3J80i

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
PKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j80i00
5E7NA 1U0LA 2PI2E 5GQOA 2JA8G 1WCMH 1HH2P 1QVCA 1OXTA 3SGIA 1J5EQ 1YJNA 4JI5Q 4A3BH 4R1JA 2NVYH 1VQPA 1HR0W 2IHFA 3RLFA 2Z0SA 3BZCA 2JA6G 2K14A 4JI6L 1KRSA 1UE5A 4GLXA 1SE8A 2WFWA 4BA2I 4P73A 4LF5Q 2Q2UA 4OWWB 1FJGQ 2UXBQ 4X6AH 1UE6A 1E24A 2K75A 4L5RC 4AYBE 1YHAA 4PZ7A 4B3SL 4JV5L 2JJQA 4LF6L 2JA7H 3TEHB 5FLMH 3KOJA 3I4NG 2AWOA 5K36G 1S72A 1KL9A 3I2ZA 4DR4L 2I5LX 2F52A 2MO0A 2WAQE 3RN2A 1KD1C 1S3OA 3JC66 1VQOA 5C0XG 4JI2L 2D62A 1G51A 5C3EH 1XPRA 4A3EH 3KYHC 1L1OA 1XMQQ 1QVFA 3I4MH 4A3JG 4DR2L 2UUBQ 4DR6L 2XTIA 2Q2HA 1Y1WH 4OO1G 4YY3L 1VS0A 3W5OA 1PVOA 3JAMi 4A3DG 3A5ZB 4XIGS 5M3FH 3OTOL 3HFZB 4AH6A 4XTCS 3S24A 4GS3A 2JEAI 3ERSX 3CC7A 4QIWE 2R93G 2QEXA 3U4VA 3K7AH 2UU9Q 1KHIA 3ICEA 1VQGA 3KF6A 5ELOA 4YWLA 3RLOA 4A3KH 2MFIA 1KIXA 2F4VQ 2V1CC 4MZ9A 4DR3L 2CQOA 3ULPA 1VCIA 1QZGA 1PV4A 2YU9H 1N34Q 1PH5A 3ZJYC 2MO1A 1PH6A 1Q1BA 4PG3A 3GTOH 1X55A 1HZAA 1N8RC 1N33Q 4HJ5A 3HOYG 1NMGA 2GVAA 1PHJA 1PH3A 4DV5Q 5M3MH 3BJUA 5IP9G 1IZ6A 1E1OA 1YJWA 3PO3H 1XNRQ 3S16H 1S40A 1L1OC 3UDXA 4QGUA 4JI7L 1OTCA 1Q8KA 3CCSA 5GROA 3PUXA 4PMWA 3WWVA 4PZ8A 2JQOA 4AYBG 1K83H 1GKHA 2OTLA 3DLLA 2AMCB 1QUQA 3IRBA 1JB7A 2B3GA 1C7YA 4JI1Q 1NBWA 4A3LG 1XPOA 4X66Q 2E5LQ 5IYCG 5IP7G 4DV0Q 4DV3L 2WAQG 3KFUA 4IFDJ 3AYHB 1CKNB 3E9IA 1Q46A 4LUZA 4GKJL 1SLJA 3TRZA 3L7ZC 4LUOA 3S17H 1IYJB 2BA0A 1VQAA 4UPAA 4JI0Q 4LFCQ 3HOVG 1YVCA 5FJ8H 3M7NA 3KF8B 1T9HA 3CAMA 4YCWA 2UU9L 4A3FG 1KXLA 1JJGA 4POFA 3T1YQ 4B3RQ 1A62A 4IPHA 1PYBA 2F3IA 3HOZH 4IPGA 3UDFA 2E2JH 3EBEA 3GDEA 1VQ8A 3PIPA 2HQLA 1VQLA 2VQFL 4JBMA 5C4XH 1Z47A 2KENA 4X64L 1HJPA 4AQYL 1YIJA 1BBWA 1HZCA 1SR3A 4C2MH 3CC2A 3HOXG 3G6EA 1N32Q 4P75A 3TREA 1Y1VG 2VL6A 4X65L 3PUZA 1JMCA 1VQBA 1D8LA 2QA4A 4OXPA 1HNWL 3K0XA 4LW1A 3PO2H 2UXDQ 1Q7YC 3J7ZC 1YBYA 3U58A 2OWOA 3AFPA 4A93G 1NTGA 1BVSA 4DV1Q 3TS0A 2R7ZG 1WJJA 4B3SQ 1UE7A 4LF6Q 1G291 1X3EA 2DUDA 3J80c 4B3MQ 2WB1E 5C44G 4X66L 4A4IA 4UP9A 1FVIA 3F2DA 4DV0L 1VQ4A 4QL5A 2E5LL 4JYAQ 3FHWA 2YV5A 4DR4Q 2PQAA 1JE5A 3BZKA 5AJ3L 1FGUA 1E7ZA 5C0XI 4R4CA 4JI2Q 3W1GA 2K4KA 4PZ6A 4DR1L 4B3TL 3UDIA 2R92G 4C3HH 4DR2Q 2VUMH 4DR6Q 5JJKA 3T1YL 5LMUQ 4OO1I 4YY3Q 5JJIA 1EUJA 2E8GA 1XTDA 1BBUA 5IYBG 2NVTH 1IBML 3HOWG 3OTOQ 1YITA 3I4OA 2B63G 2R7FA 4IPCA 3PF4A 3D31A 2BA1A 3UE1A 4LF7L 2GN5A 2ZTEA 4HIOA 1A8VA 1C9OA 2JA8H 1N32L 3I7FA 3EN2A 5BR8L 1YI2A 1GM5A 3FP9A 3F8TA 2N8NA 4DR3Q 4NXMQ 1Q12A 3RZOH 4OWTB 3M4PA 3AQQA 3HOUG 2JA9A 4L5TA 4HIKA 1E1TA 3F2CA 4NPSA 3M4OH 2UXDL 1CSQA 4P74A 3W1BA 1IL2A 4DV1L 4A75A 3S1RH 4A3CH 1B8AA 3RN5A 3CMAA 2ASBA 1VQ5A 4Y52H 4LF4Q 1PH7A 4B3ML 5HY6A 4DUYQ 3KLWA 4JI7Q 4JYAL 4A3BG 4OX9L 4BY1H 2N78A 2ZJRA 4DR5L 1M90C 3GTPH 4WJ3M 2WB1G 4BBSH 4BXXG 2NN6G 1CUKA 2JEBI 1GD7A 3H15A 3M4QA 5J3BA 1EWIA 3GD7A 1VQEA 2N49A 1EFWA 2UUCL 4NXNQ 4DV3Q 3PGZA 2Z6KA 1YHQA 4OONA 1YZ6A 5LMUL 3AEVA 1YNXA 1ASYA 4A3JH 1JT8A 2JA7G 5FLMG 3CCLA 4JG2A 4GKJQ 4GOPC 4DAMA 1X65A 4A3DH 1YHBA 4JBJA 3MXNB 1Q82C 3J80i 1QZHA 1X3GA 3G4SA 4DUZL 1JJ2A 1IBLL 2PNHA 4L5QA 3CCRA 4JCVE 3KJOA 5C3EG 1BKBA 4A3EG 5JEAJ 4NXML 1I3QH 4LNQA 4DKAC 4DAYB 4EQ5A 2CFMA 3J81c 1EOVA 3NENA 1Y1WG 3KDFA 2VQFQ 4R4QA 1H95A 1MIUA 1Q1EA 4X64Q 3STBC 4IJHA 4AQYQ 1VQNA 5M3FG 4IOAA 2OTJA 3B6YA 5IT9c 3GTQH 1N9WA 3I56A 4LF4L 4X65Q 3CCQA 4MTNA 4DUYL 1YJ9A 1P8LA 1GVPA 3A5UA 3T1HL 2LXKA 1HNWQ 2Z6KC 3A0JA 4KLKA 4A3KG 3H0GH 2E2HH 4JOIA 4AIMA 1L1OB 4HIDA 1VQKA 4NXNL 5IWAL 3Q8DA 2UUAL 3GO5A 3PUWA 1PH4A 2K5NA 1KAWA 1TWCH 1L0WA 4JI8L 5IYCH 5IP7H 3PO3G 5M5XH 3TS2A 3FKIH 5AJ3Q 2R6GA 4BBRH 4DV6L 1K73C 4BY7H 4R4TA 2GVBA 5DLQE 1HNZL 4DR1Q 2Q2TA 4B3TQ 2NVXH 4K0KQ 3K81C 1OXXK 4X62L 3HOVH 1K8AC 2NZOA 4QQBX 3KF6B 2WP8J 1ASZA 1VQHA 4LUVA 2BH2A 4H02A 3CCUA 1QVGA 1IBMQ 2CWPA 1FL0A 3CPFA 4ALPA 5IY0A 1MJCA 4NB3A 3PUYA 4BA1I 3NELA 2N3SA 1PYSB 3NEMA 2AHOB 4GN4B 4GNXA 1R9TH 1IBKQ 4A3MH 2ES2A 4LF7Q 4IFDG 1WOCA 2NZHA 5BR8Q 3M85A 4HJAA 1VQ6A 4JOIC 1Z9FA 4DNIA 1XMOL 4LFAL 3CCMA 3K8AA 4DK3C 2OCEA 2D0OA 2RHQB 4JI4L 4A3GH 3K80C 1SFOH 1M1KC 4JBKA 3RLNA 3CD6A 2A8VA 1QUQB 4R4OA 4YCUA 2IHEA 2IY5B 4KI0A 4HJ7A 3GTJH 5C4XG 1AH9A 3EIVA 1KQSA 5GAGC 4YWMA 4OX9Q 2MNAA 1B7YB 2EIFA 3J81i 4IO9A 4DR5Q 2I5HA 3CMEA 1N36L 2VY3A 4J15A 5LMNW 5IYDH 3AFQA 5EAYA 1Q86C 2A19A 4YHHL 2UUCQ 4DV2Q 3S14H 4K0KL 4LFBL 5IE8A 4GNXC 5FLXc 1X3FA 3E0EA 3S2HH 2K50A 1A0IA 1VQ7A 2LXJA 3ER0A 3MEFA 1VQJA 3CW2C 4OWXB 2OQKA 5GAHC 4POGA 1IBKL 2EQSA 2YTVA 1EIYB 4DUZQ 1IBLQ 3CCEA 3RNUA 4GN3B 1C0AA 3CQZH 3GTGH 2KHIA 5JJLA 3LGJA 4LF8L 2HIXA 4GOPA 3GTMH 4GKKL 2HHHL 1W3SA 2JA5G 2VUMG 2CCZA 2JA6H 4GLAC 1VQIA 1OXSC 1VQCA 2L15A 1KRTA 1O7IA 4A3IG 3CC4A 3CP0A 2JE6I 4LF9L 3CCJA 1WCMG 3PSIA 4LWCA 4DV7L 3T1HQ 1EYGA 5ELNA 2VW9A 1VQDA 1NE3A 2PQAB 4UP8A 1X54A 4JI3L 3H3VI 3I4NH 1DGSA 3I55A 4C3JH 1OXUA 1EIFA 2C35B 5C0XJ 3STBD 1XJVA 2HT1A 3OW2A 2D0PA 5M5YH 2KCTA 3A74A 5IWAQ 4DV2L 2UUAQ 4RMFA 4BXXH 1HZ9A 1E22A 4A3CG 3CCVA 1TWHH 4KHPL 4JI8Q 1Y14B 1LM0A 2IX0A 1RL2A 2UXCL 1X56A 4DV6Q 4JBWA 4GLVB 2ZM6L 4YCVA 2JK8A 4BY1G 4L5SA 3GTLH 1HNZQ 1XNQQ 1RIPA 4X62Q 1SN8A 2B29A 2R93H 4BBSG 1NJIC 3J7A5 3S1QH 4GOPB 3I4MG 2BH8A 3M3YH 3BU2A 4FDBA 1VQFA 1HNXL 3G48A 1I50H 2Y0SE 1I5FA 4IFDI 1PH1A 2ALYB 4R4IA 2VQEQ 3ULLA 1CKNA 3HOYH 3HKZE 2XGTA 1HZBA 1WFQA 1XMOQ 1PH2A 4LFAQ 1I94L 4WJ4A 4IJLA 3G71A 5LMNQ 5IP9H 1UEBA 4HIMA 4JI4Q 2YTYA 1VQ9A 1KC8C 1NY4A 1J5EL 4JI5L 4RG1A 3UDGA 1LYLA 1IXRA 4ME3A 1A63A 3H3VH 1J6QA 1XPUA 1TWGH 1NMFA 2LSSA 1WI5A 3HKSA 1P16A 5JEAG 1OXVA 3J81j 3PF5A 1AE3A 2IT1A 5M5WH 4A3LH 1EQQA 3PIOA 2Q2IA 2YTXA 1YEZA 4DV4Q 5M3MG 4LF5L 1FJGL 4EX5A 1CKMA 2IX1A 2UXBL 3F2BA 1TWAH 2RCNA 1N36Q 3K7UC 2ID0A 1UWVA 5H1SE 1B70B 4YHHQ 3S1MH 4YWKA 1XNQL 4LFBQ 1LUZA 3H0GG 2MQHA 3UE0A 3S1NH 4A3FH 1TXYA 1UE1A 1GO3E 4P71A 3RZDH 2FXQA 5GAEC 3CXCA 3KDFB 4Y7NH 1XMQL 2KBNA 3M9BA 3KJPA 2UUBL 4APVA 2NVQH 4A76A 1D7QA 3FKIG 1Q81C 2RHSB 3ULJA 1PH8A 4BBRG 2HIVA 4IPDA 2VQEL 4BY7G 4IOCA 4O0AA 4LF8Q 4KHZA 1V9PA 5FJ8G 4GKKQ 3HOXH 2HHHQ 5LMNL 1W2BA 1PH9A 1HR0Q 1Y1VH 2AWNA 4GN5A 2Y0SG 2EXDA 1SMXA 1V1QA 2PI2A 2RF4A 1AE2A 3HOZG 2E2IH 3F1ZA 2VNUD 2DGYA 1LTLA 3HKZG 3S2DH 3L0OA 2F4VL 1CSPA 2VS1A 1I6HH 4A93H 1SRUA 3TQYA 2AKWB 2ZJQA 4LF9Q 2I0QA 2R7ZH 1N34L 4DV7Q 4DR7Q 1G6PA 3U50C 4HJ8A 4A3MG 4QJFA 1PFSA 5C44H 4P72A 4MNOA 3CF5A 4DV4L 1U5KA 4JI3Q 5GADC 1N33L 4DPGA 2ATWA 3DM3A 4DV5L 2NN6I 3PO2G 4A3GG 1XNRL 1X9NA 2ZTDA 4JI6Q 2KCMA 3GTKH 1V43A 3JAMc 2ZTCA 2R92H 2CKZB 4KHPQ 3NBHB 3VDYA 2K5VA 3PUVA 5C4JH 2UXCQ 1CKOA 1JJCB 4C3IH 1PA6A 4JV5Q 4JI1L 2ZM6Q 1K0RA 5IYBH 3HOWH 4DK6C 1X6OA 2VZAA 2QGQA 3PCOB 4JC0A 4GNXB 3RR5A 4HJ9A 1WYDA 4QY7A 2PMZE 5HGQA 2ZJPA 2B63H 2R7DA 4TVAB 1TWFH 2K5HA 3L2PA 1VQMA 1E3PA 2YYZA 2OQ0A 3E9HA 3PV0A 3OYYA 3D0FA 5IYDG 2K52A 1MKHA 2KHJA 1HR0L 4UY8C 1K9MC 4JI0L 4LFCL 3S15H 2CWAA 2I5MX 1K3RA 1HNXQ 2A1AA 2JA5H 1L2FA 3HOUH 1SROA 4B3RL 1MJEA 4O2DA 4UP7A 2H5XA 4TQUS 1I94Q 1EQRA 1K8GA 4A3IH 4DR7L 3U4ZA 3CPWA
chains in the Genus database with same CATH superfamily
