K47A 2YFQA 4S12A 3KSXA 5BPVA 1HNZM 2D7EA 3KOYE 3CF6E 2M60A 4LGMA 4B7GA 1QQWA 4LJ4A 4DV3M 5EQTA 1R2YA 1MX0A 2VQEM 2XZUA 3JR5A 4LJ8A 1HQYE 4JI2M 3VKGA 2W82A 2J7NA 3UJNA 2X8AA 1GLNA 1FNNA 3SFZA 1L8QA 2C9CA 2ZAMA 4JXJA 2LNHC 4DR5M 4GH9A 5LMNM 4IBGA 1XMOM 2BJVA 4GC9A 3AL0C 4LF8M 1IXSB 3D8BA 4IBEA 2YNMD 4L15A 1SXJB 4LG2A 2XFTA 3VLFB 2XFSA 3L2AA 3L25A 3J80S 2P5TA 1NNJA 2DWMA 2V1CA 4GRIA 3RFWA 3TL4X 3DFZA 3SBJA 3HHYA 4DR6M 1DO0A 2QP9X 5LMUM 3AKZA 4KODA 1XNRM 2I7PA 4LFAM 3U60A 1G4AE 3U60B 2C99A 3FUVA 1E32A 1G3IA 4L4UA 2RKOA 4B7HA 3U6QA 4JI6M 3FTFA 3IG8A 1FJGM 1XXHB 2L7IA 3FYCA 2DWLA 2C9OA 3J7AS 1W5SA 2UXBM 4TUWA 4GIPA 4NOOB 4RF0A 2CFOA 2R45A 1SXJE 2X49A 2Y0TA 1XHBA 3HU3A 4KO8A 2H1RA 4II7A 3GLHB 3GRYA 5ITXE 3U5ZA 2M5ZA 1Z5CA 3VK7A 1DGHA 3GLGA 2HCBA 2I7NA 1NSFA 4LJAA 3KOZE 5FSWA 1WXQA 2LH0A 3E4RA 2XZFA 3KW6A 1L2BA 4DR7M 4KHPM 2G8LA 5GKNA 1JR3D 3SAWA 1TDHA 1GL7A 1IXZA 2KZSA 2F4VM 2DHRA 2EO2A 3E9SA 4IBDA 4OW0A 3QWLA 1L1TA 4JI3M 3GPPA 5EP1A 3I4VA 4AKGA 3DA1A 2BNKA 2L7HA 4MH0E 5C1BA 1IY2A 3GLFB 3HKPA 3ILKA 4RF1A 2C98A 1XMQM 3PXGA 3LQRA 2KZUA 5ITTA 2E5LM 3SHGB 3CTWB 1HT1E 3GPUA 5F3WA 1IY0A 1HT2E 4KLNA 4AW4A 4GC5A 1IBMM 1IY1A 1IM2A 2C96A 3M0EA 1E94E 3T38A 3A45A 4G4QA 4Z6YA 3MHVC 1ZAEA 1NHGC 3FD9A 2UU9M 5DYGA 4JI7M 1ZQ9A 3I4YA 3VFDA 5FTNA 2XLJA 4LZJA 4IBKA 1NY6A 3HWSA 4MGYE 2FOIC 2D7HA 3FUTA 5EXPA 2Z7JA 4R3DA 3RGPA 3U5ZB 3SARA 4PCZA 2DVWB 2QENA 3EIHA 4OX9M 3HHZA 3PFIA 4LJ5A 1X37A 2Z4RA 2L6OA 2DWZB 3KOXE 3GLHA 1XXHA 4YHHM 3UZUA 2YR0A 1VDDA 3DZDA 2FNAA 4G4OA 3W0LB 1EE8A 4JI1M 2ZM6M 1YE9A 4I5SA 4B3MM 2OQ4A 4B08A 3FKEA 2UUCM 4REZA 2DZOB 2CE7A 4L78A 4WW0A 2Q2EB 1TH4A 2KEBA 1QAQA 3IG5A 3U6MA 3A42A 4NXMM 2DWNA 1IN8A 3B9PA 3AOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ3 A;  1K82 A;  3J7A S;  1N33 M;  2UXB M;  3GPX A;  4DR1 M;  3U6O A;  4JI4 M;  3VK8 A;  4JV5 M;  1I94 M;  1R2Z A;  1N32 M;  4JI0 M;  4LFB M;  2ZBK B;  4X66 M;  5ITX E;  2F5P A;  4B3S M;  1Z5C A;  3VK7 A;  3SAT A;  3GP1 A;  4YY3 M;  5ITX A;  1PJI A;  4DUY M;  4DV7 M;  2F5Q A;  3C58 A;  4DV0 M;  1N34 M;  5FLX S;  3SAV A;  4X65 M;  3U6P A;  4NXN M;  2XZF A;  1L2B A;  3U6S A;  4DR7 M;  4LFC M;  1Z5A A;  4PDG A;  3U6E A;  4KHP M;  5IWA M;  1N36 M;  1K3W A;  1TDZ A;  2F5S A;  1PJJ A;  3SAW A;  4GKJ M;  1TDH A;  4PDI A;  2VQF M;  2HKJ A;  4DV6 M;  1IBK M;  3SAS A;  2F4V M;  5ITR A;  1HNW M;  1L1Z A;  4DV4 M;  4G4N A;  4LF6 M;  3T1Y M;  3TWK A;  4DUZ M;  4LF5 M;  3GPY A;  4MB7 A;  1L1T A;  4JI3 M;  3GPP A;  3T1H M;  2EA0 A;  1Q39 A;  3JR4 