3J80Z

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j80Z00
2L54A 1G3TA 3WE3A 2DTRA 3MEXA 2E1NA 1RZ4A 3DXJF 1XB4A 4Z2YA 2JT1A 1ZARA 2XKOA 2Z33A 1IZ1A 3BOQA 1W7PB 2GIVA 3R61A 3EQLF 2F2EA 1H9GA 5L3BA 2KKOA 1IN5A 1ZREA 3QOPA 2XASA 3CDHA 2FEZA 1MDMB 4CICA 4ENMA 4JK1X 4LMYA 3E3VA 4OIOF 1H0MA 1UHMA 3F22A 4MTDA 1DPUA 3V7CA 4EJUA 3I64A 3LA7A 2H6CA 3QP5A 3FM3A 5H20A 2ZO4A 1ZRCA 1K78B 1USSA 3QPHA 2X0LA 1DPRA 3KZZA 4P9FA 4Q47A 1JE8A 4Y17A 2HDCA 2A69F 3MAJA 3SXYA 3RYPA 3SQNA 4FX0A 2PMUA 4HX8A 1G3SA 4RB0A 1TLHB 3BJ6A 4GCVA 2FNAA 1F9NA 4I01A 1O3TA 2J5OA 2HTJA 3SZTA 3WE2A 1Q1HA 1U5TC 3IHUA 5DD4A 3RPQA 3ULQB 4O3MA 3VOEA 3GFJA 3QPTA 3LA2A 2DT5A 4OIRF 3CO7C 1YIOA 2FMYA 1KU3A 1HBXG 5DYMA 3GO5A 2UZKA 1T6SA 3IL2A 1WWXA 4YFNF 2PEXA 2MLKA 5D8LB 2F5FA 3GZ6A 3MFKA 3GXOA 1O7LA 4IXAA 5L3GA 3B02A 1V4RA 4HW0A 1D8JA 1KYWA 3TO6A 3ECOA 1TQPA 2ZMEA 4HF0A 3J80Z 4BHBA 1FOKA 1R36A 5BOXA 5L3CA 1OMIA 5D4SA 1U5TB 3N97A 2VT2A 3DPLC 2L3DA 3V7RA 2YU3A 5E8IA 1HSTA 1UCRA 4L9VA 2B0LA 2FMLA 1S7AA 4ENNA 2HKOA 1HKQA 2RC4A 2L01A 3KEQA 4LJZF 5IT9K 1S7OA 1HSJA 1FLIA 1HKSA 1GVJA 1FBSA 1D3YA 5TRDA 1PUEE 3ABTA 1W5SA 4ETSA 1JHHA 3Q5FA 1QBJA 1J7KA 2PBIA 2H09A 5D5WB 3T5XA 1AWCA 2HZTA 1IXSB 2IP2A 3EUHA 2Z5UA 3KZYA 4KIGA 1REPC 5IT3A 2OZUA 1I27A 4LB5A 2KJCA 4U7BA 4MEXF 3KP2A 4R1HA 2HS5A 1I1GA 1MJ9A 3O3KA 3IC7A 1QQIA 3HOTA 2IVMA 3SHFA 1T38A 1EH8A 5F64A 1F5TA 3E5XA 1SFEA 2EJRA 2ESNA 4A6DA 4UNOA 2XVCA 2L4MA 1JGSA 1ZHFA 2EFNA 2NNNA 3HSRA 5KVRA 3V8JA 3FHZA 1LDKB 4MNUA 4I98B 1B59A 1TNTA 3WU1B 3P9IA 3IKTA 1FPQA 3T1BA 2IRFG 4ZYDA 1UHWA 4QLCU 4L0YB 4PGHA 2JSCA 2M45A 1JHFA 1USTA 4L9NA 5BMZA 4KFCA 3C1DA 5LHGA 2HYFA 5LEKA 1H9TA 3HUGA 1UFMA 3FMSA 5HDNA 4HX4A 2QBYB 4BQAA 2ZCWA 1U5TA 4L5IA 1YO5C 1TQIA 3WG9A 3ML6A 1MJAA 1OYYA 4G7ZF 4ZZLA 1W5TA 4ESBA 2ZNZA 1LDDA 1FBUA 4KMUX 4LG0B 1TNSA 3DP7A 1T2KA 4G94A 1CF7B 2OZ6A 4XRFA 3R60A 2IT0A 2PMHA 3BP8A 4BAYA 4LGWA 5E1ZB 3EYYA 5A2QK 2DQLA 3FZVA 3WTZA 5DCFA 5L3DA 2OAZA 4M6XA 1ZG1A 1BIBA 1SD5A 3HHHA 4M9XA 3I4PA 1TW2A 1E17A 4HYEA 2HEOA 2QQAA 4HDUA 3BWGA 3COAC 1XDSA 4IRGA 2F5DA 2JTVA 4RGSA 1J2XA 1XCVA 3QRFF 3F8NA 2H94A 4U0WA 2ZBKA 5LGUA 1ZRFA 3V4GA 2RVCA 1LEAA 3JTHA 2F5EA 4I2OA 5BQTA 1TBXA 1O7FA 1IUYA 2EV6A 1C0WA 1YLFA 3ZP5A 2IW5A 1J5YA 2EK5A 1DP7P 4D0PA 4K2EA 1LDJA 1R5GA 2ETHA 2FBKA 3BJAA 1FYMA 2ZKZA 1WQ2A 1XMKA 5ICCA 4U88A 5D6FA 1B6AA 4AVPA 4EGYA 3LAPA 1FC3A 3V7SA 2MBFA 5A2QZ 2FA5A 3TQNA 3CO6C 4DNCA 3WTVC 4A0ZA 5LGTA 3NEUA 2ZJ2A 1YTYA 1S29A 4A6EA 3FXQA 1KGSA 3E6DA 2EFWA 4OIQF 5DV5A 1HXDA 3RDIA 1ZH5A 2P6SA 3ABUA 3RKWA 3RIRA 5HOOA 5CVJA 2FRHA 2HQRA 2FBHA 4EVIA 3VB2A 2Q0OA 3N4MA 1OR7A 3CUOA 4Q48A 4Y13A 4M9ZA 5JR3A 4G7OF 3HSFA 2VE9A 2HFHA 1YW7A 3VODA 4R79A 3RTRA 3IWZA 3JTGA 2P5VA 2OQGA 2IPQX 4HOBA 4MTEA 3FMRA 4BHPA 5F1RA 5FLXK 2MC3A 3WTSC 4BHCA 2GWRA 3IRRA 1EH7A 2P6TA 4G8XA 4UV8A 3ZMUA 4IPAA 5F6FA 1J75A 2HYGD 1HW5A 1FP1D 4WX9A 2A5YB 3M9AA 4L0ZB 1ZLJA 2YX7A 4A5MA 3GX4X 2TDXA 5E18F 2NNYA 3EDPA 4EM0B 4UV9A 4GYGA 3OOPA 4YIIA 4BNCA 4CGZA 3SZPA 3LQRA 1OPCA 4KDPA 2DK8A 1R23A 4G6DA 5HS7A 2LF7A 2KIUA 3RJPA 1QGPA 4B09A 1WKMA 5FB2A 2EB7A 1OYWA 2QLZA 1QNTA 2XRNA 4MQVA 1ZGAA 2A68F 1B9NA 1P4XA 3WTXC 2J5PA 4KIFA 3GVAA 4I0AA 3R0JA 4RGUA 5D5VB 1R5HA 5DCMA 3DFGA 1I5ZA 1FX7A 3FXRA 3EYIA 2ZMEB 1S6LA 1KQ9A 2K86A 3HRSA 5ILUA 5FD5A 2FSWA 2WWYA 2DAOA 2GAUA 1FBQA 1BM9A 3I54A 2YR2A 4HAMA 4WXHA 2FNPA 3DKWA 3H92A 2PI0A 4NHJA 2LF8A 2RKHA 3RYRA 4OU0A 1O3QA 3WTUC 4IRIA 2V1UA 3LAJA 2NS0A 3HHGA 3QP6A 4UXNA 5HLHA 4S04A 4RB2C 4G7HF 2VBWA 2CO5A 2O0YA 4HA8A 3TOBA 2Z3YA 3JAMK 2Y75A 1XCBA 1WI9A 3TKYA 1K7AA 3C3WA 4LFUA 3HYIA 4LG0A 1KYZA 1GXQA 5JHUA 4A12A 2EV0A 5TJJA 2V9VA 4A0YA 2MH9A 1X3UA 2G9WA 1QO0D 1U6GA 2HKXA 5E8GA 5KK1A 5J8CA 2ZNYA 4MEYF 4WXDA 3L7WA 1L0OC 1QPMA 1XSVA 1SFXA 1SFUA 3KEOA 3TGNA 4YIFA 5K5QA 5L3EA 2HOEA 4JBAA 2QQ9A 2P5LC 5K5OA 3M8EA 2OU2A 3C7JA 3CUQB 4LD5A 4TV7A 1RI7A 4P55A 2A07F 3GFMA 4KIBA 5K1YA 2WC2A 1RIOH 4ZYEA 2ISZA 4H0EA 4WWCA 3LWFA 4PCQA 3Q9VA 2XV4S 1LB2A 4AD9A 4IJAA 2H27A 1KA8A 2O61A 3QAHA 3KCCA 2PLYA 4HDVA 5E20A 4QWQA 1YS6A 2RN7A 5ED4A 2STWA 4EJWA 4KA4A 1TW3A 2QENA 5JVTA 4WCGA 2EFQA 2QBYA 3K9TA 4BYYA 1KU7A 1HW2A 4HF1A 3JW4A 4MGRA 4UUVA 1T98A 1G3WA 4WK8F 3K69A 1ON1A 4EV0A 2D1HA 3T0YA 2R7FA 2VONA 3HRTA 2NYXA 4FT8A 1RNLA 1IW7F 4E70A 5D5UB 5FFZA 1FYLA 2YPRA 5H6RA 3MZYA 2LKPA 4U7DA 1BJAA 4N0BA 1JXSA 3ZMDA 2AXLA 2C6YA 4S05A 3DQVC 1KQ8A 1P2FA 2D1VA 4O6JA 1LVAA 3BDDA 3GFLA 1XGSA 4N9HA 1Z6TA 2K4BA 2LNBA 5DUKA 2IJLA 3C18A 3PQKA 4R8HA 1SD6A 2L02A 2IA2A 2R3SA 4RB1A 2XAJA 1KU9A 1NHAA 1RUOA 2W57A 2XAQA 1HQCA 2IA0A 3I5UA 3NQOA 3I0TA 1ZLKA 4ENJA 3E6CC 2FU4A 2P4WA 4EGZA 3S2WA 4KUMA 5ILVA 3U9GA 2GXGA 5DD8A 4KICA 3J81Z 3WGHA 3J80K 3F21A 2EA4A 3KE2A 2ISYA 1P4WA 1R22A 2QM3A 2NAZA 2JPCA 1W4MA 1O57A 1MDMA 2VOOA 5CVVA 2XIGA 3TO9A 2Z99A 5DEQA 3F23A 5HLIA 2UWMA 5DDGA 3P7NA 1Z1DA 2PQ8A 1VTNC 1FT9A 3WTTC 2A6EF 2CWEA 2CW0F 3ISPA 2XHKA 4M9SA 2DFIA 2E1CA 2DK5A 3HRMA 1DUXC 2ACJA 5LRSA 3V8KA 2E7XA 1IN6A 1R1UA 4L5JA 2OQRA 2QQBA 2Y0MA 1ZRDA 3F6OA 2V1DA 5D4RA 1GXPA 1AOYA 1ODDA 5FO5A 3DV8A 1S3JA 2O3FA 2FOKA 3RI4A 5ICFA 4CO8A 4KNYA 1TTYA 3CLOA 1J9IA 2WTEA 2BYVE 2VODA 2DO7A 3LSTA 3KLNA 3P9KA 2FQ3A 4M74A 1I1SA 5LLQA 4IF4A 1B1BA 4RGRA 1MJBA 2W84A 4AIJA 5H6QA 1Z6RA 2HGCA 1U2WA 2VXZA 2VE8A 3KETA 2Q2EA 1ONVA 4RGXA 1ULYA 4I0BA 1KQ0A 3E6MA 4N9IA 3M7GA 3K2ZA 2KRFA 3IKVA 2EFPA 2DI3A 1BC8C 1PP7U 4LK1F 2VC0A 1HW1A 1XGMA 2H6BA 3E5UA 5LRRA 1I6XA 3EETA 2GA1A 3BY6A 1ZAOA 3WU0A 3LFKA 2HR3A 4XSZF 1YQAA 2RNJA 4LLGF 2HQNA 4M72A 4M73A 4FX4A 4HX7A 3W6JB 3IWFA 1LJ9A 3KP3A 4EJOA 4F7ZA 1R00A 1A04A 1YS7A 3GW2A 3I58A 1TQMA 3DPTA 2V6CA 2L4AA 3D5LA 2RV8A 3ROUA 2CGPA 3AAFA 3WGGA 1CF7A 1G6NA 2CQKA 2M87A 2QZ8A 4P5OA 5FFXA 4KN4X 1E2XA 2XGXA 3F8FA 2DPUA 2UXXA 4EM1A 1SD7A 4RAZA 5ERIA 1EV7A 4GXOA 4M71A 3K1NA 2ESHA 3OV8A 5E1XA 5HDGA 5BPIA 1Z9CA 2DU9A 4O5VA 3M1EA 2O8XA 4XSXF 2ZXJA 1S8NA 5HLGA 1EH6A 2VC1A 4HF2A 2CG4A 3DEUA 3TDZC 3KFWX 2G7HA 4AIKA 1U3EM 3LA3A 1IAWA 3TO7A 2EV5A 1V3FA 4UVAA 3G73A 3G3ZA 4L9JA 1W7PA 1STZA 2EFOA 3ZMVA 1Z7UA 4P96A 1FSEA 3O2PE 1HKTA 1YFHA 2HTSA 3K0LA 4ESJA 3MZHA 2FE3A 4G6QA 3DF8A 5FD6A 2MD5A 2ELHA 4U0VA 3JAMZ 4AWXB 3FMQA 4HQEA 4XBFA 4UHTA 1U8RA 4KYWA 2XAGA 3I59A 2OA4A 2K27A 1U78A 5ICGA 3BROA 2JRTA 5CVRA 2LDUA 2WV0A 2GQQA 4ZYHA 2GA2A 1ON2A 2P8TA 5D6EA 3KP4A 4KN7X 4UVBA 4OIPF 2XUBA 2DLLA 1J0RA 1XN7A 5D8KB 1XSDA 2A61A 1BI3A 3F72A 3L9FA 4ON0A 1W7PD 3ZMTA 2CSOA 4ZZDA 1XDUA 3ERED 3RKYA 2RQPA 3I71A 1BI1A 1J59A 3ZQ7A 3PQJA 2RGVA 2M30A 3GF2A 2PJPA 2JZYA 2VBXA 5J6XA 3FF5A 5E1WA 1QZZA 4BXUA 2JPBA 4LLNA 3HTUA 1R58A 3L2CA 1BOAA 2KIFA 2P5KA 3O6BB 2MA3A 1PP8F 3ZPLA 3ZMSA 2V1XA 4OINF 1BI0A 4ESFA 4OMYA 1SMYF 5J8FA 2PN6A 1UB9A 2P7VB 3MQ0A 3E97A 2DQRA 1PDNC 2Z9OA 4CHUA 3HIFA 3H3UA 4LLLA 2G7UA 2QYOA 4RAYA 4UVCA 1XD7A 4RS8A 2EWNA 3GEZA 1IRGA 1R1VA 5EEGA 1LQ1A 3E5QA 3GLXA 3K1MA 1IN4A 1BBYA 3U1DA 1BI2A 1FZPB 1WRJA 4GO1A 2XAFA 3ZN0A 3KP7A 1XGNA 1BIAA 3F3XA 2A6HF 4HBLA 3ECHA 4FHTA 1Y0UA 4DQ2A 4ENKA 2CYYA 1LEBA 3J81K 3U2RA 2E7WA 2M1BA 4I02A 3WODF 5HS9A 5JI6A 1XGOA 3FM5A 5L3FA 1P6RA 1T39A 1LNWA 4YG2F 3GFIA 4OOIA 4PDKA 5K5RA 3D0SA 2BBYA 3F6VA 2XROA 3FWEA 1SMTA 4OMZA 1IN7A 3F8MA 3E6BA 1Z05A 1O3RA 2UXNA 5DCMB 3K1PA 4PGGA 2R7DA 3ELKA 4LK0F 3SFZA 3CUQC 3R0AA 4IVNA 4P9UA 2KIMA 4EJTA 2K7LA 4CXFA 3HRUA 4WXCA 4L9TA 4CYDA 1MD0A 4HQMA 1RUNA 2OBPA 1WSUA 4ASNA 2QVOA 2DBBA 1FNNA 5LGNA 5FLXZ 2FXAA 2YSRA 4Y15A 4EJVA 4AIHA 5EEHA 4MQ9F 1YG2A 2P7CB 1G3YA 4HZFA 2W25A 4WF2A 2QUFA 3VFZA 3ZMZA 2K4JA 1DDNA 1OYIA 5LHIA 1FP2A 2Q8KA 5ICEA 4PZJA 4IRHA 3BPXA 5CJ9A 1Z91A 1ZYRF 4ZYGA 4BH9A 3B73A 1FY7A 3L00A 2XAHA 3TDUC 4JQFA 3V8LA 4U0YA 1K79A 1G4DA 2EA2A 1F1ZA 1F4KA 4YFXF 2W85A 3FXUA 4GGGA 1T0FA 1IXCA 5CVIA 5DUIA 3T8RA 2A3SA 4MHGA 3HOSA 3W6KB 1K6OA 3ZN1A 2X4HA 2BV6A 4EMSA 3F8BA 2GXBA 4M6YA 4NB5A 3MWMA 5IT9Z 1OKRA 1P4AA 2AS5F 2VT3A 3Q9SA 3PFIA 4HLXA 5LBQA 3R6SA 1IXRC 2D2WA 3BPVA 2MLGA 1ZG5A 3P9CA 1YW8A 3M8FA 1IF1A 5JFRA 3GZ5A 3CUQA 4XLPF 3I59B 3WGIA 6PAXA 1YYVA 2PFBA 1MGTA 4LB6B 4KMFA 4NQWA 4EM2A 1FYKA 4L18B 3JSPA 1B4AA 5CVUA 2D45A 2ADUA 1SAXA 1K78A 2COMA 4XLNF 2BE5F 1XMAA 4GYIA 4B8XA 2BGCA 3JSOA 4CZZA 4YFKF 1ZN2A 3REOA 5AIQA 5E17F 4A5NA 3KLOA 2Y48A 3WTYC 3VEPA 2FBIA 5HVQC 3GYHX 1D5VA 1GHCA 3CJNA 4HV5A 2XKPA 2M8EA 2FF4A 2LSOA 3LQQA 3J7AO 3GWZA 3NRVA 4G9YA 5AIPA 3I53A 1R1TA 4I7HA 4Q5SF 2ZFWA 2NRAC 1L3LA 3KP6A 2OD5A 1IN8A 5CYVA 1MKMA 3KP5A 5LHHA 1P92A 4ZH4F 3QU6A 4IHTA 5AONA 2CFXA 1BC7C 5D5XB 2VBYA 5ILSA 1D8KA 1B9MA 3HSEA 1ZGJA 4KT5C 5HDKA 3RPUA 3MCZA 1CGPA 2KJBA 3WTWC 1IRFA 2K02A 5HS8A 1KU2A 3HTSB 5BPDA 5BS6A 3FX3A 1YW9A 3RKXA 4RB3C 4A0XA 2HWVA 2BEOA 4I09A 2O03A 1BN5A 3IRQA 1SD4A 2W24A 5LEJA 2DW4A 4A2UA 3TOAA 3QU3A 4Q4ZF 2DPDA 2STTA 3L09A 5CLSA 2YX4A 3T8TA 2MH2A 4HV6A 2V79A 1ZG3A 1QZYA 1FWZA 2IA1A 3CTAA 2GZWA 2QWWA 1XSXA 4IHSA 3BZ6A 1MZBA 2VBZA 2RDPA 4CDGA 2PG4A 5FGMA 1O3SA 1R7JA 3BJOA 4HLYA 4EQQA 2F5CA 3GUDA 2O6GE 2VN2A 1FSHA 2M5WA 2VOPA 3R4KA 3F8CA 3H3ZA
chains in the Genus database with same CATH superfamily
2L54A 1G3TA 3WE3A 2DTRA 3MEXA 1LE8B 1K83J 1JJ6C 2E1NA 4XRMA 1RZ4A 2WB1N 4GFBA 3DXJF 1XB4A 2XGEA 4Z2YA 2JT1A 2HXOA 1ZARA 3LSRA 1I39A 2XKOA 3RKQA 1ETVA 1ZGWA 2Z33A 2E2JJ 1IZ1A 3BOQA 1W7PB 1LFBA 2GIVA 3R61A 4NC7A 2JUCA 3EQLF 2F2EA 3KYDB 4M6VA 1FJLA 1H9GA 3BCAA 5L3BA 1AA7A 2KKOA 1TC3C 1IN5A 1ZREA 3QOPA 3OS2A 2XASA 3CDHA 5C44J 3ZQGA 3HOWJ 2E34A 2FEZA 2E71A 1K61A 1MDMB 4CICA 4PJLA 4ENMA 2K5CA 4BY1J 4JK1X 1I6HJ 4LMYA 5LD2C 2L7FP 3E3VA 3GTPJ 4OIOF 1H0MA 1UHMA 3F22A 4DZJA 3G4SI 4MTDA 1DPUA 3V7CA 4EJUA 3WHBA 3I64A 3LA7A 2H6CA 1XMXA 4RMNA 3QP5A 3FM3A 5H20A 3S93A 5E3LA 4MLOA 2ZO4A 1TWCJ 1ZRCA 5J1YA 1K78B 4HEA2 1USSA 3QPHA 3BQYA 3CCLI 1SVLA 3GLLA 2X0LA 4BEHA 2BVMA 1DPRA 3KZZA 4P9FA 4Q47A 1JE8A 4Y17A 2CRGA 2HDCA 2A69F 3MAJA 1W5CC 3LSHA 2DJIA 4G6TB 3LSKA 3SXYA 1FOXA 5LFAA 2LKXA 2EIKH 2GBYA 3RYPA 3SQNA 1PUFA 3JR9A 3LSIA 4FX0A 4XORA 2PMUA 2CS3A 2TCTA 3BZKA 3C2BA 4HX8A 5H2FC 1G3SA 1OLTA 4RB0A 1TLHB 2FUG2 3BJ6A 3BLYA 4GCVA 2IS4A 2FNAA 1F9NA 3HOUJ 4BUPA 3JCUC 4Y4RA 3K10A 4I01A 1O3TA 2J5OA 2HTJA 2WBMA 3IUOA 3OY9A 2HZDA 1TZLA 3SZTA 3WE2A 1UAAA 1FTTA 1Q1HA 1U5TC 3IHUA 5DD4A 3RPQA 3ULQB 4O3MA 3K4NA 3HB9A 3VOEA 3GFJA 3QPTA 3LA2A 4DBRA 3HBLA 2DT5A 1VFCA 4OIRF 3CO7C 1YIOA 2IS2A 2FMYA 4M3DA 1KU3A 4BDZA 1HBXG 5DYMA 3VWBA 3GO5A 2UZKA 1GV5A 1T6SA 2IGKA 3QYBA 3IL2A 1WWXA 4YFNF 2PEXA 2MLKA 5D8LB 1SVOA 1APLC 2F5FA 3GZ6A 4DIQA 3MFKA 1H89C 2NOJB 1QHGA 3GXOA 1Z7LA 1O7LA 4KITB 4IXAA 3SDGA 3K7AJ 3B02A 4XKBA 4DW6A 2BXZA 5L3GA 1V4RA 3U1KA 1SVMA 2M8GX 4HW0A 1D8JA 4N4NB 1BR4A 1KYWA 3LSGA 3TO6A 1YJWI 3ECOA 1TQPA 5GAGJ 1S7EA 4XICA 2ZMEA 5FKKA 4HF0A 1OR7C 3J80Z 2JVHA 4CUGA 4JX5A 4BHBA 1FOKA 1VNDA 5J1UA 1R36A 1FTZA 2V9PA 5BOXA 2R7SA 4A3IJ 5L3CA 1OMIA 5D4SA 1U5TB 4IEJA 2JVGA 4NDLA 3TW7A 3N97A 2VT2A 2PJRA 3DPLC 2L3DA 2OPTA 3V7RA 2YU3A 3M1CA 1D1BA 5E8IA 1HSTA 1UCRA 4L9VA 2B0LA 2NS7A 2FMLA 1TWGJ 4YIRX 2CUFA 2X6WA 4PK4A 4IL6C 2JUGA 1S7AA 4ENNA 2HKOA 1GDTA 3BTJA 1HKQA 3HGGA 1YI2I 2RC4A 2L01A 3KEQA 2XDVA 3HXLA 1WVRA 4LJZF 2WAQN 5IT9K 1N75A 1MMDA 1S7OA 3K4BA 1ZTRA 1HSJA 3GTLJ 1FLIA 1HKSA 1A31A 1GVJA 1FBSA 1D3YA 5TRDA 1PUEE 1FMVA 5DTDA 3ABTA 1W5SA 3DTIA 4ETSA 1JHHA 3Q5FA 2CJJA 1QBJA 1J7KA 2CQQA 1Y8RB 5KCMA 2PBIA 2CFOA 2H09A 2KZGA 5D5WB 5F08A 2OCCH 3T5XA 3K70C 5K7HA 3RQIA 3LOCA 1JI8A 2LOOA 5C4XJ 3ZQFA 3IH3A 1S5LC 3PFYA 3OYLA 4BXXJ 4XQFA 2L9RA 2M4GA 1AWCA 2HZTA 1IXSB 1M1EB 2IP2A 2M7BA 3EUHA 2Z5UA 1ORKA 2G0EA 2X1CA 2L9SA 2ID6A 3KZYA 3PL8A 1PJRA 4KIGA 1UG2A 2GOMA 1REPC 4HRIA 2EH3A 5IT3A 1U8BA 4RLFA 2ZXWH 1NG6A 1EF4A 2OZUA 1I27A 4LITA 