3J80S

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 21
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j80S01
3U6LA 2UUCM 4JV5M 4X62M 3OTOM 1K3WA 3DOAA 5ITXE 2F5OA 2F5QA 3U6CA 5A2QS 4DUZM 1XNQM 4JI1M 1IBMM 1Z5AA 1L1ZA 4B3RM 3U6MA 1Q3CA 4DV7M 3GPUA 1KFVA 4DR6M 3GO8A 3GP1A 4PDGA 2UU9M 3U6QA 2UXBM 4JI7M 4LFAM 3SAVA 1Q3BA 2UUBM 2OPFA 4ITQA 2UUAM 4PCZA 1K3XA 4LF6M 4DR3M 4JI3M 3U6EA 4LF4M 4JYAM 1TDHA 3J7AS 4NXMM 1N36M 2Q2EB 4LF5M 5ITUA 3GPYA 4NRVA 4JI2M 4DUYM 1EE8A 1XC8A 4DR4M 5BR8M 4DV3M 2UXDM 4DV6M 5ITRA 4MB7A 3U6SA 5ITYA 3GQ3A 3VK8A 4YY3M 4JI6M 2E5LM 3J80S 4G4RA 4LF9M 1N32M 4KHPM 1XMQM 3J81S 2XZUA 3JAMS 4CISA 5IT9S 1HNXM 3A45A 2XZFA 4LF8M 2UXCM 4NXNM 1L2CA 4G4QA 3SAUA 1K82A 2F5PA 4DR1M 4LFBM 1TDZA 1IBKM 3GQ4A 1R2YA 5LMUM 1IBLM 4GKKM 1L2BA 4AQYM 3TWKA 1N34M 1R2ZA 2EA0A 4DV0M 2VQEM 3A46A 4LFCM 4PD2A 3A42A 3TWMA 3VK7A 2F5NA 4DV4M 3T1YM 1XMOM 4DR2M 4B3TM 4JI5M 4G4NA 4DV2M 2HKJA 5LMNM 1I94M 4DR7M 2F5SA 3GPXA 3GQ5A 4X65M 1Z5BA 3JR4A 5IWAM 1Z59A 3JR5A 1PM5A 2F4VM 4DR5M 4OX9M 4NRWA 3TWLA 3GPPA 3C58A 1PJIA 1MU5A 5ITXA 2ZBKB 1Q39A 5ITTA 3U6OA 3SATA 4JI4M 1L2DA 4K0KM 2VQFM 4DV5M 1XNRM 1PJJA 5ITQA 4JI8M 4X66M 1HNZM 1L1TA 1HR0M 3U6PA 4JI0M 3SBJA 2HHHM 4DV1M 4PDIA 4B3SM 4GKJM 1Z5CA 1FJGM 4X64M 1HNWM 3SASA 5FLXS 3SARA 4YHHM 2ZM6M 4G4OA 3T1HM 1NNJA 2OQ4A 1MX0A 3W0FA 3U6DA 4B3MM 4LF7M 3SAWA 1N33M 1J5EM
chains in the Genus database with same CATH superfamily
1DGBA 4GHAA 3VFDA 3DOAA 2DENA 4GH9A 5ITXE 2F5QA 1WJ7A 2QNJA 1JR3A 3KSJA 2ZAMA 3M0EA 5A2QS 1EIJA 4JI1M 1T6OA 1PJTA 3C3DA 3FYCA 1IQPA 3RGSA 3VLFB 2N35A 4B3RM 2H5XA 1SXJC 4I4LA 4GEWA 3T15A 4G6ZA 1TF0B 1X37A 1XXHE 1G4AE 3L29A 3SYLA 2XFTA 3VDPA 1AUAA 3GO8A 2D7GA 5FSWA 1IFYA 4LJAA 2C99A 4OW0A 2JP7A 1LV7A 2WSFF 4B7HA 4RF1A 1K3XA 1D0KA 4LF6M 4IBBA 5EXSA 1TDHA 3UZUA 2WSEF 4LJ8A 4LF5M 1OQYA 4G3OA 4NRVA 2JUJA 1IXSA 4A3VB 2R45A 2CV2A 1QYRA 1VG5A 3TL4X 3RE8A 2MGWA 1IXSB 2KRKA 2YQZA 1AIPC 4IBFA 3SHGB 1NHWC 4DV3M 2WZJA 4DV6M 5H37D 3K1JA 1H6UA 2Z7JA 1GL6A 2DWZB 2DVWB 4FWHA 4M9SA 1GJTA 3GQ3A 3VK8A 2QSFX 4JI6M 2E5LM 1GABA 2DAIA 5BPVA 2RGOA 2K47A 3ILKA 4BB9A 4BBAA 2X49A 2JY6B 1XMQM 2OOAA 2DKLA 3HY5A 5KPTA 4WP2A 2KNZA 2XGNA 3HHYA 1OIPA 3PNYA 4CISA 3LW5F 2R46A 1DO0A 5EP3A 2Y20A 4TUWA 2LWXA 2UXCM 1NV9A 4G4QA 3UJNA 3SAUA 4LFBM 1OAIA 4AG5A 1RU3A 1A5TA 3B7QA 5LMUM 3R9XB 1SXJE 2DXIA 3TWKA 4LZZA 4DV0M 3KDSE 3PFIA 1N78A 2L09A 3FRIA 3A42A 2JZ0A 2Z4SA 4WURA 2JY8A 3T1YM 2JY5A 3L2AA 4L16A 3C3EA 3MHVC 4EIWA 2CP8A 3B74A 2HKJA 2OOBA 3FTEA 1T43A 3FTFA 4ZPXA 3IG8A 4X65M 4AKHA 2YFQA 2RKOA 4NOOB 4OU7A 1IN8A 3HKPA 1NY6A 4ANRA 4DR5M 4II7A 3U61A 3BOSA 2R65A 4L15A 2LVNC 1MU5A 2ZBKB 1NNUC 3KOYE 1XHBA 1NHGC 2KA6B 2DZOB 4LCBA 3R8FA 2APLA 4DV5M 2R0IA 1W5TA 4I5SA 5ITQA 3U61B 2R44A 2WSCF 3ZQJA 1PJJA 1HNZM 1QAQA 1G41A 1YSYA 3IG5A 3NWLA 1HT2E 4I81A 5E26A 2LNHC 4B3SM 4M9XA 1VEGA 1PRBA 3W68A 4JN6A 1HNWM 2DZLA 2LBCA 3SARA 3FKEA 4YHHM 3GRYA 4G4OA 2L2DA 4B3MM 1E9RA 1MX0A 4L6V6 4LF7M 1E32A 2GNOA 1TH4A 3HWSA 4LGYA 2LVQD 1HT1E 2R4JA 3WHLA 3AOEA 3A98B 4JV5M 2F5OA 5KQDA 4GRIA 2J7NA 3Q8GA 3U60A 3H4MA 3GLFA 4FCTA 3J7BA 2R62A 1Z5AA 1IBMM 5DYGA 2CV1A 1VDDA 2L4FA 1W5SA 1UFZA 3E46A 3I04M 1Q3CA 1JB0F 4IBJA 5KPRA 1QAMA 2XEPA 2V6ZM 3GPUA 2M5ZA 2KRUA 3FTDA 3RGPA 4LJ5A 1QUSA 1OAOC 1KFVA 4DR6M 2LTUA 1QZMA 2CEAA 1G71A 4DBGB 3E9SA 1J7KA 3AL0C 3NBXX 2UUBM 4GC5A 3MMPA 4F1IA 4ITQA 1JR3D 3GLIA 1ZMUA 3U6EA 3CTWB 4LRSA 3CF0A 1PJQA 4KLNA 5EXXA 2Q2EB 2CFOA 1T3TA 5ITUA 1JR3E 1GVNA 1SG9A 3GLIB 1BVSA 4Q7JA 4B7FA 3D8BA 2Y0QA 1IN6A 1YUBA 3C9PA 3PVSA 2KNAA 3T6PA 4CJ6A 1XC8A 1VDLA 1TH2A 2RGHA 2X8AA 3KP1E 4HL4A 4DR4M 4RKUF 4D81A 2XF3A 1NO1A 2DNAA 1QQWA 3GLHA 4YY3M 2CHQA 1MJGM 3HJQA 2ERCA 1QUTA 1D0MA 3GLHB 5KPZA 4KHPM 2QP9X 3J81S 3JAMS 2XZUA 1NJFA 3LQRA 3FTCA 4F2LA 2KNVA 2J7OA 4GHLA 2XZFA 1PJSA 4NXNM 4KODA 1L2CA 2CWBA 1E9SA 1ZV1A 2EKKA 3E4RA 4IBKA 4DR1M 4Y28F 4HLQA 2DWMA 3GLGE 3GQ4A 