A;  4LF9 M;  3DOA A;  4DR4 M;  3GQ4 A;  2UXC M;  4B3T M;  1Q3B A;  4PD2 A;  4DR2 M;  1XMQ M;  4LF7 M;  5ITU A;  5ITT A;  4LF4 M;  4X64 M;  3J81 S;  2E5L M;  2HHH M;  4CIS A;  4DV2 M;  3GPU A;  3GO8 A;  4DR3 M;  3U6D A;  4JI8 M;  1Q3C A;  4DV5 M;  1IBM M;  1XNQ M;  1IBL M;  1PM5 A;  3TWM A;  5ITQ A;  3A45 A;  3A46 A;  4G4Q A;  4G4R A;  1J5E M;  3U6L A;  2UU9 M;  1HNZ M;  1K3X A;  4JI7 M;  1HR0 M;  4X62 M;  1Z5B A;  4DV3 M;  1R2Y A;  1MU5 A;  1MX0 A;  2VQE M;  2XZU A;  3JR5 A;  1KFV A;  4NRW A;  4JI2 M;  3OTO M;  2F5N A;  1XC8 A;  2UUA M;  5BR8 M;  4DR5 M;  3GQ5 A;  3SAR A;  4JI5 M;  4PCZ A;  5LMN M;  4OX9 M;  1XMO M;  4DV1 M;  4JYA M;  4LF8 M;  4GKK M;  1HNX M;  4AQY M;  3U6C A;  4YHH M;  4G4O A;  5IT9 S;  1L2D A;  1EE8 A;  4JI1 M;  3SAU A;  2ZM6 M;  1L2C A;  4B3M M;  4B3R M;  2OQ4 A;  3J80 S;  1NNJ A;  4K0K M;  2UUC M;  4NRV A;  3TWL A;  5ITY A;  1Z59 A;  3SBJ A;  3JAM S;  5LMU M;  5A2Q S;  4DR6 M;  2F5O A;  1XNR M;  2UXD M;  4LFA M;  2Q2E B;  2OPF A;  3U6M A;  3U6Q A;  4ITQ A;  4JI6 M;  3A42 A;  3W0F A;  4NXM M;  2UUB M;  1FJG M; 
#chains in the Genus database with same CATH topology
 2MRO B;  3GQ3 A;  2DKL A;  1N33 M;  2O25 A;  2G3Q A;  3B7Z A;  4M0D A;  3GPX A;  4DR1 M;  3U6O A;  3THG A;  1NJG A;  3QAU A;  2R6F A;  2QCU A;  1I94 M;  1R7R A;  3RE8 A;  4PT5 A;  3VDP A;  5DNY A;  2KNA A;  2L4F A;  2JY6 B;  4FCV A;  2FFJ A;  4X66 M;  2QQ8 A;  3M6A A;  5FTM A;  2XH9 A;  4FCT A;  2F5P A;  1Z6T A;  4QOS A;  1D2N A;  2WSE F;  4L16 A;  4AZF A;  3LVV A;  3L26 A;  4B3S M;  4AKH A;  1DV0 A;  4LRT A;  4DUY M;  2CEA A;  5EXX A;  4IBI A;  1NJF A;  3MK6 A;  5L8R F;  4DV0 M;  1N34 M;  3LMM A;  2XSZ D;  3T6P A;  1QAO A;  2JY8 A;  4G6Z A;  1D0K A;  3E46 A;  4RNA A;  3SAV A;  2GNO A;  1LV7 A;  3PNY A;  4IJE A;  4X65 M;  1S3S A;  4OU7 A;  3U6P A;  3U6S A;  1Z5A A;  3SMP A;  2ERC A;  3ZCB B;  4I81 A;  1K3W A;  2DZL A;  1TDZ A;  2F5S A;  4GKJ M;  2HKJ A;  1SXJ D;  1IBK M;  2EUC A;  1N77 A;  1N75 A;  1HNW M;  1QUS A;  2DEN A;  3VDU A;  4DV4 M;  4G4N A;  3AOG A;  1OKS A;  4MB7 A;  4UN2 B;  2JA2 A;  1DGF A;  1E9R A;  4BLC A;  3T1H M;  2K9D A;  1Q39 A;  1VQ1 A;  2QPA A;  3AOE C;  2EA0 A;  3FUX A;  3HHX A;  4DR4 M;  2CWB A;  1GKI A;  2NQ8 C;  4QOZ C;  3GQ4 A;  2VII A;  2UXC M;  4B3T M;  2ZTD A;  1Q3B A;  2R4E A;  3LW5 F;  4FD2 A;  2B3T A;  3AJI B;  7CAT A;  4DBG B;  2OO9 A;  5ITU A;  4LF4 M;  3BBZ A;  3GRU A;  1IN5 A;  4HEO A;  3CF0 A;  5FTL A;  4DV2 M;  1YSY A;  1DGB A;  4DR3 M;  2CUZ A;  4AG6 A;  3U6D