1UJ8A 4LB5A 2ICWG 4W97A 2KJCA 1EKEA 3ZQCA 2L5QA 4U7BA 3BC8A 5B1AH 1HLVA 3JRAA 2LFBA 2Y2ZA 4MEXF 3KP2A 5GTIC 4R1HA 2HS5A 4II2A 1BA5A 4X1EA 1I1GA 1MJ9A 3O3KA 3IC7A 3GTGJ 3CMMA 4A3EJ 1QQIA 4XLEA 3HOTA 2IVMA 5FKOA 3SHFA 1T38A 3CP8A 2DOEA 1EH8A 2BW3B 5F64A 1JKRC 1F5TA 3E5XA 1SFEA 2VJ4A 2EJRA 2BVLA 2ESNA 4A6DA 2CUJA 1JUPA 4UNOA 3GTMJ 3ZQLA 4BJ6C 3BG5A 4E4HA 3MZ8A 2XVCA 3L2VA 2HVSA 2L4MA 1WZ2A 3HOZJ 1JGSA 1ZHFA 4C9YA 1AKHB 2EFNA 2K9NA 2NNNA 1Y6IA 4C2TA 3HSRA 2AXTC 5KVRA 1SFKA 3M07A 3V8JA 3FHZA 1Z3YA 1XG1A 2LMDA 5M3MJ 1LDKB 2DDBA 4MNUA 1T33A 1U9NA 3QPSA 1SC7A 4I98B 1B59A 1TNTA 4M3FA 5GADJ 2ZXIA 2NS8A 3P9IA 3WU1B 1RETA 3IKTA 1FPQA 4E7LA 3T1BA 1FOYA 2WY7Q 1V5GA 1DP3A 3A2KA 2IRFG 4ZYDA 1UHWA 4QLCU 4L0YB 4PGHA 2JSCA 2M45A 1JHFA 1USTA 4BQNA 4J19A 4L9NA 4B3XA 2M3AA 5BMZA 4KFCA 3C1DA 3KZIC 5LHGA 2HYFA 5EF6A 5LEKA 4LG3A 4ZDLA 1H9TA 3W6VA 3BR1A 5IYDJ 1SEUA 2L7ZA 2O5RA 3HUGA 1UFMA 2OF7A 1Y1WJ 5E79C 3FMSA 5HDNA 1WJ5A 2LBFA 4HX4A 4RLQA 2QBYB 4BQAA 1MBJA 4UB6C 2ZCWA 1U5TA 4L5IA 2JA8J 1YO5C 2D5VA 1TQIA 2YS9A 3WG9A 3ML6A 2ZC2A 4IQJA 3LL7A 3S2DJ 1MJAA 1OYYA 4G7ZF 2X6YA 4ZZLA 1W5TA 2QSGX 4ESBA 3PUFA 2ZNZA 1LDDA 3HJEA 1FBUA 4KMUX 3BG7A 3CQZJ 1YRNB 4LG0B 1TNSA 1MH4A 3DP7A 3X2QH 2JA5J 1X19A 4L5EA 2B63J 5JVGF 5E3OA 1T2KA 4G94A 3J7ZI 1CF7B 2OZ6A 4XRFA 4JOMA 4BE1A 4ZJZA 2X85A 3R60A 2CUEA 4IHYA 2IT0A 2L9NA 2PMHA 3PNTA 3CD6I 3E0JB 3BP8A 4BAYA 4LGWA 5E1ZB 3EYYA 5A2QK 3JREA 3GTQJ 2DQLA 3FZVA 1WHUA 2ECCA 4V2FA 3WTZA 2DYRH 5DCFA 3VPRA 2JA7J 1UHSA 3RCOA 3FXJA 4MFDA 5L3DA 1VI0A 2DMQA 2OAZA 4M6XA 4IHWA 1XC5A 1ZG1A 3G1LA 1BIBA 1SD5A 2ELJA 2K85A 4BQOA 4RM3A 1IDZA 1VQ9I 3O8HA 2KP6A 3HHHA 3S1NJ 5EYRA 4M9XA 2LY1A 2EIMH 1NK3P 3A01A 3I4PA 3ZRGA 1TW2A 1E17A 3VSLA 1POGA 2DA1A 4M3GA 4KJZA 4HYEA 2HEOA 1WGXA 3FXOA 4C2MJ 2QQAA 4HDUA 2E35A 2LLKA 3BWGA 3COAC 1QU3A 2GIZA 1XDSA 3PNYA 4IRGA 2F5DA 2BY1A 2JTVA 4RGSA 2DA5A 2LY9A 1J2XA 4IOCF 2VPRA 5KAIC 2JN6A 3B6CA 3QOEA 4F52A 3HL2A 1XCVA 3QRFF 4Y52J 3F8NA 2H94A 4U0WA 4XLCA 2ZBKA 3HPHA 5LGUA 1ZRFA 3V4GA 2RVCA 1LEAA 1U9OA 3PSIA 1VQNI 3JTHA 2F5EA 1HDDC 3A03A 3IV5A 4I2OA 5BQTA 3MMYB 1TBXA 1Z67A 1O7FA 1IUYA 2EV6A 2LP0A 3C2HA 1C0WA 3ZOBA 5BNGA 1MSFC 1YLFA 3L1PA 4X0GA 3ZP5A 1OFCX 1WJDA 2IW5A 1S72I 3EUHC 1J5YA 3BQZA 2JMWA 2EK5A 1DP7P 1TWHJ 4D0PA 4K2EA 1LDJA 3HGYA 2ZJRF 1R5GA 2ETHA 2FBKA 3BJAA 5DS9A 1FYMA 2ZKZA 3HDDA 4A3LJ 1WQ2A 1XMKA 2KL4A 5ICCA 3M4OJ 3TL4X 4U88A 5D6FA 1B6AA 2HQAA 4AVPA 4EGYA 3LAPA 1FC3A 2AO9A 3OIQA 4ITVA 1ENHA 3V7SA 1YE9A 3O8GA 2MBFA 3QODA 5A2QZ 3CDLA 3WHCA 2FA5A 4GDFA 1ETXA 2VQCA 3TQNA 3CO6C 3ZQHA 4DNCA 3WTVC 2IGOA 4A0ZA 5LGTA 3NEUA 2ZJ2A 2VPLA 4PSXA 4CCJA 1YTYA 1S29A 5IYCJ 4A6EA 1SANA 2Z1DA 4RAGA 3FXQA 2I5UA 4B44A 1KGSA 3E6DA 2EFWA 3EPZA 4XLAA 4OIQF 5DV5A 1HXDA 3RDIA 4N4OB 1ZH5A 2P6SA 3VYUB 2HDWA 4BBSJ 2YUSA 5EG0B 2IS1A 3BG6A 4PSWA 1R4NB 3ABUA 3RKWA 3RIRA 5HOOA 5CVJA 5J47A 2KMUA 2FRHA 2HQRA 2MC4A 1HOMA 2DA2A 2KISA 2FBHA 4FE4A 3K4KA 3SZGA 3H35A 4LIVA 4EVIA 1Z3XA 2VASA 1X1AA 3VB2A 1NTCA 2Q0OA 4CCLA 3N4MA 2KT0A 1OR7A 1X1DA 3CUOA 2KZVA 2Y9YA 2A5WA 2IAIA 4Q48A 4M9ZA 4Y13A 5JR3A 2QA4I 4G7OF 3HSFA 2VE9A 4FTHA 5GTHC 2HFHA 1YW7A 2W82A 2ZJPF 3VODA 3Q0VA 3S3NA 3AG4H 1WJBA 2F48A 1T95A 4R79A 3RTRA 3G1OA 2OJED 3IWZA 3H5NA 3CCEI 5JHFA 2F4OB 3NARA 3C2GA 3JTGA 2P5VA 3DBRB 3JRHA 2OQGA 3I9V2 2CV1A 4A3JJ 3CMEI 2IPQX 3W2WA 4HOBA 4MTEA 3FMRA 3W3CA 2M7AA 3CLQA 1G59A 4BHPA 5F1RA 3S2HJ 5FLXK 5M5XJ 2MC3A 3WTSC 4KT6A 4BHCA 1WH7A 3A01B 1OCZH 2GWRA 4RM2A 3IRRA 1WPKA 2XRLA 2EINH 1EH7A 1LVKA 2XGCA 3OYKA 1B8IB 2P6TA 1AHDP 3OOUA 4G8XA 3V42A 4DJAA 4U87A 4UV8A 1W1WE 4S0HB 3ZMUA 4IPAA 1YX5A 5F6FA 1J75A 1MSEC 2HYGD 2JQ7A 1HW5A 1FP1D 1XX5A 4WX9A 3VDXA 1R49A 2A5YB 2X1DA 3M9AA 4L0ZB 1ZLJA 2YX7A 2ZMEC 1BR1A 4A5MA 1P9QC 3GX4X 2TDXA 2VL8A 3BG9A 5F04A 5E18F 2NNYA 4C2UA 3EDPA 4EM0B 4UV9A 4GYGA 3OOPA 2DA6A 1JKPC 4YIIA 4BNCA 4CGZA 3RZOJ 3QPLA 3SZPA 3GTOJ 3CZ6A 1YITI 2HOSA 3LQRA 1Y0NA 1D1CA 1OPCA 1VQ8I 1Y8QB 4KDPA 2DK8A 1R23A 2BHZA 2NOGA 4G6DA 1WJAA 1D0YA 1X58A 5IP7J 4BE2A 5HS7A 2LF7A 3RSNA 1Y39A 1X1BA 2KIUA 3RJPA 5FKMA 1QGPA 1X2MA 4FE7A 4B09A 2DFEA 1WKMA 5FB2A 4AYBN 2EB7A 2A05A 1OYWA 2F6CA 3FK6A 3FXKA 2QLZA 1QNTA 3A0HC 4UY8I 3CF5F 2XRNA 2BW3A 4MQVA 4E6KG 1ZGAA 2A68F 4A3DJ 3AG2H 1B9NA 2W4SA 1P4XA 3WTXC 2J5PA 2ZB9A 4KIFA 1WJFA 2M2EA 3OYDA 3GVAA 4I0AA 3R0JA 4RGUA 1GVDA 2LYCA 1HDPA 5D5VB 2QQ8A 3CCVI 1R5HA 5DCMA 1EA3A 3DFGA 2R92J 1I5ZA 3CCUI 1FX7A 4CSWA 3FXRA 3EYIA 2ZMEB 2OTJI 1S6LA 5DM7F 2DDAA 4XK4A 1KQ9A 4AM3A 2FX0A 2K86A 2K9QA 3HRSA 5ILUA 5FD5A 3CCSI 2FSWA 2WWYA 2DAOA 2GAUA 1FBQA 2KLOA 3GBGA 2JA6J 1BM9A 3I54A 3K4CA 3VYRB 2YR2A 4HAMA 4MIMA 4WXHA 4FASD 2FNPA 4HSRA 3DKWA 3H92A 5FLVA 2PI0A 4NHJA 3A1YA 2LF8A 2RKHA 3RYRA 4OU0A 1O3QA 1MMNA 3WTUC 4IRIA 2RQQA 1G2HA 1KZHA 2V1UA 2VKHA 2NS0A 3HHGA 3QP6A 4UXNA 5HLHA 4S04A 3LAJA 1DU0A 3EUKL 4RB2C 2R7WA 3E1SA 3ZCOA 4G7HF 2VBWA 1T8IA 2CO5A 2O0YA 4V19K 3E7LA 3QQAA 5IPAA 5J4VA 4HA8A 3TOBA 3OSFA 2CV2A 2P81A 1V5EA 2Z3YA 4I76A 3JAMK 1A6IA 2WA0A 2Y75A 1XCBA 1WI9A 3TKYA 4XONA 1UMQA 1VQKI 1K7AA 3C3WA 4LFUA 2X6OA 3HYIA 2O8KA 3FBNB 2IS6A 3OWTA 4LG0A 1YRNA 1KYZA 4G12A 1O4XA 4II3A 1X1CA 1J09A 1VF9A 1GXQA 5JHUA 4A12A 2HOAA 2EV0A 5TJJA 2V9VA 2CMPA 2VQGA 4A0YA 2MH9A 1MNEA 2KDZA 1X3UA 3BTLA 2G9WA 1QO0D 1U6GA 2HKXA 4IX7A 4JP0A 3GMEA 5E8GA 5IP9J 4Y33A 2WADA 3VSKA 2Y0SA 1SAUA 4V2GA 5KK1A 5J8CA 2ZNYA 3CP2A 4MEYF 3FDYA 2XC7A 4WXDA 4F91B 3QYFA 3L7WA 1DGRM 2VUMJ 1MMAA 1L0OC 3HOXJ 2K9LA 4HNVA 5TISC 1WCMJ 3HM5A 1DGWY 1QPMA 1XSVA 2HPIA 1X3WB 1OJLA 1SFXA 4M3EA 1SFUA 2XF5A 5CQEA 3KEOA 3H3VK 3TGNA 4YIFA 5K5QA 3PSFA 5L3EA 3IP4B 2HOEA 4JBAA 3ABMH 1MBEA 2JRMA 2QQ9A 2P5LC 5K5OA 3LSJA 3M8EA 2OU2A 2ELKA 4XKVA 3C7JA 3CUQB 4YELA 2H1KA 4LD5A 2E1OA 2LC2A 2M4KA 4TV7A 4BQQA 1IUFA 1RI7A 4P55A 2A07F 3GFMA 3G1MA 4KIBA 2X6XA 5K1YA 1ZR4A 2WC2A 3AL0B 5JLXA 2EZHA 1RIOH 1W36C 4ZYEA 2ISZA 4AYBA 3CJQB 4H0EA 4XLHA 2R7QA 5F1JA 4NQWB 4WWCA 3L2UA 1ERDA 5IOZA 3LWFA 2EPFA 4PCQA 3Q9VA 4QPQA 4DOZA 2XV4S 3OL3A 1LB2A 3I4NJ 4AD9A 2R0QC 4W1UA 3ABKH 4XLFA 4IJAA 1MW7A 5EZHA 3H36A 2H27A 1KA8A 1ACIA 3DBHB 1V54H 2O61A 3QAHA 3KCCA 2PLYA 2XPWA 1D5YA 1ZK8A 3K6GA 4HDVA 1IRZA 5E20A 1U0JA 4QWQA 3VYTB 4RDUA 3CCRI 1YS6A 2RN7A 4XN0A 5KHDA 5ED4A 2STWA 2CQNA 1OCCH 4EJWA 4KA4A 1DQUA 2JJ7A 2VKVA 2WY8Q 1TW3A 2QENA 1R71A 5JVTA 1TP4A 4WCGA 2EFQA 4XRSA 2QBYA 5B66C 2RREA 4D7MA 2R5YA 1YJ9I 3K9TA 4BYYA 2MYSA 3CCMI 1KU7A 1RKWA 1HW2A 4HF1A 2XPUA 2W1OA 3CJTB 3JW4A 4MGRA 4F3QA 3H0DA 2DMUA 1VZ0A 4UUVA 1T98A 1G3WA 4WK8F 3K69A 3OL4A 1ON1A 4EV0A 2D1HA 2A6TA 3T0YA 5FROA 3OYGA 1LFUP 2R7FA 3SFIA 2XB5A 2VONA 3HRTA 2KRCA 3CCYA 3F0CA 2NYXA 4FT8A 1RNLA 1S9HA 4A3KJ 1IW7F 4E70A 5D5UB 5FFZA 1FYLA 3OMYA 2YPRA 5H6RA 3MZYA 2LKPA 1ETQA 5EEAA 4U7DA 1BJAA 4BE0A 4N0BA 2GXAA 1JXSA 2CU7A 1JJ8C 3ZMDA 2AXLA 2C6YA 4RA2A 4S05A 3DQVC 2PJRB 1KQ8A 1P2FA 2D1VA 1VQ6I 1Y1VJ 4O6JA 3NWSA 4B48A 2R7OA 2L7MP 1LVAA 4YEJA 2I8DA 3I3LA 4D7NA 3BDDA 3H1CA 3GFLA 4JYKA 1XGSA 1ETYA 4N9HA 1Z6TA 4NBQA 2LD5A 2EIJH 2K4BA 4OAZA 1LKXA 2LNBA 5DUKA 1BW5A 1IGNA 2IJLA 3C18A 3PQKA 4AIDA 4IO9F 3RZDJ 2V1NA 3K4MA 4R8HA 2XGDA 1SD6A 2L02A 2F4IA 2IA2A 2R3SA 2KPMA 4RB1A 2XAJA 1I50J 1KU9A 1VQ7I 4HSTA 1HC8A 1NHAA 2HQ5A 4NC6A 3TBIA 1HCRA 1RUOA 2W57A 4QTRA 1TT0A 2XAQA 2JK3A 1GV2A 1HQCA 2IA0A 3I5UA 3DEEA 3NQOA 4CZCA 2GLOA 3I0TA 2KRHA 1ZLKA 4NUBA 4LOCA 2HDDA 4ENJA 3E6CC 2FU4A 2P4WA 1JTYA 4EGZA 2XPVA 1Z0XA 3S2WA 3S3OA 4KUMA 5ILVA 4XR6A 4ZDOA 3U9GA 4QSHA 2GXGA 2QSHX 1F36A 2WV1A 4DZPA 1RKTA 5DD8A 4KICA 3J81Z 1RC9A 2IGMA 3WGHA 3J80K 3JRGA 3F21A 2EA4A 2P0WA 1IO2A 3KE2A 4NNJA 3BR0A 2L9VA 2ISYA 1P4WA 1R22A 1AU7A 2QM3A 2NAZA 2VB6A 2JPCA 3CMYA 1W4MA 1B72B 1BJZA 4EATA 2HYJA 5EDNA 3H9QA 1D1AA 2JSPA 1O57A 1MDMA 2VOOA 3HOVJ 5CVVA 2XIGA 1W0TA 3TO9A 2Z99A 3HKZN 4XIDA 5DEQA 3F23A 5HLIA 3BT9A 3JRCA 5F27A 1Q1VA 2UWMA 4ZTJA 4DYCA 5DDGA 3P7NA 1Z1DA 2PQ8A 3BTCA 1VTNC 1FT9A 2K3PA 3WTTC 5J1RA 3CCQI 2A6EF 2CWEA 3OSGA 3OYBA 2QEXI 2CW0F 3PUBA 2K3FA 2E1MC 4EEFG 3ISPA 2XHKA 5HNHA 2Z2SB 5K7FA 2LRDA 4M9SA 2LY2A 2DFIA 1E0EA 1MNMC 2XAUA 1NG7A 2L2OA 1Z77A 2E5NA 2LBFB 4BEHB 2E1CA 2DK5A 3HRMA 1RRJA 1DUXC 2ACJA 5LRSA 2VLAA 3CDIA 3IAM2 3GTJJ 3V8KA 2E7XA 5KNLA 1IN6A 1R1UA 4L5JA 5FLMJ 3BR3A 2DMTA 2OQRA 2QQBA 2COBA 2Y0MA 4M3BA 1ZRDA 3F6OA 2MFZA 2ZSIB 2R5ZB 4A3MJ 2V1DA 1VQMI 3OYMA 5D4RA 1GXPA 2DOFA 1AOYA 1ODDA 5FO5A 3DV8A 2DODA 1S3JA 1ZELA 2LK2A 2O3FA 2FOKA 1R6RA 3RI4A 4CA0A 1XS9A 2V26A 5ICFA 4CO8A 2XSDC 2IGNA 3MN2A 5GPAA 2EZKA 1VQ5I 4KNYA 1TTYA 3CLOA 2IXSA 2K9MA 3A4CA 1J9IA 2ZXHA 2WTEA 2BYVE 2QF7A 2VODA 2DO7A 2L7KA 4JX4A 3LSTA 3KLNA 3OIPA 2E2HJ 2NVYJ 3P9KA 2FQ3A 4M74A 3U21A 2VJJA 1B72A 1I1SA 3J7YJ 5EGOA 1YIJI 1BW6A 3PJRA 1IV8A 3CCJI 1OQYA 1IDYA 2K9SA 3DPUA 3DKYA 5LLQA 2DJNA 4IF4A 3N05A 1B1BA 4RGRA 1MJBA 2NXNB 2CQ7A 2W84A 4AIJA 5H6QA 1Z6RA 2HGCA 1OCOH 1AKHA 1U2WA 2VXZA 3WG7H 3OS1A 1KONA 2VE8A 3KETA 2Q2EA 1MBGA 1OISA 1ONVA 4PJMA 4RGXA 1ULYA 1V5FA 4I0BA 2R93J 1H88C 1KQ0A 3E6MA 4N9IA 3M7GA 2LVSA 3K2ZA 2LG4A 2KRFA 3IKVA 2EFPA 2XF7A 2Y31A 3FXLA 2DI3A 3HC7A 3HKZA 1BC8C 2HOTA 2E5ZA 4CCOA 4XL9A 1PP7U 4LK1F 4KISA 2VC0A 3OS0A 1HW1A 2CW7A 1XGMA 2H6BA 3E5UA 5LRRA 1OCRH 2MW8A 3PIOF 1I6XA 4Z6YA 4HG2A 3EETA 2GA1A 1TL8A 3BY6A 2Q2EB 2Y30A 1N78A 4UUTA 4CYCA 1ZAOA 1JUSA 2EILH 3WU0A 5EJCA 3LFKA 2HR3A 2LTPA 4XSZF 2ZJQF 2ID3A 4IZZA 1YQAA 2RNJA 2Y0SN 4LLGF 2CQXA 1Y56A 2HQNA 4M72A 4M73A 4FX4A 4HX7A 3W6JB 3IWFA 4CCKA 1LJ9A 3KP3A 2HXIA 4EJOA 4F7ZA 4A3CJ 4D9JA 1R00A 4B1RA 1A04A 3RQ4A 4QIWN 1VQOI 1MMSA 1YS7A 1YHQI 3GW2A 3I58A 5EGOB 1TQMA 3DPTA 2NVUB 2V6CA 2L4AA 3D5LA 4J00A 3MD2A 1ETKA 2EBIA 2RV8A 4PJ0C 3ROUA 5E3NA 3AAFA 1NH3A 2CGPA 3WGGA 1CF7A 4LIUA 4PFPA 1G6NA 4XNFA 5M5YJ 2CQKA 2M87A 2QZ8A 4P5OA 5E3MA 2R4GA 2MGQA 3L2RA 1LUJB 5FFXA 5M3FJ 4KN4X 3TP0A 4XKWA 2TRTA 4CH7A 1E2XA 2XGXA 2HPMA 1T0FC 3F8FA 2DPUA 3OYHA 3K4JA 3KYLA 2UXXA 4EM1A 3ZGKA 2R7RA 2NVXJ 1GLNA 3L2WA 4XN3A 5FKLA 1SD7A 4RAZA 5ERIA 1HF0A 4UB8C 1EV7A 2R5YB 1EJ9A 4GXOA 4M71A 2HVRA 3K1NA 2ESHA 5F0CA 3OV8A 5E1XA 5HDGA 3MKYB 1A36A 2R7UA 5BPIA 2X48A 1Z9CA 2M0CA 5EG0A 2R5ZA 2DU9A 2CV0A 4O5VA 2HI3A 1P7IA 3M1EA 2Y69H 2O8XA 4XSXF 1PYVA 2ZXJA 1S8NA 2WAQA 2QSFX 3KIOA 3RPUD 1XTAA 5HLGA 3BR2A 4BGDA 1EH6A 2VC1A 2KFDA 3ONQA 4HF2A 1JKOC 2CG4A 2LREA 4ZDPA 3DEUA 3TDZC 2BY2A 2E1MB 2FOWA 2QKLB 4PFOA 3KFWX 2G7HA 4XM3A 2GOXB 4AIKA 4P1WA 1U3EM 5EZGA 3BTIA 4D5CA 2E60A 2WAFA 1K6YA 3LA3A 3CC4I 1ETOA 3H0GJ 1IAWA 3LMMA 3TO7A 3S3MA 1JUMA 3TP3A 1UELB 1H8AC 3L2QA 2EV5A 2X9DA 3GCMA 4E7HA 4IHVA 5IP6A 1JKQC 1V3FA 4UVAA 3JRDA 3G73A 3G3ZA 4L9JA 1W7PA 1STZA 2EFOA 1I3AA 4J01A 3DKXA 4B47A 3Q0WA 3ZMVA 1NK2P 3H5AA 4B3AA 2M9HA 1V55H 3CF2A 2M34A 1Z7UA 2OCEA 4BS9A 1JTXA 2IBDA 1FSEA 3B6AA 4P96A 4A3FJ 2DMNA 4BACA 3O2PE 1HKTA 1YFHA 2HTSA 3K0LA 4ESJA 3MZHA 2FE3A 1UZCA 4C3HJ 4G6QA 1QVUA 3DF8A 2AHQA 2WAEA 1BR2A 5FD6A 2JA2A 2MD5A 1SFOJ 2V4JC 3H5RA 2ELHA 4U0VA 3DTKA 1IRXA 3JAMZ 1R9TJ 1VQPI 5IYBJ 4AWXB 3FMQA 5GAHJ 3S17J 4HQEA 4HPQA 4XBFA 4UHTA 1U8RA 3DLAA 4KYWA 2VJ5A 2XAGA 1QA6A 4UUSA 2B7EA 3I59A 2MABA 3FHNA 2OA4A 2K27A 3PM1A 1U78A 2X51A 5ICGA 2H1LA 3KPHA 3BROA 2JRTA 3LFUA 1BOBA 4D5FA 5CVRA 2LDUA 2WV0A 2GQQA 4ZYHA 5IY5H 5M5WJ 2GA2A 2L0KA 1ON2A 2V7FA 2P8TA 3FK7A 2MG4A 3BG3A 5D6EA 2PX9A 2AQEA 4BJ5C 4XKCA 3KP4A 4KN7X 4UVBA 4OIPF 2JWTA 5DM6F 3UR3C 2O7OA 2DA7A 2XUBA 2DLLA 3HOYJ 1J0RA 1GUUA 1XN7A 4E7SA 5D8KB 3CESA 2R7TA 2A61A 3F72A 1BI3A 3L9FA 1RR7A 2VXDA 3JRIA 1XSDA 4ON0A 3ASNH 4ZYAA 1W7PD 3ZMTA 4IOAF 1FMWA 2XB0X 3CJRB 2CSOA 3EUAA 1Z21A 4ZZDA 3DWLE 3PO3J 1XDUA 1T56A 3ERED 3TMOA 3RKYA 2RQPA 3KEYA 2VIXA 3I71A 1BI1A 3W2VA 1J59A 3ZQ7A 4CYCB 3PQJA 4Y7NJ 5B3SH 3OYIA 1MMGA 