5E7NA 4IUNA 4ABNA 1OXTA 1PYWD 1J5EQ 1YJNA 4KN4C 1ET9A 2JA6G 1I4HA 1MHWC 1NR2A 3QWNA 1WTPA 1MSGA 3EVQA 1SE8A 5IODA 2HDMA 2UXBQ 2EYLA 1UE6A 1E24A 2EXZA 4L5RC 3D8GA 1TY2A 1BCPD 3A8JE 5K36G 1JWUD 3QOLA 1BOSA 1KL9A 1E2VA 2WAQE 3DM1A 4ZKBB 3HOZB 1QNKA 1CTMA 1VQOA 4O42A 5C0XG 1G51A 1TR5A 3NK9A 4RCNA 5C3EH 1LTGD 3K58A 2UUBQ 1LT4D 2L0CA 2NBFA 1VS0A 2RDFA 3W5OA 2K5QA 5M3FH 1CHPD 3OTOL 1PLFA 2JEAI 4XTCS 3IL8A 3ERSX 2NYZD 5EKIA 1KHIA 1VQGA 5JOBA 4MZ9A 2WIIB 1CK1A 3ULPA 3BS1A 4RGTA 1PV4A 1N34Q 1B53A 4WFN3 2MO1A 5I2XA 4K14A 1PDQA 1N8RC 4OEMB 1NMGA 1PH3A 4DV5Q 3P20A 5M3MH 3S16H 2JN4A 1JWMD 4EQOA 3CCSA 1TS5A 1WD0A 2KEDA 1K83H 2AMCB 3IRBA 1C7YA 2B3GA 4K5VA 3TDQA 1NBWA 2EJFC 2DNEA 3J80L 2BDNA 4IFDJ 3KFUA 3AYHB 2JA8B 2F0EA 5LL6S 1CKNB 1SMYD 3HEJA 1L0XB 3CRLC 2OF1A 4ZCKA 1SLJA 4UPAA 3HOVG 1M4VA 3NUCA 2LS01 3KF8B 4O1NA 1KXLA 2HCIA 3T1YQ 4B3RQ 2C9OA 1A62A 1BF4A 2E2JH 1H9SA 5CC4A 4G7ZC 5C4XH 3I91A 1Z47A 1YIJA 1BBWA 1D5XC 4OIKA 3HOXG 1DZ1A 3TREA 1ESRA 1NR4A 1XTCD 2PQEA 1VQBA 2K28A 2R3ZA 3RD4A 1HNWL 4LW1A 3PO2H 2X6GA 3J7ZC 1YBYA 3T4AC 3AFPA 3HRZC 4HSVA 2OWOA 4A93G 1BVSA 1HTLD 1UE7A 4A3DB 2E5LL 1SNDA 3F2DA 2NWGA 3I90A 2MHVA 4DR4Q 2PQAA 1FGUA 1I3QB 4ID6A 3EQLC 5C0XI 1GUSA 2EY2A 3UDIA 2PO4A 3HGBA 3GTQB 2E8GA 1EY6A 5IGGA 2A68D 1RTOA 4IUTA 2R7FA 4IPCA 3D31A 1A8VA 1C9OA 4FXGC 2K5WA 1SE3A 5T1GA 3WOFA 4DR3Q 4NXMQ 3RZOH 4L5TA 2UXDL 1AFPA 1NNXA 3W1BA 1TU2B 4DV1L 4A3CH 1EWHA 4RKLA 3CMAA 3KLWA 4JI7Q 5CV6A 2QW7A 4BY1H 1GOZA 3DWQA 1O7ZA 2QF7A 2CHBD 3HKZB 3C1FA 4WJ3M 4BBSH 3D4RA 1G2TA 1GD7A 2SNSA 1EWIA 4NXNQ 4NKLA 1AZPA 2Z6KA 4OONA 5LMUL 1SYDA 2B2VC 1ASYA 4A3JH 1U4PA 3CCLA 4OO1H 4JG2A 1QCBD 3I73A 2DJGC 1M8AA 3G4SA 3KLSA 2PNHA 3CCRA 3KJOA 4RHRA 2BE5C 3DWPA 4UHVA 4DKAC 2CFMA 2XWJB 1EOVA 2EY1A 3STBC 3QO2A 3B6YA 5IT9c 5C4ZA 4LF4L 3BDCA 2EJMA 1GUWA 2IPKD 3T1HL 1QJOA 2LXKA 4PQXA 3A0JA 4A3KG 4DA2A 4JK1C 3H0GH 1BCPC 1HTPA 1LTAD 1L1OB 1BUVT 3Q8DA 2L9HA 1IW7D 1LTTD 3K5MA 2L55A 3CQZB 4C56C 4JI8L 5C3WA 5IYCH 5IP7H 5M5XH 5AJ3Q 3EROA 3SXHA 1K73C 4BY7H 1STEA 2GVBA 5DLQE 4DR1Q 2JA6B 4K0KQ 1G6ZA 2Z9HA 1A15A 4DNTB 1AEXA 2WP8J 1IHZA 1SE2A 1IBMQ 1SYCA 2N55A 3EFXD 4N9TA 5IY0A 1TS3A 4GN4B 1PYSB 1R9TH 2D9UA 1IBKQ 4LF7Q 1WOCA 4OELB 2CH4A 2EYOA 4JOIC 5M5YB 5I6WA 2PMZB 1S5DD 4K2KA 1SFOH 3RLNA 4BWGB 2O5JC 3MHBA 2O4XA 4YCUA 2EYMA 1SYEA 4HJ7A 5EGTA 3SE0A 3GTLB 1AH9A 3EIVA 2EYJA 2F0LA 1KQSA 3BDOA 4OHJA 2MNAA 1B7YB 4IO9A 4FF3A 3BVGA 1RF2D 3ND8A 1N36L 2VY3A 5IYDH 5EAYA 2B2YC 1I50B 4GNXC 1RKNA 4NMZA 5ELBA 4DAVA 1MD2D 1VQ7A 4K6LA 3MEFA 3EJIA 3BDLA 3CW2C 4LAAA 4OWXB 4POGA 1A2UA 1EIYB 4DUZQ 1AZQA 4GN3B 1ZEQX 3AB9A 3E5SA 3RUZA 1A3TA 3GTMH 4GOPA 2RBMA 1CQVA 1LLRD 4GLAC 1BXTA 2B2TA 2TMPA 2L15A 5CBEE 2F0TA 5IGBA 3CCJA 3UI2A 1WCMG 4B9XA 1SYFA 1WTRA 1B4OA 1X54A 1E0BA 1OXUA 1EIFA 3RZDB 1A3VA 2HT1A 2PZTA 1HCZA 4BXXH 4ILWA 1BQQT 1K3BC 4DN4M 3HOXB 1L0YB 1X56A 4ZK9B 1AN8A 4GLVB 1JOQA 3O13A 1ESFA 4L5SA 4U68A 4G4KA 4Q0FA 1HNZQ 1XNQQ 2A68C 5EPLA 1G8ZD 4A93B 5T1IA 4GOPB 5JVG3 3I4MG 2BH8A 3M3YH 4KJOA 1SYGA 1S5ED 2D2CC 4R4IA 3ULLA 1RD9D 5EPKA 2EPBA 4WJ4A 4LFAQ 4IJLA 2A73B 3R93A 3TZUA 5IP9H 1UEAB 2F3VA 1VQ9A 2EVBA 1KC8C 1NY4A 1J5EL 4M8AA 5C4JB 1IXRA 2SNMA 1XPUA 1TWGH 1WI5A 1OXVA 1K8MA 1W6JA 4PNYA 4QUCA 4QMGA 3PIOA 2Q2IA 2UXBL 3NSWA 4K5WA 3TSSA 5IT9E 1TWAH 3K7UC 1FR3A 3S15B 5DM63 3S1MH 4YWKA 5CV8A 1PZID 4A3FH 1TXYA 3KK7A 1JOOA 4FF4A 2FXQA 3MXPA 1PFMA 3CXCA 3KDFB 1EU4A 2KBNA 4FVMA 2UUBL 2Q8IB 4G7HC 2HIVA 4IPDA 4IUQA 4LF8Q 1TY0A 1V9PA 4WJWA 3U9SA 1PH9A 1HR0Q 4KTAA 1SEBD 2NZ1D 1SMXA 1V1QA 4V0BA 4FYDA 1AE2A 3HOZG 1U4MA 1VF5C 4XT3B 3S2DH 3L0OA 3VYTA 1SRUA 2AKWB 2ZJQA 4IUVA 1N34L 3VR5A 4DV7Q 4DR7Q 1HPCA 3OWEB 5C44H 4P72A 3M7GA 4DV4L 1U5KA 5ELEA 4DPGA 2DN8A 3DM3A 3VYUA 4DV5L 1D6EC 3ZYYX 4K8JA 3AU7A 4JI6Q 1B1ZA 1S5CD 2F0IA 2ZTCA 2R92H 4KHPQ 3I70A 1CKOA 1JJCB 1PA6A 4JV5Q 1RODA 1B2TA 1K0RA 3HOWH 2B2WC 5AFWA 2VZAA 3PCOB 2MP1A 4HJ9A 1WYDA 5L37A 4A3KB 1E3PA 4FXKC 3E9HA 1RHPA 3PV0A 1JICA 4UY8C 1HA5A 2KA7A 4TSSA 2DY7A 2I5MX 2KCNA 1Q90A 2XVSA 4B3RL 4UP7A 4KKTA 4F8MA 4E6IA 1O78A 3TZDA 1HQMC 4CDDC 2F0HA 2JA8G 3D4WA 1QVCA 3SGIA 1OO9B 4JI5Q 2KOLA 4R1JA 1ILPA 2NVYH 2IHFA 3RLFA 3BZCA 1LV9A 5EBCA 1D5MC 2NN6H 1I6VC 1EWCA 4OWWB 4AYBE 1YHAA 4ME5A 1S5FD 2JP1A 3S17B 2JA7H 3TEHB 5FLMH 2QKIC 5I9PA 3I4NG 2XN9C 1S72A 2Y0SB 4DR4L 2MO0A 1KD1C 3RN2A 1S3OA 5C6AA 3JC66 2D62A 3T16A 4A3EH 2WKCA 1XMQQ 1Q8IA 2XTIA 1Y1WH 4L6TB 4A3DG 4XIGS 1K8OA 4NW2A 4GS3A 2CVRA 1DOKA 3K7AH 2UU9Q 5KNDA 3ICEA 3KF6A 5ELOA 2O2LD 4DR3L 2YU9H 1PH5A 3ZJYC 4PG3A 4HJ5A 3HOYG 1O7LA 3BYYB 3R3OA 4I65A 4XQQA 3PO3H 1YJWA 1QB5D 4DNRB 5JPNC 4JI7L 3Q23A 4FF2A 1Q8KA 5GROA 4PMWA 4FXDA 2OTLA 1GKHA 2EY5A 5I6YA 1JB7A 3R2TA 4A3LG 1XPOA 3MA2B 4X66Q 2AUJD 1S4ZA 3E9IA 2XRSD 5IGDA 3L7ZC 4JI0Q 2DJFC 5FJ8H 1T9HA 2G9HD 3CAMA 3OW7A 2O5IC 1SYBA 5F2DA 2F3IA 3EBEA 1TQOA 2PW5A 1X3QA 2F0QA 3PIPA 1VQLA 4C1NI 2KENA 1KLGD 1LABA 1C8CA 3GTPB 1SR3A 4C2MH 3G6EA 2WINB 4P75A 1PMRA 1Y1VG 2QA4A 1EL0A 2SOBA 3U58A 2MGSA 3MAQA 3RMHA 3TS0A 2R7ZG 4B3SQ 5A2QE 4B3MQ 5FK9C 1SBBB 4A4IA 1VQ4A 4UP9A 1FVIA 3FMCA 4DV0L 5J39A 4QL5A 1ENFA 4JYAQ 5HGTA 3BZKA 5AJ3L 3T13A 1E7ZA 1MGSA 4ZUJA 1JC7A 5KNCA 4DR1L 5C4HA 4C3HH 4DR2Q 2VUMH 1WD1A 4YY3Q 1BDOA 4PMBA 1EUJA 1ICWA 4RHSA 2NVTH 1IBML 3D6CA 2B63G 2C5CA 2EE1A 3ND9A 4LF7L 2GN5A 4HIOA 2B2VA 1N32L 2KVMA 3I7FA 3EN2A 3F8TA 3R8BA 3HOUG 2JA9A 4I7ZC 4NDXA 4HIKA 3F2CA 3M4OH 4P74A 2M9VA 4A75A 3S1RH 5FOBB 1B8AA 1V1PB 2FHTA 4OIJA 5IT9L 1VQ5A 2ASBA 1ICFB 5J22A 4DUYQ 3BVZA 4ZAIA 1MI2A 5TSSA 5K36H 4TKOB 3MXUA 2WB1G 5JAVA 5M9OA 1RDPD 2B2UC 1CUKA 1QILA 3GD7A 5C0XH 1VQEA 2N49A 1UNSA 1YHQA 2TSSA 3HP3A 4H0LC 5LHY1 4GKJQ 3FVQA 1CZGA 4DUZL 1JJ2A 3SK6A 4JCVE 5C3EG 1BKBA 4XQNA 1EY0A 4LNQA 4CKBA 3J81c 1H95A 2JYOA 4X64Q 1RTNA 4IJHA 4IOAA 5M3FG 1N9WA 2EDGA 1CT1D 1P8LA 1EY7A 1GVPA 4KLKA 1PTOC 2E2HH 3J7AV 5KYIA 1B44D 4J6HA 4JOIA 4AIMA 1VQKA 2FINB 1EYAA 4PMCA 3GO5A 2M2LA 2BE5D 1PH4A 2K5NA 1KAWA 1TWCH 1L0WA 1AP0A 1I4RA 3FKIH 2R6GA 4BBRH 1Z6HA 4R4TA 1HNZL 2Q2TA 2NVXH 3K81C 1OXXK 3MEHA 3HOVH 1K8AC 4DK0A 1NAPA 4LUVA 3H6MA 4Z9CB 4H7BA 4NB3A 2B2YA 2N3SA 2LFNA 3NEMA 4ZLTF 2HD3A 4GNXA 3SK8A 3I4NB 4A3MH 4C3JB 4IFDG 5KNBA 2NZHA 1A2TA 3OHXC 4IZ8A 5BR8Q 3M85A 4HJAA 4MN3A 4L8JA 4LFAL 3CCMA 1ENCA 4KN7C 2RHQB 4A3GH 3QR8A 1M1KC 1IYUA 1XX8A 3VR2A 4R4OA 2IY5B 3GTJH 5C4XG 5CMDA 3PIO3 4YWMA 4OX9Q 1F2MA 2EIFA 3J81i 1EIGA 1EY4A 3BG3A 4CJ2C 2A5HA 3AFQA 2A19A 3S14H 1SDFA 5IE8A 1DYQA 3S2HH 2K6AA 1H9SB 4CDEC 3HOYB 2AUKA 3K5LA 2LXJA 4IQZA 4QF4A 1U4RA 2YTVA 1IBLQ 3HS0C 1C0AA 1GJXA 1O7YA 3GTGH 2KHIA 5JJLA 4LF8L 4CHTB 3OSOA 2EY6A 1H9KA 1YNND 1D5ZC 4FP5D 2JSOA 4OGQC 3CP0A 1DXMA 2JE6I 2A6HD 5NUCA 4DU9A 5CV7A 4DV7L 3TMEA 2PQAB 3H3VI 1STAA 4LMQD 2F0VA 4Y7NB 4QIWB 3A74A 5IGEA 5IWAQ 4DV2L 2UUAQ 4IN3A 4A3CG 3CCVA 1TWHH 5BN4A 4KHPL 5CR3A 1Q3LA 1K0SA 3DWAA 4DV6Q 1Y1VB 4JBWA 4BY1G 4H13C 1B50A 4X3TA 2R93H 4BBSG 1NCVA 1U4LA 1LO5D 3S1QH 2R7ZB 3G48A 1I5FA 4IFDI 3FEWX 1PH1A 2VQEQ 3NBIA 1EZ8A 3HKZE 1HXYD 1HZBA 2H1EA 1Z7TA 3MVVA 3SHLA 3GQBA 5HURA 5LMNQ 4HIMA 1UEBA 3I3CA 1F9RA 2K32A 4JI5L 5BN5A 1PFNA 4C3IB 2LSSA 3HKSA 1P16A 5A2QL 3PF5A 1ZYRD 2B63B 3J81E 5M5WH 5ISRA 3DEOA 1YEZA 3MZ5A 4EX5A 1JOKA 3NHHA 2L1BA 3F2BA 5H1SE 1B70B 1HUNA 4YHHQ 3HOUB 2JA5B 4LFBQ 3H0GG 2MQHA 3UE0A 2NUCA 3S1NH 4CJ0B 4FO2A 3L9AX 4P71A 4A3IB 5FO7B 5GAEC 2ZXRA 1XMQL 3KJPA 1D7QA 2NVQH 3VA7A 1Q81C 2Q8TA 1PH8A 4BY7G 1PRTB 3KBXA 2WB1B 2EYPA 1W2BA 2B2WA 2Y0SG 2VNUD 2QDLA 1J9OA 1ML0D 2QEJC 2E2IH 4LJZC 1I6HH 1CSPA 1GHJA 2K03A 3BVMA 4LF9Q 3IFDA 2ZXOA 4HR7B 3U50C 3E0JA 4QJFA 2HQEA 3Q24A 3A7AB 5C3EB 1X9NA 1Y8OB 2ZTDA 3GTKH 2KCMA 1SMYC 2DNCA 1V43A 3NXWA 4KV6A 2K5VA 5M3FB 