A;  2HL7 A;  4DV5 M;  4GMQ A;  4I8O A;  4P16 A;  2R62 A;  2CV0 A;  3WHK A;  4ANR A;  1OFH A;  1JR3 A;  2LVA A;  3W67 A;  4B7F A;  3A46 A;  2KNV A;  2Z3X A;  4G4R A;  1C7Y A;  4FWH A;  3SC3 A;  1GAB A;  4LCB A;  2LXE A;  4X62 M;  1Z5B A;  2R4J A;  1CUK A;  1MU5 A;  2MJ5 B;  1KFV A;  2FH0 A;  4NRW A;  2BWE A;  2O01 F;  2R0I A;  3OTO M;  2ZTC A;  1Y8G A;  5KPZ A;  3KFU G;  5IRE B;  3K9P A;  2KXE A;  2RGO A;  3GLG B;  1DGH B;  2F5N A;  4HLQ A;  1XC8 A;  2HAK A;  2J7O A;  1W5T A;  1GL6 A;  3B89 A;  1NV8 A;  1TGU A;  2R65 A;  2DXI A;  4GHA A;  3KS8 A;  1KSF X;  5H37 D;  3ZH9 B;  1TH2 A;  3J2P B;  3UK6 A;  2C5R A;  2LWX A;  3HU1 A;  3U6C A;  3I51 A;  1L2D A;  3M7G A;  3SHF A;  4GIT A;  3PVS A;  3AFH A;  3SAU A;  2FE8 A;  3KXE C;  2KW0 A;  2LBC A;  1G41 A;  4RKU F;  1V33 A;  1R4G A;  1OQY A;  1VDL A;  1V92 A;  4NRV A;  3FRI A;  2WZJ A;  2H5X A;  2K0B X;  2OOA A;  4JN6 A;  5JI3 E;  2KA6 B;  2LTU A;  5A2Q S;  4LY6 A;  4MGZ E;  2F5O A;  2UXD M;  3MMP A;  4ZPX A;  5C18 A;  3NWL A;  4ITQ A;  3HU2 A;  1SXJ A;  1TR8 A;  1PJQ A;  4CHT B;  3TQS A;  2ZAN A;  2AHM A;  4JI4 M;  3EIE A;  4JV5 M;  3A98 B;  1N32 M;  2XEP A;  4LJ9 A;  4JI0 M;  3HJQ A;  2BWB A;  3KS4 A;  4I4L A;  3D8L A;  3FRH A;  3ZC7 B;  3GLI B;  1WGN A;  3CF2 A;  1GJS A;  2QHO B;  4L8R C;  4IBC A;  4XGI A;  8CAT A;  1R5L A;  1OJL A;  2LHC A;  2LVN C;  1PJI A;  4DV7 M;  3NBI A;  2F5Q A;  3C58 A;  5DYI A;  1WIV A;  2DZN B;  2QBY A;  1LTM A;  3FUW A;  3KP0 E;  4QNR A;  3U61 A;  3Q8X A;  3SYL A;  1G59 A;  2A5Y B;  4LFC M;  2CV2 A;  1UM8 A;  2RGH A;  2EKF A;  4BBA A;  1OFI A;  2Y20 A;  1PJJ A;  5EP3 A;  2VQF M;  4DV6 M;  4P17 A;  3I04 M;  5ITR A;  5IZ7 D;  3RGS A;  3K1J A;  4Y28 F;  4LF6 M;  1QZE A;  3UMM A;  3U61 B;  2G5G X;  2R18 A;  4LF5 M;  3GPY A;  3GLF E;  2D7G A;  4M9Z A;  3CGW A;  1SXJ C;  3JR4 A;  4LF9 M;  4WUR A;  4XBO A;  4AKI A;  1QYR A;  1NVM A;  1ZMV A;  3FTD A;  4IJF A;  3GLI A;  3KDS E;  4NSO B;  4D81 A;  3B7N A;  3UGJ A;  4LF7 M;  1J09 A;  3J7B A;  4X64 M;  2HHH M;  1JQJ C;  3FE3 A;  1XWI A;  2X4A A;  1PJS A;  4IBJ A;  2DAI A;  4NSR A;  4QHT A;  4D80 A;  4HL4 A;  1IN4 A;  3Q8G A;  3MJ5 A;  3FUU A;  5ITQ A;  3TPZ A;  1J5E M;  4OVZ B;  2MGW A;  3V76 A;  3U6L A;  1T43 A;  1GVN A;  5EXS A;  1D0M A;  3LQQ A;  1IFY A;  1K3X A;  1HR0 M;  1XXH E;  3R8F A;  4QNM A;  3KVW A;  2KRK A;  3L29 A;  4W5W A;  2Z4S A;  3TE6 A;  1DO2 A;  4GHL A;  3VKH A;  4LJ7 A;  2LVO C;  2WSC F;  2DHY A;  1PJT A;  4XK8 F;  2UUA M;  5BR8 M;  1PRB A;  2CHG