1YLAA 2QCUA 2XFSA 3KS4A 1IBLM 4BLCA 4GKKM 2BWBA 4AQYM 2KW0A 4D80A 1N34M 2EA0A 3L28A 5IZ7D 1WR1B 5FTLA 4DV4M 3J27B 1DGFA 3U5ZA 2G3QA 3SFZA 4DR2M 3M6AA 2DAKA 3BXWA 2LH0A 4QOSA 4JI5M 2V1UA 4DV2M 3HHZA 5EP2A 3U5ZB 3B9PA 2ZTDA 2VDBB 2XLJA 4IBDA 3JR5A 2F4VM 3KOZE 4QHSA 4L4UA 1S3SA 4OX9M 3TPZA 4NRWA 3FUTA 3KXEC 2LVPC 4XK8F 3LVVA 3MK6A 2OO9A 5ITTA 4XBOA 1QAOA 2D7HA 1V34A 3KVWA 4JI8M 2EKFA 4X66M 2QZ4A 3U6PA 1IN7A 3SBJA 4DV1M 1V92A 2XSZA 4HEOA 1Z5CA 2BNKA 1FJGM 2JXNA 5FTJA 3SASA 1XB2B 5FLXS 4S12A 3QWLA 4I8OA 4P16A 2KHHA 1PGYA 2QHOB 3FUWA 2QQ8A 5IREB 1ZAEA 1V33A 2DI0A 3K9PA 3DZDA 3SC3A 3U6LA 2JZ1A 3SMSA 2DHRA 2UUCM 3EIHA 4MGKE 4X62M 3OTOM 3VDUA 1IN4A 1TGUA 5F3WA 1KSFX 2FH0A 3B7ZA 4DUZM 4R7GA 2FE8A 4AKIA 4JXJA 1SXJA 3BBZA 4L78A 1L1ZA 4FD2A 3HJSA 1QANA 1IY2A 3FYDA 3KOXE 3ZCBB 1NJGA 4DV7M 2C9OA 1SXJB 1GKIA 3WHKA 1OFHA 5JI3E 3PXGA 4PDGA 3LQQA 3HHWA 4LFAM 2I7NA 1J09A 1WHCA 2ZAOA 3SYKA 2C98A 3FUXA 4D82A 4PCZA 2UUAM 5DYIA 3M7GA 4LF4M 3LCUA 1N77A 4JYAM 4QOZC 3HU2A 2H1RA 3THGA 2DAGA 3I4VA 4LJ9A 2J5YA 1NSFA 3DA1A 3EIEA 4AG6A 3HU3A 2EO2A 4RNAA 1EE8A 4Z6YA 2RRUA 3GRUA 2FNAA 3U60B 5ITRA 1IY1A 4IJEA 3GLFB 2DZNB 3FUVA 3FRHA 4GIPA 3K9OA 2D7EA 4WW0A 3LVWA 4QNRA 1R5LA 3J80S 4OVZA 1ZQ9A 2HAKA 2QENA 3W67A 5JI2E 4LGMA 4LF9M 3K8ZA 2DAEA 1HQYE 2LHCA 4OVZB 1HNXM 4FVMA 2QPAA 3HU1A 2LHGA 3A45A 4MGIE 1WXQA 4R3DA 1EFUB 1D0LA 3CF6E 1ZMWA 1WGLA 5FTNA 1IN5A 3QYBA 1K82A 3T38A 1IM2A 2F5PA 2JNHA 3KS8A 2I7PA 1TDZA 1IBKM 2QBYA 2R4EA 1E94E 2Z3XA 1R4GA 1IXRC 1G3IA 3H4JA 5GKNA 4FWGA 1TH3A 4KT0F 2KDLA 2JA2A 2BWEA 2QBYB 2LVAA 3A46A 3VK7A 4REZA 3TWMA 3IHPA 2F5NA 2C96A 3FE3A 1Q02A 3Q8XA 1GLNA 1C7YA 2LVOC 4MGYE 1QZEA 1R6BX 1XMOM 2DWNA 5DFLA 1QVRA 4FCVA 4G4NA 3VKGA 3ZH9B 2YR0A 5LMNM 1I94M 4DR7M 3L27A 4B08A 2CRUA 2Z8YM 1I4WA 1Z5BA 3AV0A 3JR4A 1DV0A 3SMPA 2G8LA 1UM8A 1IXZA 4M0DA 2C9CA 3TWLA 1R7RA 2DWLA 1DGGA 5ITXA 2XH9A 3SATA 3U6OA 1MN3A 4K0KM 3D8LA 3RFWA 3L26A 1GL7A 1WGNA 5KO3A 2L7IA 1LTMA 4M9ZA 4PDIA 1OTRA 2HWJA 4Z8XA 2K6BA 7CATA 4M0WA 2L6OA 1OFIA 1XXHA 3VKHA 4KO8A 4PT5A 4UN2B 2AHMA 2CHGA 3KSXA 2CHVA 1JQJC 3FUUA 5KQ8A 3T1HM 1CUKA 1XXHB 1NNJA 3U6DA 2DHYA 2MR9A 1OJLA 4AZFA 1N33M 2KXEA 1C1KA 4LJ6A 1J5EM 2CE7A 1VEKA 5EQTA 4R71A 4NL4H 1DO2A 2KEBA 4IJFA 1K3WA 2FOIC 4NSRA 1HJPA 3L25A 3AOEC 3U6CA 3GLGA 3NBIA 1XNQM 2FFJA 2XSZD 3GRRA 3K2LA 3MJ5A 8CATA 3GRVA 1IY0A 3J2PB 3U6MA 3GLGB 4QNMA 2BJVA 2GQFA 1Z6TA 2W82A 3UK6A 5EJCA 5FTKA 3GP1A 2UU9M 3U6QA 1VQ1A 4JI7M 2UXBM 4NC6A 2G5GX 3SHFA 3UMMA 4FW9A 5C18A 1Q3BA 2O5RA 3KOWE 3SAVA 2OPFA 2JWSA 2M60A 2O25A 3HGIA 2R18A 1QDTA 5EXTA 4IBCA 4JI3M 3V76A 4DR3M 2K9DA 3J7AS 2LXEA 1ORYB 1SXJD 1N36M 4NXMM 2V1CA 3GPYA 2MROB 4JI2M 1OKSA 3DFZA 4AI6A 1XWIA 4LRTA 2KZUA 4P17A 2Y0TA 5E6JA 2P5TA 4DUYM 4MGZE 1D2NA 1NY5A 2HCBA 1G8PA 5BR8M 2HL7A 2UXDM 1OIZA 2VF7A 2CUZA 3E21A 4MB7A 1KYIA 5ITYA 3U6SA 2NQ8C 4QHTA 2X4AA 3I4YA 4IBEA 2O01F 3I01M 4GC9A 5L8RF 4G4RA 2C5RA 2Z4RA 1TTEA 1N32M 1DGHA 3FD9A 5IT9S 3HZJA 1YE9A 3KW6A 4CIZA 3PNVA 4LY6A 1ZMVA 3KP0E 4LF8M 1DGHB 3QAUA 4IBIA 2K0BX 4GMQA 5EP4A 3K92A 3W0LB 1G59A 4MM3B 4AW4A 3GLFE 1NV8A 1R2YA 2BJWA 3CF2A 3QYEA 4RF0A 1L2BA 4GITA 1F4IA 4MH0E 1GO5A 2VF8A 1N75A 3HX3A 2KZSA 5EXPA 3UGJA 1R2ZA 4LJ7A 5FTMA 2CV0A 2VQEM 2MH8A 4LFCM 4PD2A 5DNYA 3AKZA 2MJ5B 2EUCA 5C1BA 2L7HA 4B3TM 2EJSA 4LG2A 1GJSA 4IBGA 4XGIA 3LMMA 3TE6A 1QDRA 1NVMA 1L8QA 1VEJA 4L8RC 3HJ8A 3GLIE 3GPXA 3GQ5A 2F5SA 1Y8GA 2YNMD 3IECA 3B7NA 1Z59A 5IWAM 2VIIA 2ZANA 1PM5A 4IIWA 2ZTCA 4W5WA 4CGYB 4CHTB 3B89A 3GPPA 4NSOB 3C58A 1PJIA 3F92A 2DAMA 4FWDA 3CGWA 1Q39A 2A5YB 2JY7A 3HHXA 1HQCA 1L2DA 1TR8A 2FS1A 2VQFM 4JI4M 1XNRM 2R6FA 5EP1A 1L1TA 1HR0M 4LJ4A 4JI0M 3GLHE 4MGHA 3ZC7B 2HHHM 4GKJM 3AFHA 1FNNA 2B3TA 4B7GA 1WIVA 4X64M 3LCVB 4LZJA 2ZM6M 2Y21A 2L4EA 3AOGA 3KFUG 2OQ4A 3W0FA 1P3QQ 3TQSA 3I51A 3SAWA 3AJIB 4AKGA 4FCWA
chains in the Genus database with same CATH topology