2UXCQ 1IYVA 2ZM6Q 5IYBH 1TVXA 4QY7A 2PMZE 1SAPA 3FPPA 1EY8A 5HGQA 1PTOH 1TWFH 4XYOA 5IYDG 3D0FA 4P2CB 1MKHA 2KHJA 2VB2X 4CDCC 4JI0L 3E3XA 3C3LA 4ZKCB 1K3RA 1HNXQ 2A1AA 1L2FA 4WRDA 1MJEA 2XWBB 3FPUB 5M3MB 3PIP3 4RAUC 4TQUS 1I94Q 1K8GA 3S16B 1E2ZA 1U0LA 4DFAA 3MXNA 5GQOA 1WCMH 1LACA 1K83B 4A3BH 3L3OC 5DM73 1VQPA 1KDBA 3SR1A 3P1HA 4DAYA 2FFKB 4GLXA 1WTVA 3C2PA 4BA2I 5JVH3 1FJGQ 4X6AH 2K75A 3GV3A 4B3SL 2JJQA 3QIAA 1KLUD 2A74C 3I2ZA 1IKLA 2F52A 2I5LX 3QOJA 1ZXTA 2E2JB 3Q0AA 2IWHA 2R61A 3A8IE 5COYA 5KEEA 4KHVA 1QVFA 3I4MH 5C4XB 4DR2L 3NQTA 4YY3L 3A5ZB 3HZXA 4AH6A 5KYLA 2K1BA 3PO2B 2F0DA 4C1NK 2F0PA 3ERQA 2A6HC 2RDGA 3DEPA 2CW0D 3RLOA 2F4VQ 2MFIA 1KIXA 2V1CC 2G9DA 2PYKA 1JQYD 1R4QB 1Q1BA 3GTOH 1HZAA 1N33Q 2Z6BA 3GP7A 1PZKD 3BJUA 5IP9G 1IZ6A 2NB0A 3J7YW 1S40A 1L1OC 3UDXA 4QGUA 1OTCA 1I4QA 4PZ8A 2JQOA 1QUQA 3A56A 1CQFA 2E5LQ 5E4WC 2WAQG 4XT1B 1HFNA 1WVLA 1FD7D 4GKJL 4LUZA 3RZOB 3FDTA 3V05A 1VQAA 4EQPA 3M7NA 4A3FG 3HOZH 4IPGA 3UDFA 4CKEA 3GDEA 2RKSA 1FNWA 1VQ8A 5CV4A 2HQLA 4J8QA 3BYTB 4BY1B 4JBMA 4X64L 2F0JA 1HJPA 1WTQA 1E2WA 3AMUA 1EFID 3CC2A 1ZYRC 2KQ3A 1TS2A 4EGVA 1IW7C 4BBSB 2VL6A 2BOSA 4S3SA 1D8LA 4OXPA 3K0XA 2UXDQ 1Q7YC 2F0WA 3QG1A 4A3JB 4U673 4DV1Q 2F0FA 3U9OA 4LF6Q 4HEDA 5C44G 3S9WA 1IKMA 1JE5A 4LK1C 4M1UB 4JI2Q 3MTSA 3W1GA 2K4KA 2KUMA 4PZ6A 1PXUA 2R92G 1GHKA 2F0KA 2L5TA 4DR6Q 5JJKA 3T1YL 5LMUQ 1LTRD 5JJIA 3KLSX 4IALA 1XTDA 3H3VC 2BDOA 3HOWG 3I4OA 3KUPA 3PF4A 4KKUA 1Y69U 3UE1A 3DHQA 3H0GB 3WOEA 2JA8H 1FNVA 4AYBB 1JE4A 5BR8L 1YI2A 1GM5A 3FP9A 1HA6A 1Q12A 1NSNS 3J81L 3OWFA 5FO8B 1IL2A 5M5XB 4GZYC 2L11A 3RN5A 4BY7B 4Y52H 4LF4Q 1PH7A 1XYIA 3TBIB 2X6LA 4OX9L 4C3JG 2N78A 1XXGA 4HMIA 2BCOA 1EEFD 1MSHA 2NN6G 3M4QA 5J3BA 4CJ1B 1CI3M 1F77A 1R9TB 3M4YA 1V1OA 4DV3Q 3PGZA 1YNXA 2JA7G 3PQIA 1QOHA 3MC0B 4NP5A 5FLMG 4GOPC 4A3DH 1YHBA 1GUOA 1Q82C 1SFOB 4UDUC 1SNMA 1IBLL 5D14A 2DY8A 4L5QA 3X3MA 4A3EG 5JEAJ 4NXML 1I3QH 2SDFA 4EQ5A 1O80A 1Y1WG 1LT6D 2VQFQ 5JEAH 1MIUA 4AQYQ 1VQNA 2OTJA 2K04A 3GTQH 4R8NA 1SE4A 4F87A 4X65Q 2NTTA 3I4LA 3CCQA 2E75C 3BZDB 4MTNA 2RSNA 3A5UA 2KEEA 1DONA 4CBVA 3KLRA 3P75A 4RWSC 4NXNL 5IWAL 2A6ED 2AQ2B 2UUAL 1KNEA 3PUWA 3TP7A 1H9MA 3VR3A 3PO3G 3GTMB 2P5ZX 4DV6L 2B8GA 3J7AF 3OOCA 1EYDA 2KJXA 2GA4B 4B3TQ 4IURA 4QQBX 2RQXA 3KF6B 1ASZA 1VQHA 3MFGA 3NBHA 3CCUA 2FMMA 2CWPA 3CPFA 4ALPA 3DUZA 1HRJA 1D1IA 3NELA 2ES2A 3URYA 3SK4A 5C3XA 5C5LA 4K5XA 2IJ0A 2F4IA 1GXDC 3T53B 4DNIA 4KY7A 4CDFC 4K2LA 3K80C 3ITPA 3CD6A 3D6WA 2F1MA 2X69A 4DF7A 3D3RA 4X3UA 5JJZA 1LTBD 2G5DA 5GAGC 2PW7A 2L4NA 1PRTF 4DR5Q 1X32A 2I5HA 4CKCA 3CMEA 1T5XD 1HQRD 1G2SA 5LMNW 4J15A 3M3YB 1Q86C 2UUCQ 4YHHL 1TIID 1I4XA 4K0KL 1F2ZA 4LFBL 5FLXc 4C3IG 2CH4W 3N52A 1A0IA 2F0GA 3ER0A 3WDNA 1UAPA 3K5NA 5GAHC 5EJWA 3W2DA 5KIXA 2EQSA 1IBKL 4KD3A 1C48A 3CQZH 4G57A 1NUCA 4RGOS 1TWGB 1KABA 1LT5D 1MBYA 2HIXA 5E3FA 3VYSA 4C3HG 2JA5G 2VUMG 2JA6H 1OXSC 2WAQB 1VQCA 4RGNA 1EEID 1TWAB 1KRTA 4A3IG 3CC4A 4LF9L 2F0OA 2HCCA 3S1MB 4JVZA 4QUFA 1KDAA 2KECA 4A3FB 3W3AA 5KRUA 1DGSA 1KTKA 5C0XJ 2C35B 1F2LA 3STBD 2D0PA 5M5YH 2KCTA 4J1MA 1PZJD 1E22A 1CA6A 1TT2A 2OT2A 1Y14B 4MTKA 1LM0A 2IL8A 2XSCA 1RL2A 2UXCL 4UAIA 5EQ0A 2ZM6L 4YCVA 4EQNA 3SEBA 1CHQD 3GTLH 4G7OC 4X62Q 2EJGC 3S2DB 3DMUA 1QG7A 1DJRD 1RCVD 1NJIC 3LWUA 3LX0A 3D4DA 3BU2A 5C44B 1VQFA 1HNXL 1I50H 5CV5A 5FKAC 4ZQ3A 2WACA 1I4PA 3G7LA 1CKNA 1I94L 2VXWA 1PH2A 1WFQA 1XMOQ 3G71A 4JI4Q 5G3LF 2YTYA 2RSOA 3KF8A 2R92B 4ME3A 1A63A 1CFMA 3H3VH 1WTXA 1NMFA 3HOWB 3J81j 3EA6A 2MUYA 1EQQA 4ZUIA 2YTXA 4DV4Q 1BO0A 1BCPB 5M3MG 1FJGL 1B9NA 2XRQD 2ID0A 1UWVA 2ENBA 5EBDA 4H44C 4RKBA 3ONAB 1HUMA 2B39A 5DNFA 1XNQL 3MXGA 3NTHA 5JPMC 1GO3E 3RZDH 1CM9A 3H91A 3TP8A 1STBA 4A76A 3FKIG 4HTHA 2RHSB 4BBRG 5CYUA 1UUPA 2NVYB 5CV9A 4O0AA 4IFDH 4GKKQ 4KY6A 3HOXH 2HHHQ 2AWNA 2FMCA 1JCKB 1G91A 2EXDA 2PI2A 2RF4A 3F1ZA 2QCPX 2F0MA 1STGA 2F4VL 2VS1A 4A93H 2JA7B 3TQYA 3P7JA 5DAUA 1G6PA 4ULLA 2F03A 1EOTA 4JW0A 5D3IB 4HJ8A 4A3MG 1PFSA 2KCCA 4MNOA 3NE5B 4JI3Q 2K01A 1N33L 5EKLA 2CQAA 2RDHA 5CORA 2A6EC 2RCFA 3SK5A 4A3EB 3PO2G 4A3GG 1D2BA 4K8IA 1F2YA 3C1EA 2J4XA 1Y1WB 1EZ6A 3JAMc 2D5DA 2CKZB 2PZUA 5I9OA 3VDYA 2AQ3B 3PUVA 5C4JH 2KHSA 1X6OA 3OMGA 1CZWA 3K7AB 3NQIA 4GNXB 2ZJPA 5D3DA 2R7DA 2K5HA 1U9RA 3OYYA 1KAAA 3CRKC 2K52A 2PPBC 2RA4A 1EY9A 2SEBD 2YU9B 1HR0L 1QWYA 3NTIA 4DAPA 3NWSA 3S15H 2EYHA 4X3SA 3IKJA 5FLXE 1AW7A 4O2DA 1GUNA 2L12A 5E4XA 3PO3B 1DD2A 4DR7L 4XQJA 3U4ZA 3CPWA 2PI2E 1HH2P 4KKSA 5EPJA 2K5DA 4RCOA 1HR0W 5J1ZA 1F9PA 2Z0SA 2K14A 4JI6L 1KRSA 1UE5A 1FGBD 2WFWA 4P73A 3NWTA 4LF5Q 5ELFA 2Q2UA 5CBAE 3A8KE 4PZ7A 4JV5L 4LF6L 1EQTA 1Y8NB 4L63B 3KOJA 2AWOA 1WTHA 3E6ZX 4CGYB 1EQVA 3K59A 2ZT9C 1TS4A 4JI2L 4N8FA 1XPRA 3KYHC 1L1OA 4MIUA 4A3JG 4DR6L 2Q2HA 4OO1G 4C2MB 3VR4A 1PVOA 1DM0B 3JAMi 2ZXPA 3T51B 3HFZB 3S24A 3CC7A 4QIWE 2WKDA 2R93G 2QEXA 3U4VA 2F0NA 2B8FA 1PRTD 1H9JA 4YWLA 4A3KH 1DCZA 5FO9B 2CQOA 1VCIA 3IFTA 1QZGA 1PH6A 3I72A 1X55A 2GVAA 1PHJA 1E1OA 1XNRQ 4KMUC 2IX3A 1DOMA 4C3HB 2VUMB 2J7ZA 3PUXA 3WWVA 1SNPA 4AYBG 2EZVA 3DLLA 2NVTB 4F88A 4JI1Q 3NPPA 3K6OA 5IYCG 5IP7G 4DV0Q 4DV3L 4FF1A 1BR9A 1Q46A 4N9PA 3TRZA 4LUOA 3S17H 1IYJB 2BA0A 3H09A 4LFCQ 3M4OB 1YVCA 4YCWA 5LL6X 2UU9L 1LTID 1JJGA 4POFA 3S1RB 1SNOA 1J8IA 5D65A 4IPHA 1PYBA 3VYRA 1PTOF 2M00A 1GUTA 2VQFL 1F9SA 1QE6A 4AQYL 1BBXC 4V190 1HZCA 1N32Q 1SSOA 4X65L 3V2TA 3PUZA 3Q22A 1JMCA 2ICIA 3K57A 3OIQA 1NTGA 1WJJA 1G291 1X3EA 2DUDA 4IUUA 3V96A 2WB1E 3J80c 4X66L 3FHWA 1V8QA 2YV5A 1T5EA 2V4DA 3HG9A 4XDXA 3CHBD 2PCFB 1LTSD 4I7AA 3OMCA 4R4CA 1X3PA 5G3LD 1QNUA 1TKWB 1Y8PB 4B3TL 1SJHD 2Z4IA 1EYCA 2QDBA 4OO1I 3JAME 2EYFA 1BBUA 2MJ8A 5IYBG 1VMCA 3OTOQ 1YITA 3A54A 3CKIB 2BA1A 4WORA 2ZTEA 4B9WA 2E2HB 2LKVA 1SNCA 3SVMA 2N8NA 4FNFA 3M4PA 1VMPA 3AQQA 4OWTB 3SDZA 1E1TA 4KK7A 4NPSA 1SJED 1TWCB 1CSQA 1BNZA 3FKIB 1YNJD 4BBRB 4B3ML 5HY6A 1F9QA 2Z8LA 2EOTA 4JYAL 2NVXB 4YIJA 3HOVB 4A3BG 2ZJRA 4DR5L 1M90C 3GTPH 3N6RA 1JB3A 4BXXG 2JEBI 3H15A 2UUCL 1EFWA 4A3MB 1YZ6A 1XWEA 3PMFA 3AEVA 1JT8A 4DK1A 1A6XA 1C4QA 2E74C 1YNNC 1X65A 4DAMA 4JBJA 4A3GB 3MXNB 1R4PB 2K7VA 3J80i 4Q5VA 1QZHA 1X3GA 3R2IA 2A69D 3GTJB 3VR6A 4DAYB 1A3UA 3NENA 3KDFA 4R4QA 4XXEA 1Q1EA 3GV6A 3H94A 1B3AA 3I56A 1SNQA 4DUYL 3S14B 1YJ9A 1STHA 1HNWQ 4DXFA 2Z6KC 3S2HB 4RGMA 2E76C 2ICEC 3LNNA 1RJTA 4RFBA 2QILA 1KNAA 4HIDA 5IGFA 5KGUA 1WTWA 1PFBA 1SXTA 3F2UA 2H4OA 3GTGB 3TS2A 1HHVA 1B3QA 2PZWA 5IOCA 3MWYW 4RH6A 1CA5A 4X62L 3TN2A 2NZOA 2HUGA 5FLXL 1KDCA 3QB3A 5IGCA 2BH2A 4ZRZA 4H02A 1QVGA 3T56B 3CU7A 1FL0A 1LT3D 1PRTC 4PV1C 1ZKOA 1K28A 1MJCA 1BCPF 3PUYA 2OXPA 4BA1I 2AHOB 2VB3X 2Z1CA 5A35A 3K5OA 1VQ6A 1Z9FA 1XMOL 3K8AA 1ENAA 1ILQA 4DK3C 2OCEA 2D0OA 3I8ZA 4JI4L 1TWHB 4JBKA 3TP5A 2A8VA 1QUQB 3OIPA 2IHEA 4HMJA 4KI0A 3Q6SA 3X3NA 2F0UA 2R93B 2F3WA 1W6KA 3S1QB 2XNAC 1VF7A 2AQ1B 4JPBW 4DV2Q 2K33A 2WV6D 1X3FA 3E0EA 2K05A 3A7LA 2K50A 2B2UA 1VQJA 3J80E 3NTKA 2OQKA 4HCEA 4DXGA 3CCEA 3RNUA 2LY7A 3LGJA 4GKKL 2HHHL 1W3SA 5M5WB 2CCZA 2I07B 1VQIA 5ELCA 1FYCA 1O7IA 3FRPB 4EVOA 2FJ2A 3PSIA 4LWCA 3T1HQ 1EYGA 5ELNA 2NTSA 2VW9A 1VQDA 3TP6A 3S1NB 1NE3A 2N88A 4UP8A 4JI3L 3I4NH 3I55A 1GUGA 3A55A 4C3JH 1XJVA 3OW2A 4XYQA 4RMFA 2NVQB 1HZ9A 5IIFA 2F0SA 4JI8Q 3DXJC 2IX0A 1PTOD 1STYA 2RVLA 2LMCB 2JK8A 4R8IA 4OL7A 4TRDA 2E2IB 1RIPA 1SN8A 2B29A 1II3A 2B2TC 1I6HB 1EU3A 4ODGA 3J7A5 2XIWA 4N8X1 4MHEA 5DEHA 4FDBA 2PNRC 5E1FA 2Y0SE 2HDLA 2ALYB 1VDZA 5I2YA 2MPMA 4HSPA 3HOYH 2XGTA 1B9MA 3GTKB 1I4GA 1YNJC 3LWEA 4RG1A 3UDGA 1LYLA 2OEOA 4ZYSA 1J6QA 3IAYA 4HAEA 5EKKA 5JEAG 1EIHA 1S5BD 3MFYA 1AE3A 2IT1A 4A3LH 1PTOB 1TWFB 1DOLA 4LF5L 2IX1A 1CKMA 4DGZA 2RCNA 1N36Q 4QB4A 1H9RA 1LUZA 4K6DA 3JAML 4BS9A 1UE1A 2I46A 2IW3A 4KY5A 5I4DA 4Y7NH 4KD4A 3K0YA 1WCMB 2CW0C 3M9BA 4RA8A 4APVA 2A69C 4A3BB 3ULJA 2Z4HA 1HFGA 2VQEL 4IOCA 4KHZA 5FJ8G 2E2DC 5K5PA 5LMNL 1JORA 1Y1VH 4GN5A 1WTOA 3OPOA 4KJNA 5C5MA 5ELDA 2DGYA 1LTLA 3HKZG 4F7XA 2I0QA 2R7ZH 4B08A 2Q8RE 3CF5A 5GADC 2ATWA 1IL8A 3VA5A 2NN6I 1XNRL 1JR0D 1EY5A 3I4MB 4IUPA 4R9WA 5CGKA 4HCSA 3NBHB 4HN7A 5BN3A 4C3IH 1V1PA 4JI1L 1ET6A 4DK6C 4QCLA 3QJYA 2QGQA 4JC0A 3RR5A 2B63H 4TVAB 3L2PA 1VQMA 2YYZA 2OQ0A 1D1KA 1FNUA 3C46A 1K9MC 1STNA 4LFCL 4X3KA 3GTOB 3G6JB 2CWAA 3HOUH 2JA5H 1SROA 2J0TD 3KBGA 1ONLA 2H5XA 1EQRA 4A3IH 1JWSD 3NP8A 2JXMB