A;  2CHQ A;  3GQ5 A;  1NY5 A;  4JI5 M;  4Q7J A;  4DV1 M;  1QZM A;  2QSF X;  4F2L A;  3H4J A;  4QHS A;  4JYA M;  4R7G A;  3HGI A;  4GKK M;  3H4M A;  1YUB A;  1HNX M;  4AQY M;  5IT9 S;  2BJW A;  2LHG A;  1J7K A;  2YQZ A;  1N78 A;  5EP2 A;  5EJC A;  1L2C A;  3LVW A;  4OVZ A;  4B3R M;  2DNA A;  1AUA A;  4LJ6 A;  4FVM A;  5KQD A;  4K0K M;  3GLI E;  5KO3 A;  3TWL A;  2XSZ A;  5ITY A;  3FTE A;  1Z59 A;  3QYB A;  4Z8X A;  4IIW A;  3SMS A;  3JAM S;  4IBF A;  3FYD A;  3KP1 E;  1IN6 A;  2R46 A;  2VF8 A;  3J27 B;  3K8Z A;  5EP4 A;  4MGI E;  2K6B A;  5FTK A;  2Y0Q A;  2OPF A;  3GRV A;  1TH3 A;  3W0F A;  4AG5 A;  1T3T A;  2UUB M;  1XB2 B;  1QDT A;  1K82 A;  4MGK E;  2KRU A;  2ZAO A;  1OIZ A;  3GLH E;  3VK8 A;  2KHH A;  3HJS A;  3SYK A;  1R2Z A;  1H6U A;  1HJP A;  2RRU A;  4M0W A;  3HX3 A;  5JI2 E;  5KPT A;  3PNV A;  3L27 A;  2N35 A;  5E26 A;  2ZBK B;  4LFB M;  1QVR A;  2EJS A;  4KT0 F;  4LZZ A;  4M9S A;  3AV0 A;  1KYI A;  2L09 A;  1QAM A;  1T6O A;  4FWG A;  1IN7 A;  2WSF F;  5E6J A;  3GP1 A;  3GLF A;  4CIZ A;  4YY3 M;  1G8P A;  5ITX A;  2O5R A;  2V6Z M;  1E9S A;  1R6B X;  4A3V B;  2XGN A;  3KOW E;  1WJ7 A;  3BXW A;  5EXT A;  1NV9 A;  5FLX S;  4LGY A;  2CV1 A;  4BB9 A;  1IQP A;  2APL A;  1WR1 B;  1NNU C;  3K92 A;  3KSJ A;  4NXN M;  4PDG A;  3U6E A;  5IWA M;  5FTJ A;  3BOS A;  2QBY B;  1N36 M;  3R9X B;  2XF3 A;  4IBB A;  2KNZ A;  4PDI A;  4LRS A;  5KQ8 A;  1ZMU A;  1C1K A;  2L2D A;  1VEJ A;  3T15 A;  3SAS A;  1L1Z A;  2DAE A;  2R44 A;  2JZ0 A;  3T1Y M;  3TWK A;  4DUZ M;  1IXR C;  1HQC A;  4AI6 A;  1OAO C;  3DOA A;  1NHW C;  5KPR A;  1ORY B;  3HHW A;  4EIW A;  4FCW A;  2QZ4 A;  1P3Q Q;  4MGH A;  2Y21 A;  4D82 A;  3K2L A;  2OOB A;  3W68 A;  2V1U A;  1AIP C;  3NBX X;  4PD2 A;  2JNH A;  4FWD A;  2GQF A;  4FW9 A;  3FTC A;  4NL4 H;  3L28 A;  4M9X A;  4DR2 M;  3GRR A;  2JZ1 A;  2VDB B;  1DGG A;  3J81 S;  4MM3 B;  4CGY B;  4CIS A;  1I4W A;  2LVQ D;  3LCU A;  1JR3 E;  3WHL A;  2DAM A;  3HJ8 A;  3GO8 A;  1QAN A;  2CHV A;  1Q3C A;  3QYE A;  4JI8 M;  1XNQ M;  1EIJ A;  1IBL M;  1PM5 A;  3TWM A;  2K47 A;  2YFQ A;  4L6V 6;  4S12 A;  3KSX A;  1WHC A;  1OAI A;  3C3D A;  5BPV A;  1HNZ M;  2D7E A;  3KOY E;  1WGL A;  2M60 A;  3CF6 E;  4LGM A;  1QQW A;  4B7G A;  4LJ4 A;  4DV3 M;  5EQT A;  1R2Y A;  1MX0 A;  2VQE M;  2XZU A;  3JR5 A;  4LJ8 A;  1HQY E;  3HZJ A;  4JI2 M;  3VKG A;  2W82 A;  3B7Q A;  1OTR A;  2J7N A;  3UJN A;  2X8A A;  3K9O A;  1GLN A;  1FNN A;  3SFZ A;  3F92 A;  1L8Q A;  2C9C A;  2ZAM A;  4JXJ A;  2LNH