1LE8A 2BZTA 2RGVA 4QPOA 2M30A 3GF2A 2PJPA 2JZYA 2VBXA 1YOVB 3AKZA 2PMZN 1D0ZA 1RESA 5J6XA 3BR6A 2DTZA 3FF5A 5E1WA 1QZZA 4BXUA 1X3ZB 2JPBA 4LLNA 3MKWB 1TWFJ 3HTUA 1R58A 3L2CA 1PUFB 1BOAA 2KIFA 2P5KA 3O6BB 2QGUA 1X4PA 2CW8A 3KYCB 4I99C 2F5VA 2MA3A 1PP8F 1ZR2A 3ZPLA 3AL0C 3ZMSA 1A6QA 2V1XA 4OINF 1BI0A 1MNDA 1R4MB 4CCMA 4ESFA 4I6ZA 1HA8A 4OMYA 1SMYF 3GZNB 2DT6A 1G8XA 1JT0A 1MIJA 5J8FA 2PN6A 3ESWB 1UB9A 3W2AA 4AC0A 2P7VB 4BBRJ 3OIOA 4PJJA 2LH9A 3MQ0A 2DA4A 3E97A 3AG1H 2BY3A 1A5JA 2DQRA 1MBFA 2RAEA 1PDNC 2ME6A 3UKGA 2Z9OA 4CHUA 3WU2C 2MSYA 3HIFA 3SJMA 2FJ1A 3H3UA 4LLLA 2G7UA 2QYOA 4RAYA 4UVCA 1XD7A 3MVPA 4RS8A 2CUZA 2EWNA 3GEZA 1IRGA 1R1VA 5EEGA 1LQ1A 3E5QA 3GLXA 3K1MA 1IN4A 3TEDA 1BBYA 4C30A 3U1DA 3D1NI 1QRYA 5K7ZA 2H8RA 3OYEA 1BI2A 3P5JA 1FZPB 1WRJA 3FISA 4GO1A 1MH3A 3CC2I 2XAFA 3ZN0A 3KP7A 1XGNA 1YX3A 3AG3H 2VQHA 1BIAA 3F3XA 2A6HF 1DU6A 4HBLA 3ECHA 4FHTA 1Y0UA 4DQ2A 5CPRB 1OCPA 4ENKA 2VJIA 3LNQA 2CYYA 2DFHA 2BOLA 1K4TA 1LEBA 3J81K 2WB1A 1VQ4I 3PNVA 3U2RA 5GPCA 2VKDA 2E7WA 5HLTA 3J7AY 2M1BA 3OYNA 3A02A 4BU2A 2DFFA 4I02A 2B9SA 2OTLI 3WODF 5HS9A 5JI6A 1XGOA 3FM5A 1QHHD 5KAFC 5L3FA 1P6RA 2LKSA 1D0XA 1T39A 1LNWA 1X4OA 4YG2F 3GFIA 4F92B 1QZEA 3JRBA 4OOIA 3S1QJ 4PDKA 5K5RA 3D0SA 2BBYA 3F6VA 1MBHA 3VYSB 1WJCA 1X2NA 2FD5A 2XROA 3FWEA 1A35A 4IQ4A 1X1PA 2DCEA 1SMTA 4D1QA 4OMZA 1FIPA 1IN7A 4BKXA 3DBLB 4FCYA 3F8MA 3MKLA 2DMPA 3E6BA 1Z05A 1O3RA 2UXNA 5DCMB 3K1PA 4PGGA 2R7DA 3ELKA 3DU6A 4LK0F 4MO7A 2DYSH 2Y9ZA 3SFZA 3S8PA 3CUQC 3R0AA 4IVNA 3OR1C 4P9UA 2E19A 1E3HA 4AVZA 2KIMA 3DU5A 4DBQA 1E3PA 4A3GJ 2VKEA 3S1MJ 2X1EA 4EJTA 3BCBA 3OYFA 1N25A 2K7LA 4CXFA 3HRUA 4WXCA 2ME0A 4L9TA 4CYDA 1MD0A 1P7JA 3H9JA 4HQMA 1RUNA 3S14J 2OBPA 1WSUA 4BJTA 2OV7A 4ASNA 3ERMA 2QVOA 2DBBA 1FNNA 5B5EC 5LGNA 5FLXZ 2FXAA 2W48A 1YJNI 2YSRA 3S16J 4Y15A 4EJVA 4AIHA 5EEHA 4MQ9F 1YG2A 1GT0C 2P7CB 1G3YA 4BDYA 2QKMB 4HZFA 2W25A 4UUSB 4NC8A 4WF2A 2QUFA 3VFZA 4DYQA 3ZMZA 3ZQQA 2K4JA 2F4MB 2Z16A 4BXFA 1DDNA 1OYIA 5LHIA 1ETWA 2M0MA 1QVTA 5FRMA 4ZC3A 2ZSHB 1FP2A 2EZIA 2Q8KA 4ZTFA 3M8JA 5ICEA 1IG7A 4PZJA 3SEQA 4IRHA 3BPXA 5CJ9A 1Z91A 1ZYRF 4ZYGA 2KHMA 5TGTA 4BH9A 1PVEA 3B73A 1FY7A 2W7NA 3L00A 2XAHA 3TDUC 4JQFA 3BZCA 3V8LA 4U0YA 3K70D 3M3YJ 5F0HA 4HNUA 5JLWA 1K79A 5J3LA 1G4DA 2EA2A 3IH2A 1F1ZA 5HODA 1JGGA 2KQRA 1F4KA 4YFXF 2XF6A 2OUMA 2W85A 3FXUA 4GGGA 4PJNA 4OAYA 1T0FA 1IXCA 5CVIA 5DUIA 1WI3A 5HNFA 3T8RA 2YU9J 3TW6A 2A3SA 4X6AJ 4MHGA 1ITYA 2EZLA 3HOSA 3W6KB 1K6OA 3ZN1A 4E7IA 2HVQA 2X4HA 2BV6A 4Y3OA 1K4SA 4EMSA 1OCTC 3F8BA 2GXBA 4PUSA 4M6YA 4NB5A 3MWMA 5IT9Z 1OKRA 4E7KA 1P4AA 2AS5F 2CH0A 2VT3A 3Q9SA 3PFIA 4HLXA 2IEKA 5GP9A 5LBQA 3R6SA 4GRIA 1IXRC 2D2WA 3BPVA 5FJ8J 2V6EA 3A0BC 2R7ZJ 2MLGA 4IKFA 2R7XA 1ZG5A 4B4CA 3P9CA 1YW8A 3M8FA 1IF1A 5JFRA 1B8IA 3GZ5A 3CUQA 4XLPF 3I59B 2EQRA 3S1RJ 1CQTA 4E7ZA 3ABLH 3WGIA 6PAXA 1F43A 1YYVA 1IJWC 2BHYA 2RNGA 1T08B 2PFBA 1MGTA 3D5RC 3S32A 4LB6B 4H4KC 4KMFA 2K40A 3H9GA 3SDBA 3NAUA 4NQWA 1VQLI 4EM2A 1FYKA 3HEFA 4L18B 2KDOA 2H8WA 1B4AA 4FQGA 3JSPA 4RAFA 2ECBA 2UV1A 5CVUA 2D45A 2R7VA 2ADUA 5J4YA 3G2BA 1SAXA 1E3OC 1FEXA 1K78A 2COMA 4XLNF 1JT6A 4JX6A 3DCFA 3OR2C 2BE5F 4E7JA 3S15J 2FQ4A 1XMAA 2ZFUA 4GYIA 4B8XA 2BGCA 3OYJA 2Q1ZB 3JSOA 4CZZA 4YFKF 3CMAI 1ZN2A 2W00A 1I3QJ 3REOA 4XOPA 4RBOA 5AIQA 5E17F 2I10A 4A5NA 3KLOA 2MD0A 5CQGA 2Y48A 3WTYC 2DA3A 3VEPA 4YRVA 2FBIA 4HNTA 5HVQC 4C3IJ 3PIPF 3GYHX 1D5VA 4DYRA 1GHCA 4C3JJ 3K4LA 3CJNA 4HV5A 2XKPA 3ZR8X 1WH5A 1FOWA 2VI6A 3SEZA 5CKTA 2KIQA 2M8EA 2VQLA 2V9KA 2FF4A 2LSOA 3LQQA 2HU9A 3J7AO 1LFPA 3KX2A 3GWZA 3NRVA 4G9YA 5FKNA 5AIPA 4F93B 3OYAA 3I53A 1R1TA 4I7HA 1LPQA 4Q5SF 2ZFWA 2NRAC 1L3LA 3BR5A 3KP6A 2OD5A 1W36D 1QPIA 5C4JJ 1IN8A 5CYVA 3I55I 1MKMA 3FKJA 3KP5A 1P92A 5LHHA 2DOAA 2DXIA 4A3BJ 3LSPA 4ZH4F 3QU6A 4IHTA 5AONA 3GTKJ 3DLLF 3ZXSA 3SYTA 2AQFA 2CFXA 1BC7C 4BY7J 2QCOA 5D5XB 1BL0A 9ANTA 2VBYA 1N77A 5ILSA 3MKZA 3PO2J 2PMZA 1D8KA 2OC6A 1B9MA 3K2AA 3QYEA 2DT7B 3HSEA 1ZGJA 4KT5C 5HDKA 2UUZA 2GM4A 1WFXA 3LSMA 3RPUA 4AU7A 1RPWA 3MCZA 1CGPA 4AUXA 3FXMA 2KJBA 3WTWC 3FBIB 1IRFA 1ZQ3P 4IHXA 2K02A 5GAEJ 5HS8A 1KU2A 3JRFA 3HTSB 4XMYA 5BPDA 3ASOH 4DGWB 5FRNA 5BS6A 5IOYA 3FX3A 1YW9A 4FETA 3RKXA 2XSJC 3DEWA 1IV6A 3ZQIA 3I4MJ 4OWRB 4RB3C 1TWAJ 3NWTA 2E36A 4A0XA 2HWVA 4A69C 4ABZA 4A93J 2E2IJ 2BEOA 1ZKGA 4I09A 2O03A 1TT5B 3FIWA 1BN5A 4MFEA 3IRQA 1SD4A 1MBKA 2W24A 3HUGB 2DW4A 5F0FA 4A2UA 5LEJA 3TOAA 1UG0A 3QU3A 2N8GA 3Q0UA 5J40A 4Q4ZF 4XOTA 3QWLA 2DPDA 2STTA 3L09A 5CLSA 1XPXA 2YX4A 3HZJA 3UNGC 4B43A 3HPGA 3T8TA 2MH2A 3IAS2 3IH4A 4CCNA 4HV6A 2V79A 1ZG3A 1QZYA 2HNHA 1FWZA 3G71I 3CTAA 2IA1A 2GZWA 3F9KA 2QWWA 1W0UA 4BL0B 2DN0A 3DTEA 1XSXA 4IHSA 3BZ6A 3OYCA 3CC7I 5C3EJ 1MZBA 2O9LA 2VBZA 3AFHA 3HG9A 2RDPA 1R5ID 3FKIJ 4CDGA 2PG4A 4F55A 5FGMA 1O3SA 2NVQJ 1R7JA 4XRSG 3BJOA 3D5SC 4HLYA 2BXYA 4EQQA 1IC8A 2F5CA 3GUDA 2O6GE 2VN2A 2NVTJ 1FSHA 4FISA 1WJEA 1FIAA 2LR8A 2M5WA 5B1BH 3I56I 1RR8C 2VOPA 2BY0A 3Q3SA 3G6EI 3R4KA 3F8CA 4ANJA 3H3ZA
chains in the Genus database with same CATH topology
2L54A 1G3TA 3WE3A 2DTRA 3MEXA 2E1NA 1RZ4A 3DXJF 1XB4A 4Z2YA 2JT1A 1ZARA 2XKOA 2Z33A 1IZ1A 3BOQA 1W7PB 2GIVA 3R61A 3EQLF 2F2EA 1H9GA 5L3BA 2KKOA 1IN5A 1ZREA 3QOPA 2XASA 3CDHA 2FEZA 1MDMB 4CICA 4ENMA 4JK1X 4LMYA 3E3VA 4OIOF 1H0MA 1UHMA 3F22A 4MTDA 1DPUA 3V7CA 4EJUA 3I64A 3LA7A 2H6CA 3QP5A 3FM3A 5H20A 2ZO4A 1ZRCA 1K78B 1USSA 3QPHA 2X0LA 1DPRA 3KZZA 4P9FA 4Q47A 1JE8A 4Y17A 2HDCA 2A69F 3MAJA 3SXYA 3RYPA 3SQNA 4FX0A 2PMUA 4HX8A 1G3SA 4RB0A 1TLHB 3BJ6A 4GCVA 2FNAA 1F9NA 4I01A 1O3TA 2J5OA 2HTJA 3SZTA 3WE2A 1Q1HA 1U5TC 3IHUA 5DD4A 3RPQA 3ULQB 4O3MA 3VOEA 3GFJA 3QPTA 3LA2A 2DT5A 4OIRF 3CO7C 1YIOA 2FMYA 1KU3A 1HBXG 5DYMA 3GO5A 2UZKA 1T6SA 3IL2A 1WWXA 4YFNF 2PEXA 2MLKA 5D8LB 2F5FA 3GZ6A 3MFKA 3GXOA 1O7LA 4IXAA 5L3GA 3B02A 1V4RA 4HW0A 1D8JA 1KYWA 3TO6A 3ECOA 1TQPA 2ZMEA 4HF0A 3J80Z 4BHBA 1FOKA 1R36A 5BOXA 5L3CA 1OMIA 5D4SA 1U5TB 3N97A 2VT2A 3DPLC 2L3DA 3V7RA 2YU3A 5E8IA 1HSTA 1UCRA 4L9VA 2B0LA 2FMLA 1S7AA 4ENNA 2HKOA 1HKQA 2RC4A 2L01A 3KEQA 4LJZF 5IT9K 1S7OA 1HSJA 1FLIA 1HKSA 1GVJA 1FBSA 1D3YA 5TRDA 1PUEE 3ABTA 1W5SA 4ETSA 1JHHA 3Q5FA 1QBJA 1J7KA 2PBIA 2H09A 5D5WB 3T5XA 1AWCA 2HZTA 1IXSB 2IP2A 3EUHA 2Z5UA 3KZYA 4KIGA 1REPC 5IT3A 2OZUA 1I27A 4LB5A 2KJCA 4U7BA 4MEXF 3KP2A 4R1HA 2HS5A 1I1GA 1MJ9A 3O3KA 3IC7A 1QQIA 3HOTA 2IVMA 3SHFA 1T38A 1EH8A 5F64A 1F5TA 3E5XA 1SFEA 2EJRA 2ESNA 4A6DA 4UNOA 2XVCA 2L4MA 1JGSA 1ZHFA 2EFNA 2NNNA 3HSRA 5KVRA 3V8JA 3FHZA 1LDKB 4MNUA 4I98B 1B59A 1TNTA 3WU1B 3P9IA 3IKTA 1FPQA 3T1BA 2IRFG 4ZYDA 1UHWA 4QLCU 4L0YB 4PGHA 2JSCA 2M45A 1JHFA 1USTA 4L9NA 5BMZA 4KFCA 3C1DA 5LHGA 2HYFA 5LEKA 1H9TA 3HUGA 1UFMA 3FMSA 5HDNA 4HX4A 2QBYB 4BQAA 2ZCWA 1U5TA 4L5IA 1YO5C 1TQIA 3WG9A 3ML6A 1MJAA 1OYYA 4G7ZF 4ZZLA 1W5TA 4ESBA 2ZNZA 1LDDA 1FBUA 4KMUX 4LG0B 1TNSA 3DP7A 1T2KA 4G94A 1CF7B 2OZ6A 4XRFA 3R60A 2IT0A 2PMHA 3BP8A 4BAYA 4LGWA 5E1ZB 3EYYA 5A2QK 2DQLA 3FZVA 3WTZA 5DCFA 5L3DA 2OAZA 4M6XA 1ZG1A 1BIBA 1SD5A 3HHHA 4M9XA 3I4PA 1TW2A 1E17A 4HYEA 2HEOA 2QQAA 4HDUA 3BWGA 3COAC 1XDSA 4IRGA 2F5DA 2JTVA 4RGSA 1J2XA 1XCVA 3QRFF 3F8NA 2H94A 4U0WA 2ZBKA 5LGUA 1ZRFA 3V4GA 2RVCA 1LEAA 3JTHA 2F5EA 4I2OA 5BQTA 1TBXA 1O7FA 1IUYA 2EV6A 1C0WA 1YLFA 3ZP5A 2IW5A 1J5YA 2EK5A 1DP7P 4D0PA 4K2EA 1LDJA 1R5GA 2ETHA 2FBKA 3BJAA 1FYMA 2ZKZA 1WQ2A 1XMKA 5ICCA 4U88A 5D6FA 1B6AA 4AVPA 4EGYA 3LAPA 1FC3A 3V7SA 2MBFA 5A2QZ 2FA5A 3TQNA 3CO6C 4DNCA 3WTVC 4A0ZA 5LGTA 3NEUA 2ZJ2A 1YTYA 1S29A 4A6EA 3FXQA 1KGSA 3E6DA 2EFWA 4OIQF 5DV5A 1HXDA 3RDIA 1ZH5A 2P6SA 3ABUA 3RKWA 3RIRA 5HOOA 5CVJA 2FRHA 2HQRA 2FBHA 4EVIA 3VB2A 2Q0OA 3N4MA 1OR7A 3CUOA 4Q48A 4Y13A 4M9ZA 5JR3A 4G7OF 3HSFA 2VE9A 2HFHA 1YW7A 3VODA 4R79A 3RTRA 3IWZA 3JTGA 2P5VA 2OQGA 2IPQX 4HOBA 4MTEA 3FMRA 4BHPA 5F1RA 5FLXK 2MC3A 3WTSC 4BHCA 2GWRA 3IRRA 1EH7A 2P6TA 4G8XA 4UV8A 3ZMUA 4IPAA 5F6FA 1J75A 2HYGD 1HW5A 1FP1D 4WX9A 2A5YB 3M9AA 4L0ZB 1ZLJA 2YX7A 4A5MA 3GX4X 2TDXA 5E18F 2NNYA 3EDPA 4EM0B 4UV9A 4GYGA 3OOPA 4YIIA 4BNCA 4CGZA 3SZPA 3LQRA 1OPCA 4KDPA 2DK8A 1R23A 4G6DA 5HS7A 2LF7A 2KIUA 3RJPA 1QGPA 4B09A 1WKMA 5FB2A 2EB7A 1OYWA 2QLZA 1QNTA 2XRNA 4MQVA 1ZGAA 2A68F 1B9NA 1P4XA 3WTXC 2J5PA 4KIFA 3GVAA 4I0AA 3R0JA 4RGUA 5D5VB 1R5HA 5DCMA 3DFGA 1I5ZA 1FX7A 3FXRA 3EYIA 2ZMEB 1S6LA 1KQ9A 2K86A 3HRSA 5ILUA 5FD5A 2FSWA 2WWYA 2DAOA 2GAUA 1FBQA 1BM9A 3I54A 2YR2A 4HAMA 4WXHA 2FNPA 3DKWA 3H92A 2PI0A 4NHJA 2LF8A 2RKHA 3RYRA 4OU0A 1O3QA 3WTUC 4IRIA 2V1UA 3LAJA 2NS0A 3HHGA 3QP6A 4UXNA 5HLHA 4S04A 4RB2C 4G7HF 2VBWA 2CO5A 2O0YA 4HA8A 3TOBA 2Z3YA 3JAMK 2Y75A 1XCBA 1WI9A 3TKYA 1K7AA 3C3WA 4LFUA 3HYIA 4LG0A 1KYZA 1GXQA 5JHUA 4A12A 2EV0A 5TJJA 2V9VA 4A0YA 2MH9A 1X3UA 2G9WA 1QO0D 1U6GA 2HKXA 5E8GA 5KK1A 5J8CA 2ZNYA 4MEYF 4WXDA 3L7WA 1L0OC 1QPMA 1XSVA 1SFXA 1SFUA 3KEOA 3TGNA 4YIFA 5K5QA 5L3EA 2HOEA 4JBAA 2QQ9A 2P5LC 5K5OA 3M8EA 2OU2A 3C7JA 3CUQB 4LD5A 4TV7A 1RI7A 4P55A 2A07F 3GFMA 4KIBA 5K1YA 2WC2A 1RIOH 4ZYEA 2ISZA 4H0EA 4WWCA 3LWFA 4PCQA 3Q9VA 2XV4S 1LB2A 4AD9A 4IJAA 2H27A 1KA8A 2O61A 3QAHA 3KCCA 2PLYA 4HDVA 5E20A 4QWQA 1YS6A 2RN7A 5ED4A 2STWA 4EJWA 4KA4A 1TW3A 2QENA 5JVTA 4WCGA 2EFQA 2QBYA 3K9TA 4BYYA 1KU7A 1HW2A 4HF1A 3JW4A 4MGRA 4UUVA 1T98A 1G3WA 4WK8F 3K69A 1ON1A 4EV0A 2D1HA 3T0YA 2R7FA 2VONA 3HRTA 2NYXA 4FT8A 1RNLA 1IW7F 4E70A 5D5UB 5FFZA 1FYLA 2YPRA 5H6RA 3MZYA 2LKPA 4U7DA 1BJAA 4N0BA 1JXSA 3ZMDA 2AXLA 2C6YA 4S05A 3DQVC 1KQ8A 1P2FA 2D1VA 4O6JA 1LVAA 3BDDA 3GFLA 1XGSA 4N9HA 1Z6TA 2K4BA 2LNBA 5DUKA 2IJLA 3C18A 3PQKA 4R8HA 1SD6A 2L02A 2IA2A 2R3SA 4RB1A 2XAJA 1KU9A 1NHAA 1RUOA 2W57A 2XAQA 1HQCA 2IA0A 3I5UA 3NQOA 3I0TA 1ZLKA 4ENJA 3E6CC 2FU4A 2P4WA 4EGZA 3S2WA 4KUMA 5ILVA 3U9GA 2GXGA 5DD8A 4KICA 3J81Z 3WGHA 3J80K 3F21A 2EA4A 3KE2A 2ISYA 1P4WA 1R22A 2QM3A 2NAZA 2JPCA 1W4MA 1O57A 1MDMA 2VOOA 5CVVA 2XIGA 3TO9A 2Z99A 5DEQA 3F23A 5HLIA 2UWMA 5DDGA 3P7NA 1Z1DA 2PQ8A 1VTNC 1FT9A 3WTTC 2A6EF 2CWEA 2CW0F 3ISPA 2XHKA 4M9SA 2DFIA 2E1CA 2DK5A 3HRMA 1DUXC 2ACJA 5LRSA 3V8KA 2E7XA 1IN6A 1R1UA 4L5JA 2OQRA 2QQBA 2Y0MA 1ZRDA 3F6OA 2V1DA 5D4RA 1GXPA 1AOYA 1ODDA 5FO5A 3DV8A 1S3JA 2O3FA 2FOKA 3RI4A 5ICFA 4CO8A 4KNYA 1TTYA 3CLOA 1J9IA 2WTEA 2BYVE 2VODA 2DO7A 3LSTA 3KLNA 3P9KA 2FQ3A 4M74A 1I1SA 5LLQA 4IF4A 1B1BA 4RGRA 1MJBA 2W84A 4AIJA 5H6QA 1Z6RA 2HGCA 1U2WA 2VXZA 2VE8A 3KETA 2Q2EA 1ONVA 4RGXA 1ULYA 4I0BA 1KQ0A 3E6MA 4N9IA 3M7GA 3K2ZA 2KRFA 3IKVA 2EFPA 2DI3A 1BC8C 1PP7U 4LK1F 2VC0A 1HW1A 1XGMA 2H6BA 3E5UA 5LRRA 1I6XA 3EETA 2GA1A 3BY6A 1ZAOA 3WU0A 3LFKA 2HR3A 4XSZF 1YQAA 2RNJA 4LLGF 2HQNA 4M72A 4M73A 4FX4A 4HX7A 3W6JB 3IWFA 1LJ9A 3KP3A 4EJOA 4F7ZA 1R00A 1A04A 1YS7A 3GW2A 3I58A 1TQMA 3DPTA 2V6CA 2L4AA 3D5LA 2RV8A 3ROUA 2CGPA 3AAFA 3WGGA 1CF7A 1G6NA 2CQKA 2M87A 2QZ8A 4P5OA 5FFXA 4KN4X 1E2XA 2XGXA 3F8FA 2DPUA 2UXXA 4EM1A 1SD7A 4RAZA 5ERIA 1EV7A 4GXOA 4M71A 3K1NA 2ESHA 3OV8A 5E1XA 5HDGA 5BPIA 1Z9CA 2DU9A 4O5VA 3M1EA 2O8XA 4XSXF 2ZXJA 1S8NA 5HLGA 1EH6A 2VC1A 4HF2A 2CG4A 3DEUA 3TDZC 3KFWX 2G7HA 4AIKA 1U3EM 3LA3A 1IAWA 3TO7A 2EV5A 1V3FA 4UVAA 3G73A 3G3ZA 4L9JA 1W7PA 1STZA 2EFOA 3ZMVA 1Z7UA 4P96A 1FSEA 3O2PE 1HKTA 1YFHA 2HTSA 3K0LA 4ESJA 3MZHA 2FE3A 4G6QA 3DF8A 5FD6A 2MD5A 2ELHA 4U0VA 3JAMZ 4AWXB 3FMQA 4HQEA 4XBFA 4UHTA 1U8RA 4KYWA 2XAGA 3I59A 2OA4A 2K27A 1U78A 5ICGA 3BROA 2JRTA 5CVRA 2LDUA 2WV0A 2GQQA 4ZYHA 2GA2A 1ON2A 2P8TA 5D6EA 3KP4A 4KN7X 4UVBA 4OIPF 2XUBA 2DLLA 1J0RA 1XN7A 5D8KB 1XSDA 2A61A 1BI3A 3F72A 3L9FA 4ON0A 1W7PD 3ZMTA 2CSOA 4ZZDA 1XDUA 3ERED 3RKYA 2RQPA 3I71A 1BI1A 1J59A 3ZQ7A 3PQJA 2RGVA 2M30A 3GF2A 2PJPA 2JZYA 2VBXA 5J6XA 3FF5A 5E1WA 1QZZA 4BXUA 2JPBA 4LLNA 3HTUA 1R58A 3L2CA 1BOAA 2KIFA 2P5KA 3O6BB 