3J80S

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
145
Chain Sequence
b'SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 21
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j80S01
5FLXS 2HKJA 4DR3M 1K3WA 1N33M 4G4QA 4B3TM 5IT9S 3GPUA 4DV4M 3GPYA 3JR4A 3DOAA 1EE8A 1Z5AA 5ITTA 2HHHM 3JR5A 5ITQA 3SATA 4X66M 1TDZA 3U6PA 2F5SA 4JI3M 2F5NA 4JI1M 3VK7A 2ZM6M 4DV2M 1PJJA 3T1HM 2F5PA 3J81S 4DR7M 1Z5BA 1K3XA 1Q39A 5IWAM 4AQYM 1N36M 3GO8A 4DR5M 3U6DA 3U6EA 1R2YA 4DR4M 4DR6M 4B3SM 3TWMA 3A46A 2UUCM 4GKJM 5BR8M 1L1ZA 3U6MA 2UXCM 1PJIA 3VK8A 1NNJA 2OQ4A 3U6SA 3A45A 1IBLM 4DV0M 4PCZA 3SAUA 5LMNM 5ITXE 2E5LM 4ITQA 4NRVA 1L2CA 3C58A 4DV6M 3U6CA 2XZUA 1FJGM 2ZBKB 4DV7M 4DUZM 4DV1M 3U6OA 4JI4M 1N32M 3TWKA 5ITRA 2VQEM 1J5EM 2UXDM 2UUBM 3GQ3A 1XMOM 4PD2A 1I94M 4LF7M 1XNQM 5LMUM 2VQFM 4PDIA 4DUYM 3JAMS 4KHPM 2Q2EB 4X64M 3U6LA 3T1YM 1IBMM 4JI7M 2UU9M 4LF5M 4LF9M 4NXNM 1XNRM 4JYAM 2UUAM 2EA0A 4DV3M 4OX9M 3SBJA 3SASA 1Z5CA 1IBKM 4JI5M 4DV5M 4K0KM 4GKKM 1HNWM 1TDHA 3U6QA 1XC8A 2OPFA 4B3RM 4LF8M 1Q3CA 1HNZM 1HR0M 3SAWA 4MB7A 3A42A 4DR2M 4LFCM 3OTOM 4LF4M 1MX0A 3W0FA 1PM5A 3GP1A 1MU5A 4JI8M 5A2QS 4JI0M 2UXBM 2F5QA 4LF6M 1KFVA 4CISA 3J80S 5ITXA 3GPPA 1L2DA 4B3MM 1L1TA 2F5OA 4G4NA 1N34M 5ITYA 1K82A 1L2BA 3J7AS 4YY3M 3SARA 4X62M 2F4VM 4NXMM 1HNXM 4JI2M 2XZFA 4NRWA 4YHHM 3TWLA 4G4RA 1Z59A 1XMQM 4LFAM 4G4OA 4JI6M 3GPXA 1R2ZA 5ITUA 4PDGA 4DR1M 3GQ5A 4X65M 4JV5M 4LFBM 1Q3BA 3SAVA 3GQ4A
chains in the Genus database with same CATH superfamily
1J7KA 3L29A 3LMMA 5IT9S 4DV4M 3K1JA 2XFTA 3HY5A 3UZUA 3AL0C 1Z5AA 3GLHB 2R4EA 3GQ4A 2HWJA 4QOZC 1OIPA 3GLGA 3SC3A 3SATA 2Y20A 1OAOC 2F5SA 3KSJA 2Y21A 4GEWA 2ZM6M 2RKOA 1Y8GA 2YNMD 1QAOA 1R4GA 3PNVA 4S12A 2Y0TA 5FTMA 1K3XA 4DR7M 4L78A 1KYIA 1CUKA 2Z7JA 4AQYM 3KS8A 1N36M 3GO8A 4DR5M 4ZPXA 1QQWA 1R2YA 4DR4M 5EXPA 2L7IA 3EIHA 2D7GA 1L8QA 3DZDA 3GRUA 3K92A 1J09A 3PVSA 4FCTA 3SYLA 1GKIA 2BNKA 1YSYA 2DAKA 1E32A 2R65A 1ZMVA 3BBZA 3U6MA 1Z6TA 3HWSA 1I4WA 4F1IA 2C9CA 2QSFX 3FYDA 4L15A 1IY2A 4I8OA 1PJQA 2R0IA 3D8LA 2JA2A 4GIPA 4DV0M 1IBLM 3FKEA 2CRUA 4GC5A 3LW5F 4IBIA 5KPTA 1G71A 1UM8A 4NRVA 2N35A 4OW0A 2QBYA 3KP1E 1PGYA 2L2DA 2ZBKB 4L16A 4MGIE 4QHTA 3T15A 3FUVA 1IN7A 2JY8A 1WGLA 3LQQA 3NBIA 4DUZM 4JI4M 1GJSA 2CHQA 2FH0A 2JZ0A 1IXSB 2O5RA 2LBCA 3WHLA 3GQ3A 1I94M 4EIWA 1LTMA 2LHCA 2FFJA 2DAEA 4MM3B 3UJNA 1G59A 4DUYM 1Q02A 3JAMS 4KHPM 3M6AA 4LG2A 1IXZA 3U6LA 4JI7M 4LF5M 4FW9A 2UU9M 1XNRM 3RGSA 4JYAM 3LQRA 2EA0A 2CP8A 4OX9M 4AW4A 4IBCA 2BJVA 2L4FA 1KSFX 2EUCA 1QDRA 3KOXE 4RF1A 3IG8A 2WSEF 4DV5M 1V33A 1G3IA 5EP2A 1VDDA 3R8FA 1XWIA 3VDPA 5FTKA 2K6BA 4LF8M 2RRUA 4W5WA 1HR0M 3A42A 4MB7A 1OIZA 2CHGA 3C3DA 4LFCM 2CUZA 1MU5A 1YUBA 3FE3A 1GO5A 4QNMA 2QHOB 2QCUA 4LF6M 1WGNA 4XK8F 3BXWA 3EIEA 2LVOC 4IJFA 3A98B 1L2DA 5ITYA 2WSCF 2A5YB 4M0WA 4IBBA 4X62M 4NXMM 2LXEA 3HJ8A 2FOIC 4JI2M 2YFQA 2XZFA 3PXGA 1QZMA 3AFHA 1XXHA 4YHHM 1NY6A 1G4AE 5EP1A 2QZ4A 4G4RA 1XMQM 2LVQD 4LCBA 5FTJA 3SHGB 4FWDA 5KO3A 3W0LB 2CV2A 2K47A 1PJSA 3GLIB 3LVWA 4PDGA 3J27B 1TTEA 2KZUA 2V1CA 3GQ5A 3FUUA 4Y28F 2DAMA 1NNUC 2M5ZA 1DGFA 4LZZA 3ZC7B 3KS4A 3L28A 4BBAA 3B7ZA 5FLXS 2CHVA 2DZLA 2HKJA 5JI3E 2CEAA 3B7NA 4B3TM 2DI0A 2W82A 3GPUA 2I7NA 3JR4A 3KFUG 3I51A 2Z4RA 2QP9X 2ZAMA 1W5SA 5EXTA 5ITTA 3L2AA 3GRVA 3VDUA 2D7HA 3JR5A 2X8AA 1WR1B 5KQDA 2L09A 2XSZD 4RKUF 2GQFA 1TF0B 2QPAA 4RF0A 3I04M 1TDZA 2L6OA 5FSWA 1R7RA 4LRTA 4IIWA 3VK7A 1NV9A 4DV2M 4MGHA 2K0BX 4P17A 4B7FA 3AKZA 3J81S 3HGIA 1OTRA 2Y0QA 3FTEA 3UGJA 1QAMA 2ZAOA 2AHMA 2ZANA 1MJGM 4L4UA 3U6DA 1TH3A 3U60B 4IBKA 4DR6M 2J5YA 1VEKA 1DGHB 3U61A 3A46A 5BR8M 1P3QQ 2KHHA 4REZA 3HJSA 1N77A 1JQJC 2D7EA 3U5ZA 2KZSA 3AOEC 4AZFA 2KW0A 4LJ5A 3SMPA 3H4MA 1NHGC 2WSFF 2MJ5B 4LJ8A 2XZUA 1SXJE 2DENA 3U6CA 3FTDA 2XLJA 3RFWA 2JUJA 1E94E 3B74A 2M60A 4HL4A 3Q8GA 3TQSA 1N32M 4AI6A 1PJTA 1HQYE 2KA6B 5ITRA 2CE7A 5FTNA 4DBGB 2VQEM 2UXDM 2UUBM 4Q7JA 4PD2A 3ZH9B 