1DGBA 4GHAA 3VFDA 3DOAA 4GH9A 5ITXE 2F5QA 3M0EA 1JR3A 3KSJA 2ZAMA 5A2QS 4JI1M 3FYCA 4B3RM 1IQPA 3RGSA 3VLFB 1SXJC 4I4LA 3T15A 4G6ZA 1X37A 1G4AE 3L29A 3SYLA 2XFTA 3VDPA 3GO8A 2D7GA 5FSWA 4LJAA 2C99A 4OW0A 1LV7A 4B7HA 4RF1A 1K3XA 4LF6M 4IBBA 5EXSA 1TDHA 3UZUA 4LJ8A 4LF5M 4NRVA 4A3VB 2R45A 2CV2A 1QYRA 3TL4X 3RE8A 1IXSB 2KRKA 2YQZA 4IBFA 3SHGB 1NHWC 4DV3M 4DV6M 5H37D 3K1JA 1H6UA 2Z7JA 1GL6A 2DWZB 2DVWB 4FWHA 4M9SA 3GQ3A 3VK8A 4JI6M 2E5LM 5BPVA 2RGOA 2K47A 3ILKA 4BB9A 4BBAA 2X49A 1XMQM 5KPTA 4CISA 2XGNA 3HHYA 3PNYA 2R46A 1DO0A 5EP3A 2Y20A 4TUWA 2LWXA 2UXCM 4G4QA 3UJNA 3SAUA 4LFBM 4AG5A 5LMUM 3R9XB 1SXJE 2DXIA 3TWKA 4LZZA 4DV0M 3KDSE 3PFIA 1N78A 2L09A 3A42A 2Z4SA 4WURA 3T1YM 3L2AA 4L16A 3MHVC 4EIWA 3FTEA 2HKJA 3FTFA 4ZPXA 3IG8A 4X65M 4AKHA 2YFQA 2RKOA 4NOOB 4OU7A 1IN8A 3HKPA 1NY6A 4DR5M 4II7A 3U61A 3BOSA 2R65A 4L15A 1MU5A 2ZBKB 1NNUC 3KOYE 1XHBA 1NHGC 2KA6B 2DZOB 4LCBA 3R8FA 4DV5M 3U61B 1PJJA 1W5TA 4I5SA 5ITQA 1HNZM 1QAQA 1G41A 1YSYA 3IG5A 3NWLA 1HT2E 4I81A 5E26A 2LNHC 4B3SM 4M9XA 4JN6A 1HNWM 3SARA 3FKEA 4YHHM 3GRYA 4G4OA 4B3MM 1E9RA 1MX0A 4LF7M 1E32A 1TH4A 3HWSA 4LGYA 2R4JA 1HT1E 3WHLA 3AOEA 3A98B 4JV5M 2F5OA 5KQDA 4GRIA 2J7NA 3U60A 3H4MA 3GLFA 4FCTA 3J7BA 2R62A 1Z5AA 1IBMM 5DYGA 2CV1A 1VDDA 5KPRA 1W5SA 1Q3CA 4IBJA 1QAMA 2XEPA 2V6ZM 3GPUA 2M5ZA 2KRUA 3FTDA 3RGPA 4LJ5A 1KFVA 4DR6M 1QZMA 2CEAA 3E9SA 1J7KA 3AL0C 2UUBM 4GC5A 4ITQA 1JR3D 3GLIA 3U6EA 3CTWB 4LRSA 3CF0A 4KLNA 5EXXA 2Q2EB 2CFOA 1T3TA 5ITUA 3GLIB 1GVNA 4B7FA 3D8BA 2Y0QA 1IN6A 1YUBA 3PVSA 1XC8A 4DR4M 1TH2A 2RGHA 2X8AA 3KP1E 4HL4A 4D81A 2XF3A 1QQWA 3GLHA 4YY3M 2CHQA 3HJQA 2ERCA 3GLHB 4KHPM 5KPZA 2QP9X 3J81S 3JAMS 2XZUA 1NJFA 3LQRA 3FTCA 2J7OA 4GHLA 2XZFA 4NXNM 4KODA 1L2CA 1E9SA 3E4RA 4IBKA 4DR1M 4HLQA 2DWMA 3GQ4A 2QCUA 2XFSA 3KS4A 1IBLM 4BLCA 4GKKM 4AQYM 2KW0A 4D80A 1N34M 2EA0A 3L28A 5IZ7D 5FTLA 4DV4M 3J27B 1DGFA 3U5ZA 3SFZA 4DR2M 3M6AA 4QOSA 2LH0A 4JI5M 2V1UA 4DV2M 3HHZA 5EP2A 3U5ZB 3B9PA 2XLJA 4IBDA 3JR5A 2F4VM 3KOZE 4QHSA 4L4UA 1S3SA 4OX9M 3TPZA 4NRWA 3FUTA 3KXEC 3LVVA 3MK6A 5ITTA 4XBOA 1QAOA 2D7HA 3KVWA 4JI8M 4X66M 2QZ4A 3U6PA 1IN7A 3SBJA 4DV1M 2XSZA 1Z5CA 2BNKA 1FJGM 5FTJA 3SASA 5FLXS 4S12A 3QWLA 4I8OA 4P16A 3FUWA 5IREB 1ZAEA 3DZDA 3SC3A 3U6LA 3SMSA 2DHRA 2UUCM 3EIHA 4MGKE 4X62M 3OTOM 3VDUA 1IN4A 1TGUA 5F3WA 1KSFX 4DUZM 4R7GA 2FE8A 4AKIA 4JXJA 1SXJA 4L78A 1L1ZA 4FD2A 3HJSA 1QANA 1IY2A 3FYDA 3KOXE 3ZCBB 1NJGA 4DV7M 2C9OA 1SXJB 1GKIA 3WHKA 1OFHA 5JI3E 3PXGA 4PDGA 3LQQA 3HHWA 4LFAM 2I7NA 1J09A 2ZAOA 3SYKA 2C98A 3FUXA 4D82A 4PCZA 2UUAM 5DYIA 3M7GA 4LF4M 1N77A 4JYAM 4QOZC 3HU2A 2H1RA 3THGA 3I4VA 4LJ9A 1NSFA 3DA1A 3EIEA 4AG6A 3HU3A 2EO2A 4RNAA 1EE8A 4Z6YA 3GRUA 2FNAA 3U60B 5ITRA 1IY1A 4IJEA 3GLFB 2DZNB 3FUVA 4GIPA 2D7EA 4WW0A 3LVWA 4QNRA 3J80S 4OVZA 1ZQ9A 2QENA 5JI2E 4LGMA 4LF9M 3K8ZA 1HQYE 4OVZB 1HNXM 4FVMA 2QPAA 3HU1A 3A45A 4MGIE 1WXQA 4R3DA 3CF6E 5FTNA 1IN5A 1K82A 3T38A 1IM2A 2F5PA 3KS8A 2I7PA 1TDZA 1IBKM 2QBYA 2R4EA 1E94E 2Z3XA 1IXRC 1G3IA 5GKNA 4FWGA 1TH3A 2QBYB 2JA2A 3A46A 3VK7A 4REZA 3TWMA 2F5NA 2C96A 3Q8XA 1GLNA 4MGYE 1XMOM 1R6BX 2DWNA 1QVRA 4FCVA 4G4NA 3VKGA 3ZH9B 2YR0A 5LMNM 1I94M 4DR7M 3L27A 4B08A 1I4WA 1Z5BA 3AV0A 3JR4A 3SMPA 2G8LA 1UM8A 1IXZA 4M0DA 2C9CA 3TWLA 1R7RA 2DWLA 1DGGA 5ITXA 2XH9A 3SATA 3U6OA 4K0KM 3D8LA 3RFWA 3L26A 1GL7A 5KO3A 2L7IA 4M9ZA 4PDIA 4Z8XA 7CATA 4M0WA 2L6OA 1OFIA 1XXHA 3VKHA 4KO8A 4PT5A 2AHMA 2CHGA 3KSXA 2CHVA 1JQJC 3FUUA 5KQ8A 3T1HM 1XXHB 1NNJA 3U6DA 1OJLA 4AZFA 1N33M 2KXEA 1C1KA 4LJ6A 1J5EM 2CE7A 5EQTA 4NL4H 1DO2A 2KEBA 4IJFA 1K3WA 2FOIC 4NSRA 3L25A 3AOEC 3U6CA 3GLGA 3NBIA 1XNQM 2FFJA 2XSZD 3GRRA 3K2LA 3MJ5A 8CATA 3GRVA 1IY0A 3J2PB 3U6MA 3GLGB 4QNMA 2BJVA 1Z6TA 2W82A 3UK6A 5EJCA 5FTKA 3GP1A 2UU9M 3U6QA 2UXBM 4JI7M 2G5GX 3SHFA 3UMMA 4FW9A 5C18A 1Q3BA 2O5RA 3KOWE 3SAVA 2OPFA 2M60A 3HGIA 2R18A 4JI3M 5EXTA 4IBCA 4DR3M 3J7AS 2LXEA 1ORYB 1SXJD 1N36M 4NXMM 2V1CA 3GPYA 4JI2M 3DFZA 4AI6A 1XWIA 