2MA3A 1PP8F 3ZPLA 3ZMSA 2V1XA 4OINF 1BI0A 4ESFA 4OMYA 1SMYF 5J8FA 2PN6A 1UB9A 2P7VB 3MQ0A 3E97A 2DQRA 1PDNC 2Z9OA 4CHUA 3HIFA 3H3UA 4LLLA 2G7UA 2QYOA 4RAYA 4UVCA 1XD7A 4RS8A 2EWNA 3GEZA 1IRGA 1R1VA 5EEGA 1LQ1A 3E5QA 3GLXA 3K1MA 1IN4A 1BBYA 3U1DA 1BI2A 1FZPB 1WRJA 4GO1A 2XAFA 3ZN0A 3KP7A 1XGNA 1BIAA 3F3XA 2A6HF 4HBLA 3ECHA 4FHTA 1Y0UA 4DQ2A 4ENKA 2CYYA 1LEBA 3J81K 3U2RA 2E7WA 2M1BA 4I02A 3WODF 5HS9A 5JI6A 1XGOA 3FM5A 5L3FA 1P6RA 1T39A 1LNWA 4YG2F 3GFIA 4OOIA 4PDKA 5K5RA 3D0SA 2BBYA 3F6VA 2XROA 3FWEA 1SMTA 4OMZA 1IN7A 3F8MA 3E6BA 1Z05A 1O3RA 2UXNA 5DCMB 3K1PA 4PGGA 2R7DA 3ELKA 4LK0F 3SFZA 3CUQC 3R0AA 4IVNA 4P9UA 2KIMA 4EJTA 2K7LA 4CXFA 3HRUA 4WXCA 4L9TA 4CYDA 1MD0A 4HQMA 1RUNA 2OBPA 1WSUA 4ASNA 2QVOA 2DBBA 1FNNA 5LGNA 5FLXZ 2FXAA 2YSRA 4Y15A 4EJVA 4AIHA 5EEHA 4MQ9F 1YG2A 2P7CB 1G3YA 4HZFA 2W25A 4WF2A 2QUFA 3VFZA 3ZMZA 2K4JA 1DDNA 1OYIA 5LHIA 1FP2A 2Q8KA 5ICEA 4PZJA 4IRHA 3BPXA 5CJ9A 1Z91A 1ZYRF 4ZYGA 4BH9A 3B73A 1FY7A 3L00A 2XAHA 3TDUC 4JQFA 3V8LA 4U0YA 1K79A 1G4DA 2EA2A 1F1ZA 1F4KA 4YFXF 2W85A 3FXUA 4GGGA 1T0FA 1IXCA 5CVIA 5DUIA 3T8RA 2A3SA 4MHGA 3HOSA 3W6KB 1K6OA 3ZN1A 2X4HA 2BV6A 4EMSA 3F8BA 2GXBA 4M6YA 4NB5A 3MWMA 5IT9Z 1OKRA 1P4AA 2AS5F 2VT3A 3Q9SA 3PFIA 4HLXA 5LBQA 3R6SA 1IXRC 2D2WA 3BPVA 2MLGA 1ZG5A 3P9CA 1YW8A 3M8FA 1IF1A 5JFRA 3GZ5A 3CUQA 4XLPF 3I59B 3WGIA 6PAXA 1YYVA 2PFBA 1MGTA 4LB6B 4KMFA 4NQWA 4EM2A 1FYKA 4L18B 3JSPA 1B4AA 5CVUA 2D45A 2ADUA 1SAXA 1K78A 2COMA 4XLNF 2BE5F 1XMAA 4GYIA 4B8XA 2BGCA 3JSOA 4CZZA 4YFKF 1ZN2A 3REOA 5AIQA 5E17F 4A5NA 3KLOA 2Y48A 3WTYC 3VEPA 2FBIA 5HVQC 3GYHX 1D5VA 1GHCA 3CJNA 4HV5A 2XKPA 2M8EA 2FF4A 2LSOA 3LQQA 3J7AO 3GWZA 3NRVA 4G9YA 5AIPA 3I53A 1R1TA 4I7HA 4Q5SF 2ZFWA 2NRAC 1L3LA 3KP6A 2OD5A 1IN8A 5CYVA 1MKMA 3KP5A 5LHHA 1P92A 4ZH4F 3QU6A 4IHTA 5AONA 2CFXA 1BC7C 5D5XB 2VBYA 5ILSA 1D8KA 1B9MA 3HSEA 1ZGJA 4KT5C 5HDKA 3RPUA 3MCZA 1CGPA 2KJBA 3WTWC 1IRFA 2K02A 5HS8A 1KU2A 3HTSB 5BPDA 5BS6A 3FX3A 1YW9A 3RKXA 4RB3C 4A0XA 2HWVA 2BEOA 4I09A 2O03A 1BN5A 3IRQA 1SD4A 2W24A 5LEJA 2DW4A 4A2UA 3TOAA 3QU3A 4Q4ZF 2DPDA 2STTA 3L09A 5CLSA 2YX4A 3T8TA 2MH2A 4HV6A 2V79A 1ZG3A 1QZYA 1FWZA 2IA1A 3CTAA 2GZWA 2QWWA 1XSXA 4IHSA 3BZ6A 1MZBA 2VBZA 2RDPA 4CDGA 2PG4A 5FGMA 1O3SA 1R7JA 3BJOA 4HLYA 4EQQA 2F5CA 3GUDA 2O6GE 2VN2A 1FSHA 2M5WA 2VOPA 3R4KA 3F8CA 3H3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L54 A;  1G3T A;  3WE3 A;  2DTR A;  3MEX A;  2E1N A;  1RZ4 A;  3DXJ F;  1XB4 A;  4Z2Y A;  2JT1 A;  1ZAR A;  2XKO A;  2Z33 A;  1IZ1 A;  3BOQ A;  1W7P B;  2GIV A;  3R61 A;  3EQL F;  2F2E A;  1H9G A;  5L3B A;  2KKO A;  1IN5 A;  1ZRE A;  3QOP A;  2XAS A;  3CDH A;  2FEZ A;  1MDM B;  4CIC A;  4ENM A;  4JK1 X;  4LMY A;  3E3V A;  4OIO F;  1H0M A;  1UHM A;  3F22 A;  4MTD A;  1DPU A;  3V7C A;  4EJU A;  3I64 A;  3LA7 A;  2H6C A;  3QP5 A;  3FM3 A;  5H20 A;  2ZO4 A;  1ZRC A;  1K78 B;  1USS A;  3QPH A;  2X0L A;  1DPR A;  3KZZ A;  4P9F A;  4Q47 A;  1JE8 A;  4Y17 A;  2HDC A;  2A69 F;  3MAJ A;  3SXY A;  3RYP A;  3SQN A;  4FX0 A;  2PMU A;  4HX8 A;  1G3S A;  4RB0 A;  1TLH B;  3BJ6 A;  4GCV A;  2FNA A;  1F9N A;  4I01 A;  1O3T A;  2J5O A;  2HTJ A;  3SZT A;  3WE2 A;  1Q1H A;  1U5T C;  3IHU A;  5DD4 A;  3RPQ A;  3ULQ B;  4O3M A;  3VOE A;  3GFJ A;  3QPT A;  3LA2 A;  2DT5 A;  4OIR F;  3CO7 C;  1YIO A;  2FMY A;  1KU3 A;  1HBX G;  5DYM A;  3GO5 A;  2UZK A;  1T6S A;  3IL2 A;  1WWX A;  4YFN F;  2PEX A;  2MLK A;  5D8L B;  2F5F A;  3GZ6 A;  3MFK A;  3GXO A;  1O7L A;  4IXA A;  5L3G A;  3B02 A;  1V4R A;  4HW0 A;  1D8J A;  1KYW A;  3TO6 A;  3ECO A;  1TQP A;  2ZME A;  4HF0 A;  3J80 Z;  4BHB A;  1FOK A;  1R36 A;  5BOX A;  5L3C A;  1OMI A;  5D4S A;  1U5T B;  3N97 A;  2VT2 A;  3DPL C;  2L3D A;  3V7R A;  2YU3 A;  5E8I A;  1HST A;  1UCR A;  4L9V A;  2B0L A;  2FML A;  1S7A A;  4ENN A;  2HKO A;  1HKQ A;  2RC4 A;  2L01 A;  3KEQ A;  4LJZ F;  5IT9 K;  1S7O A;  1HSJ A;  1FLI A;  1HKS A;  1GVJ A;  1FBS A;  1D3Y A;  5TRD A;  1PUE E;  3ABT A;  1W5S A;  4ETS A;  1JHH A;  3Q5F A;  1QBJ A;  1J7K A;  2PBI A;  2H09 A;  5D5W B;  3T5X A;  1AWC A;  2HZT A;  1IXS B;  2IP2 A;  3EUH A;  2Z5U A;  3KZY A;  4KIG A;  1REP C;  5IT3 A;  2OZU A;  1I27 A;  4LB5 A;  2KJC A;  4U7B A;  4MEX F;  3KP2 A;  4R1H A;  2HS5 A;  1I1G A;  1MJ9 A;  3O3K A;  3IC7 A;  1QQI A;  3HOT A;  2IVM A;  3SHF A;  1T38 A;  1EH8 A;  5F64 A;  1F5T A;  3E5X A;  1SFE A;  2EJR A;  2ESN A;  4A6D A;  4UNO A;  2XVC A;  2L4M A;  1JGS A;  1ZHF A;  2EFN A;  2NNN A;  3HSR A;  5KVR A;  3V8J A;  3FHZ A;  1LDK B;  4MNU A;  4I98 B;  1B59 A;  1TNT A;  3WU1 B;  3P9I A;  3IKT A;  1FPQ A;  3T1B A;  2IRF G;  4ZYD A;  1UHW A;  4QLC U;  4L0Y B;  4PGH A;  2JSC A;  2M45 A;  1JHF A;  1UST A;  4L9N A;  5BMZ A;  4KFC A;  3C1D A;  5LHG A;  2HYF A;  5LEK A;  1H9T A;  3HUG A;  1UFM A;  3FMS A;  5HDN A;  4HX4 A;  2QBY B;  4BQA A;  2ZCW A;  1U5T A;  4L5I A;  1YO5 C;  1TQI A;  3WG9 A;  3ML6 A;  1MJA A;  1OYY A;  4G7Z F;  4ZZL A;  1W5T A;  4ESB A;  2ZNZ A;  1LDD A;  1FBU A;  4KMU X;  4LG0 B;  1TNS A;  3DP7 A;  1T2K A;  4G94 A;  1CF7 B;  2OZ6 A;  4XRF A;  3R60 A;  2IT0 A;  2PMH A;  3BP8 A;  4BAY A;  4LGW A;  5E1Z B;  3EYY A;  5A2Q K;  2DQL A;  3FZV A;  3WTZ A;  5DCF A;  5L3D A;  2OAZ A;  4M6X A;  1ZG1 A;  1BIB A;  1SD5 A;  3HHH A;  4M9X A;  3I4P A;  1TW2 A;  1E17 A;  4HYE A;  2HEO A;  2QQA A;  4HDU A;  3BWG A;  3COA C;  1XDS A;  4IRG A;  2F5D A;  2JTV A;  4RGS A;  1J2X A;  1XCV A;  3QRF F;  3F8N A;  2H94 A;  4U0W A;  2ZBK A;  5LGU A;  1ZRF A;  3V4G A;  2RVC A;  1LEA A;  3JTH A;  2F5E A;  4I2O A;  5BQT A;  1TBX A;  1O7F A;  1IUY A;  2EV6 A;  1C0W A;  1YLF A;  3ZP5 A;  2IW5 A;  1J5Y A;  2EK5 A;  1DP7 P;  4D0P A;  4K2E A;  1LDJ A;  1R5G A;  2ETH A;  2FBK A;  3BJA A;  1FYM A;  2ZKZ A;  1WQ2 A;  1XMK A;  5ICC A;  4U88 A;  5D6F A;  1B6A A;  4AVP A;  4EGY A;  3LAP A;  1FC3 A;  3V7S A;  2MBF A;  5A2Q Z;  2FA5 A;  3TQN A;  3CO6 C;  4DNC A;  3WTV C;  4A0Z A;  5LGT A;  3NEU A;  2ZJ2 A;  1YTY A;  1S29 A;  4A6E A;  3FXQ A;  1KGS A;  3E6D A;  2EFW A;  4OIQ F;  5DV5 A;  1HXD A;  3RDI A;  1ZH5 A;  2P6S A;  3ABU A;  3RKW A;  3RIR A;  5HOO A;  5CVJ A;  2FRH A;  2HQR A;  2FBH A;  4EVI A;  3VB2 A;  2Q0O A;  3N4M A;  1OR7 A;  3CUO A;  4Q48 A;  4Y13 A;  4M9Z A;  5JR3 A;  4G7O F;  3HSF A;  2VE9 A;  2HFH A;  1YW7 A;  3VOD A;  4R79 A;  3RTR A;  3IWZ A;  3JTG A;  2P5V A;  2OQG A;  2IPQ X;  4HOB A;  4MTE A;  3FMR A;  4BHP A;  5F1R A;  5FLX K;  2MC3 A;  3WTS C;  4BHC A;  2GWR A;  3IRR A;  1EH7 A;  2P6T A;  4G8X A;  4UV8 A;  3ZMU A;  4IPA A;  5F6F A;  1J75 A;  2HYG D;  1HW5 A;  1FP1 D;  4WX9 A;  2A5Y B;  3M9A A;  4L0Z B;  1ZLJ A;  2YX7 A;  4A5M A;  3GX4 X;  2TDX A;  5E18 F;  2NNY A;  3EDP A;  4EM0 B;  4UV9 A;  4GYG A;  3OOP A;  4YII A;  4BNC A;  4CGZ A;  3SZP A;  3LQR A;  1OPC A;  4KDP A;  2DK8 A;  1R23 A;  4G6D A;  5HS7 A;  2LF7 A;  2KIU A;  3RJP A;  1QGP A;  4B09 A;  1WKM A;  5FB2 A;  2EB7 A;  1OYW A;  2QLZ A;  1QNT A;  2XRN A;  4MQV A;  1ZGA A;  2A68 F;  1B9N A;  1P4X A;  3WTX C;  2J5P A;  4KIF A;  3GVA A;  4I0A A;  3R0J A;  4RGU A;  5D5V B;  1R5H A;  5DCM A;  3DFG A;  1I5Z A;  1FX7 A;  3FXR A;  3EYI A;  2ZME B;  1S6L A;  1KQ9 A;  2K86 A;  3HRS A;  5ILU A;  5FD5 A;  2FSW A;  2WWY A;  2DAO A;  2GAU A;  1FBQ A;  1BM9 A;  3I54 A;  2YR2 A;  4HAM A;  4WXH A;  2FNP A;  3DKW A;  3H92 A;  2PI0 A;  4NHJ A;  2LF8 A;  2RKH A;  3RYR A;  4OU0 A;  1O3Q A;  3WTU C;  4IRI A;  2V1U A;  3LAJ A;  2NS0 A;  3HHG A;  3QP6 A;  4UXN A;  5HLH A;  4S04 A;  4RB2 C;  4G7H F;  2VBW A;  2CO5 A;  2O0Y A;  4HA8 A;  3TOB A;  2Z3Y A;  3JAM K;  2Y75 A;  1XCB A;  1WI9 A;  3TKY A;  1K7A A;  3C3W A;  4LFU A;  3HYI A;  4LG0 A;  1KYZ A;  1GXQ A;  5JHU A;  4A12 A;  2EV0 A;  5TJJ A;  2V9V A;  4A0Y A;  2MH9 A;  1X3U A;  2G9W A;  1QO0 D;  1U6G A;  2HKX A;  5E8G A;  5KK1 A;  5J8C A;  2ZNY A;  4MEY F;  4WXD A;  3L7W A;  1L0O C;  1QPM A;  1XSV A;  1SFX A;  1SFU A;  3KEO A;  3TGN A;  4YIF A;  5K5Q A;  5L3E A;  2HOE A;  4JBA A;  2QQ9 A;  2P5L C;  5K5O A;  3M8E A;  2OU2 A;  3C7J A;  3CUQ B;  4LD5 A;  4TV7 A;  1RI7 A;  4P55 A;  2A07 F;  3GFM A;  4KIB A;  5K1Y A;  2WC2 A;  1RIO H;  4ZYE A;  2ISZ A;  4H0E A;  4WWC A;  3LWF A;  4PCQ A;  3Q9V A;  2XV4 S;  1LB2 A;  4AD9 A;  4IJA A;  2H27 A;  1KA8 A;  2O61 A;  3QAH A;  3KCC A;  2PLY A;  4HDV A;  5E20 A;  4QWQ A;  1YS6 A;  2RN7 A;  5ED4 A;  2STW A;  4EJW A;  4KA4 A;  1TW3 A;  2QEN A;  5JVT A;  4WCG A;  2EFQ A;  2QBY A;  3K9T A;  4BYY A;  1KU7 A;  1HW2 A;  4HF1 A;  3JW4 A;  4MGR A;  4UUV A;  1T98 A;  1G3W A;  4WK8 F;  3K69 A;  1ON1 A;  4EV0 A;  2D1H A;  3T0Y A;  2R7F A;  2VON A;  3HRT A;  2NYX A;  4FT8 A;  1RNL A;  1IW7 F;  4E70 A;  5D5U B;  5FFZ A;  1FYL A;  2YPR A;  5H6R A;  3MZY A;  2LKP A;  4U7D A;  1BJA A;  4N0B A;  1JXS A;  3ZMD A;  2AXL A;  2C6Y A;  4S05 A;  3DQV C;  1KQ8 A;  1P2F A;  2D1V A;  4O6J A;  1LVA A;  3BDD A;  3GFL A;  1XGS A;  4N9H A;  1Z6T A;  2K4B A;  2LNB A;  5DUK A;  2IJL A;  3C18 A;  3PQK A;  4R8H A;  1SD6 A;  2L02 A;  2IA2 A;  2R3S A;  4RB1 A;  2XAJ A;  1KU9 A;  1NHA A;  1RUO A;  2W57 A;  2XAQ A;  1HQC A;  2IA0 A;  3I5U A;  3NQO A;  3I0T A;  1ZLK A;  4ENJ A;  3E6C C;  2FU4 A;  2P4W A;  4EGZ A;  3S2W A;  4KUM A;  5ILV A;  3U9G A;  2GXG A;  5DD8 A;  4KIC A;  3J81 Z;  3WGH A;  3J80 K;  3F21 A;  2EA4 A;  3KE2 A;  2ISY A;  1P4W A;  1R22 A;  2QM3 A;  2NAZ A;  2JPC A;  1W4M A;  1O57 A;  1MDM A;  2VOO A;  5CVV A;  2XIG A;  3TO9 A;  2Z99 A;  5DEQ A;  3F23 A;  5HLI A;  2UWM A;  5DDG A;  3P7N A;  1Z1D A;  2PQ8 A;  1VTN C;  1FT9 A;  3WTT C;  2A6E F;  2CWE A;  2CW0 F;  3ISP A;  2XHK A;  4M9S A;  2DFI A;  2E1C A;  2DK5 A;  3HRM A;  1DUX C;  2ACJ A;  5LRS A;  3V8K A;  2E7X A;  1IN6 A;  1R1U A;  4L5J A;  2OQR A;  2QQB A;  2Y0M A;  1ZRD A;  3F6O A;  2V1D A;  5D4R A;  1GXP A;  1AOY A;  1ODD A;  5FO5 A;  3DV8 A;  1S3J A;  2O3F A;  2FOK A;  3RI4 A;  5ICF A;  4CO8 A;  4KNY A;  1TTY A;  3CLO A;  1J9I A;  2WTE A;  2BYV E;  2VOD A;  2DO7 A;  3LST A;  3KLN A;  3P9K A;  2FQ3 A;  4M74 A;  1I1S A;  5LLQ A;  4IF4 A;  1B1B A;  4RGR A;  1MJB A;  2W84 A;  4AIJ A;  5H6Q A;  1Z6R A;  2HGC A;  1U2W A;  2VXZ A;  2VE8 A;  3KET A;  2Q2E A;  1ONV A;  4RGX A;  1ULY A;  4I0B A;  1KQ0 A;  3E6M A;  4N9I A;  3M7G A;  3K2Z A;  2KRF A;  3IKV A;  2EFP A;  2DI3 A;  1BC8 C;  1PP7 U;  4LK1 F;  2VC0 A;  1HW1 A;  1XGM A;  2H6B A;  3E5U A;  5LRR A;  1I6X A;  3EET A;  2GA1 A;  3BY6 A;  1ZAO A;  3WU0 A;  3LFK A;  2HR3 A;  4XSZ F;  1YQA A;  2RNJ A;  4LLG F;  2HQN A;  4M72 A;  4M73 A;  4FX4 A;  4HX7 A;  3W6J B;  3IWF A;  1LJ9 A;  3KP3 A;  4EJO A;  4F7Z A;  1R00 A;  1A04 A;  1YS7 A;  3GW2 A;  3I58 A;  1TQM A;  3DPT A;  2V6C A;  2L4A A;  3D5L A;  2RV8 A;  3ROU A;  2CGP A;  3AAF A;  3WGG A;  1CF7 A;  1G6N A;  2CQK A;  2M87 A;  2QZ8 A;  4P5O A;  5FFX A;  4KN4 X;  1E2X A;  2XGX A;  3F8F A;  2DPU A;  2UXX A;  4EM1 A;  1SD7 A;  4RAZ A;  5ERI A;  1EV7 A;  4GXO A;  4M71 A;  3K1N A;  2ESH A;  3OV8 A;  5E1X A;  5HDG A;  5BPI A;  1Z9C A;  2DU9 A;  4O5V A;  3M1E A;  2O8X A;  4XSX F;  2ZXJ A;  1S8N A;  5HLG A;  1EH6 A;  2VC1 A;  4HF2 A;  2CG4 A;  3DEU A;  3TDZ C;  3KFW X;  2G7H A;  4AIK A;  1U3E M;  3LA3 A;  1IAW A;  3TO7 A;  2EV5 A;  1V3F A;  4UVA A;  3G73 A;  3G3Z A;  4L9J A;  1W7P A;  1STZ A;  2EFO A;  3ZMV A;  1Z7U A;  4P96 A;  1FSE A;  3O2P E;  1HKT A;  1YFH A;  2HTS A;  3K0L A;  4ESJ A;  3MZH A;  2FE3 A;  4G6Q A;  3DF8 A;  5FD6 A;  2MD5 A;  2ELH A;  4U0V A;  3JAM Z;  4AWX B;  3FMQ A;  4HQE A;  4XBF A;  4UHT A;  