C;  4DR5 M;  1F4I A;  4GH9 A;  5LMN M;  1Q02 A;  4IBG A;  1XMO M;  3ZQJ A;  2JY5 A;  1ZV1 A;  1QUT A;  2BJV A;  4GC9 A;  3AL0 C;  4LF8 M;  1EFU B;  1IXS B;  1TTE A;  2CRU A;  3D8B A;  1NO1 A;  4IBE A;  1PGY A;  2YNM D;  1SXJ B;  2KDL A;  4L15 A;  4LG2 A;  3B9P A;  2XFT A;  3IHP A;  3VLF B;  2XFS A;  3L2A A;  3L25 A;  4CJ6 A;  3J80 S;  2P5T A;  1NNJ A;  2DWM A;  2V1C A;  4GRI A;  3RFW A;  3TL4 X;  3DFZ A;  3SBJ A;  3HHY A;  1GO5 A;  4DR6 M;  1DO0 A;  2QP9 X;  1GJT A;  3AKZ A;  5LMU M;  4KOD A;  2QNJ A;  1XNR M;  2I7P A;  1OIP A;  3I01 M;  4WP2 A;  4LFA M;  1G4A E;  3U60 A;  2C99 A;  3U60 B;  3FUV A;  1E32 A;  1G3I A;  4L4U A;  2RKO A;  4B7H A;  3U6Q A;  4JI6 M;  3FTF A;  3IG8 A;  1FJG M;  1XXH B;  2L7I A;  3FYC A;  2DWL A;  2C9O A;  3J7A S;  1W5S A;  2UXB M;  4TUW A;  4GIP A;  2HWJ A;  1VG5 A;  4NOO B;  4RF0 A;  2FS1 A;  2JWS A;  2CFO A;  2R45 A;  1D0L A;  1SXJ E;  1UFZ A;  2X49 A;  2Y0T A;  1XHB A;  4F1I A;  3HU3 A;  4KO8 A;  2H1R A;  4II7 A;  3GLH B;  3GRY A;  5ITX E;  3U5Z A;  2M5Z A;  1Z5C A;  3VK7 A;  1DGH A;  1G71 A;  2MH8 A;  3E21 A;  3GLG A;  2HCB A;  2I7N A;  3GLG E;  1VEK A;  1NSF A;  2JY7 A;  3HY5 A;  3KOZ E;  4LJA A;  5FSW A;  1WXQ A;  2LH0 A;  3B74 A;  3E4R A;  2XZF A;  3KW6 A;  1L2B A;  4DR7 M;  4KHP M;  2G8L A;  5GKN A;  1JR3 D;  2L4E A;  3SAW A;  1TDH A;  1BVS A;  3LCV B;  1GL7 A;  1IXZ A;  1QDR A;  2KZS A;  2F4V M;  2DHR A;  2EO2 A;  3E9S A;  4IBD A;  4OW0 A;  1MN3 A;  1YLA A;  3QWL A;  2VF7 A;  4JI3 M;  1L1T A;  3GPP A;  5EP1 A;  3I4V A;  1SG9 A;  4AKG A;  3DA1 A;  2BNK A;  3C9P A;  2L7H A;  4MH0 E;  1JB0 F;  1IY2 A;  5C1B A;  5DFL A;  3GLF B;  4R71 A;  2LVP C;  3HKP A;  3ILK A;  2MR9 A;  4RF1 A;  4NC6 A;  2C98 A;  1XMQ M;  2DAK A;  3PXG A;  3LQR A;  2KZU A;  5ITT A;  2E5L M;  3SHG B;  2DAG A;  1A5T A;  3CTW B;  1HT1 E;  3GPU A;  5F3W A;  1IY0 A;  1HT2 E;  4KLN A;  4AW4 A;  4GC5 A;  1IBM M;  1IY1 A;  2DI0 A;  1IM2 A;  2C96 A;  3C3E A;  1E94 E;  2EKK A;  3M0E A;  3T38 A;  1MJG M;  3A45 A;  4G4Q A;  4Z6Y A;  3MHV C;  1ZAE A;  1NHG C;  3FD9 A;  2UU9 M;  5DYG A;  4JI7 M;  1ZQ9 A;  3I4Y A;  3IEC A;  5FTN A;  3VFD A;  2XLJ A;  2J5Y A;  1VEG A;  4LZJ A;  4IBK A;  1NY6 A;  1TF0 B;  3HWS A;  4MGY E;  2FOI C;  2D7H A;  3FUT A;  5EXP A;  3SAT A;  2Z7J A;  4R3D A;  3RGP A;  3U5Z B;  3SAR A;  1IXS A;  4PCZ A;  2DVW B;  2QEN A;  3EIH A;  4OX9 M;  1ZMW A;  3HHZ A;  3PFI A;  4LJ5 A;  4GEW A;  1X37 A;  2Z4R A;  2L6O A;  2DWZ B;  3KOX E;  3GLH A;  1XXH A;  2Z8Y M;  3UZU A;  2YR0 A;  1VDD A;  3DZD A;  2FNA A;  4YHH M;  4G4O A;  3W0L B;  1EE8 A;  4JI1 M;  2ZM6 M;  2JP7 A;  1YE9 A;  2CP8 A;  4I5S A;  4B3M M;  2OQ4 A;  4B08 A;  3FKE A;  2UUC M;  4REZ A;  2DZO B;  4G3O A;  2CE7 A;  1V34 A;  1RU3 A;  4L78 A;  4WW0 A;  2Q2E B;  1TH4 A;  2KEB A;  1QAQ A;  3IG5 A;  3U6M A;  3A42 A;  4NXM M;  2JUJ A;  2DWN A;  1IN8 A;  2JXN A;  3AOE A; 