4LRTA 2KZUA 2Y0TA 5E6JA 2P5TA 4DUYM 4MGZE 1D2NA 1NY5A 2HCBA 1G8PA 5BR8M 2HL7A 2UXDM 2CUZA 4MB7A 1KYIA 5ITYA 3U6SA 2NQ8C 4QHTA 2X4AA 3I4YA 4IBEA 4GC9A 4G4RA 2C5RA 2Z4RA 1N32M 1DGHA 3FD9A 5IT9S 1YE9A 3KW6A 3PNVA 4LY6A 3KP0E 4LF8M 1DGHB 3QAUA 4IBIA 4GMQA 5EP4A 3K92A 3W0LB 1G59A 4MM3B 4AW4A 1R2YA 2BJWA 3CF2A 4RF0A 1L2BA 4GITA 4MH0E 1N75A 1R2ZA 2KZSA 5EXPA 3UGJA 4LJ7A 5FTMA 2CV0A 2VQEM 4LFCM 4PD2A 5DNYA 3AKZA 2EUCA 5C1BA 2L7HA 4B3TM 4LG2A 4IBGA 4XGIA 3LMMA 3TE6A 4L8RC 1NVMA 1L8QA 3HJ8A 2F5SA 3GPXA 3GQ5A 2YNMD 1Z59A 5IWAM 2VIIA 2ZANA 1PM5A 4IIWA 4W5WA 4CGYB 4CHTB 3GPPA 4NSOB 3C58A 1PJIA 4FWDA 1Q39A 2A5YB 3HHXA 1HQCA 1L2DA 4JI4M 2VQFM 1XNRM 5EP1A 1L1TA 1HR0M 4LJ4A 4JI0M 4MGHA 3ZC7B 2HHHM 4GKJM 3AFHA 1FNNA 4B7GA 4X64M 4LZJA 2ZM6M 2Y21A 3AOGA 3KFUG 2OQ4A 3W0FA 3TQSA 3SAWA 3I51A 3AJIB 4AKGA 4FCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6L A;  2UUC M;  4JV5 M;  4X62 M;  3OTO M;  1K3W A;  3DOA A;  5ITX E;  2F5O A;  2F5Q A;  3U6C A;  5A2Q S;  4DUZ M;  1XNQ M;  4JI1 M;  1IBM M;  1Z5A A;  1L1Z A;  4B3R M;  3U6M A;  1Q3C A;  4DV7 M;  3GPU A;  1KFV A;  4DR6 M;  3GO8 A;  3GP1 A;  4PDG A;  2UU9 M;  3U6Q A;  2UXB M;  4JI7 M;  4LFA M;  3SAV A;  1Q3B A;  2UUB M;  2OPF A;  4ITQ A;  2UUA M;  4PCZ A;  1K3X A;  4LF6 M;  4DR3 M;  4JI3 M;  3U6E A;  4LF4 M;  4JYA M;  1TDH A;  3J7A S;  4NXM M;  1N36 M;  2Q2E B;  4LF5 M;  5ITU A;  3GPY A;  4NRV A;  4JI2 M;  4DUY M;  1EE8 A;  1XC8 A;  4DR4 M;  5BR8 M;  4DV3 M;  2UXD M;  4DV6 M;  5ITR A;  4MB7 A;  3U6S A;  5ITY A;  3GQ3 A;  3VK8 A;  4YY3 M;  4JI6 M;  2E5L M;  3J80 S;  4G4R A;  4LF9 M;  1N32 M;  4KHP M;  1XMQ M;  3J81 S;  2XZU A;  3JAM S;  4CIS A;  5IT9 S;  1HNX M;  3A45 A;  2XZF A;  4LF8 M;  2UXC M;  4NXN M;  1L2C A;  4G4Q A;  3SAU A;  1K82 A;  2F5P A;  4DR1 M;  4LFB M;  1TDZ A;  1IBK M;  3GQ4 A;  1R2Y A;  5LMU M;  1IBL M;  4GKK M;  1L2B A;  4AQY M;  3TWK A;  1N34 M;  1R2Z A;  2EA0 A;  4DV0 M;  2VQE M;  3A46 A;  4LFC M;  4PD2 A;  3A42 A;  3TWM A;  3VK7 A;  2F5N A;  4DV4 M;  3T1Y M;  1XMO M;  4DR2 M;  4B3T M;  4JI5 M;  4G4N A;  4DV2 M;  2HKJ A;  5LMN M;  1I94 M;  4DR7 M;  2F5S A;  3GPX A;  3GQ5 A;  4X65 M;  1Z5B A;  3JR4 A;  5IWA M;  1Z59 A;  3JR5 A;  1PM5 A;  2F4V M;  4DR5 M;  4OX9 M;  4NRW A;  3TWL A;  3GPP A;  3C58 A;  1PJI A;  1MU5 A;  5ITX A;  2ZBK B;  1Q39 A;  5ITT A;  3U6O A;  3SAT A;  4JI4 M;  1L2D A;  4K0K M;  2VQF M;  4DV5 M;  1XNR M;  1PJJ A;  5ITQ A;  4JI8 M;  4X66 M;  1HNZ M;  1L1T A;  1HR0 M;  3U6P A;  4JI0 M;  3SBJ A;  2HHH M;  4DV1 M;  4PDI A;  4B3S M;  4GKJ M;  1Z5C A;  1FJG M;  4X64 M;  1HNW M;  3SAS A;  5FLX S;  3SAR A;  4YHH M;  2ZM6 M;  4G4O A;  3T1H M;  1NNJ A;  2OQ4 A;  1MX0 A;  3W0F A;  3U6D A;  4B3M M;  4LF7 M;  3SAW A;  1N33 M;  1J5E M; 
#chains in the Genus database with same CATH topology
 1DGB A;  4GHA A;  3VFD A;  3DOA A;  2DEN A;  4GH9 A;  5ITX E;  2F5Q A;  1WJ7 A;  2QNJ A;  1JR3 A;  3KSJ A;  2ZAM A;  3M0E A;  5A2Q S;  1EIJ A;  4JI1 M;  1T6O A;  1PJT A;  3C3D A;  3FYC A;  1IQP A;  3RGS A;  3VLF B;  2N35 A;  4B3R M;  2H5X A;  1SXJ C;  4I4L A;  4GEW A;  3T15 A;  4G6Z A;  1TF0 B;  1X37 A;  1XXH E;  1G4A E;  3L29 A;  3SYL A;  2XFT A;  3VDP A;  1AUA A;  3GO8 A;  2D7G A;  5FSW A;  1IFY A;  4LJA A;  2C99 A;  4OW0 A;  2JP7 A;  1LV7 A;  2WSF F;  4B7H A;  4RF1 A;  1K3X A;  1D0K A;  4LF6 M;  4IBB A;  5EXS A;  1TDH A;  3UZU A;  2WSE F;  4LJ8 A;  4LF5 M;  1OQY A;  4G3O A;  4NRV A;  2JUJ A;  1IXS A;  4A3V B;  2R45 A;  2CV2 A;  1QYR A;  1VG5 A;  3TL4 X;  3RE8 A;  2MGW A;  1IXS B;  2KRK A;  2YQZ A;  1AIP C;  4IBF A;  3SHG B;  1NHW C;  4DV3 M;  2WZJ A;  4DV6 M;  5H37 D;  3K1J A;  1H6U A;  2Z7J A;  1GL6 A;  2DWZ B;  2DVW B;  4FWH A;  4M9S A;  1GJT A;  3GQ3 A;  3VK8 A;  2QSF X;  4JI6 M;  2E5L M;  1GAB A;  2DAI A;  5BPV A;  2RGO A;  2K47 A;  3ILK A;  4BB9 A;  4BBA A;  2X49 A;  2JY6 B;  1XMQ M;  2OOA A;  