1U8R A;  4KYW A;  2XAG A;  3I59 A;  2OA4 A;  2K27 A;  1U78 A;  5ICG A;  3BRO A;  2JRT A;  5CVR A;  2LDU A;  2WV0 A;  2GQQ A;  4ZYH A;  2GA2 A;  1ON2 A;  2P8T A;  5D6E A;  3KP4 A;  4KN7 X;  4UVB A;  4OIP F;  2XUB A;  2DLL A;  1J0R A;  1XN7 A;  5D8K B;  1XSD A;  2A61 A;  1BI3 A;  3F72 A;  3L9F A;  4ON0 A;  1W7P D;  3ZMT A;  2CSO A;  4ZZD A;  1XDU A;  3ERE D;  3RKY A;  2RQP A;  3I71 A;  1BI1 A;  1J59 A;  3ZQ7 A;  3PQJ A;  2RGV A;  2M30 A;  3GF2 A;  2PJP A;  2JZY A;  2VBX A;  5J6X A;  3FF5 A;  5E1W A;  1QZZ A;  4BXU A;  2JPB A;  4LLN A;  3HTU A;  1R58 A;  3L2C A;  1BOA A;  2KIF A;  2P5K A;  3O6B B;  2MA3 A;  1PP8 F;  3ZPL A;  3ZMS A;  2V1X A;  4OIN F;  1BI0 A;  4ESF A;  4OMY A;  1SMY F;  5J8F A;  2PN6 A;  1UB9 A;  2P7V B;  3MQ0 A;  3E97 A;  2DQR A;  1PDN C;  2Z9O A;  4CHU A;  3HIF A;  3H3U A;  4LLL A;  2G7U A;  2QYO A;  4RAY A;  4UVC A;  1XD7 A;  4RS8 A;  2EWN A;  3GEZ A;  1IRG A;  1R1V A;  5EEG A;  1LQ1 A;  3E5Q A;  3GLX A;  3K1M A;  1IN4 A;  1BBY A;  3U1D A;  1BI2 A;  1FZP B;  1WRJ A;  4GO1 A;  2XAF A;  3ZN0 A;  3KP7 A;  1XGN A;  1BIA A;  3F3X A;  2A6H F;  4HBL A;  3ECH A;  4FHT A;  1Y0U A;  4DQ2 A;  4ENK A;  2CYY A;  1LEB A;  3J81 K;  3U2R A;  2E7W A;  2M1B A;  4I02 A;  3WOD F;  5HS9 A;  5JI6 A;  1XGO A;  3FM5 A;  5L3F A;  1P6R A;  1T39 A;  1LNW A;  4YG2 F;  3GFI A;  4OOI A;  4PDK A;  5K5R A;  3D0S A;  2BBY A;  3F6V A;  2XRO A;  3FWE A;  1SMT A;  4OMZ A;  1IN7 A;  3F8M A;  3E6B A;  1Z05 A;  1O3R A;  2UXN A;  5DCM B;  3K1P A;  4PGG A;  2R7D A;  3ELK A;  4LK0 F;  3SFZ A;  3CUQ C;  3R0A A;  4IVN A;  4P9U A;  2KIM A;  4EJT A;  2K7L A;  4CXF A;  3HRU A;  4WXC A;  4L9T A;  4CYD A;  1MD0 A;  4HQM A;  1RUN A;  2OBP A;  1WSU A;  4ASN A;  2QVO A;  2DBB A;  1FNN A;  5LGN A;  5FLX Z;  2FXA A;  2YSR A;  4Y15 A;  4EJV A;  4AIH A;  5EEH A;  4MQ9 F;  1YG2 A;  2P7C B;  1G3Y A;  4HZF A;  2W25 A;  4WF2 A;  2QUF A;  3VFZ A;  3ZMZ A;  2K4J A;  1DDN A;  1OYI A;  5LHI A;  1FP2 A;  2Q8K A;  5ICE A;  4PZJ A;  4IRH A;  3BPX A;  5CJ9 A;  1Z91 A;  1ZYR F;  4ZYG A;  4BH9 A;  3B73 A;  1FY7 A;  3L00 A;  2XAH A;  3TDU C;  4JQF A;  3V8L A;  4U0Y A;  1K79 A;  1G4D A;  2EA2 A;  1F1Z A;  1F4K A;  4YFX F;  2W85 A;  3FXU A;  4GGG A;  1T0F A;  1IXC A;  5CVI A;  5DUI A;  3T8R A;  2A3S A;  4MHG A;  3HOS A;  3W6K B;  1K6O A;  3ZN1 A;  2X4H A;  2BV6 A;  4EMS A;  3F8B A;  2GXB A;  4M6Y A;  4NB5 A;  3MWM A;  5IT9 Z;  1OKR A;  1P4A A;  2AS5 F;  2VT3 A;  3Q9S A;  3PFI A;  4HLX A;  5LBQ A;  3R6S A;  1IXR C;  2D2W A;  3BPV A;  2MLG A;  1ZG5 A;  3P9C A;  1YW8 A;  3M8F A;  1IF1 A;  5JFR A;  3GZ5 A;  3CUQ A;  4XLP F;  3I59 B;  3WGI A;  6PAX A;  1YYV A;  2PFB A;  1MGT A;  4LB6 B;  4KMF A;  4NQW A;  4EM2 A;  1FYK A;  4L18 B;  3JSP A;  1B4A A;  5CVU A;  2D45 A;  2ADU A;  1SAX A;  1K78 A;  2COM A;  4XLN F;  2BE5 F;  1XMA A;  4GYI A;  4B8X A;  2BGC A;  3JSO A;  4CZZ A;  4YFK F;  1ZN2 A;  3REO A;  5AIQ A;  5E17 F;  4A5N A;  3KLO A;  2Y48 A;  3WTY C;  3VEP A;  2FBI A;  5HVQ C;  3GYH X;  1D5V A;  1GHC A;  3CJN A;  4HV5 A;  2XKP A;  2M8E A;  2FF4 A;  2LSO A;  3LQQ A;  3J7A O;  3GWZ A;  3NRV A;  4G9Y A;  5AIP A;  3I53 A;  1R1T A;  4I7H A;  4Q5S F;  2ZFW A;  2NRA C;  1L3L A;  3KP6 A;  2OD5 A;  1IN8 A;  5CYV A;  1MKM A;  3KP5 A;  5LHH A;  1P92 A;  4ZH4 F;  3QU6 A;  4IHT A;  5AON A;  2CFX A;  1BC7 C;  5D5X B;  2VBY A;  5ILS A;  1D8K A;  1B9M A;  3HSE A;  1ZGJ A;  4KT5 C;  5HDK A;  3RPU A;  3MCZ A;  1CGP A;  2KJB A;  3WTW C;  1IRF A;  2K02 A;  5HS8 A;  1KU2 A;  3HTS B;  5BPD A;  5BS6 A;  3FX3 A;  1YW9 A;  3RKX A;  4RB3 C;  4A0X A;  2HWV A;  2BEO A;  4I09 A;  2O03 A;  1BN5 A;  3IRQ A;  1SD4 A;  2W24 A;  5LEJ A;  2DW4 A;  4A2U A;  3TOA A;  3QU3 A;  4Q4Z F;  2DPD A;  2STT A;  3L09 A;  5CLS A;  2YX4 A;  3T8T A;  2MH2 A;  4HV6 A;  2V79 A;  1ZG3 A;  1QZY A;  1FWZ A;  2IA1 A;  3CTA A;  2GZW A;  2QWW A;  1XSX A;  4IHS A;  3BZ6 A;  1MZB A;  2VBZ A;  2RDP A;  4CDG A;  2PG4 A;  5FGM A;  1O3S A;  1R7J A;  3BJO A;  4HLY A;  4EQQ A;  2F5C A;  3GUD A;  2O6G E;  2VN2 A;  1FSH A;  2M5W A;  2VOP A;  3R4K A;  3F8C A;  3H3Z A; 
#chains in the Genus database with same CATH topology
 2L54 A;  1G3T A;  3WE3 A;  2DTR A;  3MEX A;  1LE8 B;  1K83 J;  1JJ6 C;  2E1N A;  4XRM A;  1RZ4 A;  2WB1 N;  4GFB A;  3DXJ F;  1XB4 A;  2XGE A;  4Z2Y A;  2JT1 A;  2HXO A;  1ZAR A;  3LSR A;  1I39 A;  2XKO A;  3RKQ A;  1ETV A;  1ZGW A;  2Z33 A;  2E2J J;  1IZ1 A;  3BOQ A;  1W7P B;  1LFB A;  2GIV A;  3R61 A;  4NC7 A;  2JUC A;  3EQL F;  2F2E A;  3KYD B;  4M6V A;  1FJL A;  1H9G A;  3BCA A;  5L3B A;  1AA7 A;  2KKO A;  1TC3 C;  1IN5 A;  1ZRE A;  3QOP A;  3OS2 A;  2XAS A;  3CDH A;  5C44 J;  3ZQG A;  3HOW J;  2E34 A;  2FEZ A;  2E71 A;  1K61 A;  1MDM B;  4CIC A;  4PJL A;  4ENM A;  2K5C A;  4BY1 J;  4JK1 X;  1I6H J;  4LMY A;  5LD2 C;  2L7F P;  3E3V A;  3GTP J;  4OIO F;  1H0M A;  1UHM A;  3F22 A;  4DZJ A;  3G4S I;  4MTD A;  1DPU A;  3V7C A;  4EJU A;  3WHB A;  3I64 A;  3LA7 A;  2H6C A;  1XMX A;  4RMN A;  3QP5 A;  3FM3 A;  5H20 A;  3S93 A;  5E3L A;  4MLO A;  2ZO4 A;  1TWC J;  1ZRC A;  5J1Y A;  1K78 B;  4HEA 2;  1USS A;  3QPH A;  3BQY A;  3CCL I;  1SVL A;  3GLL A;  2X0L A;  4BEH A;  2BVM A;  1DPR A;  3KZZ A;  4P9F A;  4Q47 A;  1JE8 A;  4Y17 A;  2CRG A;  2HDC A;  2A69 F;  3MAJ A;  1W5C C;  3LSH A;  2DJI A;  4G6T B;  3LSK A;  3SXY A;  1FOX A;  5LFA A;  2LKX A;  2EIK H;  2GBY A;  3RYP A;  3SQN A;  1PUF A;  3JR9 A;  3LSI A;  4FX0 A;  4XOR A;  2PMU A;  2CS3 A;  2TCT A;  3BZK A;  3C2B A;  4HX8 A;  5H2F C;  1G3S A;  1OLT A;  4RB0 A;  1TLH B;  2FUG 2;  3BJ6 A;  3BLY A;  4GCV A;  2IS4 A;  2FNA A;  1F9N A;  3HOU J;  4BUP A;  3JCU C;  4Y4R A;  3K10 A;  4I01 A;  1O3T A;  2J5O A;  2HTJ A;  2WBM A;  3IUO A;  3OY9 A;  2HZD A;  1TZL A;  3SZT A;  3WE2 A;  1UAA A;  1FTT A;  1Q1H A;  1U5T C;  3IHU A;  5DD4 A;  3RPQ A;  3ULQ B;  4O3M A;  3K4N A;  3HB9 A;  3VOE A;  3GFJ A;  3QPT A;  3LA2 A;  4DBR A;  3HBL A;  2DT5 A;  1VFC A;  4OIR F;  3CO7 C;  1YIO A;  2IS2 A;  2FMY A;  4M3D A;  1KU3 A;  4BDZ A;  1HBX G;  5DYM A;  3VWB A;  3GO5 A;  2UZK A;  1GV5 A;  1T6S A;  2IGK A;  3QYB A;  3IL2 A;  1WWX A;  4YFN F;  2PEX A;  2MLK A;  5D8L B;  1SVO A;  1APL C;  2F5F A;  3GZ6 A;  4DIQ A;  3MFK A;  1H89 C;  2NOJ B;  1QHG A;  3GXO A;  1Z7L A;  1O7L A;  4KIT B;  4IXA A;  3SDG A;  3K7A J;  3B02 A;  4XKB A;  4DW6 A;  2BXZ A;  5L3G A;  1V4R A;  3U1K A;  1SVM A;  2M8G X;  4HW0 A;  1D8J A;  4N4N B;  1BR4 A;  1KYW A;  3LSG A;  3TO6 A;  1YJW I;  3ECO A;  1TQP A;  5GAG J;  1S7E A;  4XIC A;  2ZME A;  5FKK A;  4HF0 A;  1OR7 C;  3J80 Z;  2JVH A;  4CUG A;  4JX5 A;  4BHB A;  1FOK A;  1VND A;  5J1U A;  1R36 A;  1FTZ A;  2V9P A;  5BOX A;  2R7S A;  4A3I J;  5L3C A;  1OMI A;  5D4S A;  1U5T B;  4IEJ A;  2JVG A;  4NDL A;  3TW7 A;  3N97 A;  2VT2 A;  2PJR A;  3DPL C;  2L3D A;  2OPT A;  3V7R A;  2YU3 A;  3M1C A;  1D1B A;  5E8I A;  1HST A;  1UCR A;  4L9V A;  2B0L A;  2NS7 A;  2FML A;  1TWG J;  4YIR X;  2CUF A;  2X6W A;  4PK4 A;  4IL6 C;  2JUG A;  1S7A A;  4ENN A;  2HKO A;  1GDT A;  3BTJ A;  1HKQ A;  3HGG A;  1YI2 I;  2RC4 A;  2L01 A;  3KEQ A;  2XDV A;  3HXL A;  1WVR A;  4LJZ F;  2WAQ N;  5IT9 K;  1N75 A;  1MMD A;  1S7O A;  3K4B A;  1ZTR A;  1HSJ A;  3GTL J;  1FLI A;  1HKS A;  1A31 A;  1GVJ A;  1FBS A;  1D3Y A;  5TRD A;  1PUE E;  1FMV A;  5DTD A;  3ABT A;  1W5S A;  3DTI A;  4ETS A;  1JHH A;  3Q5F A;  2CJJ A;  1QBJ A;  1J7K A;  2CQQ A;  1Y8R B;  5KCM A;  2PBI A;  2CFO A;  2H09 A;  2KZG A;  5D5W B;  5F08 A;  2OCC H;  3T5X A;  3K70 C;  5K7H A;  3RQI A;  3LOC A;  1JI8 A;  2LOO A;  5C4X J;  3ZQF A;  3IH3 A;  1S5L C;  3PFY A;  3OYL A;  4BXX J;  4XQF A;  2L9R A;  2M4G A;  1AWC A;  2HZT A;  1IXS B;  1M1E B;  2IP2 A;  2M7B A;  3EUH A;  2Z5U A;  1ORK A;  2G0E A;  2X1C A;  2L9S A;  2ID6 A;  3KZY A;  3PL8 A;  1PJR A;  4KIG A;  1UG2 A;  2GOM A;  1REP C;  4HRI A;  2EH3 A;  5IT3 A;  1U8B A;  4RLF A;  2ZXW H;  1NG6 A;  1EF4 A;  2OZU A;  1I27 A;  4LIT A;  1UJ8 A;  4LB5 A;  2ICW G;  4W97 A;  2KJC A;  1EKE A;  3ZQC A;  2L5Q A;  4U7B A;  3BC8 A;  5B1A H;  1HLV A;  3JRA A;  2LFB A;  2Y2Z A;  4MEX F;  3KP2 A;  5GTI C;  4R1H A;  2HS5 A;  4II2 A;  1BA5 A;  4X1E A;  1I1G A;  1MJ9 A;  3O3K A;  3IC7 A;  3GTG J;  3CMM A;  4A3E J;  1QQI A;  4XLE A;  3HOT A;  2IVM A;  5FKO A;  3SHF A;  1T38 A;  3CP8 A;  2DOE A;  1EH8 A;  2BW3 B;  5F64 A;  1JKR C;  1F5T A;  3E5X A;  1SFE A;  2VJ4 A;  2EJR A;  2BVL A;  2ESN A;  4A6D A;  2CUJ A;  1JUP A;  4UNO A;  3GTM J;  3ZQL A;  4BJ6 C;  3BG5 A;  4E4H A;  3MZ8 A;  2XVC A;  3L2V A;  2HVS A;  2L4M A;  1WZ2 A;  3HOZ J;  1JGS A;  1ZHF A;  4C9Y A;  1AKH B;  2EFN A;  2K9N A;  2NNN A;  1Y6I A;  4C2T A;  3HSR A;  2AXT C;  5KVR A;  1SFK A;  3M07 A;  3V8J A;  3FHZ A;  1Z3Y A;  1XG1 A;  2LMD A;  5M3M J;  1LDK B;  2DDB A;  4MNU A;  1T33 A;  1U9N A;  3QPS A;  1SC7 A;  4I98 B;  1B59 A;  1TNT A;  4M3F A;  5GAD J;  2ZXI A;  2NS8 A;  3P9I A;  3WU1 B;  1RET A;  3IKT A;  1FPQ A;  4E7L A;  3T1B A;  1FOY A;  2WY7 Q;  1V5G A;  1DP3 A;  3A2K A;  2IRF G;  4ZYD A;  1UHW A;  4QLC U;  4L0Y B;  4PGH A;  2JSC A;  2M45 A;  1JHF A;  1UST A;  4BQN A;  4J19 A;  4L9N A;  4B3X A;  2M3A A;  5BMZ A;  4KFC A;  3C1D A;  3KZI C;  5LHG A;  2HYF A;  5EF6 A;  5LEK A;  4LG3 A;  4ZDL A;  1H9T A;  3W6V A;  3BR1 A;  5IYD J;  1SEU A;  2L7Z A;  2O5R A;  3HUG A;  1UFM A;  2OF7 A;  1Y1W J;  5E79 C;  3FMS A;  5HDN A;  1WJ5 A;  2LBF A;  4HX4 A;  4RLQ A;  2QBY B;  4BQA A;  1MBJ A;  4UB6 C;  2ZCW A;  1U5T A;  4L5I A;  2JA8 J;  1YO5 C;  2D5V A;  1TQI A;  2YS9 A;  3WG9 A;  3ML6 A;  2ZC2 A;  4IQJ A;  3LL7 A;  3S2D J;  1MJA A;  1OYY A;  4G7Z F;  2X6Y A;  4ZZL A;  1W5T A;  2QSG X;  4ESB A;  3PUF A;  2ZNZ A;  1LDD A;  3HJE A;  1FBU A;  4KMU X;  3BG7 A;  3CQZ J;  1YRN B;  4LG0 B;  1TNS A;  1MH4 A;  3DP7 A;  3X2Q H;  2JA5 J;  1X19 A;  4L5E A;  2B63 J;  5JVG F;  5E3O A;  1T2K A;  4G94 A;  3J7Z I;  1CF7 B;  2OZ6 A;  4XRF A;  4JOM A;  4BE1 A;  4ZJZ A;  2X85 A;  3R60 A;  2CUE A;  4IHY A;  2IT0 A;  2L9N A;  2PMH A;  3PNT A;  3CD6 I;  3E0J B;  3BP8 A;  4BAY A;  4LGW A;  5E1Z B;  3EYY A;  5A2Q K;  3JRE A;  3GTQ J;  2DQL A;  3FZV A;  1WHU A;  2ECC A;  4V2F A;  3WTZ A;  2DYR H;  5DCF A;  3VPR A;  2JA7 J;  1UHS A;  3RCO A;  3FXJ A;  4MFD A;  5L3D A;  1VI0 A;  2DMQ A;  2OAZ A;  4M6X A;  4IHW A;  1XC5 A;  1ZG1 A;  3G1L A;  1BIB A;  1SD5 A;  2ELJ A;  2K85 A;  4BQO A;  4RM3 A;  1IDZ A;  1VQ9 I;  3O8H A;  2KP6 A;  3HHH A;  3S1N J;  5EYR A;  4M9X A;  2LY1 A;  2EIM H;  1NK3 P;  3A01 A;  3I4P A;  3ZRG A;  1TW2 A;  1E17 A;  3VSL A;  1POG A;  2DA1 A;  4M3G A;  4KJZ A;  4HYE A;  2HEO A;  1WGX A;  3FXO A;  4C2M J;  2QQA A;  4HDU A;  2E35 A;  2LLK A;  3BWG A;  3COA C;  1QU3 A;  2GIZ A;  1XDS A;  3PNY A;  4IRG A;  2F5D A;  2BY1 A;  2JTV A;  4RGS A;  2DA5 A;  2LY9 A;  1J2X A;  4IOC F;  2VPR A;  5KAI C;  2JN6 A;  3B6C A;  3QOE A;  4F52 A;  3HL2 A;  1XCV A;  3QRF F;  4Y52 J;  3F8N A;  2H94 A;  4U0W A;  4XLC A;  2ZBK A;  3HPH A;  5LGU A;  1ZRF A;  3V4G A;  2RVC A;  1LEA A;  1U9O A;  3PSI A;  1VQN I;  3JTH A;  2F5E A;  1HDD C;  3A03 A;  3IV5 A;  4I2O A;  5BQT A;  3MMY B;  1TBX A;  1Z67 A;  1O7F A;  1IUY A;  2EV6 A;  2LP0 A;  3C2H A;  1C0W A;  3ZOB A;  5BNG A;  1MSF C;  1YLF A;  3L1P A;  4X0G A;  3ZP5 A;  1OFC X;  1WJD A;  2IW5 A;  1S72 I;  3EUH C;  1J5Y A;  3BQZ A;  2JMW A;  2EK5 A;  1DP7 P;  1TWH J;  4D0P A;  4K2E A;  1LDJ A;  3HGY A;  2ZJR F;  1R5G A;  2ETH A;  2FBK A;  3BJA A;  5DS9 A;  1FYM A;  