chains in the Genus database with same CATH topology
5E7NA 1U0LA 2PI2E 5GQOA 2JA8G 1WCMH 1HH2P 1QVCA 1OXTA 3SGIA 1J5EQ 1YJNA 4JI5Q 4A3BH 4R1JA 2NVYH 1VQPA 1HR0W 2IHFA 3RLFA 2Z0SA 3BZCA 2JA6G 2K14A 4JI6L 1KRSA 1UE5A 4GLXA 1SE8A 2WFWA 4BA2I 4P73A 4LF5Q 2Q2UA 4OWWB 1FJGQ 2UXBQ 4X6AH 1UE6A 1E24A 2K75A 4L5RC 4AYBE 1YHAA 4PZ7A 4B3SL 4JV5L 2JJQA 4LF6L 2JA7H 3TEHB 5FLMH 3KOJA 3I4NG 2AWOA 5K36G 1S72A 1KL9A 3I2ZA 4DR4L 2I5LX 2F52A 2MO0A 2WAQE 3RN2A 1KD1C 1S3OA 3JC66 1VQOA 5C0XG 4JI2L 2D62A 1G51A 5C3EH 1XPRA 4A3EH 3KYHC 1L1OA 1XMQQ 1QVFA 3I4MH 4A3JG 4DR2L 2UUBQ 4DR6L 2XTIA 2Q2HA 1Y1WH 4OO1G 4YY3L 1VS0A 3W5OA 1PVOA 3JAMi 4A3DG 3A5ZB 4XIGS 5M3FH 3OTOL 3HFZB 4AH6A 4XTCS 3S24A 4GS3A 2JEAI 3ERSX 3CC7A 4QIWE 2R93G 2QEXA 3U4VA 3K7AH 2UU9Q 1KHIA 3ICEA 1VQGA 3KF6A 5ELOA 4YWLA 3RLOA 4A3KH 2MFIA 1KIXA 2F4VQ 2V1CC 4MZ9A 4DR3L 2CQOA 3ULPA 1VCIA 1QZGA 1PV4A 2YU9H 1N34Q 1PH5A 3ZJYC 2MO1A 1PH6A 1Q1BA 4PG3A 3GTOH 1X55A 1HZAA 1N8RC 1N33Q 4HJ5A 3HOYG 1NMGA 2GVAA 1PHJA 1PH3A 4DV5Q 5M3MH 3BJUA 5IP9G 1IZ6A 1E1OA 1YJWA 3PO3H 1XNRQ 3S16H 1S40A 1L1OC 3UDXA 4QGUA 4JI7L 1OTCA 1Q8KA 3CCSA 5GROA 3PUXA 4PMWA 3WWVA 4PZ8A 2JQOA 4AYBG 1K83H 1GKHA 2OTLA 3DLLA 2AMCB 1QUQA 3IRBA 1JB7A 2B3GA 1C7YA 4JI1Q 1NBWA 4A3LG 1XPOA 4X66Q 2E5LQ 5IYCG 5IP7G 4DV0Q 4DV3L 2WAQG 3KFUA 4IFDJ 3AYHB 1CKNB 3E9IA 1Q46A 4LUZA 4GKJL 1SLJA 3TRZA 3L7ZC 4LUOA 3S17H 1IYJB 2BA0A 1VQAA 4UPAA 4JI0Q 4LFCQ 3HOVG 1YVCA 5FJ8H 3M7NA 3KF8B 1T9HA 3CAMA 4YCWA 2UU9L 4A3FG 1KXLA 1JJGA 4POFA 3T1YQ 4B3RQ 1A62A 4IPHA 1PYBA 2F3IA 3HOZH 4IPGA 3UDFA 2E2JH 3EBEA 3GDEA 1VQ8A 3PIPA 2HQLA 1VQLA 2VQFL 4JBMA 5C4XH 1Z47A 2KENA 4X64L 1HJPA 4AQYL 1YIJA 1BBWA 1HZCA 1SR3A 4C2MH 3CC2A 3HOXG 3G6EA 1N32Q 4P75A 3TREA 1Y1VG 2VL6A 4X65L 3PUZA 1JMCA 1VQBA 1D8LA 2QA4A 4OXPA 1HNWL 3K0XA 4LW1A 3PO2H 2UXDQ 1Q7YC 3J7ZC 1YBYA 3U58A 2OWOA 3AFPA 4A93G 1NTGA 1BVSA 4DV1Q 3TS0A 2R7ZG 1WJJA 4B3SQ 1UE7A 4LF6Q 1G291 1X3EA 2DUDA 3J80c 4B3MQ 2WB1E 5C44G 4X66L 4A4IA 4UP9A 1FVIA 3F2DA 4DV0L 1VQ4A 4QL5A 2E5LL 4JYAQ 3FHWA 2YV5A 4DR4Q 2PQAA 1JE5A 3BZKA 5AJ3L 1FGUA 1E7ZA 5C0XI 4R4CA 4JI2Q 3W1GA 2K4KA 4PZ6A 4DR1L 4B3TL 3UDIA 2R92G 4C3HH 4DR2Q 2VUMH 4DR6Q 5JJKA 3T1YL 5LMUQ 4OO1I 4YY3Q 5JJIA 1EUJA 2E8GA 1XTDA 1BBUA 5IYBG 2NVTH 1IBML 3HOWG 3OTOQ 1YITA 3I4OA 2B63G 2R7FA 4IPCA 3PF4A 3D31A 2BA1A 3UE1A 4LF7L 2GN5A 2ZTEA 4HIOA 1A8VA 1C9OA 2JA8H 1N32L 3I7FA 3EN2A 5BR8L 1YI2A 1GM5A 3FP9A 3F8TA 2N8NA 4DR3Q 4NXMQ 1Q12A 3RZOH 4OWTB 3M4PA 3AQQA 3HOUG 2JA9A 4L5TA 4HIKA 1E1TA 3F2CA 4NPSA 3M4OH 2UXDL 1CSQA 4P74A 3W1BA 1IL2A 4DV1L 4A75A 3S1RH 4A3CH 1B8AA 3RN5A 3CMAA 2ASBA 1VQ5A 4Y52H 4LF4Q 1PH7A 4B3ML 5HY6A 4DUYQ 3KLWA 4JI7Q 4JYAL 4A3BG 4OX9L 4BY1H 2N78A 2ZJRA 4DR5L 1M90C 3GTPH 4WJ3M 2WB1G 4BBSH 4BXXG 2NN6G 1CUKA 2JEBI 1GD7A 3H15A 3M4QA 5J3BA 1EWIA 3GD7A 1VQEA 2N49A 1EFWA 2UUCL 4NXNQ 4DV3Q 3PGZA 2Z6KA 1YHQA 4OONA 1YZ6A 5LMUL 3AEVA 1YNXA 1ASYA 4A3JH 1JT8A 2JA7G 5FLMG 3CCLA 4JG2A 4GKJQ 4GOPC 4DAMA 1X65A 4A3DH 1YHBA 4JBJA 3MXNB 1Q82C 3J80i 1QZHA 1X3GA 3G4SA 4DUZL 1JJ2A 1IBLL 2PNHA 4L5QA 3CCRA 4JCVE 3KJOA 5C3EG 1BKBA 4A3EG 5JEAJ 4NXML 1I3QH 4LNQA 4DKAC 4DAYB 4EQ5A 2CFMA 3J81c 1EOVA 3NENA 1Y1WG 3KDFA 2VQFQ 4R4QA 1H95A 1MIUA 1Q1EA 4X64Q 3STBC 4IJHA 4AQYQ 1VQNA 5M3FG 4IOAA 2OTJA 3B6YA 5IT9c 3GTQH 1N9WA 3I56A 4LF4L 4X65Q 3CCQA 4MTNA 4DUYL 1YJ9A 1P8LA 1GVPA 3A5UA 3T1HL 2LXKA 1HNWQ 2Z6KC 3A0JA 4KLKA 4A3KG 3H0GH 2E2HH 4JOIA 4AIMA 1L1OB 4HIDA 1VQKA 4NXNL 5IWAL 3Q8DA 2UUAL 3GO5A 3PUWA 1PH4A 2K5NA 1KAWA 1TWCH 1L0WA 4JI8L 5IYCH 5IP7H 3PO3G 5M5XH 3TS2A 3FKIH 5AJ3Q 2R6GA 4BBRH 4DV6L 1K73C 4BY7H 4R4TA 2GVBA 5DLQE 1HNZL 4DR1Q 2Q2TA 4B3TQ 2NVXH 4K0KQ 3K81C 1OXXK 4X62L 3HOVH 1K8AC 2NZOA 4QQBX 3KF6B 2WP8J 1ASZA 1VQHA 4LUVA 2BH2A 4H02A 3CCUA 1QVGA 1IBMQ 2CWPA 1FL0A 3CPFA 4ALPA 5IY0A 1MJCA 4NB3A 3PUYA 4BA1I 3NELA 2N3SA 1PYSB 3NEMA 2AHOB 4GN4B 4GNXA 1R9TH 1IBKQ 4A3MH 2ES2A 4LF7Q 4IFDG 1WOCA 2NZHA 5BR8Q 3M85A 4HJAA 1VQ6A 4JOIC 1Z9FA 4DNIA 1XMOL 4LFAL 3CCMA 3K8AA 4DK3C 2OCEA 2D0OA 2RHQB 4JI4L 4A3GH 3K80C 1SFOH 1M1KC 4JBKA 3RLNA 3CD6A 2A8VA 1QUQB 4R4OA 4YCUA 2IHEA 2IY5B 4KI0A 4HJ7A 3GTJH 5C4XG 1AH9A 3EIVA 1KQSA 5GAGC 4YWMA 4OX9Q 2MNAA 1B7YB 2EIFA 3J81i 4IO9A 4DR5Q 2I5HA 3CMEA 1N36L 2VY3A 4J15A 5LMNW 5IYDH 3AFQA 5EAYA 1Q86C 2A19A 4YHHL 2UUCQ 4DV2Q 3S14H 4K0KL 4LFBL 5IE8A 4GNXC 5FLXc 1X3FA 3E0EA 3S2HH 2K50A 1A0IA 1VQ7A 2LXJA 3ER0A 3MEFA 1VQJA 3CW2C 4OWXB 2OQKA 5GAHC 4POGA 1IBKL 2EQSA 2YTVA 1EIYB 4DUZQ 1IBLQ 3CCEA 3RNUA 4GN3B 1C0AA 3CQZH 3GTGH 2KHIA 5JJLA 3LGJA 4LF8L 2HIXA 4GOPA 3GTMH 4GKKL 2HHHL 1W3SA 2JA5G 2VUMG 2CCZA 2JA6H 4GLAC 1VQIA 1OXSC 1VQCA 2L15A 1KRTA 1O7IA 4A3IG 3CC4A 3CP0A 2JE6I 4LF9L 3CCJA 1WCMG 3PSIA 4LWCA 4DV7L 3T1HQ 1EYGA 5ELNA 2VW9A 1VQDA 1NE3A 2PQAB 4UP8A 1X54A 4JI3L 3H3VI 3I4NH 1DGSA 3I55A 4C3JH 1OXUA 1EIFA 2C35B 5C0XJ 3STBD 1XJVA 2HT1A 3OW2A 2D0PA 5M5YH 2KCTA 3A74A 5IWAQ 4DV2L 2UUAQ 4RMFA 4BXXH 1HZ9A 1E22A 4A3CG 3CCVA 1TWHH 4KHPL 4JI8Q 1Y14B 1LM0A 2IX0A 1RL2A 2UXCL 1X56A 4DV6Q 4JBWA 4GLVB 2ZM6L 4YCVA 2JK8A 4BY1G 4L5SA 3GTLH 1HNZQ 1XNQQ 1RIPA 4X62Q 1SN8A 2B29A 2R93H 4BBSG 1NJIC 3J7A5 3S1QH 4GOPB 3I4MG 2BH8A 3M3YH 3BU2A 4FDBA 1VQFA 1HNXL 3G48A 1I50H 2Y0SE 1I5FA 4IFDI 1PH1A 2ALYB 4R4IA 2VQEQ 3ULLA 1CKNA 3HOYH 3HKZE 2XGTA 1HZBA 1WFQA 1XMOQ 1PH2A 4LFAQ 1I94L 4WJ4A 4IJLA 3G71A 5LMNQ 5IP9H 1UEBA 4HIMA 4JI4Q 2YTYA 1VQ9A 1KC8C 1NY4A 1J5EL 4JI5L 4RG1A 3UDGA 1LYLA 1IXRA 4ME3A 1A63A 3H3VH 1J6QA 1XPUA 1TWGH 1NMFA 2LSSA 1WI5A 3HKSA 1P16A 5JEAG 1OXVA 3J81j 3PF5A 1AE3A 2IT1A 5M5WH 4A3LH 1EQQA 3PIOA 2Q2IA 2YTXA 1YEZA 4DV4Q 5M3MG 4LF5L 1FJGL 4EX5A 1CKMA 2IX1A 2UXBL 3F2BA 1TWAH 2RCNA 1N36Q 3K7UC 2ID0A 1UWVA 5H1SE 1B70B 4YHHQ 3S1MH 4YWKA 1XNQL 4LFBQ 1LUZA 3H0GG 2MQHA 3UE0A 3S1NH 4A3FH 1TXYA 1UE1A 1GO3E 4P71A 3RZDH 2FXQA 5GAEC 3CXCA 3KDFB 4Y7NH 1XMQL 2KBNA 3M9BA 3KJPA 2UUBL 4APVA 2NVQH 4A76A 1D7QA 3FKIG 1Q81C 2RHSB 3ULJA 1PH8A 4BBRG 2HIVA 4IPDA 2VQEL 4BY7G 4IOCA 4O0AA 4LF8Q 4KHZA 1V9PA 5FJ8G 4GKKQ 3HOXH 2HHHQ 5LMNL 1W2BA 1PH9A 1HR0Q 1Y1VH 2AWNA 4GN5A 2Y0SG 2EXDA 1SMXA 1V1QA 2PI2A 2RF4A 1AE2A 3HOZG 2E2IH 3F1ZA 2VNUD 2DGYA 1LTLA 3HKZG 3S2DH 3L0OA 2F4VL 1CSPA 2VS1A 1I6HH 4A93H 1SRUA 3TQYA 2AKWB 2ZJQA 4LF9Q 2I0QA 2R7ZH 1N34L 4DV7Q 4DR7Q 1G6PA 3U50C 4HJ8A 4A3MG 4QJFA 1PFSA 5C44H 4P72A 4MNOA 3CF5A 4DV4L 1U5KA 4JI3Q 5GADC 1N33L 4DPGA 2ATWA 3DM3A 4DV5L 2NN6I 3PO2G 4A3GG 1XNRL 1X9NA 2ZTDA 4JI6Q 2KCMA 3GTKH 1V43A 3JAMc 2ZTCA 2R92H 2CKZB 4KHPQ 3NBHB 3VDYA 2K5VA 3PUVA 5C4JH 