2DKL A;  3HY5 A;  5KPT A;  4WP2 A;  2KNZ A;  2XGN A;  3HHY A;  1OIP A;  3PNY A;  4CIS A;  3LW5 F;  2R46 A;  1DO0 A;  5EP3 A;  2Y20 A;  4TUW A;  2LWX A;  2UXC M;  1NV9 A;  4G4Q A;  3UJN A;  3SAU A;  4LFB M;  1OAI A;  4AG5 A;  1RU3 A;  1A5T A;  3B7Q A;  5LMU M;  3R9X B;  1SXJ E;  2DXI A;  3TWK A;  4LZZ A;  4DV0 M;  3KDS E;  3PFI A;  1N78 A;  2L09 A;  3FRI A;  3A42 A;  2JZ0 A;  2Z4S A;  4WUR A;  2JY8 A;  3T1Y M;  2JY5 A;  3L2A A;  4L16 A;  3C3E A;  3MHV C;  4EIW A;  2CP8 A;  3B74 A;  2HKJ A;  2OOB A;  3FTE A;  1T43 A;  3FTF A;  4ZPX A;  3IG8 A;  4X65 M;  4AKH A;  2YFQ A;  2RKO A;  4NOO B;  4OU7 A;  1IN8 A;  3HKP A;  1NY6 A;  4ANR A;  4DR5 M;  4II7 A;  3U61 A;  3BOS A;  2R65 A;  4L15 A;  2LVN C;  1MU5 A;  2ZBK B;  1NNU C;  3KOY E;  1XHB A;  1NHG C;  2KA6 B;  2DZO B;  4LCB A;  3R8F A;  2APL A;  4DV5 M;  2R0I A;  1W5T A;  4I5S A;  5ITQ A;  3U61 B;  2R44 A;  2WSC F;  3ZQJ A;  1PJJ A;  1HNZ M;  1QAQ A;  1G41 A;  1YSY A;  3IG5 A;  3NWL A;  1HT2 E;  4I81 A;  5E26 A;  2LNH C;  4B3S M;  4M9X A;  1VEG A;  1PRB A;  3W68 A;  4JN6 A;  1HNW M;  2DZL A;  2LBC A;  3SAR A;  3FKE A;  4YHH M;  3GRY A;  4G4O A;  2L2D A;  4B3M M;  1E9R A;  1MX0 A;  4L6V 6;  4LF7 M;  1E32 A;  2GNO A;  1TH4 A;  3HWS A;  4LGY A;  2LVQ D;  1HT1 E;  2R4J A;  3WHL A;  3AOE A;  3A98 B;  4JV5 M;  2F5O A;  5KQD A;  4GRI A;  2J7N A;  3Q8G A;  3U60 A;  3H4M A;  3GLF A;  4FCT A;  3J7B A;  2R62 A;  1Z5A A;  1IBM M;  5DYG A;  2CV1 A;  1VDD A;  2L4F A;  1W5S A;  1UFZ A;  3E46 A;  3I04 M;  1Q3C A;  1JB0 F;  4IBJ A;  5KPR A;  1QAM A;  2XEP A;  2V6Z M;  3GPU A;  2M5Z A;  2KRU A;  3FTD A;  3RGP A;  4LJ5 A;  1QUS A;  1OAO C;  1KFV A;  4DR6 M;  2LTU A;  1QZM A;  2CEA A;  1G71 A;  4DBG B;  3E9S A;  1J7K A;  3AL0 C;  3NBX X;  2UUB M;  4GC5 A;  3MMP A;  4F1I A;  4ITQ A;  1JR3 D;  3GLI A;  1ZMU A;  3U6E A;  3CTW B;  4LRS A;  3CF0 A;  1PJQ A;  4KLN A;  5EXX A;  2Q2E B;  2CFO A;  1T3T A;  5ITU A;  1JR3 E;  1GVN A;  1SG9 A;  3GLI B;  1BVS A;  4Q7J A;  4B7F A;  3D8B A;  2Y0Q A;  1IN6 A;  1YUB A;  3C9P A;  3PVS A;  2KNA A;  3T6P A;  4CJ6 A;  1XC8 A;  1VDL A;  1TH2 A;  2RGH A;  2X8A A;  3KP1 E;  4HL4 A;  4DR4 M;  4RKU F;  4D81 A;  2XF3 A;  1NO1 A;  2DNA A;  1QQW A;  3GLH A;  4YY3 M;  2CHQ A;  1MJG M;  3HJQ A;  2ERC A;  1QUT A;  1D0M A;  3GLH B;  5KPZ A;  4KHP M;  2QP9 X;  3J81 S;  3JAM S;  2XZU A;  1NJF A;  3LQR A;  3FTC A;  4F2L A;  2KNV A;  2J7O A;  4GHL A;  2XZF A;  1PJS A;  4NXN M;  4KOD A;  1L2C A;  2CWB A;  1E9S A;  1ZV1 A;  2EKK A;  3E4R A;  4IBK A;  4DR1 M;  4Y28 F;  4HLQ A;  2DWM A;  3GLG E;  3GQ4 A;  1YLA A;  2QCU A;  2XFS A;  3KS4 A;  1IBL M;  4BLC A;  4GKK M;  2BWB A;  4AQY M;  2KW0 A;  4D80 A;  1N34 M;  2EA0 A;  3L28 A;  5IZ7 D;  1WR1 B;  5FTL A;  4DV4 M;  3J27 B;  1DGF A;  3U5Z A;  2G3Q A;  3SFZ A;  4DR2 M;  3M6A A;  2DAK A;  3BXW A;  2LH0 A;  4QOS A;  4JI5 M;  2V1U A;  4DV2 M;  3HHZ A;  5EP2 A;  3U5Z B;  3B9P A;  2ZTD A;  2VDB B;  2XLJ A;  4IBD A;  3JR5 A;  2F4V M;  3KOZ E;  4QHS A;  4L4U A;  1S3S A;  4OX9 M;  3TPZ A;  4NRW A;  3FUT A;  3KXE C;  2LVP C;  4XK8 F;  3LVV A;  3MK6 A;  2OO9 A;  5ITT A;  4XBO A;  1QAO A;  2D7H A;  1V34 A;  3KVW A;  4JI8 M;  2EKF A;  4X66 M;  2QZ4 A;  3U6P A;  1IN7 A;  3SBJ A;  4DV1 M;  1V92 A;  2XSZ A;  4HEO A;  1Z5C A;  2BNK A;  1FJG M;  2JXN A;  5FTJ A;  3SAS A;  1XB2 B;  5FLX S;  4S12 A;  3QWL A;  4I8O A;  4P16 A;  2KHH A;  1PGY A;  2QHO B;  3FUW A;  2QQ8 A;  5IRE B;  1ZAE A;  1V33 A;  2DI0 A;  3K9P A;  3DZD A;  3SC3 A;  3U6L A;  2JZ1 A;  3SMS A;  2DHR A;  2UUC M;  3EIH A;  4MGK E;  4X62 M;  3OTO M;  3VDU A;  1IN4 A;  1TGU A;  5F3W A;  1KSF X;  2FH0 A;  3B7Z A;  4DUZ M;  4R7G A;  2FE8 A;  4AKI A;  4JXJ A;  1SXJ A;  3BBZ A;  4L78 A;  1L1Z A;  4FD2 A;  3HJS A;  1QAN A;  1IY2 A;  3FYD A;  3KOX E;  3ZCB B;  1NJG A;  4DV7 M;  2C9O A;  1SXJ B;  1GKI A;  3WHK A;  1OFH A;  