2ZKZ A;  3HDD A;  4A3L J;  1WQ2 A;  1XMK A;  2KL4 A;  5ICC A;  3M4O J;  3TL4 X;  4U88 A;  5D6F A;  1B6A A;  2HQA A;  4AVP A;  4EGY A;  3LAP A;  1FC3 A;  2AO9 A;  3OIQ A;  4ITV A;  1ENH A;  3V7S A;  1YE9 A;  3O8G A;  2MBF A;  3QOD A;  5A2Q Z;  3CDL A;  3WHC A;  2FA5 A;  4GDF A;  1ETX A;  2VQC A;  3TQN A;  3CO6 C;  3ZQH A;  4DNC A;  3WTV C;  2IGO A;  4A0Z A;  5LGT A;  3NEU A;  2ZJ2 A;  2VPL A;  4PSX A;  4CCJ A;  1YTY A;  1S29 A;  5IYC J;  4A6E A;  1SAN A;  2Z1D A;  4RAG A;  3FXQ A;  2I5U A;  4B44 A;  1KGS A;  3E6D A;  2EFW A;  3EPZ A;  4XLA A;  4OIQ F;  5DV5 A;  1HXD A;  3RDI A;  4N4O B;  1ZH5 A;  2P6S A;  3VYU B;  2HDW A;  4BBS J;  2YUS A;  5EG0 B;  2IS1 A;  3BG6 A;  4PSW A;  1R4N B;  3ABU A;  3RKW A;  3RIR A;  5HOO A;  5CVJ A;  5J47 A;  2KMU A;  2FRH A;  2HQR A;  2MC4 A;  1HOM A;  2DA2 A;  2KIS A;  2FBH A;  4FE4 A;  3K4K A;  3SZG A;  3H35 A;  4LIV A;  4EVI A;  1Z3X A;  2VAS A;  1X1A A;  3VB2 A;  1NTC A;  2Q0O A;  4CCL A;  3N4M A;  2KT0 A;  1OR7 A;  1X1D A;  3CUO A;  2KZV A;  2Y9Y A;  2A5W A;  2IAI A;  4Q48 A;  4M9Z A;  4Y13 A;  5JR3 A;  2QA4 I;  4G7O F;  3HSF A;  2VE9 A;  4FTH A;  5GTH C;  2HFH A;  1YW7 A;  2W82 A;  2ZJP F;  3VOD A;  3Q0V A;  3S3N A;  3AG4 H;  1WJB A;  2F48 A;  1T95 A;  4R79 A;  3RTR A;  3G1O A;  2OJE D;  3IWZ A;  3H5N A;  3CCE I;  5JHF A;  2F4O B;  3NAR A;  3C2G A;  3JTG A;  2P5V A;  3DBR B;  3JRH A;  2OQG A;  3I9V 2;  2CV1 A;  4A3J J;  3CME I;  2IPQ X;  3W2W A;  4HOB A;  4MTE A;  3FMR A;  3W3C A;  2M7A A;  3CLQ A;  1G59 A;  4BHP A;  5F1R A;  3S2H J;  5FLX K;  5M5X J;  2MC3 A;  3WTS C;  4KT6 A;  4BHC A;  1WH7 A;  3A01 B;  1OCZ H;  2GWR A;  4RM2 A;  3IRR A;  1WPK A;  2XRL A;  2EIN H;  1EH7 A;  1LVK A;  2XGC A;  3OYK A;  1B8I B;  2P6T A;  1AHD P;  3OOU A;  4G8X A;  3V42 A;  4DJA A;  4U87 A;  4UV8 A;  1W1W E;  4S0H B;  3ZMU A;  4IPA A;  1YX5 A;  5F6F A;  1J75 A;  1MSE C;  2HYG D;  2JQ7 A;  1HW5 A;  1FP1 D;  1XX5 A;  4WX9 A;  3VDX A;  1R49 A;  2A5Y B;  2X1D A;  3M9A A;  4L0Z B;  1ZLJ A;  2YX7 A;  2ZME C;  1BR1 A;  4A5M A;  1P9Q C;  3GX4 X;  2TDX A;  2VL8 A;  3BG9 A;  5F04 A;  5E18 F;  2NNY A;  4C2U A;  3EDP A;  4EM0 B;  4UV9 A;  4GYG A;  3OOP A;  2DA6 A;  1JKP C;  4YII A;  4BNC A;  4CGZ A;  3RZO J;  3QPL A;  3SZP A;  3GTO J;  3CZ6 A;  1YIT I;  2HOS A;  3LQR A;  1Y0N A;  1D1C A;  1OPC A;  1VQ8 I;  1Y8Q B;  4KDP A;  2DK8 A;  1R23 A;  2BHZ A;  2NOG A;  4G6D A;  1WJA A;  1D0Y A;  1X58 A;  5IP7 J;  4BE2 A;  5HS7 A;  2LF7 A;  3RSN A;  1Y39 A;  1X1B A;  2KIU A;  3RJP A;  5FKM A;  1QGP A;  1X2M A;  4FE7 A;  4B09 A;  2DFE A;  1WKM A;  5FB2 A;  4AYB N;  2EB7 A;  2A05 A;  1OYW A;  2F6C A;  3FK6 A;  3FXK A;  2QLZ A;  1QNT A;  3A0H C;  4UY8 I;  3CF5 F;  2XRN A;  2BW3 A;  4MQV A;  4E6K G;  1ZGA A;  2A68 F;  4A3D J;  3AG2 H;  1B9N A;  2W4S A;  1P4X A;  3WTX C;  2J5P A;  2ZB9 A;  4KIF A;  1WJF A;  2M2E A;  3OYD A;  3GVA A;  4I0A A;  3R0J A;  4RGU A;  1GVD A;  2LYC A;  1HDP A;  5D5V B;  2QQ8 A;  3CCV I;  1R5H A;  5DCM A;  1EA3 A;  3DFG A;  2R92 J;  1I5Z A;  3CCU I;  1FX7 A;  4CSW A;  3FXR A;  3EYI A;  2ZME B;  2OTJ I;  1S6L A;  5DM7 F;  2DDA A;  4XK4 A;  1KQ9 A;  4AM3 A;  2FX0 A;  2K86 A;  2K9Q A;  3HRS A;  5ILU A;  5FD5 A;  3CCS I;  2FSW A;  2WWY A;  2DAO A;  2GAU A;  1FBQ A;  2KLO A;  3GBG A;  2JA6 J;  1BM9 A;  3I54 A;  3K4C A;  3VYR B;  2YR2 A;  4HAM A;  4MIM A;  4WXH A;  4FAS D;  2FNP A;  4HSR A;  3DKW A;  3H92 A;  5FLV A;  2PI0 A;  4NHJ A;  3A1Y A;  2LF8 A;  2RKH A;  3RYR A;  4OU0 A;  1O3Q A;  1MMN A;  3WTU C;  4IRI A;  2RQQ A;  1G2H A;  1KZH A;  2V1U A;  2VKH A;  2NS0 A;  3HHG A;  3QP6 A;  4UXN A;  5HLH A;  4S04 A;  3LAJ A;  1DU0 A;  3EUK L;  4RB2 C;  2R7W A;  3E1S A;  3ZCO A;  4G7H F;  2VBW A;  1T8I A;  2CO5 A;  2O0Y A;  4V19 K;  3E7L A;  3QQA A;  5IPA A;  5J4V A;  4HA8 A;  3TOB A;  3OSF A;  2CV2 A;  2P81 A;  1V5E A;  2Z3Y A;  4I76 A;  3JAM K;  1A6I A;  2WA0 A;  2Y75 A;  1XCB A;  1WI9 A;  3TKY A;  4XON A;  1UMQ A;  1VQK I;  1K7A A;  3C3W A;  4LFU A;  2X6O A;  3HYI A;  2O8K A;  3FBN B;  2IS6 A;  3OWT A;  4LG0 A;  1YRN A;  1KYZ A;  4G12 A;  1O4X A;  4II3 A;  1X1C A;  1J09 A;  1VF9 A;  1GXQ A;  5JHU A;  4A12 A;  2HOA A;  2EV0 A;  5TJJ A;  2V9V A;  2CMP A;  2VQG A;  4A0Y A;  2MH9 A;  1MNE A;  2KDZ A;  1X3U A;  3BTL A;  2G9W A;  1QO0 D;  1U6G A;  2HKX A;  4IX7 A;  4JP0 A;  3GME A;  5E8G A;  5IP9 J;  4Y33 A;  2WAD A;  3VSK A;  2Y0S A;  1SAU A;  4V2G A;  5KK1 A;  5J8C A;  2ZNY A;  3CP2 A;  4MEY F;  3FDY A;  2XC7 A;  4WXD A;  4F91 B;  3QYF A;  3L7W A;  1DGR M;  2VUM J;  1MMA A;  1L0O C;  3HOX J;  2K9L A;  4HNV A;  5TIS C;  1WCM J;  3HM5 A;  1DGW Y;  1QPM A;  1XSV A;  2HPI A;  1X3W B;  1OJL A;  1SFX A;  4M3E A;  1SFU A;  2XF5 A;  5CQE A;  3KEO A;  3H3V K;  3TGN A;  4YIF A;  5K5Q A;  3PSF A;  5L3E A;  3IP4 B;  2HOE A;  4JBA A;  3ABM H;  1MBE A;  2JRM A;  2QQ9 A;  2P5L C;  5K5O A;  3LSJ A;  3M8E A;  2OU2 A;  2ELK A;  4XKV A;  3C7J A;  3CUQ B;  4YEL A;  2H1K A;  4LD5 A;  2E1O A;  2LC2 A;  2M4K A;  4TV7 A;  4BQQ A;  1IUF A;  1RI7 A;  4P55 A;  2A07 F;  3GFM A;  3G1M A;  4KIB A;  2X6X A;  5K1Y A;  1ZR4 A;  2WC2 A;  3AL0 B;  5JLX A;  2EZH A;  1RIO H;  1W36 C;  4ZYE A;  2ISZ A;  4AYB A;  3CJQ B;  4H0E A;  4XLH A;  2R7Q A;  5F1J A;  4NQW B;  4WWC A;  3L2U A;  1ERD A;  5IOZ A;  3LWF A;  2EPF A;  4PCQ A;  3Q9V A;  4QPQ A;  4DOZ A;  2XV4 S;  3OL3 A;  1LB2 A;  3I4N J;  4AD9 A;  2R0Q C;  4W1U A;  3ABK H;  4XLF A;  4IJA A;  1MW7 A;  5EZH A;  3H36 A;  2H27 A;  1KA8 A;  1ACI A;  3DBH B;  1V54 H;  2O61 A;  3QAH A;  3KCC A;  2PLY A;  2XPW A;  1D5Y A;  1ZK8 A;  3K6G A;  4HDV A;  1IRZ A;  5E20 A;  1U0J A;  4QWQ A;  3VYT B;  4RDU A;  3CCR I;  1YS6 A;  2RN7 A;  4XN0 A;  5KHD A;  5ED4 A;  2STW A;  2CQN A;  1OCC H;  4EJW A;  4KA4 A;  1DQU A;  2JJ7 A;  2VKV A;  2WY8 Q;  1TW3 A;  2QEN A;  1R71 A;  5JVT A;  1TP4 A;  4WCG A;  2EFQ A;  4XRS A;  2QBY A;  5B66 C;  2RRE A;  4D7M A;  2R5Y A;  1YJ9 I;  3K9T A;  4BYY A;  2MYS A;  3CCM I;  1KU7 A;  1RKW A;  1HW2 A;  4HF1 A;  2XPU A;  2W1O A;  3CJT B;  3JW4 A;  4MGR A;  4F3Q A;  3H0D A;  2DMU A;  1VZ0 A;  4UUV A;  1T98 A;  1G3W A;  4WK8 F;  3K69 A;  3OL4 A;  1ON1 A;  4EV0 A;  2D1H A;  2A6T A;  3T0Y A;  5FRO A;  3OYG A;  1LFU P;  2R7F A;  3SFI A;  2XB5 A;  2VON A;  3HRT A;  2KRC A;  3CCY A;  3F0C A;  2NYX A;  4FT8 A;  1RNL A;  1S9H A;  4A3K J;  1IW7 F;  4E70 A;  5D5U B;  5FFZ A;  1FYL A;  3OMY A;  2YPR A;  5H6R A;  3MZY A;  2LKP A;  1ETQ A;  5EEA A;  4U7D A;  1BJA A;  4BE0 A;  4N0B A;  2GXA A;  1JXS A;  2CU7 A;  1JJ8 C;  3ZMD A;  2AXL A;  2C6Y A;  4RA2 A;  4S05 A;  3DQV C;  2PJR B;  1KQ8 A;  1P2F A;  2D1V A;  1VQ6 I;  1Y1V J;  4O6J A;  3NWS A;  4B48 A;  2R7O A;  2L7M P;  1LVA A;  4YEJ A;  2I8D A;  3I3L A;  4D7N A;  3BDD A;  3H1C A;  3GFL A;  4JYK A;  1XGS A;  1ETY A;  4N9H A;  1Z6T A;  4NBQ A;  2LD5 A;  2EIJ H;  2K4B A;  4OAZ A;  1LKX A;  2LNB A;  5DUK A;  1BW5 A;  1IGN A;  2IJL A;  3C18 A;  3PQK A;  4AID A;  4IO9 F;  3RZD J;  2V1N A;  3K4M A;  4R8H A;  2XGD A;  1SD6 A;  2L02 A;  2F4I A;  2IA2 A;  2R3S A;  2KPM A;  4RB1 A;  2XAJ A;  1I50 J;  1KU9 A;  1VQ7 I;  4HST A;  1HC8 A;  1NHA A;  2HQ5 A;  4NC6 A;  3TBI A;  1HCR A;  1RUO A;  2W57 A;  4QTR A;  1TT0 A;  2XAQ A;  2JK3 A;  1GV2 A;  1HQC A;  2IA0 A;  3I5U A;  3DEE A;  3NQO A;  4CZC A;  2GLO A;  3I0T A;  2KRH A;  1ZLK A;  4NUB A;  4LOC A;  2HDD A;  4ENJ A;  3E6C C;  2FU4 A;  2P4W A;  1JTY A;  4EGZ A;  2XPV A;  1Z0X A;  3S2W A;  3S3O A;  4KUM A;  5ILV A;  4XR6 A;  4ZDO A;  3U9G A;  4QSH A;  2GXG A;  2QSH X;  1F36 A;  2WV1 A;  4DZP A;  1RKT A;  5DD8 A;  4KIC A;  3J81 Z;  1RC9 A;  2IGM A;  3WGH A;  3J80 K;  3JRG A;  3F21 A;  2EA4 A;  2P0W A;  1IO2 A;  3KE2 A;  4NNJ A;  3BR0 A;  2L9V A;  2ISY A;  1P4W A;  1R22 A;  1AU7 A;  2QM3 A;  2NAZ A;  2VB6 A;  2JPC A;  3CMY A;  1W4M A;  1B72 B;  1BJZ A;  4EAT A;  2HYJ A;  5EDN A;  3H9Q A;  1D1A A;  2JSP A;  1O57 A;  1MDM A;  2VOO A;  3HOV J;  5CVV A;  2XIG A;  1W0T A;  3TO9 A;  2Z99 A;  3HKZ N;  4XID A;  5DEQ A;  3F23 A;  5HLI A;  3BT9 A;  3JRC A;  5F27 A;  1Q1V A;  2UWM A;  4ZTJ A;  4DYC A;  5DDG A;  3P7N A;  1Z1D A;  2PQ8 A;  3BTC A;  1VTN C;  1FT9 A;  2K3P A;  3WTT C;  5J1R A;  3CCQ I;  2A6E F;  2CWE A;  3OSG A;  3OYB A;  2QEX I;  2CW0 F;  3PUB A;  2K3F A;  2E1M C;  4EEF G;  3ISP A;  2XHK A;  5HNH A;  2Z2S B;  5K7F A;  2LRD A;  4M9S A;  2LY2 A;  2DFI A;  1E0E A;  1MNM C;  2XAU A;  1NG7 A;  2L2O A;  1Z77 A;  2E5N A;  2LBF B;  4BEH B;  2E1C A;  2DK5 A;  3HRM A;  1RRJ A;  1DUX C;  2ACJ A;  5LRS A;  2VLA A;  3CDI A;  3IAM 2;  3GTJ J;  3V8K A;  2E7X A;  5KNL A;  1IN6 A;  1R1U A;  4L5J A;  5FLM J;  3BR3 A;  2DMT A;  2OQR A;  2QQB A;  2COB A;  2Y0M A;  4M3B A;  1ZRD A;  3F6O A;  2MFZ A;  2ZSI B;  2R5Z B;  4A3M J;  2V1D A;  1VQM I;  3OYM A;  5D4R A;  1GXP A;  2DOF A;  1AOY A;  1ODD A;  5FO5 A;  3DV8 A;  2DOD A;  1S3J A;  1ZEL A;  2LK2 A;  2O3F A;  2FOK A;  1R6R A;  3RI4 A;  4CA0 A;  1XS9 A;  2V26 A;  5ICF A;  4CO8 A;  2XSD C;  2IGN A;  3MN2 A;  5GPA A;  2EZK A;  1VQ5 I;  4KNY A;  1TTY A;  3CLO A;  2IXS A;  2K9M A;  3A4C A;  1J9I A;  2ZXH A;  2WTE A;  2BYV E;  2QF7 A;  2VOD A;  2DO7 A;  2L7K A;  4JX4 A;  3LST A;  3KLN A;  3OIP A;  2E2H J;  2NVY J;  3P9K A;  2FQ3 A;  4M74 A;  3U21 A;  2VJJ A;  1B72 A;  1I1S A;  3J7Y J;  5EGO A;  1YIJ I;  1BW6 A;  3PJR A;  1IV8 A;  3CCJ I;  1OQY A;  1IDY A;  2K9S A;  3DPU A;  3DKY A;  5LLQ A;  2DJN A;  4IF4 A;  3N05 A;  1B1B A;  4RGR A;  1MJB A;  2NXN B;  2CQ7 A;  2W84 A;  4AIJ A;  5H6Q A;  1Z6R A;  2HGC A;  1OCO H;  1AKH A;  1U2W A;  2VXZ A;  3WG7 H;  3OS1 A;  1KON A;  2VE8 A;  3KET A;  2Q2E A;  1MBG A;  1OIS A;  1ONV A;  4PJM A;  4RGX A;  1ULY A;  1V5F A;  4I0B A;  2R93 J;  1H88 C;  1KQ0 A;  3E6M A;  4N9I A;  3M7G A;  2LVS A;  3K2Z A;  2LG4 A;  2KRF A;  3IKV A;  2EFP A;  2XF7 A;  2Y31 A;  3FXL A;  2DI3 A;  3HC7 A;  3HKZ A;  1BC8 C;  2HOT A;  2E5Z A;  4CCO A;  4XL9 A;  1PP7 U;  4LK1 F;  4KIS A;  2VC0 A;  3OS0 A;  1HW1 A;  2CW7 A;  1XGM A;  2H6B A;  3E5U A;  5LRR A;  1OCR H;  2MW8 A;  3PIO F;  1I6X A;  4Z6Y A;  4HG2 A;  3EET A;  2GA1 A;  1TL8 A;  3BY6 A;  2Q2E B;  2Y30 A;  1N78 A;  4UUT A;  4CYC A;  1ZAO A;  1JUS A;  2EIL H;  3WU0 A;  5EJC A;  3LFK A;  2HR3 A;  2LTP A;  4XSZ F;  2ZJQ F;  2ID3 A;  4IZZ A;  1YQA A;  2RNJ A;  2Y0S N;  4LLG F;  2CQX A;  1Y56 A;  2HQN A;  4M72 A;  4M73 A;  4FX4 A;  4HX7 A;  3W6J B;  3IWF A;  4CCK A;  1LJ9 A;  3KP3 A;  2HXI A;  4EJO A;  4F7Z A;  4A3C J;  4D9J A;  1R00 A;  4B1R A;  1A04 A;  3RQ4 A;  4QIW N;  1VQO I;  1MMS A;  1YS7 A;  1YHQ I;  3GW2 A;  3I58 A;  5EGO B;  1TQM A;  3DPT A;  2NVU B;  2V6C A;  2L4A A;  3D5L A;  4J00 A;  3MD2 A;  1ETK A;  2EBI A;  2RV8 A;  4PJ0 C;  3ROU A;  5E3N A;  3AAF A;  1NH3 A;  2CGP A;  3WGG A;  1CF7 A;  4LIU A;  4PFP A;  1G6N A;  4XNF A;  5M5Y J;  2CQK A;  2M87 A;  2QZ8 A;  4P5O A;  5E3M A;  2R4G A;  2MGQ A;  3L2R A;  1LUJ B;  5FFX A;  5M3F J;  4KN4 X;  3TP0 A;  4XKW A;  2TRT A;  4CH7 A;  1E2X A;  2XGX A;  2HPM A;  1T0F C;  3F8F A;  2DPU A;  3OYH A;  3K4J A;  3KYL A;  2UXX A;  4EM1 A;  3ZGK A;  2R7R A;  2NVX J;  1GLN A;  3L2W A;  4XN3 A;  5FKL A;  1SD7 A;  4RAZ A;  5ERI A;  1HF0 A;  4UB8 C;  1EV7 A;  2R5Y B;  1EJ9 A;  4GXO A;  4M71 A;  2HVR A;  3K1N A;  2ESH A;  5F0C A;  3OV8 A;  5E1X A;  5HDG A;  3MKY B;  1A36 A;  2R7U A;  5BPI A;  2X48 A;  1Z9C A;  2M0C A;  5EG0 A;  2R5Z A;  2DU9 A;  2CV0 A;  4O5V A;  2HI3 A;  1P7I A;  3M1E A;  2Y69 H;  2O8X A;  4XSX