2UXCQ 1CKOA 1JJCB 4C3IH 1PA6A 4JV5Q 4JI1L 2ZM6Q 1K0RA 5IYBH 3HOWH 4DK6C 1X6OA 2VZAA 2QGQA 3PCOB 4JC0A 4GNXB 3RR5A 4HJ9A 1WYDA 4QY7A 2PMZE 5HGQA 2ZJPA 2B63H 2R7DA 4TVAB 1TWFH 2K5HA 3L2PA 1VQMA 1E3PA 2YYZA 2OQ0A 3E9HA 3PV0A 3OYYA 3D0FA 5IYDG 2K52A 1MKHA 2KHJA 1HR0L 4UY8C 1K9MC 4JI0L 4LFCL 3S15H 2CWAA 2I5MX 1K3RA 1HNXQ 2A1AA 2JA5H 1L2FA 3HOUH 1SROA 4B3RL 1MJEA 4O2DA 4UP7A 2H5XA 4TQUS 1I94Q 1EQRA 1K8GA 4A3IH 4DR7L 3U4ZA 3CPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E7N A;  1U0L A;  2PI2 E;  5GQO A;  2JA8 G;  1WCM H;  1HH2 P;  1QVC A;  1OXT A;  3SGI A;  1J5E Q;  1YJN A;  4JI5 Q;  4A3B H;  4R1J A;  2NVY H;  1VQP A;  1HR0 W;  2IHF A;  3RLF A;  2Z0S A;  3BZC A;  2JA6 G;  2K14 A;  4JI6 L;  1KRS A;  1UE5 A;  4GLX A;  1SE8 A;  2WFW A;  4BA2 I;  4P73 A;  4LF5 Q;  2Q2U A;  4OWW B;  1FJG Q;  2UXB Q;  4X6A H;  1UE6 A;  1E24 A;  2K75 A;  4L5R C;  4AYB E;  1YHA A;  4PZ7 A;  4B3S L;  4JV5 L;  2JJQ A;  4LF6 L;  2JA7 H;  3TEH B;  5FLM H;  3KOJ A;  3I4N G;  2AWO A;  5K36 G;  1S72 A;  1KL9 A;  3I2Z A;  4DR4 L;  2I5L X;  2F52 A;  2MO0 A;  2WAQ E;  3RN2 A;  1KD1 C;  1S3O A;  3JC6 6;  1VQO A;  5C0X G;  4JI2 L;  2D62 A;  1G51 A;  5C3E H;  1XPR A;  4A3E H;  3KYH C;  1L1O A;  1XMQ Q;  1QVF A;  3I4M H;  4A3J G;  4DR2 L;  2UUB Q;  4DR6 L;  2XTI A;  2Q2H A;  1Y1W H;  4OO1 G;  4YY3 L;  1VS0 A;  3W5O A;  1PVO A;  3JAM i;  4A3D G;  3A5Z B;  4XIG S;  5M3F H;  3OTO L;  3HFZ B;  4AH6 A;  4XTC S;  3S24 A;  4GS3 A;  2JEA I;  3ERS X;  3CC7 A;  4QIW E;  2R93 G;  2QEX A;  3U4V A;  3K7A H;  2UU9 Q;  1KHI A;  3ICE A;  1VQG A;  3KF6 A;  5ELO A;  4YWL A;  3RLO A;  4A3K H;  2MFI A;  1KIX A;  2F4V Q;  2V1C C;  4MZ9 A;  4DR3 L;  2CQO A;  3ULP A;  1VCI A;  1QZG A;  1PV4 A;  2YU9 H;  1N34 Q;  1PH5 A;  3ZJY C;  2MO1 A;  1PH6 A;  1Q1B A;  4PG3 A;  3GTO H;  1X55 A;  1HZA A;  1N8R C;  1N33 Q;  4HJ5 A;  3HOY G;  1NMG A;  2GVA A;  1PHJ A;  1PH3 A;  4DV5 Q;  5M3M H;  3BJU A;  5IP9 G;  1IZ6 A;  1E1O A;  1YJW A;  3PO3 H;  1XNR Q;  3S16 H;  1S40 A;  1L1O C;  3UDX A;  4QGU A;  4JI7 L;  1OTC A;  1Q8K A;  3CCS A;  5GRO A;  3PUX A;  4PMW A;  3WWV A;  4PZ8 A;  2JQO A;  4AYB G;  1K83 H;  1GKH A;  2OTL A;  3DLL A;  2AMC B;  1QUQ A;  3IRB A;  1JB7 A;  2B3G A;  1C7Y A;  4JI1 Q;  1NBW A;  4A3L G;  1XPO A;  4X66 Q;  2E5L Q;  5IYC G;  5IP7 G;  4DV0 Q;  4DV3 L;  2WAQ G;  3KFU A;  4IFD J;  3AYH B;  1CKN B;  3E9I A;  1Q46 A;  4LUZ A;  4GKJ L;  1SLJ A;  3TRZ A;  3L7Z C;  4LUO A;  3S17 H;  1IYJ B;  2BA0 A;  1VQA A;  4UPA A;  4JI0 Q;  4LFC Q;  3HOV G;  1YVC A;  5FJ8 H;  3M7N A;  3KF8 B;  1T9H A;  3CAM A;  4YCW A;  2UU9 L;  4A3F G;  1KXL A;  1JJG A;  4POF A;  3T1Y Q;  4B3R Q;  1A62 A;  4IPH A;  1PYB A;  2F3I A;  3HOZ H;  4IPG A;  3UDF A;  2E2J H;  3EBE A;  3GDE A;  1VQ8 A;  3PIP A;  2HQL A;  1VQL A;  2VQF L;  4JBM A;  5C4X H;  1Z47 A;  2KEN A;  4X64 L;  1HJP A;  4AQY L;  1YIJ A;  1BBW A;  1HZC A;  1SR3 A;  4C2M H;  3CC2 A;  3HOX G;  3G6E A;  1N32 Q;  4P75 A;  3TRE A;  1Y1V G;  2VL6 A;  4X65 L;  3PUZ A;  1JMC A;  1VQB A;  1D8L A;  2QA4 A;  4OXP A;  1HNW L;  3K0X A;  4LW1 A;  3PO2 H;  2UXD Q;  1Q7Y C;  3J7Z C;  1YBY A;  3U58 A;  2OWO A;  3AFP A;  4A93 G;  1NTG A;  1BVS A;  4DV1 Q;  3TS0 A;  2R7Z G;  1WJJ A;  4B3S Q;  1UE7 A;  4LF6 Q;  1G29 1;  1X3E A;  2DUD A;  3J80 c;  4B3M Q;  2WB1 E;  5C44 G;  4X66 L;  4A4I A;  4UP9 A;  1FVI A;  3F2D A;  4DV0 L;  1VQ4 A;  4QL5 A;  2E5L L;  4JYA Q;  3FHW A;  2YV5 A;  4DR4 Q;  2PQA A;  1JE5 A;  3BZK A;  5AJ3 L;  1FGU A;  1E7Z A;  5C0X I;  4R4C A;  4JI2 Q;  3W1G A;  2K4K A;  4PZ6 A;  4DR1 L;  4B3T L;  3UDI A;  2R92 G;  4C3H H;  4DR2 Q;  2VUM H;  4DR6 Q;  5JJK A;  3T1Y L;  5LMU Q;  4OO1 I;  4YY3 Q;  5JJI A;  1EUJ A;  2E8G A;  1XTD A;  1BBU A;  5IYB G;  2NVT H;  1IBM L;  3HOW G;  3OTO Q;  1YIT A;  3I4O A;  2B63 G;  2R7F A;  4IPC A;  3PF4 A;  3D31 A;  2BA1 A;  3UE1 A;  4LF7 L;  2GN5 A;  2ZTE A;  4HIO A;  1A8V A;  1C9O A;  2JA8 H;  1N32 L;  3I7F A;  3EN2 A;  5BR8 L;  1YI2 A;  1GM5 A;  3FP9 A;  3F8T A;  2N8N A;  4DR3 Q;  4NXM Q;  1Q12 A;  3RZO H;  4OWT B;  3M4P A;  3AQQ A;  3HOU G;  2JA9 A;  4L5T A;  4HIK A;  1E1T A;  3F2C A;  4NPS A;  3M4O H;  2UXD L;  1CSQ A;  4P74 A;  3W1B A;  1IL2 A;  4DV1 L;  4A75 A;  3S1R H;  4A3C H;  1B8A A;  3RN5 A;  3CMA A;  2ASB A;  1VQ5 A;  4Y52 H;  4LF4 Q;  1PH7 A;  4B3M L;  5HY6 A;  4DUY Q;  3KLW A;  4JI7 Q;  4JYA L;  4A3B G;  4OX9 L;  4BY1 H;  2N78 A;  2ZJR A;  4DR5 L;  1M90 C;  3GTP H;  4WJ3 M;  2WB1 G;  4BBS H;  4BXX G;  2NN6 G;  1CUK A;  2JEB I;  1GD7 A;  3H15 A;  3M4Q A;  5J3B A;  1EWI A;  3GD7 A;  1VQE A;  2N49 A;  1EFW A;  2UUC L;  4NXN Q;  4DV3 Q;  3PGZ A;  2Z6K A;  1YHQ A;  4OON A;  1YZ6 A;  5LMU L;  3AEV A;  1YNX A;  1ASY A;  4A3J H;  1JT8 A;  2JA7 G;  5FLM G;  3CCL A;  4JG2 A;  4GKJ Q;  4GOP C;  4DAM A;  1X65 A;  4A3D H;  1YHB A;  4JBJ A;  3MXN B;  1Q82 C;  3J80 i;  1QZH A;  1X3G A;  3G4S A;  4DUZ L;  1JJ2 A;  1IBL L;  2PNH A;  4L5Q A;  3CCR A;  4JCV E;  3KJO A;  5C3E G;  1BKB A;  4A3E G;  5JEA J;  4NXM L;  1I3Q H;  4LNQ A;  4DKA C;  4DAY B;  4EQ5 A;  2CFM A;  3J81 c;  1EOV A;  3NEN A;  1Y1W G;  3KDF A;  2VQF Q;  4R4Q A;  1H95 A;  1MIU A;  1Q1E A;  4X64 Q;  3STB C;  4IJH A;  4AQY Q;  1VQN A;  5M3F G;  4IOA A;  2OTJ A;  3B6Y A;  5IT9 c;  3GTQ H;  1N9W A;  3I56 A;  4LF4 L;  4X65 Q;  3CCQ A;  4MTN A;  4DUY L;  1YJ9 A;  1P8L A;  1GVP A;  3A5U A;  3T1H L;  2LXK A;  1HNW Q;  2Z6K C;  3A0J A;  4KLK A;  4A3K G;  3H0G H;  2E2H H;  4JOI A;  4AIM A;  1L1O B;  4HID A;  1VQK A;  4NXN L;  5IWA L;  3Q8D A;  2UUA L;  3GO5 A;  3PUW A;  1PH4 A;  2K5N A;  1KAW A;  1TWC H;  1L0W A;  4JI8 L;  5IYC H;  5IP7 H;  3PO3 G;  5M5X H;  3TS2 A;  3FKI H;  5AJ3 Q;  2R6G A;  4BBR H;  4DV6 L;  1K73 C;  4BY7 H;  4R4T A;  2GVB A;  5DLQ E;  1HNZ L;  4DR1 Q;  2Q2T A;  4B3T Q;  2NVX H;  4K0K Q;  3K81 C;  1OXX K;  4X62 L;  3HOV H;  1K8A C;  2NZO A;  4QQB X;  3KF6 B;  2WP8 J;  1ASZ A;  1VQH A;  4LUV A;  2BH2 A;  4H02 A;  3CCU A;  1QVG A;  1IBM Q;  2CWP A;  1FL0 A;  3CPF A;  4ALP A;  5IY0 A;  1MJC A;  4NB3 A;  3PUY A;  4BA1 I;  3NEL A;  2N3S A;  1PYS B;  3NEM A;  2AHO B;  4GN4 B;  4GNX A;  1R9T H;  1IBK Q;  4A3M H;  2ES2 A;  4LF7 Q;  4IFD G;  1WOC A;  2NZH A;  5BR8 Q;  3M85 A;  4HJA A;  1VQ6 A;  4JOI C;  1Z9F A;  4DNI A;  1XMO L;  4LFA L;  3CCM A;  3K8A A;  4DK3 C;  2OCE A;  2D0O A;  2RHQ B;  4JI4 L;  4A3G H;  3K80 C;  1SFO H;  1M1K C;  4JBK A;  3RLN A;  3CD6 A;  2A8V A;  1QUQ B;  4R4O A;  4YCU A;  2IHE A;  2IY5 B;  4KI0 A;  4HJ7 A;  3GTJ H;  5C4X G;  1AH9 A;  3EIV A;  1KQS A;  5GAG C;  4YWM A;  4OX9 Q;  2MNA A;  1B7Y B;  2EIF A;  3J81 i;  4IO9 A;  4DR5 Q;  2I5H A;  3CME A;  1N36 L;  2VY3 A;  4J15 A;  5LMN W;  5IYD H;  3AFQ A;  5EAY A;  1Q86 C;  2A19 A;  4YHH L;  2UUC Q;  4DV2 Q;  3S14 H;  4K0K L;  4LFB L;  5IE8 A;  4GNX C;  5FLX c;  1X3F A;  3E0E A;  3S2H H;  2K50 A;  1A0I A;  1VQ7 A;  2LXJ A;  3ER0 A;  3MEF A;  1VQJ A;  3CW2 C;  4OWX B;  2OQK A;  5GAH C;  4POG A;  1IBK L;  2EQS A;  2YTV A;  1EIY B;  4DUZ Q;  1IBL Q;  3CCE A;  3RNU A;  4GN3 B;  1C0A A;  3CQZ H;  3GTG H;  2KHI A;  5JJL A;  3LGJ A;  4LF8 L;  2HIX A;  4GOP A;  3GTM H;  4GKK L;  2HHH L;  1W3S A;  2JA5 G;  2VUM G;  2CCZ A;  2JA6 H;  4GLA C;  1VQI A;  1OXS C;  1VQC A;  2L15 A;  1KRT