3B89A 3RGPA 4LF7M 1DO0A 5LMUM 4PDIA 3SFZA 3VKGA 2XFSA 2YR0A 3DFZA 2R4JA 1JR3D 4OVZA 1V92A 1GLNA 1QZEA 1OFIA 1VG5A 2KNVA 3HZJA 4LJ9A 4R7GA 5EXXA 1IBMM 3AV0A 3C9PA 5DFLA 3HU3A 3MHVC 3MK6A 1QANA 4IBJA 1OJLA 2R18A 3GLIE 2DWLA 3SBJA 4M9SA 2JY6B 1Z5CA 3K9PA 1IBKM 4JI5M 3TE6A 2EO2A 4LJ4A 2NQ8C 4HEOA 3WHKA 1GL6A 2O25A 3HHWA 3HKPA 4MGZE 2JY7A 4GKKM 2L7HA 4LJ6A 3GLGE 1IFYA 3CF2A 2LHGA 4AG5A 3GLFA 2C9OA 2VF7A 4XBOA 3FYCA 2L4EA 3OTOM 2XSZA 4IBFA 2DZOB 2BWEA 3GP1A 2JXNA 1V34A 4A3VB 5A2QS 2DAIA 2UXBM 3HU1A 4CGYB 2FE8A 3AJIB 4M9XA 4P16A 3J80S 1KFVA 5ITXA 4B3MM 4G4NA 2R6FA 4D81A 1IY0A 2KXEA 1XHBA 4KODA 2JNHA 3SARA 3KP0E 2GNOA 2KRUA 4Z6YA 3K2LA 1JB0F 3B7QA 1IN4A 3FUXA 3GRYA 1EFUB 4LJ7A 4NL4H 3GLHA 3TWLA 3W68A 2HAKA 2C98A 2QENA 2RGHA 4KO8A 4G4OA 1QUSA 4CHTB 4D80A 4WP2A 4Z8XA 2ZTDA 5C1BA 2C99A 2KRKA 4IBGA 5E6JA 2MGWA 2VDBB 3FD9A 2DHYA 1Q3BA 3QWLA 1RU3A 4MH0E 4R3DA 1OKSA 3B9PA 3HX3A 1SXJB 3AOGA 4DR3M 1N33M 4G4QA 4TUWA 3PFIA 4F2LA 3GPYA 2G5GX 4FVMA 2MR9A 3DOAA 5EXSA 1EE8A 3QAUA 3UMMA 2V6ZM 3ZQJA 2HHHM 2O01F 8CATA 4QNRA 4RNAA 5ITQA 1ZMUA 3Q8XA 4X66M 1TR8A 4FWGA 4MGYE 2APLA 3UK6A 3J7BA 4NC6A 1E9SA 2CFOA 4JI1M 1JR3A 1TGUA 4LGMA 3CF6E 3SYKA 3MMPA 1NJFA 2DAGA 2P5TA 3ZCBB 1HT2E 4QOSA 5H37D 2F5PA 1BVSA 1PRBA 1IQPA 3IHPA 5IWAM 2Z4SA 2G3QA 3L25A 3U6EA 2JP7A 2KEBA 2XF3A 3SMSA 5L8RF 2LWXA 1ZQ9A 3KOYE 3U5ZB 2UUCM 4GKJM 2QQ8A 1IXSA 1GVNA 1L1ZA 2VIIA 1NO1A 3GLGB 2FS1A 3I01M 2UXCM 3CF0A 1PJIA 1ORYB 1DGGA 3VK8A 3KOWE 4LZJA 3E4RA 3AOEA 3E46A 3U6SA 1NNJA 3M0EA 5GKNA 4I81A 3SAUA 3D8BA 2ZTCA 3M7GA 2OOAA 4ITQA 4AG6A 3C58A 2OOBA 4I4LA 3W67A 1UFZA 1C1KA 2R62A 4DV7M 3HHZA 1D2NA 3NBXX 4L8RC 1XXHE 3THGA 1NJGA 2VF8A 3KVWA 1LV7A 1VEJA 3CTWB 4UN2B 5C18A 1NVMA 1XMOM 1QYRA 2LVPC 4NOOB 4HLQA 2YQZA 3K9OA 1HQCA 2DWZB 3QYBA 3K8ZA 2G8LA 1WHCA 4X64M 4I5SA 1R5LA 4LF9M 4KT0F 4NXNM 2H5XA 4AKIA 2QBYB 1D0LA 2J7NA 2C96A 3SASA 1IM2A 2HCBA 2R45A 4ANRA 1IN8A 1ZAEA 2LH0A 3FRIA 1IY1A 4K0KM 5EP3A 3R9XB 1HNWM 1TDHA 3U6QA 1IXRC 4B3RM 2B3TA 5FTLA 3SAWA 4DR2M 1AIPC 5E26A 4D82A 4LF4M 3ILKA 1MX0A 3E9SA 4B7HA 1H6UA 1PM5A 4JI8M 1NV8A 4L6V6 5KPZA 3GLIA 2R46A 4JI0M 7CATA 4CISA 1T3TA 2DNAA 1L1TA 1K82A 2DZNB 3FUWA 4IBDA 4YY3M 1L2BA 4FWHA 1SXJC 1WJ7A 1HNXM 4R71A 2WZJA 4NRWA 4IJEA 2ERCA 3VFDA 5F3WA 1VQ1A 1YE9A 3FUTA 1NSFA 5JI2E 2DWNA 3KOZE 5KQ8A 3IG5A 1R2ZA 2R44A 3QYEA 2C5RA 5EJCA 4DR1M 1G41A 3DA1A 4X65M 4MGKE 1F4IA 4GRIA 2DKLA 3MJ5A 2KDLA 1FNNA 4NSOB 2RGOA 3KXEC 3J2PB 1K3WA 4KLNA 4B08A 2QNJA 3U60A 2V1UA 4XGIA 1OQYA 1DGHA 1XXHB 5DYGA 3LVVA 1N75A 3I4VA 3LCVB 3T1HM 1NHWC 3HU2A 4JI3M 3U6PA 2F5NA 4M0DA 1OFHA 2DVWB 2LNHC 1D0MA 2BJWA 1NY5A 2EKKA 2KNZA 4BLCA 1PJJA 4PT5A 1Z5BA 3H4JA 1G8PA 4GHAA 2LVNC 2BWBA 1Q39A 4JN6A 1SXJD 4GITA 1A5TA 2LVAA 3KDSE 1TH4A 3I4YA 3T6PA 3GLFE 4B3SM 2DXIA 3HHXA 3TWMA 1N78A 2H1RA 2XH9A 4OU7A 4LJAA 3PNYA 2DWMA 4FD2A 2OQ4A 4AKHA 3A45A 1WXQA 4PCZA 5BPVA 5LMNM 1W5TA 5ITXE 2E5LM 1YLAA 4QHSA 3SHFA 2EKFA 1MN3A 1DGBA 4DV6M 1L2CA 1C7YA 3LCUA 3KW6A 2MH8A 1FJGM 4LRSA 5EP4A 4BB9A 3VKHA 3U6OA 4M9ZA 4DV1M 5EQTA 1VEGA 3GLHE 3CGWA 3U61B 3TWKA 1J5EM 1QVRA 2OO9A 5IZ7D 1E9RA 2XGNA 4CIZA 2VQFM 1XNQM 4FCWA 1T43A 4WURA 2KNAA 5IREB 4JXJA 2HL7A 1ZMWA 2Q2EB 4GHLA 3T1YM 4AKGA 1SG9A 2CWBA 4B7GA 1HJPA 2XEPA 2UUAM 4DV3M 1VDLA 5DYIA 5KPRA 2I7PA 2DHRA 4LY6A 1AUAA 3IECA 4LGYA 2X4AA 2Z8YM 3TL4X 4G3OA 1EIJA 3HHYA 1XC8A 1GL7A 2JZ1A 1D0KA 2OPFA 1Q3CA 2LTUA 1HNZM 1DV0A 3FRHA 2J7OA 4OVZB 1JR3E 2JY5A 2X49A 1R6BX 3W0FA 1GJTA 3RE8A 4GMQA 4WW0A 1QAQA 3KSXA 1S3SA 4GH9A 1ZV1A 3L26A 2F5QA 3HJQA 3C3EA 3GPPA 1OAIA 3FTFA 2F5OA 3J7AS 1N34M 1QDTA 3TPZA 1SXJA 2JWSA 4G6ZA 4IBEA 2Z3XA 3FTCA 5DNYA 2F4VM 2EJSA 3GRRA 4II7A 2MROB 3BOSA 3T38A 3E21A 3GLFB 1XB2B 2FNAA 4NSRA 1TH2A 1Z59A 2CV1A 1GABA 1IN5A 4LFAM 3NWLA 4JI6M 4CJ6A 3GPXA 1DO2A 1X37A 1IN6A 1QUTA 1T6OA 1WIVA 3VLFB 5ITUA 2CV0A 4FCVA 3V76A 2K9DA 4JV5M 4LFBM 1HT1E 3L27A 3SAVA 4GC9A 3F92A