F;  1PYV A;  2ZXJ A;  1S8N A;  2WAQ A;  2QSF X;  3KIO A;  3RPU D;  1XTA A;  5HLG A;  3BR2 A;  4BGD A;  1EH6 A;  2VC1 A;  2KFD A;  3ONQ A;  4HF2 A;  1JKO C;  2CG4 A;  2LRE A;  4ZDP A;  3DEU A;  3TDZ C;  2BY2 A;  2E1M B;  2FOW A;  2QKL B;  4PFO A;  3KFW X;  2G7H A;  4XM3 A;  2GOX B;  4AIK A;  4P1W A;  1U3E M;  5EZG A;  3BTI A;  4D5C A;  2E60 A;  2WAF A;  1K6Y A;  3LA3 A;  3CC4 I;  1ETO A;  3H0G J;  1IAW A;  3LMM A;  3TO7 A;  3S3M A;  1JUM A;  3TP3 A;  1UEL B;  1H8A C;  3L2Q A;  2EV5 A;  2X9D A;  3GCM A;  4E7H A;  4IHV A;  5IP6 A;  1JKQ C;  1V3F A;  4UVA A;  3JRD A;  3G73 A;  3G3Z A;  4L9J A;  1W7P A;  1STZ A;  2EFO A;  1I3A A;  4J01 A;  3DKX A;  4B47 A;  3Q0W A;  3ZMV A;  1NK2 P;  3H5A A;  4B3A A;  2M9H A;  1V55 H;  3CF2 A;  2M34 A;  1Z7U A;  2OCE A;  4BS9 A;  1JTX A;  2IBD A;  1FSE A;  3B6A A;  4P96 A;  4A3F J;  2DMN A;  4BAC A;  3O2P E;  1HKT A;  1YFH A;  2HTS A;  3K0L A;  4ESJ A;  3MZH A;  2FE3 A;  1UZC A;  4C3H J;  4G6Q A;  1QVU A;  3DF8 A;  2AHQ A;  2WAE A;  1BR2 A;  5FD6 A;  2JA2 A;  2MD5 A;  1SFO J;  2V4J C;  3H5R A;  2ELH A;  4U0V A;  3DTK A;  1IRX A;  3JAM Z;  1R9T J;  1VQP I;  5IYB J;  4AWX B;  3FMQ A;  5GAH J;  3S17 J;  4HQE A;  4HPQ A;  4XBF A;  4UHT A;  1U8R A;  3DLA A;  4KYW A;  2VJ5 A;  2XAG A;  1QA6 A;  4UUS A;  2B7E A;  3I59 A;  2MAB A;  3FHN A;  2OA4 A;  2K27 A;  3PM1 A;  1U78 A;  2X51 A;  5ICG A;  2H1L A;  3KPH A;  3BRO A;  2JRT A;  3LFU A;  1BOB A;  4D5F A;  5CVR A;  2LDU A;  2WV0 A;  2GQQ A;  4ZYH A;  5IY5 H;  5M5W J;  2GA2 A;  2L0K A;  1ON2 A;  2V7F A;  2P8T A;  3FK7 A;  2MG4 A;  3BG3 A;  5D6E A;  2PX9 A;  2AQE A;  4BJ5 C;  4XKC A;  3KP4 A;  4KN7 X;  4UVB A;  4OIP F;  2JWT A;  5DM6 F;  3UR3 C;  2O7O A;  2DA7 A;  2XUB A;  2DLL A;  3HOY J;  1J0R A;  1GUU A;  1XN7 A;  4E7S A;  5D8K B;  3CES A;  2R7T A;  2A61 A;  3F72 A;  1BI3 A;  3L9F A;  1RR7 A;  2VXD A;  3JRI A;  1XSD A;  4ON0 A;  3ASN H;  4ZYA A;  1W7P D;  3ZMT A;  4IOA F;  1FMW A;  2XB0 X;  3CJR B;  2CSO A;  3EUA A;  1Z21 A;  4ZZD A;  3DWL E;  3PO3 J;  1XDU A;  1T56 A;  3ERE D;  3TMO A;  3RKY A;  2RQP A;  3KEY A;  2VIX A;  3I71 A;  1BI1 A;  3W2V A;  1J59 A;  3ZQ7 A;  4CYC B;  3PQJ A;  4Y7N J;  5B3S H;  3OYI A;  1MMG A;  1LE8 A;  2BZT A;  2RGV A;  4QPO A;  2M30 A;  3GF2 A;  2PJP A;  2JZY A;  2VBX A;  1YOV B;  3AKZ A;  2PMZ N;  1D0Z A;  1RES A;  5J6X A;  3BR6 A;  2DTZ A;  3FF5 A;  5E1W A;  1QZZ A;  4BXU A;  1X3Z B;  2JPB A;  4LLN A;  3MKW B;  1TWF J;  3HTU A;  1R58 A;  3L2C A;  1PUF B;  1BOA A;  2KIF A;  2P5K A;  3O6B B;  2QGU A;  1X4P A;  2CW8 A;  3KYC B;  4I99 C;  2F5V A;  2MA3 A;  1PP8 F;  1ZR2 A;  3ZPL A;  3AL0 C;  3ZMS A;  1A6Q A;  2V1X A;  4OIN F;  1BI0 A;  1MND A;  1R4M B;  4CCM A;  4ESF A;  4I6Z A;  1HA8 A;  4OMY A;  1SMY F;  3GZN B;  2DT6 A;  1G8X A;  1JT0 A;  1MIJ A;  5J8F A;  2PN6 A;  3ESW B;  1UB9 A;  3W2A A;  4AC0 A;  2P7V B;  4BBR J;  3OIO A;  4PJJ A;  2LH9 A;  3MQ0 A;  2DA4 A;  3E97 A;  3AG1 H;  2BY3 A;  1A5J A;  2DQR A;  1MBF A;  2RAE A;  1PDN C;  2ME6 A;  3UKG A;  2Z9O A;  4CHU A;  3WU2 C;  2MSY A;  3HIF A;  3SJM A;  2FJ1 A;  3H3U A;  4LLL A;  2G7U A;  2QYO A;  4RAY A;  4UVC A;  1XD7 A;  3MVP A;  4RS8 A;  2CUZ A;  2EWN A;  3GEZ A;  1IRG A;  1R1V A;  5EEG A;  1LQ1 A;  3E5Q A;  3GLX A;  3K1M A;  1IN4 A;  3TED A;  1BBY A;  4C30 A;  3U1D A;  3D1N I;  1QRY A;  5K7Z A;  2H8R A;  3OYE A;  1BI2 A;  3P5J A;  1FZP B;  1WRJ A;  3FIS A;  4GO1 A;  1MH3 A;  3CC2 I;  2XAF A;  3ZN0 A;  3KP7 A;  1XGN A;  1YX3 A;  3AG3 H;  2VQH A;  1BIA A;  3F3X A;  2A6H F;  1DU6 A;  4HBL A;  3ECH A;  4FHT A;  1Y0U A;  4DQ2 A;  5CPR B;  1OCP A;  4ENK A;  2VJI A;  3LNQ A;  2CYY A;  2DFH A;  2BOL A;  1K4T A;  1LEB A;  3J81 K;  2WB1 A;  1VQ4 I;  3PNV A;  3U2R A;  5GPC A;  2VKD A;  2E7W A;  5HLT A;  3J7A Y;  2M1B A;  3OYN A;  3A02 A;  4BU2 A;  2DFF A;  4I02 A;  2B9S A;  2OTL I;  3WOD F;  5HS9 A;  5JI6 A;  1XGO A;  3FM5 A;  1QHH D;  5KAF C;  5L3F A;  1P6R A;  2LKS A;  1D0X A;  1T39 A;  1LNW A;  1X4O A;  4YG2 F;  3GFI A;  4F92 B;  1QZE A;  3JRB A;  4OOI A;  3S1Q J;  4PDK A;  5K5R A;  3D0S A;  2BBY A;  3F6V A;  1MBH A;  3VYS B;  1WJC A;  1X2N A;  2FD5 A;  2XRO A;  3FWE A;  1A35 A;  4IQ4 A;  1X1P A;  2DCE A;  1SMT A;  4D1Q A;  4OMZ A;  1FIP A;  1IN7 A;  4BKX A;  3DBL B;  4FCY A;  3F8M A;  3MKL A;  2DMP A;  3E6B A;  1Z05 A;  1O3R A;  2UXN A;  5DCM B;  3K1P A;  4PGG A;  2R7D A;  3ELK A;  3DU6 A;  4LK0 F;  4MO7 A;  2DYS H;  2Y9Z A;  3SFZ A;  3S8P A;  3CUQ C;  3R0A A;  4IVN A;  3OR1 C;  4P9U A;  2E19 A;  1E3H A;  4AVZ A;  2KIM A;  3DU5 A;  4DBQ A;  1E3P A;  4A3G J;  2VKE A;  3S1M J;  2X1E A;  4EJT A;  3BCB A;  3OYF A;  1N25 A;  2K7L A;  4CXF A;  3HRU A;  4WXC A;  2ME0 A;  4L9T A;  4CYD A;  1MD0 A;  1P7J A;  3H9J A;  4HQM A;  1RUN A;  3S14 J;  2OBP A;  1WSU A;  4BJT A;  2OV7 A;  4ASN A;  3ERM A;  2QVO A;  2DBB A;  1FNN A;  5B5E C;  5LGN A;  5FLX Z;  2FXA A;  2W48 A;  1YJN I;  2YSR A;  3S16 J;  4Y15 A;  4EJV A;  4AIH A;  5EEH A;  4MQ9 F;  1YG2 A;  1GT0 C;  2P7C B;  1G3Y A;  4BDY A;  2QKM B;  4HZF A;  2W25 A;  4UUS B;  4NC8 A;  4WF2 A;  2QUF A;  3VFZ A;  4DYQ A;  3ZMZ A;  3ZQQ A;  2K4J A;  2F4M B;  2Z16 A;  4BXF A;  1DDN A;  1OYI A;  5LHI A;  1ETW A;  2M0M A;  1QVT A;  5FRM A;  4ZC3 A;  2ZSH B;  1FP2 A;  2EZI A;  2Q8K A;  4ZTF A;  3M8J A;  5ICE A;  1IG7 A;  4PZJ A;  3SEQ A;  4IRH A;  3BPX A;  5CJ9 A;  1Z91 A;  1ZYR F;  4ZYG A;  2KHM A;  5TGT A;  4BH9 A;  1PVE A;  3B73 A;  1FY7 A;  2W7N A;  3L00 A;  2XAH A;  3TDU C;  4JQF A;  3BZC A;  3V8L A;  4U0Y A;  3K70 D;  3M3Y J;  5F0H A;  4HNU A;  5JLW A;  1K79 A;  5J3L A;  1G4D A;  2EA2 A;  3IH2 A;  1F1Z A;  5HOD A;  1JGG A;  2KQR A;  1F4K A;  4YFX F;  2XF6 A;  2OUM A;  2W85 A;  3FXU A;  4GGG A;  4PJN A;  4OAY A;  1T0F A;  1IXC A;  5CVI A;  5DUI A;  1WI3 A;  5HNF A;  3T8R A;  2YU9 J;  3TW6 A;  2A3S A;  4X6A J;  4MHG A;  1ITY A;  2EZL A;  3HOS A;  3W6K B;  1K6O A;  3ZN1 A;  4E7I A;  2HVQ A;  2X4H A;  2BV6 A;  4Y3O A;  1K4S A;  4EMS A;  1OCT C;  3F8B A;  2GXB A;  4PUS A;  4M6Y A;  4NB5 A;  3MWM A;  5IT9 Z;  1OKR A;  4E7K A;  1P4A A;  2AS5 F;  2CH0 A;  2VT3 A;  3Q9S A;  3PFI A;  4HLX A;  2IEK A;  5GP9 A;  5LBQ A;  3R6S A;  4GRI A;  1IXR C;  2D2W A;  3BPV A;  5FJ8 J;  2V6E A;  3A0B C;  2R7Z J;  2MLG A;  4IKF A;  2R7X A;  1ZG5 A;  4B4C A;  3P9C A;  1YW8 A;  3M8F A;  1IF1 A;  5JFR A;  1B8I A;  3GZ5 A;  3CUQ A;  4XLP F;  3I59 B;  2EQR A;  3S1R J;  1CQT A;  4E7Z A;  3ABL H;  3WGI A;  6PAX A;  1F43 A;  1YYV A;  1IJW C;  2BHY A;  2RNG A;  1T08 B;  2PFB A;  1MGT A;  3D5R C;  3S32 A;  4LB6 B;  4H4K C;  4KMF A;  2K40 A;  3H9G A;  3SDB A;  3NAU A;  4NQW A;  1VQL I;  4EM2 A;  1FYK A;  3HEF A;  4L18 B;  2KDO A;  2H8W A;  1B4A A;  4FQG A;  3JSP A;  4RAF A;  2ECB A;  2UV1 A;  5CVU A;  2D45 A;  2R7V A;  2ADU A;  5J4Y A;  3G2B A;  1SAX A;  1E3O C;  1FEX A;  1K78 A;  2COM A;  4XLN F;  1JT6 A;  4JX6 A;  3DCF A;  3OR2 C;  2BE5 F;  4E7J A;  3S15 J;  2FQ4 A;  1XMA A;  2ZFU A;  4GYI A;  4B8X A;  2BGC A;  3OYJ A;  2Q1Z B;  3JSO A;  4CZZ A;  4YFK F;  3CMA I;  1ZN2 A;  2W00 A;  1I3Q J;  3REO A;  4XOP A;  4RBO A;  5AIQ A;  5E17 F;  2I10 A;  4A5N A;  3KLO A;  2MD0 A;  5CQG A;  2Y48 A;  3WTY C;  2DA3 A;  3VEP A;  4YRV A;  2FBI A;  4HNT A;  5HVQ C;  4C3I J;  3PIP F;  3GYH X;  1D5V A;  4DYR A;  1GHC A;  4C3J J;  3K4L A;  3CJN A;  4HV5 A;  2XKP A;  3ZR8 X;  1WH5 A;  1FOW A;  2VI6 A;  3SEZ A;  5CKT A;  2KIQ A;  2M8E A;  2VQL A;  2V9K A;  2FF4 A;  2LSO A;  3LQQ A;  2HU9 A;  3J7A O;  1LFP A;  3KX2 A;  3GWZ A;  3NRV A;  4G9Y A;  5FKN A;  5AIP A;  4F93 B;  3OYA A;  3I53 A;  1R1T A;  4I7H A;  1LPQ A;  4Q5S F;  2ZFW A;  2NRA C;  1L3L A;  3BR5 A;  3KP6 A;  2OD5 A;  1W36 D;  1QPI A;  5C4J J;  1IN8 A;  5CYV A;  3I55 I;  1MKM A;  3FKJ A;  3KP5 A;  1P92 A;  5LHH A;  2DOA A;  2DXI A;  4A3B J;  3LSP A;  4ZH4 F;  3QU6 A;  4IHT A;  5AON A;  3GTK J;  3DLL F;  3ZXS A;  3SYT A;  2AQF A;  2CFX A;  1BC7 C;  4BY7 J;  2QCO A;  5D5X B;  1BL0 A;  9ANT A;  2VBY A;  1N77 A;  5ILS A;  3MKZ A;  3PO2 J;  2PMZ A;  1D8K A;  2OC6 A;  1B9M A;  3K2A A;  3QYE A;  2DT7 B;  3HSE A;  1ZGJ A;  4KT5 C;  5HDK A;  2UUZ A;  2GM4 A;  1WFX A;  3LSM A;  3RPU A;  4AU7 A;  1RPW A;  3MCZ A;  1CGP A;  4AUX A;  3FXM A;  2KJB A;  3WTW C;  3FBI B;  1IRF A;  1ZQ3 P;  4IHX A;  2K02 A;  5GAE J;  5HS8 A;  1KU2 A;  3JRF A;  3HTS B;  4XMY A;  5BPD A;  3ASO H;  4DGW B;  5FRN A;  5BS6 A;  5IOY A;  3FX3 A;  1YW9 A;  4FET A;  3RKX A;  2XSJ C;  3DEW A;  1IV6 A;  3ZQI A;  3I4M J;  4OWR B;  4RB3 C;  1TWA J;  3NWT A;  2E36 A;  4A0X A;  2HWV A;  4A69 C;  4ABZ A;  4A93 J;  2E2I J;  2BEO A;  1ZKG A;  4I09 A;  2O03 A;  1TT5 B;  3FIW A;  1BN5 A;  4MFE A;  3IRQ A;  1SD4 A;  1MBK A;  2W24 A;  3HUG B;  2DW4 A;  5F0F A;  4A2U A;  5LEJ A;  3TOA A;  1UG0 A;  3QU3 A;  2N8G A;  3Q0U A;  5J40 A;  4Q4Z F;  4XOT A;  3QWL A;  2DPD A;  2STT A;  3L09 A;  5CLS A;  1XPX A;  2YX4 A;  3HZJ A;  3UNG C;  4B43 A;  3HPG A;  3T8T A;  2MH2 A;  3IAS 2;  3IH4 A;  4CCN A;  4HV6 A;  2V79 A;  1ZG3 A;  1QZY A;  2HNH A;  1FWZ A;  3G71 I;  3CTA A;  2IA1 A;  2GZW A;  3F9K A;  2QWW A;  1W0U A;  4BL0 B;  2DN0 A;  3DTE A;  1XSX A;  4IHS A;  3BZ6 A;  3OYC A;  3CC7 I;  5C3E J;  1MZB A;  2O9L A;  2VBZ A;  3AFH A;  3HG9 A;  2RDP A;  1R5I D;  3FKI J;  4CDG A;  2PG4 A;  4F55 A;  5FGM A;  1O3S A;  2NVQ J;  1R7J A;  4XRS G;  3BJO A;  3D5S C;  4HLY A;  2BXY A;  4EQQ A;  1IC8 A;  2F5C A;  3GUD A;  2O6G E;  2VN2 A;  2NVT J;  1FSH A;  4FIS A;  1WJE A;  1FIA A;  2LR8 A;  2M5W A;  5B1B H;  3I56 I;  1RR8 C;  2VOP A;  2BY0 A;  3Q3S A;  3G6E I;  3R4K A;  3F8C A;  4ANJ A;  3H3Z A; 
#chains in the Genus database with same CATH homology
 2L54 A;  1G3T A;  3WE3 A;  2DTR A;  3MEX A;  2E1N A;  1RZ4 A;  3DXJ F;  1XB4 A;  4Z2Y A;  2JT1 A;  1ZAR A;  2XKO A;  2Z33 A;  1IZ1 A;  3BOQ A;  1W7P B;  2GIV A;  3R61 A;  3EQL F;  2F2E A;  1H9G A;  5L3B A;  2KKO A;  1IN5 A;  1ZRE A;  3QOP A;  2XAS A;  3CDH A;  2FEZ A;  1MDM B;  4CIC A;  4ENM A;  4JK1 X;  4LMY A;  3E3V A;  4OIO F;  1H0M A;  1UHM A;  3F22 A;  4MTD A;  1DPU A;  3V7C A;  4EJU A;  3I64 A;  3LA7 A;  2H6C A;  3QP5 A;  3FM3 A;  5H20 A;  2ZO4 A;  1ZRC A;  1K78 B;  1USS A;  3QPH A;  2X0L A;  1DPR A;  3KZZ A;  4P9F A;  4Q47 A;  1JE8 A;  4Y17 A;  2HDC A;  2A69 F;  3MAJ A;  3SXY A;  3RYP A;  3SQN A;  4FX0 A;  2PMU A;  4HX8 A;  1G3S A;  4RB0 A;  1TLH B;  3BJ6 A;  4GCV A;  2FNA A;  1F9N A;  4I01 A;  1O3T A;  2J5O A;  2HTJ A;  3SZT A;  3WE2 A;  1Q1H A;  1U5T C;  3IHU A;  5DD4 A;  3RPQ A;  3ULQ B;  4O3M A;  3VOE A;  3GFJ A;  3QPT A;  3LA2 A;  2DT5 A;  4OIR F;  3CO7 C;  1YIO A;  2FMY A;  1KU3 A;  1HBX G;  5DYM A;  3GO5 A;  2UZK A;  1T6S A;  3IL2 A;  1WWX A;  4YFN F;  2PEX A;  2MLK A;  5D8L B;  2F5F A;  3GZ6 A;  3MFK A;  3GXO A;  1O7L A;  4IXA A;  5L3G A;  3B02 A;  1V4R A;  4HW0 A;  1D8J A;  1KYW A;  3TO6 A;  3ECO A;  1TQP A;  2ZME A;  4HF0 A;  3J80 Z;  4BHB A;  1FOK A;  1R36 A;  5BOX A;  5L3C A;  1OMI A;  5D4S A;  1U5T B;  3N97 A;  2VT2 A;  3DPL C;  2L3D A;  3V7R A;  2YU3 A;  5E8I A;  1HST A;  1UCR A;  4L9V A;  2B0L A;  2FML A;  1S7A A;  4ENN A;  2HKO A;  1HKQ A;  2RC4 A;  2L01 A;  3KEQ A;  4LJZ F;  5IT9 K;  1S7O A;  1HSJ A;  1FLI A;  1HKS A;  1GVJ A;  1FBS A;  1D3Y A;  5TRD A;  1PUE E;  3ABT A;  1W5S A;  4ETS A;  1JHH A;  3Q5F A;  1QBJ A;  1J7K A;  2PBI A;  2H09 A;  5D5W B;  3T5X A;  1AWC A;  2HZT A;  1IXS B;  2IP2 A;  3EUH A;  2Z5U A;  3KZY A;  4KIG A;  1REP C;  5IT3 A;  2OZU