5JI3 E;  3PXG A;  4PDG A;  3LQQ A;  3HHW A;  4LFA M;  2I7N A;  1J09 A;  1WHC A;  2ZAO A;  3SYK A;  2C98 A;  3FUX A;  4D82 A;  4PCZ A;  2UUA M;  5DYI A;  3M7G A;  4LF4 M;  3LCU A;  1N77 A;  4JYA M;  4QOZ C;  3HU2 A;  2H1R A;  3THG A;  2DAG A;  3I4V A;  4LJ9 A;  2J5Y A;  1NSF A;  3DA1 A;  3EIE A;  4AG6 A;  3HU3 A;  2EO2 A;  4RNA A;  1EE8 A;  4Z6Y A;  2RRU A;  3GRU A;  2FNA A;  3U60 B;  5ITR A;  1IY1 A;  4IJE A;  3GLF B;  2DZN B;  3FUV A;  3FRH A;  4GIP A;  3K9O A;  2D7E A;  4WW0 A;  3LVW A;  4QNR A;  1R5L A;  3J80 S;  4OVZ A;  1ZQ9 A;  2HAK A;  2QEN A;  3W67 A;  5JI2 E;  4LGM A;  4LF9 M;  3K8Z A;  2DAE A;  1HQY E;  2LHC A;  4OVZ B;  1HNX M;  4FVM A;  2QPA A;  3HU1 A;  2LHG A;  3A45 A;  4MGI E;  1WXQ A;  4R3D A;  1EFU B;  1D0L A;  3CF6 E;  1ZMW A;  1WGL A;  5FTN A;  1IN5 A;  3QYB A;  1K82 A;  3T38 A;  1IM2 A;  2F5P A;  2JNH A;  3KS8 A;  2I7P A;  1TDZ A;  1IBK M;  2QBY A;  2R4E A;  1E94 E;  2Z3X A;  1R4G A;  1IXR C;  1G3I A;  3H4J A;  5GKN A;  4FWG A;  1TH3 A;  4KT0 F;  2KDL A;  2JA2 A;  2BWE A;  2QBY B;  2LVA A;  3A46 A;  3VK7 A;  4REZ A;  3TWM A;  3IHP A;  2F5N A;  2C96 A;  3FE3 A;  1Q02 A;  3Q8X A;  1GLN A;  1C7Y A;  2LVO C;  4MGY E;  1QZE A;  1R6B X;  1XMO M;  2DWN A;  5DFL A;  1QVR A;  4FCV A;  4G4N A;  3VKG A;  3ZH9 B;  2YR0 A;  5LMN M;  1I94 M;  4DR7 M;  3L27 A;  4B08 A;  2CRU A;  2Z8Y M;  1I4W A;  1Z5B A;  3AV0 A;  3JR4 A;  1DV0 A;  3SMP A;  2G8L A;  1UM8 A;  1IXZ A;  4M0D A;  2C9C A;  3TWL A;  1R7R A;  2DWL A;  1DGG A;  5ITX A;  2XH9 A;  3SAT A;  3U6O A;  1MN3 A;  4K0K M;  3D8L A;  3RFW A;  3L26 A;  1GL7 A;  1WGN A;  5KO3 A;  2L7I A;  1LTM A;  4M9Z A;  4PDI A;  1OTR A;  2HWJ A;  4Z8X A;  2K6B A;  7CAT A;  4M0W A;  2L6O A;  1OFI A;  1XXH A;  3VKH A;  4KO8 A;  4PT5 A;  4UN2 B;  2AHM A;  2CHG A;  3KSX A;  2CHV A;  1JQJ C;  3FUU A;  5KQ8 A;  3T1H M;  1CUK A;  1XXH B;  1NNJ A;  3U6D A;  2DHY A;  2MR9 A;  1OJL A;  4AZF A;  1N33 M;  2KXE A;  1C1K A;  4LJ6 A;  1J5E M;  2CE7 A;  1VEK A;  5EQT A;  4R71 A;  4NL4 H;  1DO2 A;  2KEB A;  4IJF A;  1K3W A;  2FOI C;  4NSR A;  1HJP A;  3L25 A;  3AOE C;  3U6C A;  3GLG A;  3NBI A;  1XNQ M;  2FFJ A;  2XSZ D;  3GRR A;  3K2L A;  3MJ5 A;  8CAT A;  3GRV A;  1IY0 A;  3J2P B;  3U6M A;  3GLG B;  4QNM A;  2BJV A;  2GQF A;  1Z6T A;  2W82 A;  3UK6 A;  5EJC A;  5FTK A;  3GP1 A;  2UU9 M;  3U6Q A;  1VQ1 A;  4JI7 M;  2UXB M;  4NC6 A;  2G5G X;  3SHF A;  3UMM A;  4FW9 A;  5C18 A;  1Q3B A;  2O5R A;  3KOW E;  3SAV A;  2OPF A;  2JWS A;  2M60 A;  2O25 A;  3HGI A;  2R18 A;  1QDT A;  5EXT A;  4IBC A;  4JI3 M;  3V76 A;  4DR3 M;  2K9D A;  3J7A S;  2LXE A;  1ORY B;  1SXJ D;  1N36 M;  4NXM M;  2V1C A;  3GPY A;  2MRO B;  4JI2 M;  1OKS A;  3DFZ A;  4AI6 A;  1XWI A;  4LRT A;  2KZU A;  4P17 A;  2Y0T A;  5E6J A;  2P5T A;  4DUY M;  4MGZ E;  1D2N A;  1NY5 A;  2HCB A;  1G8P A;  5BR8 M;  2HL7 A;  2UXD M;  1OIZ A;  2VF7 A;  2CUZ A;  3E21 A;  4MB7 A;  1KYI A;  5ITY A;  3U6S A;  2NQ8 C;  4QHT A;  2X4A A;  3I4Y A;  4IBE A;  2O01 F;  3I01 M;  4GC9 A;  5L8R F;  4G4R A;  2C5R A;  2Z4R A;  1TTE A;  1N32 M;  1DGH A;  3FD9 A;  5IT9 S;  3HZJ A;  1YE9 A;  3KW6 A;  4CIZ A;  3PNV A;  4LY6 A;  1ZMV A;  3KP0 E;  4LF8 M;  1DGH B;  3QAU A;  4IBI A;  2K0B X;  4GMQ A;  5EP4 A;  3K92 A;  3W0L B;  1G59 A;  4MM3 B;  4AW4 A;  3GLF E;  1NV8 A;  1R2Y A;  2BJW A;  3CF2 A;  3QYE A;  4RF0 A;  1L2B A;  4GIT A;  1F4I A;  4MH0 E;  1GO5 A;  2VF8 A;  1N75 A;  3HX3 A;  2KZS A;  5EXP A;  3UGJ A;  1R2Z A;  4LJ7 A;  5FTM A;  2CV0 A;  2VQE M;  2MH8 A;  4LFC M;  4PD2 A;  5DNY A;  3AKZ A;  2MJ5 B;  2EUC A;  5C1B A;  2L7H A;  4B3T M;  2EJS A;  4LG2 A;  1GJS A;  4IBG A;  4XGI A;  3LMM A;  3TE6 A;  1QDR A;  1NVM A;  1L8Q A;  1VEJ A;  4L8R C;  3HJ8 A;  3GLI E;  3GPX A;  3GQ5 A;  2F5S A;  1Y8G A;  2YNM D;  3IEC A;  3B7N A;  1Z59 A;  5IWA M;  2VII A;  2ZAN A;  1PM5 A;  4IIW A;  2ZTC A;  4W5W A;  4CGY B;  4CHT B;  3B89 A;  3GPP A;  4NSO B;  3C58 A;  1PJI A;  3F92 A;  2DAM A;  4FWD A;  3CGW A;  1Q39 A;  2A5Y B;  2JY7 A;  3HHX A;  1HQC A;  1L2D A;  1TR8 A;  2FS1 A;  2VQF M;  4JI4 M;  1XNR M;  2R6F A;  5EP1 A;  1L1T A;  1HR0 M;  4LJ4 A;  4JI0 M;  3GLH E;  4MGH A;  3ZC7 B;  2HHH M;  4GKJ M;  3AFH A;  1FNN A;  2B3T A;  4B7G A;  1WIV A;  4X64 M;  3LCV B;  4LZJ A;  2ZM6 M;  2Y21 A;  2L4E A;  3AOG A;  3KFU G;  2OQ4 A;  3W0F A;  1P3Q Q;  3TQS A;  3I51 A;  3SAW A;  3AJI B;  4AKG A;  4FCW A; 