chains in the Genus database with same CATH topology
1J7KA 3L29A 3LMMA 5IT9S 4DV4M 3K1JA 2XFTA 3UZUA 3AL0C 1Z5AA 3GLHB 2R4EA 3GQ4A 4QOZC 3GLGA 3SC3A 3SATA 2Y20A 2F5SA 3KSJA 2Y21A 2ZM6M 2RKOA 2YNMD 1QAOA 3PNVA 4S12A 2Y0TA 5FTMA 1K3XA 4DR7M 4L78A 1KYIA 2Z7JA 4AQYM 3KS8A 1N36M 3GO8A 4DR5M 4ZPXA 1QQWA 1R2YA 4DR4M 5EXPA 2L7IA 3EIHA 2D7GA 1L8QA 3DZDA 3GRUA 3K92A 1J09A 3PVSA 4FCTA 3SYLA 1GKIA 2BNKA 1YSYA 2R65A 1E32A 3U6MA 1Z6TA 3HWSA 1I4WA 2C9CA 3FYDA 4L15A 1IY2A 4I8OA 4GIPA 4DV0M 3D8LA 2JA2A 1IBLM 3FKEA 4GC5A 4IBIA 5KPTA 1UM8A 4NRVA 2QBYA 4OW0A 3KP1E 2ZBKB 4L16A 4MGIE 4QHTA 3T15A 3FUVA 1IN7A 4DUZM 3LQQA 3NBIA 4JI4M 2CHQA 1IXSB 2O5RA 3GQ3A 3WHLA 1I94M 4EIWA 2FFJA 4MM3B 3UJNA 1G59A 4DUYM 3JAMS 4KHPM 3M6AA 4LG2A 1IXZA 3U6LA 4JI7M 4LF5M 4FW9A 2UU9M 1XNRM 3RGSA 4JYAM 3LQRA 2EA0A 4OX9M 4AW4A 4IBCA 2BJVA 1KSFX 2EUCA 3KOXE 4RF1A 3IG8A 4DV5M 3R8FA 1G3IA 5EP2A 1VDDA 1XWIA 3VDPA 5FTKA 4LF8M 4W5WA 1HR0M 3A42A 4MB7A 4LFCM 2CHGA 2CUZA 1MU5A 1YUBA 4QNMA 2QCUA 4LF6M 3EIEA 4IJFA 3A98B 1L2DA 5ITYA 2A5YB 4M0WA 4IBBA 4X62M 4NXMM 2LXEA 3HJ8A 2FOIC 4JI2M 2YFQA 2XZFA 3PXGA 1QZMA 3AFHA 1XXHA 4YHHM 1NY6A 1G4AE 5EP1A 2QZ4A 4G4RA 1XMQM 4LCBA 5FTJA 3SHGB 4FWDA 5KO3A 3W0LB 2CV2A 2K47A 3GLIB 3LVWA 4PDGA 3J27B 2KZUA 3GQ5A 2V1CA 3FUUA 1NNUC 4LZZA 2M5ZA 1DGFA 3ZC7B 3KS4A 3L28A 4BBAA 5FLXS 2CHVA 2HKJA 5JI3E 2CEAA 4B3TM 2W82A 3GPUA 2I7NA 3JR4A 3KFUG 3I51A 2Z4RA 2QP9X 2ZAMA 1W5SA 5EXTA 5ITTA 3L2AA 3GRVA 3VDUA 2D7HA 3JR5A 2X8AA 5KQDA 2L09A 2XSZD 2QPAA 4RF0A 1TDZA 2L6OA 5FSWA 1R7RA 4LRTA 4IIWA 3VK7A 4DV2M 4MGHA 4B7FA 3AKZA 3J81S 3HGIA 3FTEA 2Y0QA 3UGJA 1QAMA 2ZAOA 2AHMA 2ZANA 4L4UA 3U6DA 1TH3A 3U60B 4IBKA 4DR6M 1DGHB 3U61A 3A46A 5BR8M 4REZA 3HJSA 1N77A 1JQJC 2D7EA 3U5ZA 2KZSA 3AOEC 4AZFA 2KW0A 4LJ5A 3SMPA 3H4MA 1NHGC 4LJ8A 2XZUA 1SXJE 3U6CA 3FTDA 2XLJA 3RFWA 1E94E 4HL4A 2M60A 4AI6A 3TQSA 1N32M 1HQYE 2KA6B 5ITRA 2CE7A 5FTNA 2VQEM 2UXDM 2UUBM 4PD2A 3ZH9B 4LF7M 3RGPA 1DO0A 5LMUM 4PDIA 3SFZA 3VKGA 2XFSA 2YR0A 3DFZA 2R4JA 1JR3D 4OVZA 1GLNA 1OFIA 4LJ9A 4R7GA 5EXXA 1IBMM 3AV0A 3HU3A 3MHVC 3MK6A 1QANA 4IBJA 1OJLA 2R18A 2DWLA 3SBJA 4M9SA 1Z5CA 1IBKM 4JI5M 3TE6A 2EO2A 4LJ4A 2NQ8C 3WHKA 1GL6A 3HHWA 3HKPA 4MGZE 4GKKM 2L7HA 4LJ6A 3CF2A 3GLFA 4AG5A 2C9OA 4XBOA 3FYCA 3OTOM 2XSZA 4IBFA 2DZOB 3GP1A 4A3VB 5A2QS 2UXBM 3HU1A 4CGYB 2FE8A 3AJIB 4M9XA 4P16A 3J80S 1KFVA 5ITXA 4B3MM 4G4NA 4D81A 1IY0A 2KXEA 1XHBA 4KODA 3SARA 3KP0E 2KRUA 4Z6YA 3K2LA 1IN4A 3FUXA 3GRYA 4LJ7A 4NL4H 3GLHA 3TWLA 2C98A 2QENA 2RGHA 4KO8A 4G4OA 4CHTB 4D80A 4Z8XA 5C1BA 2C99A 2KRKA 4IBGA 5E6JA 3FD9A 1Q3BA 3QWLA 4MH0E 4R3DA 3B9PA 1SXJB 3AOGA 4DR3M 1N33M 4G4QA 4TUWA 3PFIA 3GPYA 2G5GX 4FVMA 3DOAA 5EXSA 1EE8A 3QAUA 3UMMA 2V6ZM 2HHHM 8CATA 4QNRA 4RNAA 5ITQA 3Q8XA 4X66M 4FWGA 4MGYE 3UK6A 3J7BA 4JI1M 1E9SA 2CFOA 1JR3A 1TGUA 4LGMA 3CF6E 3SYKA 5H37D 1NJFA 2P5TA 3T1HM 3ZCBB 1HT2E 4QOSA 2F5PA 1IQPA 5IWAM 2Z4SA 3L25A 3U6EA 2KEBA 2XF3A 3SMSA 2LWXA 1ZQ9A 3KOYE 3U5ZB 2UUCM 4GKJM 1GVNA 1L1ZA 2VIIA 3GLGB 2UXCM 3CF0A 1PJIA 1ORYB 1DGGA 3VK8A 3KOWE 4LZJA 3E4RA 3AOEA 1NNJA 3U6SA 3M0EA 5GKNA 4I81A 3SAUA 3D8BA 3M7GA 4ITQA 4AG6A 3C58A 4I4LA 1C1KA 2R62A 4DV7M 3HHZA 1D2NA 4L8RC 3THGA 1NJGA 3KVWA 1LV7A 3CTWB 5C18A 1NVMA 1XMOM 1QYRA 4NOOB 4HLQA 2YQZA 1HQCA 2DWZB 3K8ZA 2G8LA 4X64M 4I5SA 4LF9M 4NXNM 4AKIA 2QBYB 2J7NA 2C96A 3SASA 1IM2A 2HCBA 2R45A 1IN8A 1ZAEA 2LH0A 1IY1A 4K0KM 5EP3A 3R9XB 1HNWM 1TDHA 3U6QA 1IXRC 4B3RM 5FTLA 3SAWA 4DR2M 4D82A 5E26A 4LF4M 3ILKA 1MX0A 3E9SA 4B7HA 1H6UA 1PM5A 4JI8M 5KPZA 3GLIA 2R46A 4JI0M 7CATA 4CISA 1T3TA 1L1TA 1K82A 2DZNB 3FUWA 4IBDA 4YY3M 1L2BA 4FWHA 1SXJC 1HNXM 4NRWA 4IJEA 2ERCA 3VFDA 5F3WA 1YE9A 3FUTA 1NSFA 5JI2E 2DWNA 3KOZE 5KQ8A 3IG5A 1R2ZA 2C5RA 5EJCA 4DR1M 1G41A 3DA1A 4X65M 4MGKE 4GRIA 3MJ5A 1FNNA 4NSOB 3KXEC 2RGOA 3J2PB 1K3WA 4KLNA 4B08A 3U60A 2V1UA 4XGIA 1DGHA 1XXHB 5DYGA 3LVVA 1N75A 3I4VA 1NHWC 3HU2A 4JI3M 3U6PA 2F5NA 4M0DA 1OFHA 2DVWB 2LNHC 2BJWA 4BLCA 1NY5A 