#chains in the Genus database with same CATH homology
 3GQ3 A;  1N33 M;  4M0D A;  3GPX A;  4DR1 M;  3U6O A;  3THG A;  1NJG A;  3QAU A;  2QCU A;  1I94 M;  1R7R A;  3RE8 A;  4PT5 A;  3VDP A;  5DNY A;  4FCV A;  2FFJ A;  4X66 M;  3M6A A;  2F5P A;  5FTM A;  2XH9 A;  4FCT A;  1Z6T A;  4QOS A;  1D2N A;  4L16 A;  4AZF A;  3L26 A;  3LVV A;  4B3S M;  4AKH A;  4LRT A;  4DUY M;  2CEA A;  5EXX A;  4IBI A;  1NJF A;  3MK6 A;  4DV0 M;  1N34 M;  3LMM A;  2XSZ D;  1QAO A;  4G6Z A;  3SAV A;  4RNA A;  3PNY A;  1LV7 A;  4IJE A;  4X65 M;  4OU7 A;  1S3S A;  3U6P A;  3U6S A;  1Z5A A;  3SMP A;  2ERC A;  3ZCB B;  4I81 A;  1K3W A;  1TDZ A;  2F5S A;  4GKJ M;  2HKJ A;  1SXJ D;  1IBK M;  2EUC A;  1N77 A;  1N75 A;  1HNW M;  3VDU A;  4DV4 M;  4G4N A;  3AOG A;  4MB7 A;  2JA2 A;  1DGF A;  1E9R A;  4BLC A;  3T1H M;  2QPA A;  1Q39 A;  2EA0 A;  3AOE C;  4DR4 M;  3FUX A;  3HHX A;  4QOZ C;  1GKI A;  2NQ8 C;  3GQ4 A;  2VII A;  2UXC M;  4B3T M;  1Q3B A;  2R4E A;  4FD2 A;  3AJI B;  7CAT A;  5ITU A;  4LF4 M;  3GRU A;  1IN5 A;  3CF0 A;  5FTL A;  4DV2 M;  1YSY A;  1DGB A;  4DR3 M;  2CUZ A;  4AG6 A;  3U6D A;  2HL7 A;  4DV5 M;  4GMQ A;  4I8O A;  4P16 A;  2R62 A;  2CV0 A;  3WHK A;  1OFH A;  1JR3 A;  4B7F A;  3A46 A;  2Z3X A;  4G4R A;  4FWH A;  3SC3 A;  4LCB A;  2LXE A;  4X62 M;  1Z5B A;  2R4J A;  1MU5 A;  1KFV A;  4NRW A;  3OTO M;  5KPZ A;  3KFU G;  5IRE B;  2KXE A;  2RGO A;  3GLG B;  1DGH B;  2F5N A;  4HLQ A;  1XC8 A;  2J7O A;  1W5T A;  1GL6 A;  1TGU A;  2R65 A;  2DXI A;  4GHA A;  3KS8 A;  1KSF X;  5H37 D;  3ZH9 B;  1TH2 A;  3J2P B;  3UK6 A;  2C5R A;  2LWX A;  3HU1 A;  3U6C A;  3I51 A;  1L2D A;  3M7G A;  3SHF A;  4GIT A;  3PVS A;  3AFH A;  3SAU A;  2FE8 A;  3KXE C;  2KW0 A;  1G41 A;  4NRV A;  5JI3 E;  4JN6 A;  2KA6 B;  5A2Q S;  4LY6 A;  4MGZ E;  2F5O A;  2UXD M;  4ZPX A;  5C18 A;  3NWL A;  4ITQ A;  3HU2 A;  1SXJ A;  4CHT B;  3TQS A;  2ZAN A;  2AHM A;  4JI4 M;  3EIE A;  4JV5 M;  3A98 B;  1N32 M;  2XEP A;  4LJ9 A;  4JI0 M;  3HJQ A;  3KS4 A;  4I4L A;  3D8L A;  3ZC7 B;  3GLI B;  3CF2 A;  4L8R C;  4IBC A;  4XGI A;  8CAT A;  1OJL A;  1PJI A;  4DV7 M;  3NBI A;  2F5Q A;  3C58 A;  5DYI