A;  1O7I A;  4A3I G;  3CC4 A;  3CP0 A;  2JE6 I;  4LF9 L;  3CCJ A;  1WCM G;  3PSI A;  4LWC A;  4DV7 L;  3T1H Q;  1EYG A;  5ELN A;  2VW9 A;  1VQD A;  1NE3 A;  2PQA B;  4UP8 A;  1X54 A;  4JI3 L;  3H3V I;  3I4N H;  1DGS A;  3I55 A;  4C3J H;  1OXU A;  1EIF A;  2C35 B;  5C0X J;  3STB D;  1XJV A;  2HT1 A;  3OW2 A;  2D0P A;  5M5Y H;  2KCT A;  3A74 A;  5IWA Q;  4DV2 L;  2UUA Q;  4RMF A;  4BXX H;  1HZ9 A;  1E22 A;  4A3C G;  3CCV A;  1TWH H;  4KHP L;  4JI8 Q;  1Y14 B;  1LM0 A;  2IX0 A;  1RL2 A;  2UXC L;  1X56 A;  4DV6 Q;  4JBW A;  4GLV B;  2ZM6 L;  4YCV A;  2JK8 A;  4BY1 G;  4L5S A;  3GTL H;  1HNZ Q;  1XNQ Q;  1RIP A;  4X62 Q;  1SN8 A;  2B29 A;  2R93 H;  4BBS G;  1NJI C;  3J7A 5;  3S1Q H;  4GOP B;  3I4M G;  2BH8 A;  3M3Y H;  3BU2 A;  4FDB A;  1VQF A;  1HNX L;  3G48 A;  1I50 H;  2Y0S E;  1I5F A;  4IFD I;  1PH1 A;  2ALY B;  4R4I A;  2VQE Q;  3ULL A;  1CKN A;  3HOY H;  3HKZ E;  2XGT A;  1HZB A;  1WFQ A;  1XMO Q;  1PH2 A;  4LFA Q;  1I94 L;  4WJ4 A;  4IJL A;  3G71 A;  5LMN Q;  5IP9 H;  1UEB A;  4HIM A;  4JI4 Q;  2YTY A;  1VQ9 A;  1KC8 C;  1NY4 A;  1J5E L;  4JI5 L;  4RG1 A;  3UDG A;  1LYL A;  1IXR A;  4ME3 A;  1A63 A;  3H3V H;  1J6Q A;  1XPU A;  1TWG H;  1NMF A;  2LSS A;  1WI5 A;  3HKS A;  1P16 A;  5JEA G;  1OXV A;  3J81 j;  3PF5 A;  1AE3 A;  2IT1 A;  5M5W H;  4A3L H;  1EQQ A;  3PIO A;  2Q2I A;  2YTX A;  1YEZ A;  4DV4 Q;  5M3M G;  4LF5 L;  1FJG L;  4EX5 A;  1CKM A;  2IX1 A;  2UXB L;  3F2B A;  1TWA H;  2RCN A;  1N36 Q;  3K7U C;  2ID0 A;  1UWV A;  5H1S E;  1B70 B;  4YHH Q;  3S1M H;  4YWK A;  1XNQ L;  4LFB Q;  1LUZ A;  3H0G G;  2MQH A;  3UE0 A;  3S1N H;  4A3F H;  1TXY A;  1UE1 A;  1GO3 E;  4P71 A;  3RZD H;  2FXQ A;  5GAE C;  3CXC A;  3KDF B;  4Y7N H;  1XMQ L;  2KBN A;  3M9B A;  3KJP A;  2UUB L;  4APV A;  2NVQ H;  4A76 A;  1D7Q A;  3FKI G;  1Q81 C;  2RHS B;  3ULJ A;  1PH8 A;  4BBR G;  2HIV A;  4IPD A;  2VQE L;  4BY7 G;  4IOC A;  4O0A A;  4LF8 Q;  4KHZ A;  1V9P A;  5FJ8 G;  4GKK Q;  3HOX H;  2HHH Q;  5LMN L;  1W2B A;  1PH9 A;  1HR0 Q;  1Y1V H;  2AWN A;  4GN5 A;  2Y0S G;  2EXD A;  1SMX A;  1V1Q A;  2PI2 A;  2RF4 A;  1AE2 A;  3HOZ G;  2E2I H;  3F1Z A;  2VNU D;  2DGY A;  1LTL A;  3HKZ G;  3S2D H;  3L0O A;  2F4V L;  1CSP A;  2VS1 A;  1I6H H;  4A93 H;  1SRU A;  3TQY A;  2AKW B;  2ZJQ A;  4LF9 Q;  2I0Q A;  2R7Z H;  1N34 L;  4DV7 Q;  4DR7 Q;  1G6P A;  3U50 C;  4HJ8 A;  4A3M G;  4QJF A;  1PFS A;  5C44 H;  4P72 A;  4MNO A;  3CF5 A;  4DV4 L;  1U5K A;  4JI3 Q;  5GAD C;  1N33 L;  4DPG A;  2ATW A;  3DM3 A;  4DV5 L;  2NN6 I;  3PO2 G;  4A3G G;  1XNR L;  1X9N A;  2ZTD A;  4JI6 Q;  2KCM A;  3GTK H;  1V43 A;  3JAM c;  2ZTC A;  2R92 H;  2CKZ B;  4KHP Q;  3NBH B;  3VDY A;  2K5V A;  3PUV A;  5C4J H;  2UXC Q;  1CKO A;  1JJC B;  4C3I H;  1PA6 A;  4JV5 Q;  4JI1 L;  2ZM6 Q;  1K0R A;  5IYB H;  3HOW H;  4DK6 C;  1X6O A;  2VZA A;  2QGQ A;  3PCO B;  4JC0 A;  4GNX B;  3RR5 A;  4HJ9 A;  1WYD A;  4QY7 A;  2PMZ E;  5HGQ A;  2ZJP A;  2B63 H;  2R7D A;  4TVA B;  1TWF H;  2K5H A;  3L2P A;  1VQM A;  1E3P A;  2YYZ A;  2OQ0 A;  3E9H A;  3PV0 A;  3OYY A;  3D0F A;  5IYD G;  2K52 A;  1MKH A;  2KHJ A;  1HR0 L;  4UY8 C;  1K9M C;  4JI0 L;  4LFC L;  3S15 H;  2CWA A;  2I5M X;  1K3R A;  1HNX Q;  2A1A A;  2JA5 H;  1L2F A;  3HOU H;  1SRO A;  4B3R L;  1MJE A;  4O2D A;  4UP7 A;  2H5X A;  4TQU S;  1I94 Q;  1EQR A;  1K8G A;  4A3I H;  4DR7 L;  3U4Z A;  3CPW A; 
#chains in the Genus database with same CATH topology
 5E7N A;  4IUN A;  4ABN A;  1OXT A;  1PYW D;  1J5E Q;  1YJN A;  4KN4 C;  1ET9 A;  2JA6 G;  1I4H A;  1MHW C;  1NR2 A;  3QWN A;  1WTP A;  1MSG A;  3EVQ A;  1SE8 A;  5IOD A;  2HDM A;  2UXB Q;  2EYL A;  1UE6 A;  1E24 A;  2EXZ A;  4L5R C;  3D8G A;  1TY2 A;  1BCP D;  3A8J E;  5K36 G;  1JWU D;  3QOL A;  1BOS A;  1KL9 A;  1E2V A;  2WAQ E;  3DM1 A;  4ZKB B;  3HOZ B;  1QNK A;  1CTM A;  1VQO A;  4O42 A;  5C0X G;  1G51 A;  1TR5 A;  3NK9 A;  4RCN A;  5C3E H;  1LTG D;  3K58 A;  2UUB Q;  1LT4 D;  2L0C A;  2NBF A;  1VS0 A;  2RDF A;  3W5O A;  2K5Q A;  5M3F H;  1CHP D;  3OTO L;  1PLF A;  2JEA I;  4XTC S;  3IL8 A;  3ERS X;  2NYZ D;  5EKI A;  1KHI A;  1VQG A;  5JOB A;  4MZ9 A;  2WII B;  1CK1 A;  3ULP A;  3BS1 A;  4RGT A;  1PV4 A;  1N34 Q;  1B53 A;  4WFN 3;  2MO1 A;  5I2X A;  4K14 A;  1PDQ A;  1N8R C;  4OEM B;  1NMG A;  1PH3 A;  4DV5 Q;  3P20 A;  5M3M H;  3S16 H;  2JN4 A;  1JWM D;  4EQO A;  3CCS A;  1TS5 A;  1WD0 A;  2KED A;  1K83 H;  2AMC B;  3IRB A;  1C7Y A;  2B3G A;  4K5V A;  3TDQ A;  1NBW A;  2EJF C;  2DNE A;  3J80 L;  2BDN A;  4IFD J;  3KFU A;  3AYH B;  2JA8 B;  2F0E A;  5LL6 S;  1CKN B;  1SMY D;  3HEJ A;  1L0X B;  3CRL C;  2OF1 A;  4ZCK A;  1SLJ A;  4UPA A;  3HOV G;  1M4V A;  3NUC A;  2LS0 1;  3KF8 B;  4O1N A;  1KXL A;  2HCI A;  3T1Y Q;  4B3R Q;  2C9O A;  1A62 A;  1BF4 A;  2E2J H;  1H9S A;  5CC4 A;  4G7Z C;  5C4X H;  3I91 A;  1Z47 A;  1YIJ A;  1BBW A;  1D5X C;  4OIK A;  3HOX G;  1DZ1 A;  3TRE A;  1ESR A;  1NR4 A;  1XTC D;  2PQE A;  1VQB A;  2K28 A;  2R3Z A;  3RD4 A;  1HNW L;  4LW1 A;  3PO2 H;  2X6G A;  3J7Z C;  1YBY A;  3T4A C;  3AFP A;  3HRZ C;  4HSV A;  2OWO A;  4A93 G;  1BVS A;  1HTL D;  1UE7 A;  4A3D B;  2E5L L;  1SND A;  3F2D A;  2NWG A;  3I90 A;  2MHV A;  4DR4 Q;  2PQA A;  1FGU A;  1I3Q B;  4ID6 A;  3EQL C;  5C0X I;  1GUS A;  2EY2 A;  3UDI A;  2PO4 A;  3HGB A;  3GTQ B;  2E8G A;  1EY6 A;  5IGG A;  2A68 D;  1RTO A;  4IUT A;  2R7F A;  4IPC A;  3D31 A;  1A8V A;  1C9O A;  4FXG C;  2K5W A;  1SE3 A;  5T1G A;  3WOF A;  4DR3 Q;  4NXM Q;  3RZO H;  4L5T A;  2UXD L;  1AFP A;  1NNX A;  3W1B A;  1TU2 B;  4DV1 L;  4A3C H;  1EWH A;  4RKL A;  3CMA A;  3KLW A;  4JI7 Q;  5CV6 A;  2QW7 A;  4BY1 H;  1GOZ A;  3DWQ A;  1O7Z A;  2QF7 A;  2CHB D;  3HKZ B;  3C1F A;  4WJ3 M;  4BBS H;  3D4R A;  1G2T A;  1GD7 A;  2SNS A;  1EWI A;  4NXN Q;  4NKL A;  1AZP A;  2Z6K A;  4OON A;  5LMU L;  1SYD A;  2B2V C;  1ASY A;  4A3J H;  1U4P A;  3CCL A;  4OO1 H;  4JG2 A;  1QCB D;  3I73 A;  2DJG C;  1M8A A;  3G4S A;  3KLS A;  2PNH A;  3CCR A;  3KJO A;  4RHR A;  2BE5 C;  3DWP A;  4UHV A;  4DKA C;  2CFM A;  2XWJ B;  1EOV A;  2EY1 A;  3STB C;  3QO2 A;  3B6Y A;  5IT9 c;  5C4Z A;  4LF4 L;  3BDC A;  2EJM A;  1GUW A;  2IPK D;  3T1H L;  1QJO A;  2LXK A;  4PQX A;  3A0J A;  4A3K G;  4DA2 A;  4JK1 C;  3H0G H;  1BCP C;  1HTP A;  1LTA D;  1L1O B;  1BUV T;  3Q8D A;  2L9H A;  1IW7 D;  1LTT D;  3K5M A;  2L55 A;  3CQZ B;  4C56 C;  4JI8 L;  5C3W A;  5IYC H;  5IP7 H;  5M5X H;  5AJ3 Q;  3ERO A;  3SXH A;  1K73 C;  4BY7 H;  1STE A;  2GVB A;  5DLQ E;  4DR1 Q;  2JA6 B;  4K0K Q;  1G6Z A;  2Z9H A;  1A15 A;  4DNT B;  1AEX A;  2WP8 J;  1IHZ A;  1SE2 A;  1IBM Q;  1SYC A;  2N55 A;  3EFX D;  4N9T A;  5IY0 A;  1TS3 A;  4GN4 B;  1PYS B;  1R9T H;  2D9U A;  1IBK Q;  4LF7 Q;  1WOC A;  4OEL B;  2CH4 A;  2EYO A;  4JOI C;  5M5Y B;  5I6W A;  2PMZ B;  1S5D D;  4K2K A;  1SFO H;  3RLN A;  4BWG B;  2O5J C;  3MHB A;  2O4X A;  4YCU A;  2EYM A;  1SYE A;  4HJ7 A;  5EGT A;  3SE0 A;  3GTL B;  1AH9 A;  3EIV A;  2EYJ A;  2F0L A;  1KQS A;  3BDO A;  4OHJ A;  2MNA A;  1B7Y B;  4IO9 A;  4FF3 A;  3BVG A;  1RF2 D;  3ND8 A;  1N36 L;  2VY3 A;  5IYD H;  5EAY A;  2B2Y C;  1I50 B;  4GNX C;  1RKN A;  4NMZ A;  5ELB A;  4DAV A;  1MD2 D;  1VQ7 A;  4K6L A;  3MEF A;  3EJI A;  3BDL A;  3CW2 C;  4LAA