1PJJA 4PT5A 1Z5BA 1G8PA 4GHAA 1Q39A 4JN6A 1SXJD 4GITA 3KDSE 1TH4A 3I4YA 4B3SM 2DXIA 3HHXA 3TWMA 1N78A 2H1RA 2XH9A 4OU7A 4LJAA 3PNYA 2DWMA 4FD2A 2OQ4A 4AKHA 3A45A 1WXQA 4PCZA 5BPVA 5LMNM 1W5TA 5ITXE 2E5LM 4QHSA 3SHFA 1L2CA 1DGBA 4DV6M 3KW6A 1FJGM 4LRSA 5EP4A 4BB9A 3VKHA 3U6OA 4M9ZA 4DV1M 5EQTA 3U61B 3TWKA 1J5EM 1QVRA 5IZ7D 1E9RA 2XGNA 2VQFM 1XNQM 4FCWA 4WURA 5IREB 4JXJA 2HL7A 2Q2EB 4GHLA 3T1YM 4AKGA 4B7GA 2UUAM 2XEPA 4DV3M 5DYIA 5KPRA 2I7PA 2DHRA 4LY6A 4LGYA 2X4AA 3TL4X 3HHYA 1XC8A 1GL7A 2OPFA 1Q3CA 1HNZM 2J7OA 4OVZB 2X49A 3W0FA 1R6BX 3RE8A 4GMQA 4WW0A 1QAQA 3KSXA 1S3SA 4GH9A 3L26A 2F5QA 3HJQA 3GPPA 3FTFA 3J7AS 2F5OA 1N34M 3TPZA 1SXJA 4G6ZA 4IBEA 2Z3XA 3FTCA 5DNYA 2F4VM 4II7A 3GRRA 3BOSA 3T38A 3GLFB 2FNAA 4NSRA 1TH2A 1Z59A 2CV1A 1IN5A 4LFAM 3NWLA 4JI6M 3GPXA 1DO2A 1X37A 1IN6A 3VLFB 5ITUA 2CV0A 4FCVA 4JV5M 4LFBM 1HT1E 3L27A 3SAVA 4GC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX S;  2HKJ A;  4DR3 M;  1K3W A;  1N33 M;  4G4Q A;  4B3T M;  5IT9 S;  3GPU A;  4DV4 M;  3GPY A;  3JR4 A;  3DOA A;  1EE8 A;  1Z5A A;  5ITT A;  2HHH M;  3JR5 A;  5ITQ A;  3SAT A;  4X66 M;  1TDZ A;  3U6P A;  2F5S A;  4JI3 M;  2F5N A;  4JI1 M;  3VK7 A;  2ZM6 M;  4DV2 M;  1PJJ A;  3T1H M;  2F5P A;  3J81 S;  4DR7 M;  1Z5B A;  1K3X A;  1Q39 A;  5IWA M;  4AQY M;  1N36 M;  3GO8 A;  4DR5 M;  3U6D A;  3U6E A;  1R2Y A;  4DR4 M;  4DR6 M;  4B3S M;  3TWM A;  3A46 A;  2UUC M;  4GKJ M;  5BR8 M;  1L1Z A;  3U6M A;  2UXC M;  1PJI A;  3VK8 A;  1NNJ A;  2OQ4 A;  3U6S A;  3A45 A;  1IBL M;  4DV0 M;  4PCZ A;  3SAU A;  5LMN M;  5ITX E;  2E5L M;  4ITQ A;  4NRV A;  1L2C A;  3C58 A;  4DV6 M;  3U6C A;  2XZU A;  1FJG M;  2ZBK B;  4DV7 M;  4DUZ M;  4DV1 M;  3U6O A;  4JI4 M;  1N32 M;  3TWK A;  5ITR A;  2VQE M;  1J5E M;  2UXD M;  2UUB M;  3GQ3 A;  1XMO M;  4PD2 A;  1I94 M;  4LF7 M;  1XNQ M;  5LMU M;  2VQF M;  4PDI A;  4DUY M;  3JAM S;  4KHP M;  2Q2E B;  4X64 M;  3U6L A;  3T1Y M;  1IBM M;  4JI7 M;  2UU9 M;  4LF5 M;  4LF9 M;  4NXN M;  1XNR M;  4JYA M;  2UUA M;  2EA0 A;  4DV3 M;  4OX9 M;  3SBJ A;  3SAS A;  1Z5C A;  1IBK M;  4JI5 M;  4DV5 M;  4K0K M;  4GKK M;  1HNW M;  1TDH A;  3U6Q A;  1XC8 A;  2OPF A;  4B3R M;  4LF8 M;  1Q3C A;  1HNZ M;  1HR0 M;  3SAW A;  4MB7 A;  3A42 A;  4DR2 M;  4LFC M;  3OTO M;  4LF4 M;  1MX0 A;  3W0F A;  1PM5 A;  3GP1 A;  1MU5 A;  4JI8 M;  5A2Q S;  4JI0 M;  2UXB M;  2F5Q A;  4LF6 M;  1KFV A;  4CIS A;  3J80 S;  5ITX A;  3GPP A;  1L2D A;  4B3M M;  1L1T A;  2F5O A;  4G4N A;  1N34 M;  5ITY A;  1K82 A;  1L2B A;  3J7A S;  4YY3 M;  3SAR A;  4X62 M;  2F4V M;  4NXM M;  1HNX M;  4JI2 M;  2XZF A;  4NRW A;  4YHH M;  3TWL A;  4G4R A;  1Z59 A;  1XMQ M;  4LFA M;  4G4O A;  4JI6 M;  3GPX A;  1R2Z A;  5ITU A;  4PDG A;  4DR1 M;  3GQ5 A;  4X65 M;  4JV5 M;  4LFB M;  1Q3B A;  3SAV A;  3GQ4 A; 
#chains in the Genus database with same CATH topology
 1J7K A;  3L29 A;  3LMM A;  5IT9 S;  4DV4 M;  3K1J A;  2XFT A;  3HY5 A;  3UZU A;  3AL0 C;  1Z5A A;  3GLH B;  2R4E A;  3GQ4 A;  2HWJ A;  4QOZ C;  1OIP A;  3GLG A;  3SC3 A;  3SAT A;  2Y20 A;  1OAO C;  2F5S A;  3KSJ A;  2Y21 A;  4GEW A;  2ZM6 M;  2RKO A;  1Y8G A;  2YNM D;  1QAO A;  1R4G A;  3PNV A;  4S12 A;  2Y0T A;  5FTM A;  1K3X A;  4DR7 M;  4L78 A;  1KYI A;  1CUK A;  2Z7J A;  4AQY M;  3KS8 A;  1N36 M;  3GO8 A;  4DR5 M;  4ZPX A;  1QQW A;  1R2Y A;  4DR4 M;  5EXP A;  2L7I A;  3EIH A;  2D7G A;  1L8Q A;  3DZD A;  3GRU A;  3K92 A;  1J09 A;  3PVS A;  4FCT A;  3SYL A;  1GKI A;  2BNK A;  1YSY A;  2DAK A;  1E32 A;  2R65 A;  1ZMV A;  3BBZ A;  3U6M A;  1Z6T A;  3HWS A;  1I4W A;  4F1I A;  2C9C A;  2QSF X;  3FYD A;  4L15 A;  1IY2 A;  4I8O A;  1PJQ A;  2R0I A;  3D8L A;  2JA2 A;  4GIP A;  4DV0 M;  1IBL M;  3FKE A;  2CRU A;  4GC5 A;  3LW5 F;  4IBI A;  5KPT A;  1G71 A;  1UM8 A;  4NRV A;  2N35 A;  4OW0 A;  2QBY A;  3KP1 E;  1PGY A;  2L2D A;  2ZBK B;  4L16 A;  4MGI E;  4QHT A;  3T15 