#chains in the Genus database with same CATH homology
 1DGB A;  4GHA A;  3VFD A;  3DOA A;  4GH9 A;  5ITX E;  2F5Q A;  3M0E A;  1JR3 A;  3KSJ A;  2ZAM A;  5A2Q S;  4JI1 M;  3FYC A;  4B3R M;  1IQP A;  3RGS A;  3VLF B;  1SXJ C;  4I4L A;  3T15 A;  4G6Z A;  1X37 A;  1G4A E;  3L29 A;  3SYL A;  2XFT A;  3VDP A;  3GO8 A;  2D7G A;  5FSW A;  4LJA A;  2C99 A;  4OW0 A;  1LV7 A;  4B7H A;  4RF1 A;  1K3X A;  4LF6 M;  4IBB A;  5EXS A;  1TDH A;  3UZU A;  4LJ8 A;  4LF5 M;  4NRV A;  4A3V B;  2R45 A;  2CV2 A;  1QYR A;  3TL4 X;  3RE8 A;  1IXS B;  2KRK A;  2YQZ A;  4IBF A;  3SHG B;  1NHW C;  4DV3 M;  4DV6 M;  5H37 D;  3K1J A;  1H6U A;  2Z7J A;  1GL6 A;  2DWZ B;  2DVW B;  4FWH A;  4M9S A;  3GQ3 A;  3VK8 A;  4JI6 M;  2E5L M;  5BPV A;  2RGO A;  2K47 A;  3ILK A;  4BB9 A;  4BBA A;  2X49 A;  1XMQ M;  5KPT A;  4CIS A;  2XGN A;  3HHY A;  3PNY A;  2R46 A;  1DO0 A;  5EP3 A;  2Y20 A;  4TUW A;  2LWX A;  2UXC M;  4G4Q A;  3UJN A;  3SAU A;  4LFB M;  4AG5 A;  5LMU M;  3R9X B;  1SXJ E;  2DXI A;  3TWK A;  4LZZ A;  4DV0 M;  3KDS E;  3PFI A;  1N78 A;  2L09 A;  3A42 A;  2Z4S A;  4WUR A;  3T1Y M;  3L2A A;  4L16 A;  3MHV C;  4EIW A;  3FTE A;  2HKJ A;  3FTF A;  4ZPX A;  3IG8 A;  4X65 M;  4AKH A;  2YFQ A;  2RKO A;  4NOO B;  4OU7 A;  1IN8 A;  3HKP A;  1NY6 A;  4DR5 M;  4II7 A;  3U61 A;  3BOS A;  2R65 A;  4L15 A;  1MU5 A;  2ZBK B;  1NNU C;  3KOY E;  1XHB A;  1NHG C;  2KA6 B;  2DZO B;  4LCB A;  3R8F A;  4DV5 M;  3U61 B;  1PJJ A;  1W5T A;  4I5S A;  5ITQ A;  1HNZ M;  1QAQ A;  1G41 A;  1YSY A;  3IG5 A;  3NWL A;  1HT2 E;  4I81 A;  5E26 A;  2LNH C;  4B3S M;  4M9X A;  4JN6 A;  1HNW M;  3SAR A;  3FKE A;  4YHH M;  3GRY A;  4G4O A;  4B3M M;  1E9R A;  1MX0 A;  4LF7 M;  1E32 A;  1TH4 A;  3HWS A;  4LGY A;  2R4J A;  1HT1 E;  3WHL A;  3AOE A;  3A98 B;  4JV5 M;  2F5O A;  5KQD A;  4GRI A;  2J7N A;  3U60 A;  3H4M A;  3GLF A;  4FCT A;  3J7B A;  2R62 A;  1Z5A A;  1IBM M;  5DYG A;  2CV1 A;  1VDD A;  5KPR A;  1W5S A;  1Q3C A;  4IBJ A;  1QAM A;  2XEP A;  2V6Z M;  3GPU A;  2M5Z A;  2KRU A;  3FTD A;  3RGP A;  4LJ5 A;  1KFV A;  4DR6 M;  1QZM A;  2CEA A;  3E9S A;  1J7K A;  3AL0 C;  2UUB M;  4GC5 A;  4ITQ A;  1JR3 D;  3GLI A;  3U6E A;  3CTW B;  4LRS A;  3CF0 A;  4KLN A;  5EXX A;  2Q2E B;  2CFO A;  1T3T A;  5ITU A;  3GLI B;  1GVN A;  4B7F A;  3D8B A;  2Y0Q A;  1IN6 A;  1YUB A;  3PVS A;  1XC8 A;  4DR4 M;  1TH2 A;  2RGH A;  2X8A A;  3KP1 E;  4HL4 A;  4D81 A;  2XF3 A;  1QQW A;  3GLH A;  4YY3 M;  2CHQ A;  3HJQ A;  2ERC A;  3GLH B;  4KHP M;  5KPZ A;  2QP9 X;  3J81 S;  3JAM S;  2XZU A;  1NJF A;  3LQR A;  3FTC A;  2J7O A;  4GHL A;  2XZF A;  4NXN M;  4KOD A;  1L2C A;  1E9S A;  3E4R A;  4IBK A;  4DR1 M;  4HLQ A;  2DWM A;  3GQ4 A;  2QCU A;  2XFS A;  3KS4 A;  1IBL M;  4BLC A;  4GKK M;  4AQY M;  2KW0 A;  4D80 A;  1N34 M;  2EA0 A;  3L28 A;  5IZ7 D;  5FTL A;  4DV4 M;  3J27 B;  1DGF A;  3U5Z A;  3SFZ A;  4DR2 M;  3M6A A;  4QOS A;  2LH0 A;  4JI5 M;  2V1U A;  4DV2 M;  3HHZ A;  5EP2 A;  3U5Z B;  3B9P A;  2XLJ A;  4IBD A;  3JR5 A;  2F4V M;  3KOZ E;  4QHS A;  4L4U A;  1S3S A;  4OX9 M;  3TPZ A;  4NRW A;  3FUT A;  3KXE C;  3LVV A;  3MK6 A;  5ITT A;  4XBO A;  1QAO A;  2D7H A;  3KVW A;  4JI8 M;  4X66 M;  2QZ4 A;  3U6P A;  1IN7 A;  3SBJ A;  4DV1 M;  2XSZ A;  1Z5C A;  2BNK A;  1FJG M;  5FTJ A;  3SAS A;  5FLX S;  4S12 A;  3QWL A;  4I8O A;  4P16 