A;  2DZN B;  2QBY A;  3FUW A;  3KP0 E;  4QNR A;  3U61 A;  3Q8X A;  3SYL A;  1G59 A;  2A5Y B;  4LFC M;  2CV2 A;  1UM8 A;  2RGH A;  4BBA A;  1OFI A;  2Y20 A;  1PJJ A;  5EP3 A;  2VQF M;  4DV6 M;  5ITR A;  5IZ7 D;  3RGS A;  3K1J A;  4LF6 M;  3UMM A;  3U61 B;  2G5G X;  2R18 A;  4LF5 M;  3GPY A;  2D7G A;  4M9Z A;  1SXJ C;  3JR4 A;  4LF9 M;  4WUR A;  4XBO A;  4AKI A;  1QYR A;  1NVM A;  3FTD A;  4IJF A;  3GLI A;  3KDS E;  4NSO B;  4D81 A;  3UGJ A;  4LF7 M;  1J09 A;  3J7B A;  4X64 M;  2HHH M;  1JQJ C;  1XWI A;  2X4A A;  4IBJ A;  4NSR A;  4QHT A;  4D80 A;  4HL4 A;  1IN4 A;  3MJ5 A;  3FUU A;  5ITQ A;  3TPZ A;  1J5E M;  4OVZ B;  3U6L A;  1GVN A;  5EXS A;  3LQQ A;  1K3X A;  1HR0 M;  3R8F A;  4QNM A;  3KVW A;  2KRK A;  3L29 A;  4W5W A;  2Z4S A;  3TE6 A;  1DO2 A;  4GHL A;  3VKH A;  4LJ7 A;  2UUA M;  5BR8 M;  2CHG A;  2CHQ A;  3GQ5 A;  1NY5 A;  4JI5 M;  4DV1 M;  1QZM A;  4QHS A;  4JYA M;  4R7G A;  3HGI A;  4GKK M;  3H4M A;  1YUB A;  1HNX M;  4AQY M;  5IT9 S;  2BJW A;  1J7K A;  2YQZ A;  1N78 A;  5EP2 A;  5EJC A;  1L2C A;  3LVW A;  4OVZ A;  4B3R M;  4LJ6 A;  4FVM A;  5KQD A;  4K0K M;  5KO3 A;  3TWL A;  2XSZ A;  5ITY A;  3FTE A;  1Z59 A;  4Z8X A;  4IIW A;  3SMS A;  3JAM S;  4IBF A;  3FYD A;  3KP1 E;  1IN6 A;  2R46 A;  3J27 B;  3K8Z A;  5EP4 A;  4MGI E;  5FTK A;  2OPF A;  2Y0Q A;  3GRV A;  1TH3 A;  3W0F A;  4AG5 A;  1T3T A;  2UUB M;  1K82 A;  4MGK E;  2KRU A;  2ZAO A;  3VK8 A;  3HJS A;  3SYK A;  1R2Z A;  1H6U A;  5JI2 E;  4M0W A;  5KPT A;  3PNV A;  3L27 A;  4LFB M;  5E26 A;  2ZBK B;  1QVR A;  4LZZ A;  4M9S A;  3AV0 A;  1KYI A;  2L09 A;  1QAM A;  4FWG A;  5E6J A;  1IN7 A;  3GLF A;  3SAT A;  3GP1 A;  4YY3 M;  1G8P A;  5ITX A;  2O5R A;  2V6Z M;  1E9S A;  1R6B X;  4A3V B;  2XGN A;  3KOW E;  5EXT A;  5FLX S;  4LGY A;  2CV1 A;  4BB9 A;  1IQP A;  4NXN M;  1NNU C;  3K92 A;  3KSJ A;  4PDG A;  3U6E A;  5IWA M;  5FTJ A;  3BOS A;  2QBY B;  1N36 M;  3R9X B;  2XF3 A;  4IBB A;  4PDI A;  4LRS A;  5KQ8 A;  3T15 A;  1C1K A;  3SAS A;  1L1Z A;  3T1Y M;  3TWK A;  4DUZ M;  1IXR C;  1HQC A;  4AI6 A;  3DOA A;  1NHW C;  5KPR A;  1ORY B;  3HHW A;  4EIW A;  4FCW A;  2QZ4 A;  4MGH A;  2Y21 A;  4D82 A;  3K2L A;  2V1U A;  4PD2 A;  4FWD A;  4FW9 A;  3FTC A;  4NL4 H;  3L28 A;  4M9X A;  4DR2 M;  3GRR A;  3J81 S;  1DGG A;  4MM3 B;  4CGY B;  4CIS A;  1I4W A;  3WHL A;  3HJ8 A;  3GO8 A;  4JI8 M;  1QAN A;  2CHV A;  1Q3C A;  1XNQ M;  1IBL M;  1PM5 A;  3TWM A;  2K47 A;  2YFQ A;  4S12 A;  3KSX A;  5BPV A;  1HNZ M;  2D7E A;  3KOY E;  3CF6 