A;  3FUV A;  1IN7 A;  2JY8 A;  1WGL A;  3LQQ A;  3NBI A;  4DUZ M;  4JI4 M;  1GJS A;  2CHQ A;  2FH0 A;  2JZ0 A;  1IXS B;  2O5R A;  2LBC A;  3WHL A;  3GQ3 A;  1I94 M;  4EIW A;  1LTM A;  2LHC A;  2FFJ A;  2DAE A;  4MM3 B;  3UJN A;  1G59 A;  4DUY M;  1Q02 A;  3JAM S;  4KHP M;  3M6A A;  4LG2 A;  1IXZ A;  3U6L A;  4JI7 M;  4LF5 M;  4FW9 A;  2UU9 M;  1XNR M;  3RGS A;  4JYA M;  3LQR A;  2EA0 A;  2CP8 A;  4OX9 M;  4AW4 A;  4IBC A;  2BJV A;  2L4F A;  1KSF X;  2EUC A;  1QDR A;  3KOX E;  4RF1 A;  3IG8 A;  2WSE F;  4DV5 M;  1V33 A;  1G3I A;  5EP2 A;  1VDD A;  3R8F A;  1XWI A;  3VDP A;  5FTK A;  2K6B A;  4LF8 M;  2RRU A;  4W5W A;  1HR0 M;  3A42 A;  4MB7 A;  1OIZ A;  2CHG A;  3C3D A;  4LFC M;  2CUZ A;  1MU5 A;  1YUB A;  3FE3 A;  1GO5 A;  4QNM A;  2QHO B;  2QCU A;  4LF6 M;  1WGN A;  4XK8 F;  3BXW A;  3EIE A;  2LVO C;  4IJF A;  3A98 B;  1L2D A;  5ITY A;  2WSC F;  2A5Y B;  4M0W A;  4IBB A;  4X62 M;  4NXM M;  2LXE A;  3HJ8 A;  2FOI C;  4JI2 M;  2YFQ A;  2XZF A;  3PXG A;  1QZM A;  3AFH A;  1XXH A;  4YHH M;  1NY6 A;  1G4A E;  5EP1 A;  2QZ4 A;  4G4R A;  1XMQ M;  2LVQ D;  4LCB A;  5FTJ A;  3SHG B;  4FWD A;  5KO3 A;  3W0L B;  2CV2 A;  2K47 A;  1PJS A;  3GLI B;  3LVW A;  4PDG A;  3J27 B;  1TTE A;  2KZU A;  2V1C A;  3GQ5 A;  3FUU A;  4Y28 F;  2DAM A;  1NNU C;  2M5Z A;  1DGF A;  4LZZ A;  3ZC7 B;  3KS4 A;  3L28 A;  4BBA A;  3B7Z A;  5FLX S;  2CHV A;  2DZL A;  2HKJ A;  5JI3 E;  2CEA A;  3B7N A;  4B3T M;  2DI0 A;  2W82 A;  3GPU A;  2I7N A;  3JR4 A;  3KFU G;  3I51 A;  2Z4R A;  2QP9 X;  2ZAM A;  1W5S A;  5EXT A;  5ITT A;  3L2A A;  3GRV A;  3VDU A;  2D7H A;  3JR5 A;  2X8A A;  1WR1 B;  5KQD A;  2L09 A;  2XSZ D;  4RKU F;  2GQF A;  1TF0 B;  2QPA A;  4RF0 A;  3I04 M;  1TDZ A;  2L6O A;  5FSW A;  1R7R A;  4LRT A;  4IIW A;  3VK7 A;  1NV9 A;  4DV2 M;  4MGH A;  2K0B X;  4P17 A;  4B7F A;  3AKZ A;  3J81 S;  3HGI A;  1OTR A;  2Y0Q A;  3FTE A;  3UGJ A;  1QAM A;  2ZAO A;  2AHM A;  2ZAN A;  1MJG M;  4L4U A;  3U6D A;  1TH3 A;  3U60 B;  4IBK A;  4DR6 M;  2J5Y A;  1VEK A;  1DGH B;  3U61 A;  3A46 A;  5BR8 M;  1P3Q Q;  2KHH A;  4REZ A;  3HJS A;  1N77 A;  1JQJ C;  2D7E A;  3U5Z A;  2KZS A;  3AOE C;  4AZF A;  2KW0 A;  4LJ5 A;  3SMP A;  3H4M A;  1NHG C;  2WSF F;  2MJ5 B;  4LJ8 A;  2XZU A;  1SXJ E;  2DEN A;  3U6C A;  3FTD A;  2XLJ A;  3RFW A;  2JUJ A;  1E94 E;  3B74 A;  2M60 A;  4HL4 A;  3Q8G A;  3TQS A;  1N32 M;  4AI6 A;  1PJT A;  1HQY E;  2KA6 B;  5ITR A;  2CE7 A;  5FTN A;  4DBG B;  2VQE M;  2UXD M;  2UUB M;  4Q7J A;  4PD2 A;  3ZH9 B;  3B89 A;  3RGP A;  4LF7 M;  1DO0 A;  5LMU M;  4PDI A;  3SFZ A;  3VKG A;  2XFS A;  2YR0 A;  3DFZ A;  2R4J A;  1JR3 D;  4OVZ A;  1V92 A;  1GLN A;  1QZE A;  1OFI A;  1VG5 A;  2KNV A;  3HZJ A;  4LJ9 A;  4R7G A;  5EXX A;  1IBM M;  3AV0 A;  3C9P A;  5DFL A;  3HU3 A;  3MHV C;  3MK6 A;  1QAN A;  4IBJ A;  1OJL A;  2R18 A;  3GLI E;  2DWL A;  3SBJ A;  4M9S A;  2JY6 B;  1Z5C A;  3K9P A;  1IBK M;  4JI5 M;  3TE6 A;  2EO2 A;  4LJ4 A;  2NQ8 C;  4HEO A;  3WHK A;  1GL6 A;  2O25 A;  3HHW A;  3HKP A;  4MGZ E;  2JY7 A;  4GKK M;  2L7H A;  4LJ6 A;  3GLG E;  1IFY A;  3CF2 A;  2LHG A;  4AG5 A;  3GLF A;  2C9O A;  2VF7 A;  4XBO A;  3FYC A;  2L4E A;  3OTO M;  2XSZ A;  4IBF A;  2DZO B;  2BWE A;  3GP1 A;  2JXN A;  1V34 A;  4A3V B;  5A2Q S;  2DAI A;  2UXB M;  3HU1 A;  4CGY B;  2FE8 A;  3AJI B;  4M9X A;  4P16 A;  3J80 S;  1KFV A;  5ITX A;  4B3M M;  4G4N A;  2R6F A;  4D81 A;  1IY0 A;  2KXE A;  1XHB A;  4KOD A;  2JNH A;  3SAR A;  3KP0 E;  2GNO A;  2KRU A;  4Z6Y A;  3K2L A;  1JB0 F;  3B7Q A;  1IN4 A;  3FUX A;  3GRY A;  1EFU B;  4LJ7 A;  4NL4 H;  3GLH A;  3TWL A;  3W68 A;  2HAK A;  2C98 A;  2QEN A;  2RGH A;  4KO8 A;  4G4O A;  1QUS A;  4CHT B;  4D80 A;  4WP2 A;  4Z8X A;  2ZTD A;  5C1B A;  2C99 A;  2KRK A;  4IBG A;  5E6J A;  2MGW A;  2VDB B;  3FD9 A;  2DHY A;  1Q3B A;  3QWL A;  1RU3 A;  4MH0 E;  4R3D A;  1OKS