A;  3FUW A;  5IRE B;  1ZAE A;  3DZD A;  3SC3 A;  3U6L A;  3SMS A;  2DHR A;  2UUC M;  3EIH A;  4MGK E;  4X62 M;  3OTO M;  3VDU A;  1IN4 A;  1TGU A;  5F3W A;  1KSF X;  4DUZ M;  4R7G A;  2FE8 A;  4AKI A;  4JXJ A;  1SXJ A;  4L78 A;  1L1Z A;  4FD2 A;  3HJS A;  1QAN A;  1IY2 A;  3FYD A;  3KOX E;  3ZCB B;  1NJG A;  4DV7 M;  2C9O A;  1SXJ B;  1GKI A;  3WHK A;  1OFH A;  5JI3 E;  3PXG A;  4PDG A;  3LQQ A;  3HHW A;  4LFA M;  2I7N A;  1J09 A;  2ZAO A;  3SYK A;  2C98 A;  3FUX A;  4D82 A;  4PCZ A;  2UUA M;  5DYI A;  3M7G A;  4LF4 M;  1N77 A;  4JYA M;  4QOZ C;  3HU2 A;  2H1R A;  3THG A;  3I4V A;  4LJ9 A;  1NSF A;  3DA1 A;  3EIE A;  4AG6 A;  3HU3 A;  2EO2 A;  4RNA A;  1EE8 A;  4Z6Y A;  3GRU A;  2FNA A;  3U60 B;  5ITR A;  1IY1 A;  4IJE A;  3GLF B;  2DZN B;  3FUV A;  4GIP A;  2D7E A;  4WW0 A;  3LVW A;  4QNR A;  3J80 S;  4OVZ A;  1ZQ9 A;  2QEN A;  5JI2 E;  4LGM A;  4LF9 M;  3K8Z A;  1HQY E;  4OVZ B;  1HNX M;  4FVM A;  2QPA A;  3HU1 A;  3A45 A;  4MGI E;  1WXQ A;  4R3D A;  3CF6 E;  5FTN A;  1IN5 A;  1K82 A;  3T38 A;  1IM2 A;  2F5P A;  3KS8 A;  2I7P A;  1TDZ A;  1IBK M;  2QBY A;  2R4E A;  1E94 E;  2Z3X A;  1IXR C;  1G3I A;  5GKN A;  4FWG A;  1TH3 A;  2QBY B;  2JA2 A;  3A46 A;  3VK7 A;  4REZ A;  3TWM A;  2F5N A;  2C96 A;  3Q8X A;  1GLN A;  4MGY E;  1XMO M;  1R6B X;  2DWN A;  1QVR A;  4FCV A;  4G4N A;  3VKG A;  3ZH9 B;  2YR0 A;  5LMN M;  1I94 M;  4DR7 M;  3L27 A;  4B08 A;  1I4W A;  1Z5B A;  3AV0 A;  3JR4 A;  3SMP A;  2G8L A;  1UM8 A;  1IXZ A;  4M0D A;  2C9C A;  3TWL A;  1R7R A;  2DWL A;  1DGG A;  5ITX A;  2XH9 A;  3SAT A;  3U6O A;  4K0K M;  3D8L A;  3RFW A;  3L26 A;  1GL7 A;  5KO3 A;  2L7I A;  4M9Z A;  4PDI A;  4Z8X A;  7CAT A;  4M0W A;  2L6O A;  1OFI A;  1XXH A;  3VKH A;  4KO8 A;  4PT5 A;  2AHM A;  2CHG A;  3KSX A;  2CHV A;  1JQJ C;  3FUU A;  5KQ8 A;  3T1H M;  1XXH B;  1NNJ A;  3U6D A;  1OJL A;  4AZF A;  1N33 M;  2KXE A;  1C1K A;  4LJ6 A;  1J5E M;  2CE7 A;  5EQT A;  4NL4 H;  1DO2 A;  2KEB A;  4IJF A;  1K3W A;  2FOI C;  4NSR A;  3L25 A;  3AOE C;  3U6C A;  3GLG A;  3NBI A;  1XNQ M;  2FFJ A;  2XSZ D;  3GRR A;  3K2L A;  3MJ5 A;  8CAT A;  3GRV A;  1IY0 A;  3J2P B;  3U6M A;  3GLG B;  4QNM A;  2BJV A;  1Z6T A;  2W82 A;  3UK6 A;  5EJC A;  5FTK A;  3GP1 A;  2UU9 M;  3U6Q A;  2UXB M;  4JI7 M;  2G5G X;  3SHF A;  3UMM A;  4FW9 A;  5C18 A;  1Q3B A;  2O5R A;  3KOW E;  3SAV A;  2OPF A;  2M60 A;  3HGI A;  2R18 A;  4JI3 M;  5EXT A;  4IBC A;  4DR3 M;  3J7A S;  2LXE A;  1ORY B;  1SXJ D;  1N36 M;  4NXM M;  2V1C A;  3GPY A;  4JI2 M;  3DFZ A;  4AI6 A;  1XWI A;  4LRT A;  2KZU A;  2Y0T A;  5E6J A;  2P5T A;  4DUY M;  4MGZ E;  1D2N A;  1NY5 A;  2HCB A;  1G8P A;  5BR8 M;  2HL7 A;  2UXD M;  2CUZ A;  4MB7 A;  1KYI A;  5ITY A;  3U6S A;  2NQ8 C;  4QHT A;  2X4A A;  3I4Y A;  4IBE A;  4GC9 A;  4G4R A;  2C5R A;  2Z4R A;  1N32 M;  1DGH A;  3FD9 A;  5IT9 S;  1YE9 A;  3KW6 A;  3PNV A;  4LY6 A;  3KP0 E;  4LF8 M;  1DGH B;  3QAU A;  4IBI A;  4GMQ A;  5EP4 A;  3K92 A;  3W0L B;  1G59 A;  4MM3 B;  4AW4 A;  1R2Y A;  2BJW A;  3CF2 A;  4RF0 A;  1L2B A;  4GIT A;  4MH0 E;  1N75 A;  1R2Z A;  2KZS A;  5EXP A;  3UGJ A;  4LJ7 A;  5FTM A;  2CV0 A;  2VQE M;  4LFC M;  4PD2 A;  5DNY A;  3AKZ A;  2EUC A;  5C1B A;  2L7H A;  4B3T M;  4LG2 A;  4IBG A;  4XGI A;  3LMM A;  3TE6 A;  4L8R C;  1NVM A;  1L8Q A;  3HJ8 A;  2F5S A;  3GPX A;  3GQ5 A;  2YNM D;  1Z59 A;  5IWA M;  2VII A;  2ZAN A;  1PM5 A;  4IIW A;  4W5W A;  4CGY B;  4CHT B;  3GPP A;  4NSO B;  3C58 A;  1PJI A;  4FWD A;  1Q39 A;  2A5Y B;  3HHX A;  1HQC A;  1L2D A;  4JI4 M;  2VQF M;  1XNR M;  5EP1 A;  1L1T A;  1HR0 M;  4LJ4 A;  4JI0 M;  4MGH A;  3ZC7 B;  2HHH M;  4GKJ M;  3AFH A;  1FNN A;  4B7G A;  4X64 M;  4LZJ A;  2ZM6 M;  2Y21 A;  3AOG A;  3KFU G;  2OQ4 A;  3W0F A;  3TQS A;  3SAW A;  3I51 A;  3AJI B;  4AKG A;  4FCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...