A;  4OWX B;  4POG A;  1A2U A;  1EIY B;  4DUZ Q;  1AZQ A;  4GN3 B;  1ZEQ X;  3AB9 A;  3E5S A;  3RUZ A;  1A3T A;  3GTM H;  4GOP A;  2RBM A;  1CQV A;  1LLR D;  4GLA C;  1BXT A;  2B2T A;  2TMP A;  2L15 A;  5CBE E;  2F0T A;  5IGB A;  3CCJ A;  3UI2 A;  1WCM G;  4B9X A;  1SYF A;  1WTR A;  1B4O A;  1X54 A;  1E0B A;  1OXU A;  1EIF A;  3RZD B;  1A3V A;  2HT1 A;  2PZT A;  1HCZ A;  4BXX H;  4ILW A;  1BQQ T;  1K3B C;  4DN4 M;  3HOX B;  1L0Y B;  1X56 A;  4ZK9 B;  1AN8 A;  4GLV B;  1JOQ A;  3O13 A;  1ESF A;  4L5S A;  4U68 A;  4G4K A;  4Q0F A;  1HNZ Q;  1XNQ Q;  2A68 C;  5EPL A;  1G8Z D;  4A93 B;  5T1I A;  4GOP B;  5JVG 3;  3I4M G;  2BH8 A;  3M3Y H;  4KJO A;  1SYG A;  1S5E D;  2D2C C;  4R4I A;  3ULL A;  1RD9 D;  5EPK A;  2EPB A;  4WJ4 A;  4LFA Q;  4IJL A;  2A73 B;  3R93 A;  3TZU A;  5IP9 H;  1UEA B;  2F3V A;  1VQ9 A;  2EVB A;  1KC8 C;  1NY4 A;  1J5E L;  4M8A A;  5C4J B;  1IXR A;  2SNM A;  1XPU A;  1TWG H;  1WI5 A;  1OXV A;  1K8M A;  1W6J A;  4PNY A;  4QUC A;  4QMG A;  3PIO A;  2Q2I A;  2UXB L;  3NSW A;  4K5W A;  3TSS A;  5IT9 E;  1TWA H;  3K7U C;  1FR3 A;  3S15 B;  5DM6 3;  3S1M H;  4YWK A;  5CV8 A;  1PZI D;  4A3F H;  1TXY A;  3KK7 A;  1JOO A;  4FF4 A;  2FXQ A;  3MXP A;  1PFM A;  3CXC A;  3KDF B;  1EU4 A;  2KBN A;  4FVM A;  2UUB L;  2Q8I B;  4G7H C;  2HIV A;  4IPD A;  4IUQ A;  4LF8 Q;  1TY0 A;  1V9P A;  4WJW A;  3U9S A;  1PH9 A;  1HR0 Q;  4KTA A;  1SEB D;  2NZ1 D;  1SMX A;  1V1Q A;  4V0B A;  4FYD A;  1AE2 A;  3HOZ G;  1U4M A;  1VF5 C;  4XT3 B;  3S2D H;  3L0O A;  3VYT A;  1SRU A;  2AKW B;  2ZJQ A;  4IUV A;  1N34 L;  3VR5 A;  4DV7 Q;  4DR7 Q;  1HPC A;  3OWE B;  5C44 H;  4P72 A;  3M7G A;  4DV4 L;  1U5K A;  5ELE A;  4DPG A;  2DN8 A;  3DM3 A;  3VYU A;  4DV5 L;  1D6E C;  3ZYY X;  4K8J A;  3AU7 A;  4JI6 Q;  1B1Z A;  1S5C D;  2F0I A;  2ZTC A;  2R92 H;  4KHP Q;  3I70 A;  1CKO A;  1JJC B;  1PA6 A;  4JV5 Q;  1ROD A;  1B2T A;  1K0R A;  3HOW H;  2B2W C;  5AFW A;  2VZA A;  3PCO B;  2MP1 A;  4HJ9 A;  1WYD A;  5L37 A;  4A3K B;  1E3P A;  4FXK C;  3E9H A;  1RHP A;  3PV0 A;  1JIC A;  4UY8 C;  1HA5 A;  2KA7 A;  4TSS A;  2DY7 A;  2I5M X;  2KCN A;  1Q90 A;  2XVS A;  4B3R L;  4UP7 A;  4KKT A;  4F8M A;  4E6I A;  1O78 A;  3TZD A;  1HQM C;  4CDD C;  2F0H A;  2JA8 G;  3D4W A;  1QVC A;  3SGI A;  1OO9 B;  4JI5 Q;  2KOL A;  4R1J A;  1ILP A;  2NVY H;  2IHF A;  3RLF A;  3BZC A;  1LV9 A;  5EBC A;  1D5M C;  2NN6 H;  1I6V C;  1EWC A;  4OWW B;  4AYB E;  1YHA A;  4ME5 A;  1S5F D;  2JP1 A;  3S17 B;  2JA7 H;  3TEH B;  5FLM H;  2QKI C;  5I9P A;  3I4N G;  2XN9 C;  1S72 A;  2Y0S B;  4DR4 L;  2MO0 A;  1KD1 C;  3RN2 A;  1S3O A;  5C6A A;  3JC6 6;  2D62 A;  3T16 A;  4A3E H;  2WKC A;  1XMQ Q;  1Q8I A;  2XTI A;  1Y1W H;  4L6T B;  4A3D G;  4XIG S;  1K8O A;  4NW2 A;  4GS3 A;  2CVR A;  1DOK A;  3K7A H;  2UU9 Q;  5KND A;  3ICE A;  3KF6 A;  5ELO A;  2O2L D;  4DR3 L;  2YU9 H;  1PH5 A;  3ZJY C;  4PG3 A;  4HJ5 A;  3HOY G;  1O7L A;  3BYY B;  3R3O A;  4I65 A;  4XQQ A;  3PO3 H;  1YJW A;  1QB5 D;  4DNR B;  5JPN C;  4JI7 L;  3Q23 A;  4FF2 A;  1Q8K A;  5GRO A;  4PMW A;  4FXD A;  2OTL A;  1GKH A;  2EY5 A;  5I6Y A;  1JB7 A;  3R2T A;  4A3L G;  1XPO A;  3MA2 B;  4X66 Q;  2AUJ D;  1S4Z A;  3E9I A;  2XRS D;  5IGD A;  3L7Z C;  4JI0 Q;  2DJF C;  5FJ8 H;  1T9H A;  2G9H D;  3CAM A;  3OW7 A;  2O5I C;  1SYB A;  5F2D A;  2F3I A;  3EBE A;  1TQO A;  2PW5 A;  1X3Q A;  2F0Q A;  3PIP A;  1VQL A;  4C1N I;  2KEN A;  1KLG D;  1LAB A;  1C8C A;  3GTP B;  1SR3 A;  4C2M H;  3G6E A;  2WIN B;  4P75 A;  1PMR A;  1Y1V G;  2QA4 A;  1EL0 A;  2SOB A;  3U58 A;  2MGS A;  3MAQ A;  3RMH A;  3TS0 A;  2R7Z G;  4B3S Q;  5A2Q E;  4B3M Q;  5FK9 C;  1SBB B;  4A4I A;  1VQ4 A;  4UP9 A;  1FVI A;  3FMC A;  4DV0 L;  5J39 A;  4QL5 A;  1ENF A;  4JYA Q;  5HGT A;  3BZK A;  5AJ3 L;  3T13 A;  1E7Z A;  1MGS A;  4ZUJ A;  1JC7 A;  5KNC A;  4DR1 L;  5C4H A;  4C3H H;  4DR2 Q;  2VUM H;  1WD1 A;  4YY3 Q;  1BDO A;  4PMB A;  1EUJ A;  1ICW A;  4RHS A;  2NVT H;  1IBM L;  3D6C A;  2B63 G;  2C5C A;  2EE1 A;  3ND9 A;  4LF7 L;  2GN5 A;  4HIO A;  2B2V A;  1N32 L;  2KVM A;  3I7F A;  3EN2 A;  3F8T A;  3R8B A;  3HOU G;  2JA9 A;  4I7Z C;  4NDX A;  4HIK A;  3F2C A;  3M4O H;  4P74 A;  2M9V A;  4A75 A;  3S1R H;  5FOB B;  1B8A A;  1V1P B;  2FHT A;  4OIJ A;  5IT9 L;  1VQ5 A;  2ASB A;  1ICF B;  5J22 A;  4DUY Q;  3BVZ A;  4ZAI A;  1MI2 A;  5TSS A;  5K36 H;  4TKO B;  3MXU A;  2WB1 G;  5JAV A;  5M9O A;  1RDP D;  2B2U C;  1CUK A;  1QIL A;  3GD7 A;  5C0X H;  1VQE A;  2N49 A;  1UNS A;  1YHQ A;  2TSS A;  3HP3 A;  4H0L C;  5LHY 1;  4GKJ Q;  3FVQ A;  1CZG A;  4DUZ L;  1JJ2 A;  3SK6 A;  4JCV E;  5C3E G;  1BKB A;  4XQN A;  1EY0 A;  4LNQ A;  4CKB A;  3J81 c;  1H95 A;  2JYO A;  4X64 Q;  1RTN A;  4IJH A;  4IOA A;  5M3F G;  1N9W A;  2EDG A;  1CT1 D;  1P8L A;  1EY7 A;  1GVP A;  4KLK A;  1PTO C;  2E2H H;  3J7A V;  5KYI A;  1B44 D;  4J6H A;  4JOI A;  4AIM A;  1VQK A;  2FIN B;  1EYA A;  4PMC A;  3GO5 A;  2M2L A;  2BE5 D;  1PH4 A;  2K5N A;  1KAW A;  1TWC H;  1L0W A;  1AP0 A;  1I4R A;  3FKI H;  2R6G A;  4BBR H;  1Z6H A;  4R4T A;  1HNZ L;  2Q2T A;  2NVX H;  3K81 C;  1OXX K;  3MEH A;  3HOV H;  1K8A C;  4DK0 A;  1NAP A;  4LUV A;  3H6M A;  4Z9C B;  4H7B A;  4NB3 A;  2B2Y A;  2N3S A;  2LFN A;  3NEM A;  4ZLT F;  2HD3 A;  4GNX A;  3SK8 A;  3I4N B;  4A3M H;  4C3J B;  4IFD G;  5KNB A;  2NZH A;  1A2T A;  3OHX C;  4IZ8 A;  5BR8 Q;  3M85 A;  4HJA A;  4MN3 A;  4L8J A;  4LFA L;  3CCM A;  1ENC A;  4KN7 C;  2RHQ B;  4A3G H;  3QR8 A;  1M1K C;  1IYU A;  1XX8 A;  3VR2 A;  4R4O A;  2IY5 B;  3GTJ H;  5C4X G;  5CMD A;  3PIO 3;  4YWM A;  4OX9 Q;  1F2M A;  2EIF A;  3J81 i;  1EIG A;  1EY4 A;  3BG3 A;  4CJ2 C;  2A5H A;  3AFQ A;  2A19 A;  3S14 H;  1SDF A;  5IE8 A;  1DYQ A;  3S2H H;  2K6A A;  1H9S B;  4CDE C;  3HOY B;  2AUK A;  3K5L A;  2LXJ A;  4IQZ A;  4QF4 A;  1U4R A;  2YTV A;  1IBL Q;  3HS0 C;  1C0A A;  1GJX A;  1O7Y A;  3GTG H;  2KHI A;  5JJL A;  4LF8 L;  4CHT B;  3OSO A;  2EY6 A;  1H9K A;  1YNN D;  1D5Z C;  4FP5 D;  2JSO A;  4OGQ C;  3CP0 A;  1DXM A;  2JE6 I;  2A6H D;  5NUC A;  4DU9 A;  5CV7 A;  4DV7 L;  3TME A;  2PQA B;  3H3V I;  1STA A;  4LMQ D;  2F0V A;  4Y7N B;  4QIW B;  3A74 A;  5IGE A;  5IWA Q;  4DV2 L;  2UUA Q;  4IN3 A;  4A3C G;  3CCV A;  1TWH H;  5BN4 A;  4KHP L;  5CR3 A;  1Q3L A;  1K0S A;  3DWA A;  4DV6 Q;  1Y1V B;  4JBW A;  4BY1 G;  4H13 C;  1B50 A;  4X3T A;  2R93 H;  4BBS G;  1NCV A;  1U4L A;  1LO5 D;  3S1Q H;  2R7Z B;  3G48 A;  1I5F A;  4IFD I;  3FEW X;  1PH1 A;  2VQE Q;  3NBI A;  1EZ8 A;  3HKZ E;  1HXY D;  1HZB A;  2H1E A;  1Z7T A;  3MVV A;  3SHL A;  3GQB A;  5HUR A;  5LMN Q;  4HIM A;  1UEB A;  3I3C A;  1F9R A;  2K32 A;  4JI5 L;  5BN5 A;  1PFN A;  4C3I B;  2LSS A;  3HKS A;  1P16 A;  5A2Q L;  3PF5 A;  1ZYR D;  2B63 B;  3J81 E;  5M5W H;  5ISR A;  3DEO A;  1YEZ A;  3MZ5 A;  4EX5 A;  1JOK A;  3NHH A;  2L1B A;  3F2B A;  5H1S E;  1B70 B;  1HUN A;  4YHH Q;  3HOU B;  2JA5 B;  4LFB Q;  3H0G G;  2MQH A;  3UE0 A;  2NUC A;  3S1N H;  4CJ0 B;  4FO2 A;  3L9A X;  4P71 A;  4A3I B;  5FO7 B;  5GAE C;  2ZXR A;  1XMQ L;  3KJP A;  1D7Q A;  2NVQ H;  3VA7 A;  1Q81 C;  2Q8T A;  1PH8 A;  4BY7 G;  1PRT B;  3KBX A;  2WB1 B;  2EYP A;  1W2B A;  2B2W A;  2Y0S G;  2VNU D;  2QDL A;  1J9O A;  1ML0 D;  2QEJ C;  2E2I H;  