A;  3B9P A;  3HX3 A;  1SXJ B;  3AOG A;  4DR3 M;  1N33 M;  4G4Q A;  4TUW A;  3PFI A;  4F2L A;  3GPY A;  2G5G X;  4FVM A;  2MR9 A;  3DOA A;  5EXS A;  1EE8 A;  3QAU A;  3UMM A;  2V6Z M;  3ZQJ A;  2HHH M;  2O01 F;  8CAT A;  4QNR A;  4RNA A;  5ITQ A;  1ZMU A;  3Q8X A;  4X66 M;  1TR8 A;  4FWG A;  4MGY E;  2APL A;  3UK6 A;  3J7B A;  4NC6 A;  1E9S A;  2CFO A;  4JI1 M;  1JR3 A;  1TGU A;  4LGM A;  3CF6 E;  3SYK A;  3MMP A;  1NJF A;  2DAG A;  2P5T A;  3ZCB B;  1HT2 E;  4QOS A;  5H37 D;  2F5P A;  1BVS A;  1PRB A;  1IQP A;  3IHP A;  5IWA M;  2Z4S A;  2G3Q A;  3L25 A;  3U6E A;  2JP7 A;  2KEB A;  2XF3 A;  3SMS A;  5L8R F;  2LWX A;  1ZQ9 A;  3KOY E;  3U5Z B;  2UUC M;  4GKJ M;  2QQ8 A;  1IXS A;  1GVN A;  1L1Z A;  2VII A;  1NO1 A;  3GLG B;  2FS1 A;  3I01 M;  2UXC M;  3CF0 A;  1PJI A;  1ORY B;  1DGG A;  3VK8 A;  3KOW E;  4LZJ A;  3E4R A;  3AOE A;  3E46 A;  3U6S A;  1NNJ A;  3M0E A;  5GKN A;  4I81 A;  3SAU A;  3D8B A;  2ZTC A;  3M7G A;  2OOA A;  4ITQ A;  4AG6 A;  3C58 A;  2OOB A;  4I4L A;  3W67 A;  1UFZ A;  1C1K A;  2R62 A;  4DV7 M;  3HHZ A;  1D2N A;  3NBX X;  4L8R C;  1XXH E;  3THG A;  1NJG A;  2VF8 A;  3KVW A;  1LV7 A;  1VEJ A;  3CTW B;  4UN2 B;  5C18 A;  1NVM A;  1XMO M;  1QYR A;  2LVP C;  4NOO B;  4HLQ A;  2YQZ A;  3K9O A;  1HQC A;  2DWZ B;  3QYB A;  3K8Z A;  2G8L A;  1WHC A;  4X64 M;  4I5S A;  1R5L A;  4LF9 M;  4KT0 F;  4NXN M;  2H5X A;  4AKI A;  2QBY B;  1D0L A;  2J7N A;  2C96 A;  3SAS A;  1IM2 A;  2HCB A;  2R45 A;  4ANR A;  1IN8 A;  1ZAE A;  2LH0 A;  3FRI A;  1IY1 A;  4K0K M;  5EP3 A;  3R9X B;  1HNW M;  1TDH A;  3U6Q A;  1IXR C;  4B3R M;  2B3T A;  5FTL A;  3SAW A;  4DR2 M;  1AIP C;  5E26 A;  4D82 A;  4LF4 M;  3ILK A;  1MX0 A;  3E9S A;  4B7H A;  1H6U A;  1PM5 A;  4JI8 M;  1NV8 A;  4L6V 6;  5KPZ A;  3GLI A;  2R46 A;  4JI0 M;  7CAT A;  4CIS A;  1T3T A;  2DNA A;  1L1T A;  1K82 A;  2DZN B;  3FUW A;  4IBD A;  4YY3 M;  1L2B A;  4FWH A;  1SXJ C;  1WJ7 A;  1HNX M;  4R71 A;  2WZJ A;  4NRW A;  4IJE A;  2ERC A;  3VFD A;  5F3W A;  1VQ1 A;  1YE9 A;  3FUT A;  1NSF A;  5JI2 E;  2DWN A;  3KOZ E;  5KQ8 A;  3IG5 A;  1R2Z A;  2R44 A;  3QYE A;  2C5R A;  5EJC A;  4DR1 M;  1G41 A;  3DA1 A;  4X65 M;  4MGK E;  1F4I A;  4GRI A;  2DKL A;  3MJ5 A;  2KDL A;  1FNN A;  4NSO B;  2RGO A;  3KXE C;  3J2P B;  1K3W A;  4KLN A;  4B08 A;  2QNJ A;  3U60 A;  2V1U A;  4XGI A;  1OQY A;  1DGH A;  1XXH B;  5DYG A;  3LVV A;  1N75 A;  3I4V A;  3LCV B;  3T1H M;  1NHW C;  3HU2 A;  4JI3 M;  3U6P A;  2F5N A;  4M0D A;  1OFH A;  2DVW B;  2LNH C;  1D0M A;  2BJW A;  1NY5 A;  2EKK A;  2KNZ A;  4BLC A;  1PJJ A;  4PT5 A;  1Z5B A;  3H4J A;  1G8P A;  4GHA A;  2LVN C;  2BWB A;  1Q39 A;  4JN6 A;  1SXJ D;  4GIT A;  1A5T A;  2LVA A;  3KDS E;  1TH4 A;  3I4Y A;  3T6P A;  3GLF E;  4B3S M;  2DXI A;  3HHX A;  3TWM A;  1N78 A;  2H1R A;  2XH9 A;  4OU7 A;  4LJA A;  3PNY A;  2DWM A;  4FD2 A;  2OQ4 A;  4AKH A;  3A45 A;  1WXQ A;  4PCZ A;  5BPV A;  5LMN M;  1W5T A;  5ITX E;  2E5L M;  1YLA A;  4QHS A;  3SHF A;  2EKF A;  1MN3 A;  1DGB A;  4DV6 M;  1L2C A;  1C7Y A;  3LCU A;  3KW6 A;  2MH8 A;  1FJG M;  4LRS A;  5EP4 A;  4BB9 A;  3VKH A;  3U6O A;  4M9Z A;  4DV1 M;  5EQT A;  1VEG A;  3GLH E;  3CGW A;  3U61 B;  3TWK A;  1J5E M;  1QVR A;  2OO9 A;  5IZ7 D;  1E9R A;  2XGN A;  4CIZ A;  2VQF M;  1XNQ M;  4FCW A;  1T43 A;  4WUR A;  2KNA A;  5IRE B;  4JXJ A;  2HL7 A;  1ZMW A;  2Q2E B;  4GHL A;  3T1Y M;  4AKG A;  1SG9 A;  2CWB A;  4B7G A;  1HJP A;  2XEP A;  2UUA M;  4DV3 M;  1VDL A;  5DYI A;  5KPR A;  2I7P A;  2DHR A;  4LY6 A;  1AUA A;  3IEC A;  4LGY A;  2X4A A;  2Z8Y M;  3TL4 X;  4G3O A;  1EIJ A;  3HHY A;  1XC8 A;  1GL7 A;  2JZ1 A;  1D0K A;  2OPF A;  1Q3C A;  2LTU A;  1HNZ M;  1DV0 A;  3FRH A;  2J7O A;  4OVZ B;  1JR3 E;  2JY5 A;  2X49 A;  1R6B X;  3W0F A;  1GJT A;  3RE8 A;  4GMQ A;  4WW0 A;  1QAQ A;  3KSX A;  1S3S A;  4GH9 A;  1ZV1 A;  3L26 A;  2F5Q A;  3HJQ A;  3C3E A;  3GPP A;  1OAI A;  3FTF A;  2F5O A;  3J7A S;  1N34 M;  1QDT A;  3TPZ A;  1SXJ A;  2JWS A;  4G6Z A;  4IBE A;  2Z3X A;  3FTC A;  5DNY A;  2F4V M;  2EJS A;  3GRR A;  4II7 A;  2MRO B;  3BOS A;  3T38 A;  3E21 A;  3GLF B;  1XB2 B;  2FNA A;  4NSR A;  1TH2 A;  1Z59 A;  2CV1 A;  1GAB A;  1IN5 A;  4LFA M;  3NWL A;  4JI6 M;  4CJ6 A;  3GPX A;  1DO2 A;  1X37 A;  1IN6 A;  1QUT A;  1T6O A;  1WIV A;  3VLF B;  5ITU A;  2CV0 A;  4FCV A;  3V76 A;  2K9D A;  4JV5 M;  4LFB M;  1HT1 E;  3L27 A;  3SAV A;  4GC9 A;  3F92 A; 