E;  2M60 A;  4LGM A;  4B7G A;  1QQW A;  4LJ4 A;  4DV3 M;  5EQT A;  1R2Y A;  1MX0 A;  2VQE M;  2XZU A;  3JR5 A;  4LJ8 A;  1HQY E;  4JI2 M;  3VKG A;  2W82 A;  2J7N A;  3UJN A;  2X8A A;  1GLN A;  1FNN A;  3SFZ A;  1L8Q A;  2C9C A;  2ZAM A;  4JXJ A;  2LNH C;  4DR5 M;  4GH9 A;  5LMN M;  4IBG A;  1XMO M;  2BJV A;  4GC9 A;  3AL0 C;  4LF8 M;  1IXS B;  3D8B A;  4IBE A;  2YNM D;  4L15 A;  1SXJ B;  4LG2 A;  2XFT A;  3VLF B;  2XFS A;  3L2A A;  3L25 A;  3J80 S;  2P5T A;  1NNJ A;  2DWM A;  2V1C A;  4GRI A;  3RFW A;  3TL4 X;  3DFZ A;  3SBJ A;  3HHY A;  4DR6 M;  1DO0 A;  2QP9 X;  5LMU M;  3AKZ A;  4KOD A;  1XNR M;  2I7P A;  4LFA M;  3U60 A;  1G4A E;  3U60 B;  2C99 A;  3FUV A;  1E32 A;  1G3I A;  4L4U A;  2RKO A;  4B7H A;  3U6Q A;  4JI6 M;  3FTF A;  3IG8 A;  1FJG M;  1XXH B;  2L7I A;  3FYC A;  2DWL A;  2C9O A;  3J7A S;  1W5S A;  2UXB M;  4TUW A;  4GIP A;  4NOO B;  4RF0 A;  2CFO A;  2R45 A;  1SXJ E;  2X49 A;  2Y0T A;  1XHB A;  3HU3 A;  4KO8 A;  2H1R A;  4II7 A;  3GLH B;  3GRY A;  5ITX E;  3U5Z A;  2M5Z A;  1Z5C A;  3VK7 A;  1DGH A;  3GLG A;  2HCB A;  2I7N A;  1NSF A;  4LJA A;  3KOZ E;  5FSW A;  1WXQ A;  2LH0 A;  3E4R A;  2XZF A;  3KW6 A;  1L2B A;  4DR7 M;  4KHP M;  2G8L A;  5GKN A;  1JR3 D;  3SAW A;  1TDH A;  1GL7 A;  1IXZ A;  2KZS A;  2F4V M;  2DHR A;  2EO2 A;  3E9S A;  4IBD A;  4OW0 A;  3QWL A;  1L1T A;  4JI3 M;  3GPP A;  5EP1 A;  3I4V A;  4AKG A;  3DA1 A;  2BNK A;  2L7H A;  4MH0 E;  5C1B A;  1IY2 A;  3GLF B;  3HKP A;  3ILK A;  4RF1 A;  2C98 A;  1XMQ M;  3PXG A;  3LQR A;  2KZU A;  5ITT A;  2E5L M;  3SHG B;  3CTW B;  1HT1 E;  3GPU A;  5F3W A;  1IY0 A;  1HT2 E;  4KLN A;  4AW4 A;  4GC5 A;  1IBM M;  1IY1 A;  1IM2 A;  2C96 A;  3M0E A;  1E94 E;  3T38 A;  3A45 A;  4G4Q A;  4Z6Y A;  3MHV C;  1ZAE A;  1NHG C;  3FD9 A;  2UU9 M;  5DYG A;  4JI7 M;  1ZQ9 A;  3I4Y A;  3VFD A;  5FTN A;  2XLJ A;  4LZJ A;  4IBK A;  1NY6 A;  3HWS A;  4MGY E;  2FOI C;  2D7H A;  3FUT A;  5EXP A;  2Z7J A;  4R3D A;  3RGP A;  3U5Z B;  3SAR A;  4PCZ A;  2DVW B;  2QEN A;  3EIH A;  4OX9 M;  3HHZ A;  3PFI A;  4LJ5 A;  1X37 A;  2Z4R A;  2L6O A;  2DWZ B;  3KOX E;  3GLH A;  1XXH A;  4YHH M;  3UZU A;  2YR0 A;  1VDD A;  3DZD A;  2FNA A;  4G4O A;  3W0L B;  1EE8 A;  4JI1 M;  2ZM6 M;  1YE9 A;  4I5S A;  4B3M M;  2OQ4 A;  4B08 A;  3FKE A;  2UUC M;  4REZ A;  2DZO B;  2CE7 A;  4L78 A;  4WW0 A;  2Q2E B;  1TH4 A;  2KEB A;  1QAQ A;  3IG5 A;  3U6M A;  3A42 A;  4NXM M;  2DWN A;  1IN8 A;  3B9P A;  3AOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...