A;  1I27 A;  4LB5 A;  2KJC A;  4U7B A;  4MEX F;  3KP2 A;  4R1H A;  2HS5 A;  1I1G A;  1MJ9 A;  3O3K A;  3IC7 A;  1QQI A;  3HOT A;  2IVM A;  3SHF A;  1T38 A;  1EH8 A;  5F64 A;  1F5T A;  3E5X A;  1SFE A;  2EJR A;  2ESN A;  4A6D A;  4UNO A;  2XVC A;  2L4M A;  1JGS A;  1ZHF A;  2EFN A;  2NNN A;  3HSR A;  5KVR A;  3V8J A;  3FHZ A;  1LDK B;  4MNU A;  4I98 B;  1B59 A;  1TNT A;  3WU1 B;  3P9I A;  3IKT A;  1FPQ A;  3T1B A;  2IRF G;  4ZYD A;  1UHW A;  4QLC U;  4L0Y B;  4PGH A;  2JSC A;  2M45 A;  1JHF A;  1UST A;  4L9N A;  5BMZ A;  4KFC A;  3C1D A;  5LHG A;  2HYF A;  5LEK A;  1H9T A;  3HUG A;  1UFM A;  3FMS A;  5HDN A;  4HX4 A;  2QBY B;  4BQA A;  2ZCW A;  1U5T A;  4L5I A;  1YO5 C;  1TQI A;  3WG9 A;  3ML6 A;  1MJA A;  1OYY A;  4G7Z F;  4ZZL A;  1W5T A;  4ESB A;  2ZNZ A;  1LDD A;  1FBU A;  4KMU X;  4LG0 B;  1TNS A;  3DP7 A;  1T2K A;  4G94 A;  1CF7 B;  2OZ6 A;  4XRF A;  3R60 A;  2IT0 A;  2PMH A;  3BP8 A;  4BAY A;  4LGW A;  5E1Z B;  3EYY A;  5A2Q K;  2DQL A;  3FZV A;  3WTZ A;  5DCF A;  5L3D A;  2OAZ A;  4M6X A;  1ZG1 A;  1BIB A;  1SD5 A;  3HHH A;  4M9X A;  3I4P A;  1TW2 A;  1E17 A;  4HYE A;  2HEO A;  2QQA A;  4HDU A;  3BWG A;  3COA C;  1XDS A;  4IRG A;  2F5D A;  2JTV A;  4RGS A;  1J2X A;  1XCV A;  3QRF F;  3F8N A;  2H94 A;  4U0W A;  2ZBK A;  5LGU A;  1ZRF A;  3V4G A;  2RVC A;  1LEA A;  3JTH A;  2F5E A;  4I2O A;  5BQT A;  1TBX A;  1O7F A;  1IUY A;  2EV6 A;  1C0W A;  1YLF A;  3ZP5 A;  2IW5 A;  1J5Y A;  2EK5 A;  1DP7 P;  4D0P A;  4K2E A;  1LDJ A;  1R5G A;  2ETH A;  2FBK A;  3BJA A;  1FYM A;  2ZKZ A;  1WQ2 A;  1XMK A;  5ICC A;  4U88 A;  5D6F A;  1B6A A;  4AVP A;  4EGY A;  3LAP A;  1FC3 A;  3V7S A;  2MBF A;  5A2Q Z;  2FA5 A;  3TQN A;  3CO6 C;  4DNC A;  3WTV C;  4A0Z A;  5LGT A;  3NEU A;  2ZJ2 A;  1YTY A;  1S29 A;  4A6E A;  3FXQ A;  1KGS A;  3E6D A;  2EFW A;  4OIQ F;  5DV5 A;  1HXD A;  3RDI A;  1ZH5 A;  2P6S A;  3ABU A;  3RKW A;  3RIR A;  5HOO A;  5CVJ A;  2FRH A;  2HQR A;  2FBH A;  4EVI A;  3VB2 A;  2Q0O A;  3N4M A;  1OR7 A;  3CUO A;  4Q48 A;  4Y13 A;  4M9Z A;  5JR3 A;  4G7O F;  3HSF A;  2VE9 A;  2HFH A;  1YW7 A;  3VOD A;  4R79 A;  3RTR A;  3IWZ A;  3JTG A;  2P5V A;  2OQG A;  2IPQ X;  4HOB A;  4MTE A;  3FMR A;  4BHP A;  5F1R A;  5FLX K;  2MC3 A;  3WTS C;  4BHC A;  2GWR A;  3IRR A;  1EH7 A;  2P6T A;  4G8X A;  4UV8 A;  3ZMU A;  4IPA A;  5F6F A;  1J75 A;  2HYG D;  1HW5 A;  1FP1 D;  4WX9 A;  2A5Y B;  3M9A A;  4L0Z B;  1ZLJ A;  2YX7 A;  4A5M A;  3GX4 X;  2TDX A;  5E18 F;  2NNY A;  3EDP A;  4EM0 B;  4UV9 A;  4GYG A;  3OOP A;  4YII A;  4BNC A;  4CGZ A;  3SZP A;  3LQR A;  1OPC A;  4KDP A;  2DK8 A;  1R23 A;  4G6D A;  5HS7 A;  2LF7 A;  2KIU A;  3RJP A;  1QGP A;  4B09 A;  1WKM A;  5FB2 A;  2EB7 A;  1OYW A;  2QLZ A;  1QNT A;  2XRN A;  4MQV A;  1ZGA A;  2A68 F;  1B9N A;  1P4X A;  3WTX C;  2J5P A;  4KIF A;  3GVA A;  4I0A A;  3R0J A;  4RGU A;  5D5V B;  1R5H A;  5DCM A;  3DFG A;  1I5Z A;  1FX7 A;  3FXR A;  3EYI A;  2ZME B;  1S6L A;  1KQ9 A;  2K86 A;  3HRS A;  5ILU A;  5FD5 A;  2FSW A;  2WWY A;  2DAO A;  2GAU A;  1FBQ A;  1BM9 A;  3I54 A;  2YR2 A;  4HAM A;  4WXH A;  2FNP A;  3DKW A;  3H92 A;  2PI0 A;  4NHJ A;  2LF8 A;  2RKH A;  3RYR A;  4OU0 A;  1O3Q A;  3WTU C;  4IRI A;  2V1U A;  3LAJ A;  2NS0 A;  3HHG A;  3QP6 A;  4UXN A;  5HLH A;  4S04 A;  4RB2 C;  4G7H F;  2VBW A;  2CO5 A;  2O0Y A;  4HA8 A;  3TOB A;  2Z3Y A;  3JAM K;  2Y75 A;  1XCB A;  1WI9 A;  3TKY A;  1K7A A;  3C3W A;  4LFU A;  3HYI A;  4LG0 A;  1KYZ A;  1GXQ A;  5JHU A;  4A12 A;  2EV0 A;  5TJJ A;  2V9V A;  4A0Y A;  2MH9 A;  1X3U A;  2G9W A;  1QO0 D;  1U6G A;  2HKX A;  5E8G A;  5KK1 A;  5J8C A;  2ZNY A;  4MEY F;  4WXD A;  3L7W A;  1L0O C;  1QPM A;  1XSV A;  1SFX A;  1SFU A;  3KEO A;  3TGN A;  4YIF A;  5K5Q A;  5L3E A;  2HOE A;  4JBA A;  2QQ9 A;  2P5L C;  5K5O A;  3M8E A;  2OU2 A;  3C7J A;  3CUQ B;  4LD5 A;  4TV7 A;  1RI7 A;  4P55 A;  2A07 F;  3GFM A;  4KIB A;  5K1Y A;  2WC2 A;  1RIO H;  4ZYE A;  2ISZ A;  4H0E A;  4WWC A;  3LWF A;  4PCQ A;  3Q9V A;  2XV4 S;  1LB2 A;  4AD9 A;  4IJA A;  2H27 A;  1KA8 A;  2O61 A;  3QAH A;  3KCC A;  2PLY A;  4HDV A;  5E20 A;  4QWQ A;  1YS6 A;  2RN7 A;  5ED4 A;  2STW A;  4EJW A;  4KA4 A;  1TW3 A;  2QEN A;  5JVT A;  4WCG A;  2EFQ A;  2QBY A;  3K9T A;  4BYY A;  1KU7 A;  1HW2 A;  4HF1 A;  3JW4 A;  4MGR A;  4UUV A;  1T98 A;  1G3W A;  4WK8 F;  3K69 A;  1ON1 A;  4EV0 A;  2D1H A;  3T0Y A;  2R7F A;  2VON A;  3HRT A;  2NYX A;  4FT8 A;  1RNL A;  1IW7 F;  4E70 A;  5D5U B;  5FFZ A;  1FYL A;  2YPR A;  5H6R A;  3MZY A;  2LKP A;  4U7D A;  1BJA A;  4N0B A;  1JXS A;  3ZMD A;  2AXL A;  2C6Y A;  4S05 A;  3DQV C;  1KQ8 A;  1P2F A;  2D1V A;  4O6J A;  1LVA A;  3BDD A;  3GFL A;  1XGS A;  4N9H A;  1Z6T A;  2K4B A;  2LNB A;  5DUK A;  2IJL A;  3C18 A;  3PQK A;  4R8H A;  1SD6 A;  2L02 A;  2IA2 A;  2R3S A;  4RB1 A;  2XAJ A;  1KU9 A;  1NHA A;  1RUO A;  2W57 A;  2XAQ A;  1HQC A;  2IA0 A;  3I5U A;  3NQO A;  3I0T A;  1ZLK A;  4ENJ A;  3E6C C;  2FU4 A;  2P4W A;  4EGZ A;  3S2W A;  4KUM A;  5ILV A;  3U9G A;  2GXG A;  5DD8 A;  4KIC A;  3J81 Z;  3WGH A;  3J80 K;  3F21 A;  2EA4 A;  3KE2 A;  2ISY A;  1P4W A;  1R22 A;  2QM3 A;  2NAZ A;  2JPC A;  1W4M A;  1O57 A;  1MDM A;  2VOO A;  5CVV A;  2XIG A;  3TO9 A;  2Z99 A;  5DEQ A;  3F23 A;  5HLI A;  2UWM A;  5DDG A;  3P7N A;  1Z1D A;  2PQ8 A;  1VTN C;  1FT9 A;  3WTT C;  2A6E F;  2CWE A;  2CW0 F;  3ISP A;  2XHK A;  4M9S A;  2DFI A;  2E1C A;  2DK5 A;  3HRM A;  1DUX C;  2ACJ A;  5LRS A;  3V8K A;  2E7X A;  1IN6 A;  1R1U A;  4L5J A;  2OQR A;  2QQB A;  2Y0M A;  1ZRD A;  3F6O A;  2V1D A;  5D4R A;  1GXP A;  1AOY A;  1ODD A;  5FO5 A;  3DV8 A;  1S3J A;  2O3F A;  2FOK A;  3RI4 A;  5ICF A;  4CO8 A;  4KNY A;  1TTY A;  3CLO A;  1J9I A;  2WTE A;  2BYV E;  2VOD A;  2DO7 A;  3LST A;  3KLN A;  3P9K A;  2FQ3 A;  4M74 A;  1I1S A;  5LLQ A;  4IF4 A;  1B1B A;  4RGR A;  1MJB A;  2W84 A;  4AIJ A;  5H6Q A;  1Z6R A;  2HGC A;  1U2W A;  2VXZ A;  2VE8 A;  3KET A;  2Q2E A;  1ONV A;  4RGX A;  1ULY A;  4I0B A;  1KQ0 A;  3E6M A;  4N9I A;  3M7G A;  3K2Z A;  2KRF A;  3IKV A;  2EFP A;  2DI3 A;  1BC8 C;  1PP7 U;  4LK1 F;  2VC0 A;  1HW1 A;  1XGM A;  2H6B A;  3E5U A;  5LRR A;  1I6X A;  3EET A;  2GA1 A;  3BY6 A;  1ZAO A;  3WU0 A;  3LFK A;  2HR3 A;  4XSZ F;  1YQA A;  2RNJ A;  4LLG F;  2HQN A;  4M72 A;  4M73 A;  4FX4 A;  4HX7 A;  3W6J B;  3IWF A;  1LJ9 A;  3KP3 A;  4EJO A;  4F7Z A;  1R00 A;  1A04 A;  1YS7 A;  3GW2 A;  3I58 A;  1TQM A;  3DPT A;  2V6C A;  2L4A A;  3D5L A;  2RV8 A;  3ROU A;  2CGP A;  3AAF A;  3WGG A;  1CF7 A;  1G6N A;  2CQK A;  2M87 A;  2QZ8 A;  4P5O A;  5FFX A;  4KN4 X;  1E2X A;  2XGX A;  3F8F A;  2DPU A;  2UXX A;  4EM1 A;  1SD7 A;  4RAZ A;  5ERI A;  1EV7 A;  4GXO A;  4M71 A;  3K1N A;  2ESH A;  3OV8 A;  5E1X A;  5HDG A;  5BPI A;  1Z9C A;  2DU9 A;  4O5V A;  3M1E A;  2O8X A;  4XSX F;  2ZXJ A;  1S8N A;  5HLG A;  1EH6 A;  2VC1 A;  4HF2 A;  2CG4 A;  3DEU A;  3TDZ C;  3KFW X;  2G7H A;  4AIK A;  1U3E M;  3LA3 A;  1IAW A;  3TO7 A;  2EV5 A;  1V3F A;  4UVA A;  3G73 A;  3G3Z A;  4L9J A;  1W7P A;  1STZ A;  2EFO A;  3ZMV A;  1Z7U A;  4P96 A;  1FSE A;  3O2P E;  1HKT A;  1YFH A;  2HTS A;  3K0L A;  4ESJ A;  3MZH A;  2FE3 A;  4G6Q A;  3DF8 A;  5FD6 A;  2MD5 A;  2ELH A;  4U0V A;  3JAM Z;  4AWX B;  3FMQ A;  4HQE A;  4XBF A;  4UHT A;  1U8R A;  4KYW A;  2XAG A;  3I59 A;  2OA4 A;  2K27 A;  1U78 A;  5ICG A;  3BRO A;  2JRT A;  5CVR A;  2LDU A;  2WV0 A;  2GQQ A;  4ZYH A;  2GA2 A;  1ON2 A;  2P8T A;  5D6E A;  3KP4 A;  4KN7 X;  4UVB A;  4OIP F;  2XUB A;  2DLL A;  1J0R A;  1XN7 A;  5D8K B;  1XSD A;  2A61 A;  1BI3 A;  3F72 A;  3L9F A;  4ON0 A;  1W7P D;  3ZMT A;  2CSO A;  4ZZD A;  1XDU A;  3ERE D;  3RKY A;  2RQP A;  3I71 A;  1BI1 A;  1J59 A;  3ZQ7 A;  3PQJ A;  2RGV A;  2M30 A;  3GF2 A;  2PJP A;  2JZY A;  2VBX A;  5J6X A;  3FF5 A;  5E1W A;  1QZZ A;  4BXU A;  2JPB A;  4LLN A;  3HTU A;  1R58 A;  3L2C A;  1BOA A;  2KIF A;  2P5K A;  3O6B B;  2MA3 A;  1PP8 F;  3ZPL A;  3ZMS A;  2V1X A;  4OIN F;  1BI0 A;  4ESF A;  4OMY A;  1SMY F;  5J8F A;  2PN6 A;  1UB9 A;  2P7V B;  3MQ0 A;  3E97 A;  2DQR A;  1PDN C;  2Z9O A;  4CHU A;  3HIF A;  3H3U A;  4LLL A;  2G7U A;  2QYO A;  4RAY A;  4UVC A;  1XD7 A;  4RS8 A;  2EWN A;  3GEZ A;  1IRG A;  1R1V A;  5EEG A;  1LQ1 A;  3E5Q A;  3GLX A;  3K1M A;  1IN4 A;  1BBY A;  3U1D A;  1BI2 A;  1FZP B;  1WRJ A;  4GO1 A;  2XAF A;  3ZN0 A;  3KP7 A;  1XGN A;  1BIA A;  3F3X A;  2A6H F;  4HBL A;  3ECH A;  4FHT A;  1Y0U A;  4DQ2 A;  4ENK A;  2CYY A;  1LEB A;  3J81 K;  3U2R A;  2E7W A;  2M1B A;  4I02 A;  3WOD F;  5HS9 A;  5JI6 A;  1XGO A;  3FM5 A;  5L3F A;  1P6R A;  1T39 A;  1LNW A;  4YG2 F;  3GFI A;  4OOI A;  4PDK A;  5K5R A;  3D0S A;  2BBY A;  3F6V A;  2XRO A;  3FWE A;  1SMT A;  4OMZ A;  1IN7 A;  3F8M A;  3E6B A;  1Z05 A;  1O3R A;  2UXN A;  5DCM B;  3K1P A;  4PGG A;  2R7D A;  3ELK A;  4LK0 F;  3SFZ A;  3CUQ C;  3R0A A;  4IVN A;  4P9U A;  2KIM A;  4EJT A;  2K7L A;  4CXF A;  3HRU A;  4WXC A;  4L9T A;  4CYD A;  1MD0 A;  4HQM A;  1RUN A;  2OBP A;  1WSU A;  4ASN A;  2QVO A;  2DBB A;  1FNN A;  5LGN A;  5FLX Z;  2FXA A;  2YSR A;  4Y15 A;  4EJV A;  4AIH A;  5EEH A;  4MQ9 F;  1YG2 A;  2P7C B;  1G3Y A;  4HZF A;  2W25 A;  4WF2 A;  2QUF A;  3VFZ A;  3ZMZ A;  2K4J A;  1DDN A;  1OYI A;  5LHI A;  1FP2 A;  2Q8K A;  5ICE A;  4PZJ A;  4IRH A;  3BPX A;  5CJ9 A;  1Z91 A;  1ZYR F;  4ZYG A;  4BH9 A;  3B73 A;  1FY7 A;  3L00 A;  2XAH A;  3TDU C;  4JQF A;  3V8L A;  4U0Y A;  1K79 A;  1G4D A;  2EA2 A;  1F1Z A;  1F4K A;  4YFX F;  2W85 A;  3FXU A;  4GGG A;  1T0F A;  1IXC A;  5CVI A;  5DUI A;  3T8R A;  2A3S A;  4MHG A;  3HOS A;  3W6K B;  1K6O A;  3ZN1 A;  2X4H A;  2BV6 A;  4EMS A;  3F8B A;  2GXB A;  4M6Y A;  4NB5 A;  3MWM A;  5IT9 Z;  1OKR A;  1P4A A;  2AS5 F;  2VT3 A;  3Q9S A;  3PFI A;  4HLX A;  5LBQ A;  3R6S A;  1IXR C;  2D2W A;  3BPV A;  2MLG A;  1ZG5 A;  3P9C A;  1YW8 A;  3M8F A;  1IF1 A;  5JFR A;  3GZ5 A;  3CUQ A;  4XLP F;  3I59 B;  3WGI A;  6PAX A;  1YYV A;  2PFB A;  1MGT A;  4LB6 B;  4KMF A;  4NQW A;  4EM2 A;  1FYK A;  4L18 B;  3JSP A;  1B4A A;  5CVU A;  2D45 A;  2ADU A;  1SAX A;  1K78 A;  2COM A;  4XLN F;  2BE5 F;  1XMA A;  4GYI A;  4B8X A;  2BGC A;  3JSO A;  4CZZ A;  4YFK F;  1ZN2 A;  3REO A;  5AIQ A;  5E17 F;  4A5N A;  3KLO A;  2Y48 A;  3WTY C;  3VEP A;  2FBI A;  5HVQ C;  3GYH X;  1D5V A;  1GHC A;  3CJN A;  4HV5 A;  2XKP A;  2M8E A;  2FF4 A;  2LSO A;  3LQQ A;  3J7A O;  3GWZ A;  3NRV A;  4G9Y A;  5AIP A;  3I53 A;  1R1T A;  4I7H A;  4Q5S F;  2ZFW A;  2NRA C;  1L3L A;  3KP6 A;  2OD5 A;  1IN8 A;  5CYV A;  1MKM A;  3KP5 A;  5LHH A;  1P92 A;  4ZH4 F;  3QU6 A;  4IHT A;  5AON A;  2CFX A;  1BC7 C;  5D5X B;  2VBY A;  5ILS A;  1D8K A;  1B9M A;  3HSE A;  1ZGJ A;  4KT5 C;  5HDK A;  3RPU A;  3MCZ A;  1CGP A;  2KJB A;  3WTW C;  1IRF A;  2K02 A;  5HS8 A;  1KU2 A;  3HTS B;  5BPD A;  5BS6 A;  3FX3 A;  1YW9 A;  3RKX A;  4RB3 C;  4A0X A;  2HWV A;  2BEO A;  4I09 A;  2O03 A;  1BN5 A;  3IRQ A;  1SD4 A;  2W24 A;  5LEJ A;  2DW4 A;  4A2U A;  3TOA A;  3QU3 A;  4Q4Z F;  2DPD A;  2STT A;  3L09 A;  5CLS A;  2YX4 A;  3T8T A;  2MH2 A;  4HV6 A;  2V79 A;  1ZG3 A;  1QZY A;  1FWZ A;  2IA1 A;  3CTA A;  2GZW A;  2QWW A;  1XSX A;  4IHS A;  3BZ6 A;  1MZB A;  2VBZ A;  2RDP A;  4CDG A;  2PG4 A;  5FGM A;  1O3S A;  1R7J A;  3BJO A;  4HLY A;  4EQQ A;  2F5C A;  3GUD A;  2O6G E;  2VN2 A;  1FSH A;  2M5W A;  2VOP A;  3R4K A;  3F8C A;  3H3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...