#chains in the Genus database with same CATH homology
 1J7K A;  3L29 A;  3LMM A;  5IT9 S;  4DV4 M;  3K1J A;  2XFT A;  3UZU A;  3AL0 C;  1Z5A A;  3GLH B;  2R4E A;  3GQ4 A;  4QOZ C;  3GLG A;  3SC3 A;  3SAT A;  2Y20 A;  2F5S A;  3KSJ A;  2Y21 A;  2ZM6 M;  2RKO A;  2YNM D;  1QAO A;  3PNV A;  4S12 A;  2Y0T A;  5FTM A;  1K3X A;  4DR7 M;  4L78 A;  1KYI A;  2Z7J A;  4AQY M;  3KS8 A;  1N36 M;  3GO8 A;  4DR5 M;  4ZPX A;  1QQW A;  1R2Y A;  4DR4 M;  5EXP A;  2L7I A;  3EIH A;  2D7G A;  1L8Q A;  3DZD A;  3GRU A;  3K92 A;  1J09 A;  3PVS A;  4FCT A;  3SYL A;  1GKI A;  2BNK A;  1YSY A;  2R65 A;  1E32 A;  3U6M A;  1Z6T A;  3HWS A;  1I4W A;  2C9C A;  3FYD A;  4L15 A;  1IY2 A;  4I8O A;  4GIP A;  4DV0 M;  3D8L A;  2JA2 A;  1IBL M;  3FKE A;  4GC5 A;  4IBI A;  5KPT A;  1UM8 A;  4NRV A;  2QBY A;  4OW0 A;  3KP1 E;  2ZBK B;  4L16 A;  4MGI E;  4QHT A;  3T15 A;  3FUV A;  1IN7 A;  4DUZ M;  3LQQ A;  3NBI A;  4JI4 M;  2CHQ A;  1IXS B;  2O5R A;  3GQ3 A;  3WHL A;  1I94 M;  4EIW A;  2FFJ A;  4MM3 B;  3UJN A;  1G59 A;  4DUY M;  3JAM S;  4KHP M;  3M6A A;  4LG2 A;  1IXZ A;  3U6L A;  4JI7 M;  4LF5 M;  4FW9 A;  2UU9 M;  1XNR M;  3RGS A;  4JYA M;  3LQR A;  2EA0 A;  4OX9 M;  4AW4 A;  4IBC A;  2BJV A;  1KSF X;  2EUC A;  3KOX E;  4RF1 A;  3IG8 A;  4DV5 M;  3R8F A;  1G3I A;  5EP2 A;  1VDD A;  1XWI A;  3VDP A;  5FTK A;  4LF8 M;  4W5W A;  1HR0 M;  3A42 A;  4MB7 A;  4LFC M;  2CHG A;  2CUZ A;  1MU5 A;  1YUB A;  4QNM A;  2QCU A;  4LF6 M;  3EIE A;  4IJF A;  3A98 B;  1L2D A;  5ITY A;  2A5Y B;  4M0W A;  4IBB A;  4X62 M;  4NXM M;  2LXE A;  3HJ8 A;  2FOI C;  4JI2 M;  2YFQ A;  2XZF A;  3PXG A;  1QZM A;  3AFH A;  1XXH A;  4YHH M;  1NY6 A;  1G4A E;  5EP1 A;  2QZ4 A;  4G4R A;  1XMQ M;  4LCB A;  5FTJ A;  3SHG B;  4FWD A;  5KO3 A;  3W0L B;  2CV2 A;  2K47 A;  3GLI B;  3LVW A;  4PDG A;  3J27 B;  2KZU A;  3GQ5 A;  2V1C A;  3FUU A;  1NNU C;  4LZZ A;  2M5Z A;  1DGF A;  3ZC7 B;  3KS4 A;  3L28 A;  4BBA A;  5FLX S;  2CHV A;  2HKJ A;  5JI3 E;  2CEA A;  4B3T M;  2W82 A;  3GPU A;  2I7N A;  3JR4 A;  3KFU G;  3I51 A;  2Z4R A;  2QP9 X;  2ZAM A;  1W5S A;  5EXT A;  5ITT A;  3L2A A;  3GRV A;  3VDU A;  2D7H A;  3JR5 A;  2X8A A;  5KQD A;  2L09 A;  2XSZ D;  2QPA A;  4RF0 A;  1TDZ A;  2L6O A;  5FSW A;  1R7R A;  4LRT A;  4IIW A;  3VK7 A;  4DV2 M;  4MGH A;  4B7F A;  3AKZ A;  3J81 S;  3HGI A;  3FTE A;  2Y0Q A;  3UGJ A;  1QAM A;  2ZAO A;  2AHM A;  2ZAN A;  4L4U A;  3U6D A;  1TH3 A;  3U60 B;  4IBK A;  4DR6 M;  1DGH B;  3U61 A;  3A46 A;  5BR8 M;  4REZ A;  3HJS A;  1N77 A;  1JQJ C;  2D7E A;  3U5Z A;  2KZS A;  3AOE C;  4AZF A;  2KW0 A;  4LJ5 A;  3SMP A;  3H4M A;  1NHG C;  4LJ8 A;  2XZU A;  1SXJ E;  3U6C A;  3FTD A;  2XLJ A;  3RFW A;  1E94 E;  4HL4 A;  2M60 A;  4AI6 A;  3TQS A;  1N32 M;  1HQY E;  2KA6 B;  5ITR A;  2CE7 A;  5FTN A;  2VQE M;  2UXD M;  2UUB M;  4PD2 A;  3ZH9 B;  4LF7 M;  3RGP A;  1DO0 A;  5LMU M;  4PDI A;  3SFZ A;  3VKG A;  2XFS A;  2YR0 A;  3DFZ A;  2R4J A;  1JR3 D;  4OVZ A;  1GLN A;  1OFI A;  4LJ9 A;  4R7G A;  5EXX A;  1IBM M;  3AV0 A;  3HU3 A;  3MHV C;  3MK6 A;  1QAN A;  4IBJ A;  1OJL A;  2R18 A;  2DWL A;  3SBJ A;  4M9S A;  1Z5C A;  1IBK M;  4JI5 M;  3TE6 A;  2EO2 A;  4LJ4 A;  2NQ8 C;  3WHK A;  1GL6 A;  3HHW A;  3HKP A;  4MGZ E;  4GKK M;  2L7H A;  4LJ6 A;  3CF2 A;  3GLF A;  4AG5 A;  2C9O A;  4XBO A;  3FYC A;  3OTO M;  2XSZ A;  4IBF A;  2DZO B;  3GP1 A;  4A3V B;  5A2Q S;  2UXB M;  3HU1 A;  4CGY B;  2FE8 A;  3AJI B;  4M9X A;  4P16 A;  3J80 S;  1KFV A;  5ITX A;  4B3M M;  4G4N A;  4D81 A;  1IY0 A;  2KXE A;  1XHB A;  4KOD A;  3SAR A;  3KP0 E;  2KRU A;  4Z6Y A;  3K2L A;  1IN4 A;  3FUX A;  3GRY A;  4LJ7 A;  4NL4 H;  3GLH A;  3TWL A;  2C98 A;  2QEN A;  2RGH A;  4KO8 A;  4G4O A;  4CHT B;  4D80 A;  4Z8X A;  5C1B A;  2C99 A;  2KRK A;  4IBG A;  5E6J A;  3FD9 A;  1Q3B A;  3QWL A;  4MH0 E;  4R3D A;  3B9P A;  1SXJ B;  3AOG A;  4DR3 M;  1N33 M;  4G4Q A;  4TUW A;  3PFI A;  3GPY A;  2G5G X;  4FVM A;  3DOA A;  5EXS A;  1EE8 A;  3QAU A;  3UMM A;  2V6Z M;  2HHH M;  8CAT A;  4QNR A;  4RNA A;  5ITQ A;  3Q8X A;  4X66 M;  4FWG A;  4MGY E;  3UK6 A;  3J7B A;  4JI1 M;  1E9S A;  2CFO A;  1JR3 A;  1TGU A;  4LGM A;  3CF6 E;  3SYK A;  5H37 D;  1NJF A;  2P5T A;  3T1H M;  3ZCB B;  1HT2 E;  4QOS A;  2F5P A;  1IQP A;  5IWA M;  2Z4S A;  3L25 A;  3U6E A;  2KEB A;  2XF3 A;  3SMS A;  2LWX A;  1ZQ9 A;  3KOY E;  3U5Z B;  2UUC M;  4GKJ M;  1GVN A;  1L1Z A;  2VII A;  3GLG B;  2UXC M;  3CF0 A;  1PJI A;  1ORY B;  1DGG A;  3VK8 A;  3KOW E;  4LZJ A;  3E4R A;  3AOE A;  1NNJ A;  3U6S A;  3M0E A;  5GKN A;  4I81 A;  3SAU A;  3D8B A;  3M7G A;  4ITQ A;  4AG6 A;  3C58 A;  4I4L A;  1C1K A;  2R62 A;  4DV7 M;  3HHZ A;  1D2N A;  4L8R C;  3THG A;  1NJG A;  3KVW A;  1LV7 A;  3CTW B;  5C18 A;  1NVM A;  1XMO M;  1QYR A;  4NOO B;  4HLQ A;  2YQZ A;  1HQC A;  2DWZ B;  3K8Z A;  2G8L A;  4X64 M;  4I5S A;  4LF9 M;  4NXN M;  4AKI A;  2QBY B;  2J7N A;  2C96 A;  3SAS A;  1IM2 A;  2HCB A;  2R45 A;  1IN8 A;  1ZAE A;  2LH0 A;  1IY1 A;  4K0K M;  5EP3 A;  3R9X B;  1HNW M;  1TDH A;  3U6Q A;  1IXR C;  4B3R M;  5FTL A;  3SAW A;  4DR2 M;  4D82 A;  5E26 A;  4LF4 M;  3ILK A;  1MX0 A;  3E9S A;  4B7H A;  1H6U A;  1PM5 A;  4JI8 M;  5KPZ A;  3GLI A;  2R46 A;  4JI0 M;  7CAT A;  4CIS A;  1T3T A;  1L1T A;  1K82 A;  2DZN B;  3FUW A;  4IBD A;  4YY3 M;  1L2B A;  4FWH A;  1SXJ C;  1HNX M;  4NRW A;  4IJE A;  2ERC A;  3VFD A;  5F3W A;  1YE9 A;  3FUT A;  1NSF A;  5JI2 E;  2DWN A;  3KOZ E;  5KQ8 A;  3IG5 A;  1R2Z A;  2C5R A;  5EJC A;  4DR1 M;  1G41 A;  3DA1 A;  4X65 M;  4MGK E;  4GRI A;  3MJ5 A;  1FNN A;  4NSO B;  3KXE C;  2RGO A;  3J2P B;  1K3W A;  4KLN A;  4B08 A;  3U60 A;  2V1U A;  4XGI A;  1DGH A;  1XXH B;  5DYG A;  3LVV A;  1N75 A;  3I4V A;  1NHW C;  3HU2 A;  4JI3 M;  3U6P A;  2F5N A;  4M0D A;  1OFH A;  2DVW B;  2LNH C;  2BJW A;  4BLC A;  1NY5 A;  1PJJ A;  4PT5 A;  1Z5B A;  1G8P A;  4GHA A;  1Q39 A;  4JN6 A;  1SXJ D;  4GIT A;  3KDS E;  1TH4 A;  3I4Y A;  4B3S M;  2DXI A;  3HHX A;  3TWM A;  1N78 A;  2H1R A;  2XH9 A;  4OU7 A;  4LJA A;  3PNY A;  2DWM A;  4FD2 A;  2OQ4 A;  4AKH A;  3A45 A;  1WXQ A;  4PCZ A;  5BPV A;  5LMN M;  1W5T A;  5ITX E;  2E5L M;  4QHS A;  3SHF A;  1L2C A;  1DGB A;  4DV6 M;  3KW6 A;  1FJG M;  4LRS A;  5EP4 A;  4BB9 A;  3VKH A;  3U6O A;  4M9Z A;  4DV1 M;  5EQT A;  3U61 B;  3TWK A;  1J5E M;  1QVR A;  5IZ7 D;  1E9R A;  2XGN A;  2VQF M;  1XNQ M;  4FCW A;  4WUR A;  5IRE B;  4JXJ A;  2HL7 A;  2Q2E B;  4GHL A;  3T1Y M;  4AKG A;  4B7G A;  2UUA M;  2XEP A;  4DV3 M;  5DYI A;  5KPR A;  2I7P A;  2DHR A;  4LY6 A;  4LGY A;  2X4A A;  3TL4 X;  3HHY A;  1XC8 A;  1GL7 A;  2OPF A;  1Q3C A;  1HNZ M;  2J7O A;  4OVZ B;  2X49 A;  3W0F A;  1R6B X;  3RE8 A;  4GMQ A;  4WW0 A;  1QAQ A;  3KSX A;  1S3S A;  4GH9 A;  3L26 A;  2F5Q A;  3HJQ A;  3GPP A;  3FTF A;  3J7A S;  2F5O A;  1N34 M;  3TPZ A;  1SXJ A;  4G6Z A;  4IBE A;  2Z3X A;  3FTC A;  5DNY A;  2F4V M;  4II7 A;  3GRR A;  3BOS A;  3T38 A;  3GLF B;  2FNA A;  4NSR A;  1TH2 A;  1Z59 A;  2CV1 A;  1IN5 A;  4LFA M;  3NWL A;  4JI6 M;  3GPX A;  1DO2 A;  1X37 A;  1IN6 A;  3VLF B;  5ITU A;  2CV0 A;  4FCV A;  4JV5 M;  4LFB M;  1HT1 E;  3L27 A;  3SAV A;  4GC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...