4LJZ C;  1I6H H;  1CSP A;  1GHJ A;  2K03 A;  3BVM A;  4LF9 Q;  3IFD A;  2ZXO A;  4HR7 B;  3U50 C;  3E0J A;  4QJF A;  2HQE A;  3Q24 A;  3A7A B;  5C3E B;  1X9N A;  1Y8O B;  2ZTD A;  3GTK H;  2KCM A;  1SMY C;  2DNC A;  1V43 A;  3NXW A;  4KV6 A;  2K5V A;  5M3F B;  2UXC Q;  1IYV A;  2ZM6 Q;  5IYB H;  1TVX A;  4QY7 A;  2PMZ E;  1SAP A;  3FPP A;  1EY8 A;  5HGQ A;  1PTO H;  1TWF H;  4XYO A;  5IYD G;  3D0F A;  4P2C B;  1MKH A;  2KHJ A;  2VB2 X;  4CDC C;  4JI0 L;  3E3X A;  3C3L A;  4ZKC B;  1K3R A;  1HNX Q;  2A1A A;  1L2F A;  4WRD A;  1MJE A;  2XWB B;  3FPU B;  5M3M B;  3PIP 3;  4RAU C;  4TQU S;  1I94 Q;  1K8G A;  3S16 B;  1E2Z A;  1U0L A;  4DFA A;  3MXN A;  5GQO A;  1WCM H;  1LAC A;  1K83 B;  4A3B H;  3L3O C;  5DM7 3;  1VQP A;  1KDB A;  3SR1 A;  3P1H A;  4DAY A;  2FFK B;  4GLX A;  1WTV A;  3C2P A;  4BA2 I;  5JVH 3;  1FJG Q;  4X6A H;  2K75 A;  3GV3 A;  4B3S L;  2JJQ A;  3QIA A;  1KLU D;  2A74 C;  3I2Z A;  1IKL A;  2F52 A;  2I5L X;  3QOJ A;  1ZXT A;  2E2J B;  3Q0A A;  2IWH A;  2R61 A;  3A8I E;  5COY A;  5KEE A;  4KHV A;  1QVF A;  3I4M H;  5C4X B;  4DR2 L;  3NQT A;  4YY3 L;  3A5Z B;  3HZX A;  4AH6 A;  5KYL A;  2K1B A;  3PO2 B;  2F0D A;  4C1N K;  2F0P A;  3ERQ A;  2A6H C;  2RDG A;  3DEP A;  2CW0 D;  3RLO A;  2F4V Q;  2MFI A;  1KIX A;  2V1C C;  2G9D A;  2PYK A;  1JQY D;  1R4Q B;  1Q1B A;  3GTO H;  1HZA A;  1N33 Q;  2Z6B A;  3GP7 A;  1PZK D;  3BJU A;  5IP9 G;  1IZ6 A;  2NB0 A;  3J7Y W;  1S40 A;  1L1O C;  3UDX A;  4QGU A;  1OTC A;  1I4Q A;  4PZ8 A;  2JQO A;  1QUQ A;  3A56 A;  1CQF A;  2E5L Q;  5E4W C;  2WAQ G;  4XT1 B;  1HFN A;  1WVL A;  1FD7 D;  4GKJ L;  4LUZ A;  3RZO B;  3FDT A;  3V05 A;  1VQA A;  4EQP A;  3M7N A;  4A3F G;  3HOZ H;  4IPG A;  3UDF A;  4CKE A;  3GDE A;  2RKS A;  1FNW A;  1VQ8 A;  5CV4 A;  2HQL A;  4J8Q A;  3BYT B;  4BY1 B;  4JBM A;  4X64 L;  2F0J A;  1HJP A;  1WTQ A;  1E2W A;  3AMU A;  1EFI D;  3CC2 A;  1ZYR C;  2KQ3 A;  1TS2 A;  4EGV A;  1IW7 C;  4BBS B;  2VL6 A;  2BOS A;  4S3S A;  1D8L A;  4OXP A;  3K0X A;  2UXD Q;  1Q7Y C;  2F0W A;  3QG1 A;  4A3J B;  4U67 3;  4DV1 Q;  2F0F A;  3U9O A;  4LF6 Q;  4HED A;  5C44 G;  3S9W A;  1IKM A;  1JE5 A;  4LK1 C;  4M1U B;  4JI2 Q;  3MTS A;  3W1G A;  2K4K A;  2KUM A;  4PZ6 A;  1PXU A;  2R92 G;  1GHK A;  2F0K A;  2L5T A;  4DR6 Q;  5JJK A;  3T1Y L;  5LMU Q;  1LTR D;  5JJI A;  3KLS X;  4IAL A;  1XTD A;  3H3V C;  2BDO A;  3HOW G;  3I4O A;  3KUP A;  3PF4 A;  4KKU A;  1Y69 U;  3UE1 A;  3DHQ A;  3H0G B;  3WOE A;  2JA8 H;  1FNV A;  4AYB B;  1JE4 A;  5BR8 L;  1YI2 A;  1GM5 A;  3FP9 A;  1HA6 A;  1Q12 A;  1NSN S;  3J81 L;  3OWF A;  5FO8 B;  1IL2 A;  5M5X B;  4GZY C;  2L11 A;  3RN5 A;  4BY7 B;  4Y52 H;  4LF4 Q;  1PH7 A;  1XYI A;  3TBI B;  2X6L A;  4OX9 L;  4C3J G;  2N78 A;  1XXG A;  4HMI A;  2BCO A;  1EEF D;  1MSH A;  2NN6 G;  3M4Q A;  5J3B A;  4CJ1 B;  1CI3 M;  1F77 A;  1R9T B;  3M4Y A;  1V1O A;  4DV3 Q;  3PGZ A;  1YNX A;  2JA7 G;  3PQI A;  1QOH A;  3MC0 B;  4NP5 A;  5FLM G;  4GOP C;  4A3D H;  1YHB A;  1GUO A;  1Q82 C;  1SFO B;  4UDU C;  1SNM A;  1IBL L;  5D14 A;  2DY8 A;  4L5Q A;  3X3M A;  4A3E G;  5JEA J;  4NXM L;  1I3Q H;  2SDF A;  4EQ5 A;  1O80 A;  1Y1W G;  1LT6 D;  2VQF Q;  5JEA H;  1MIU A;  4AQY Q;  1VQN A;  2OTJ A;  2K04 A;  3GTQ H;  4R8N A;  1SE4 A;  4F87 A;  4X65 Q;  2NTT A;  3I4L A;  3CCQ A;  2E75 C;  3BZD B;  4MTN A;  2RSN A;  3A5U A;  2KEE A;  1DON A;  4CBV A;  3KLR A;  3P75 A;  4RWS C;  4NXN L;  5IWA L;  2A6E D;  2AQ2 B;  2UUA L;  1KNE A;  3PUW A;  3TP7 A;  1H9M A;  3VR3 A;  3PO3 G;  3GTM B;  2P5Z X;  4DV6 L;  2B8G A;  3J7A F;  3OOC A;  1EYD A;  2KJX A;  2GA4 B;  4B3T Q;  4IUR A;  4QQB X;  2RQX A;  3KF6 B;  1ASZ A;  1VQH A;  3MFG A;  3NBH A;  3CCU A;  2FMM A;  2CWP A;  3CPF A;  4ALP A;  3DUZ A;  1HRJ A;  1D1I A;  3NEL A;  2ES2 A;  3URY A;  3SK4 A;  5C3X A;  5C5L A;  4K5X A;  2IJ0 A;  2F4I A;  1GXD C;  3T53 B;  4DNI A;  4KY7 A;  4CDF C;  4K2L A;  3K80 C;  3ITP A;  3CD6 A;  3D6W A;  2F1M A;  2X69 A;  4DF7 A;  3D3R A;  4X3U A;  5JJZ A;  1LTB D;  2G5D A;  5GAG C;  2PW7 A;  2L4N A;  1PRT F;  4DR5 Q;  1X32 A;  2I5H A;  4CKC A;  3CME A;  1T5X D;  1HQR D;  1G2S A;  5LMN W;  4J15 A;  3M3Y B;  1Q86 C;  2UUC Q;  4YHH L;  1TII D;  1I4X A;  4K0K L;  1F2Z A;  4LFB L;  5FLX c;  4C3I G;  2CH4 W;  3N52 A;  1A0I A;  2F0G A;  3ER0 A;  3WDN A;  1UAP A;  3K5N A;  5GAH C;  5EJW A;  3W2D A;  5KIX A;  2EQS A;  1IBK L;  4KD3 A;  1C48 A;  3CQZ H;  4G57 A;  1NUC A;  4RGO S;  1TWG B;  1KAB A;  1LT5 D;  1MBY A;  2HIX A;  5E3F A;  3VYS A;  4C3H G;  2JA5 G;  2VUM G;  2JA6 H;  1OXS C;  2WAQ B;  1VQC A;  4RGN A;  1EEI D;  1TWA B;  1KRT A;  4A3I G;  3CC4 A;  4LF9 L;  2F0O A;  2HCC A;  3S1M B;  4JVZ A;  4QUF A;  1KDA A;  2KEC A;  4A3F B;  3W3A A;  5KRU A;  1DGS A;  1KTK A;  5C0X J;  2C35 B;  1F2L A;  3STB D;  2D0P A;  5M5Y H;  2KCT A;  4J1M A;  1PZJ D;  1E22 A;  1CA6 A;  1TT2 A;  2OT2 A;  1Y14 B;  4MTK A;  1LM0 A;  2IL8 A;  2XSC A;  1RL2 A;  2UXC L;  4UAI A;  5EQ0 A;  2ZM6 L;  4YCV A;  4EQN A;  3SEB A;  1CHQ D;  3GTL H;  4G7O C;  4X62 Q;  2EJG C;  3S2D B;  3DMU A;  1QG7 A;  1DJR D;  1RCV D;  1NJI C;  3LWU A;  3LX0 A;  3D4D A;  3BU2 A;  5C44 B;  1VQF A;  1HNX L;  1I50 H;  5CV5 A;  5FKA C;  4ZQ3 A;  2WAC A;  1I4P A;  3G7L A;  1CKN A;  1I94 L;  2VXW A;  1PH2 A;  1WFQ A;  1XMO Q;  3G71 A;  4JI4 Q;  5G3L F;  2YTY A;  2RSO A;  3KF8 A;  2R92 B;  4ME3 A;  1A63 A;  1CFM A;  3H3V H;  1WTX A;  1NMF A;  3HOW B;  3J81 j;  3EA6 A;  2MUY A;  1EQQ A;  4ZUI A;  2YTX A;  4DV4 Q;  1BO0 A;  1BCP B;  5M3M G;  1FJG L;  1B9N A;  2XRQ D;  2ID0 A;  1UWV A;  2ENB A;  5EBD A;  4H44 C;  4RKB A;  3ONA B;  1HUM A;  2B39 A;  5DNF A;  1XNQ L;  3MXG A;  3NTH A;  5JPM C;  1GO3 E;  3RZD H;  1CM9 A;  3H91 A;  3TP8 A;  1STB A;  4A76 A;  3FKI G;  4HTH A;  2RHS B;  4BBR G;  5CYU A;  1UUP A;  2NVY B;  5CV9 A;  4O0A A;  4IFD H;  4GKK Q;  4KY6 A;  3HOX H;  2HHH Q;  2AWN A;  2FMC A;  1JCK B;  1G91 A;  2EXD A;  2PI2 A;  2RF4 A;  3F1Z A;  2QCP X;  2F0M A;  1STG A;  2F4V L;  2VS1 A;  4A93 H;  2JA7 B;  3TQY A;  3P7J A;  5DAU A;  1G6P A;  4ULL A;  2F03 A;  1EOT A;  4JW0 A;  5D3I B;  4HJ8 A;  4A3M G;  1PFS A;  2KCC A;  4MNO A;  3NE5 B;  4JI3 Q;  2K01 A;  1N33 L;  5EKL A;  2CQA A;  2RDH A;  5COR A;  2A6E C;  2RCF A;  3SK5 A;  4A3E B;  3PO2 G;  4A3G G;  1D2B A;  4K8I A;  1F2Y A;  3C1E A;  2J4X A;  1Y1W B;  1EZ6 A;  3JAM c;  2D5D A;  2CKZ B;  2PZU A;  5I9O A;  3VDY A;  2AQ3 B;  3PUV A;  5C4J H;  2KHS A;  1X6O A;  3OMG A;  1CZW A;  3K7A B;  3NQI A;  4GNX B;  2ZJP A;  5D3D A;  2R7D A;  2K5H A;  1U9R A;  3OYY A;  1KAA A;  3CRK C;  2K52 A;  2PPB C;  2RA4 A;  1EY9 A;  2SEB D;  2YU9 B;  1HR0 L;  1QWY A;  3NTI A;  4DAP A;  3NWS A;  3S15 H;  2EYH A;  4X3S A;  3IKJ A;  5FLX E;  1AW7 A;  4O2D A;  1GUN A;  2L12 A;  5E4X A;  3PO3 B;  1DD2 A;  4DR7 L;  4XQJ A;  3U4Z A;  3CPW A;  2PI2 E;  1HH2 P;  4KKS A;  5EPJ A;  2K5D A;  4RCO A;  1HR0 W;  5J1Z A;  1F9P A;  2Z0S A;  2K14 A;  4JI6 L;  1KRS A;  1UE5 A;  1FGB D;  2WFW A;  4P73 A;  3NWT A;  4LF5 Q;  5ELF A;  2Q2U A;  5CBA E;  3A8K E;  4PZ7 A;  4JV5 L;  4LF6 L;  1EQT A;  1Y8N B;  4L63 B;  3KOJ A;  2AWO A;  1WTH A;  3E6Z X;  4CGY B;  1EQV A;  3K59 A;  2ZT9 C;  1TS4 A;  4JI2 L;  4N8F A;  1XPR A;  3KYH C;  1L1O A;  4MIU A;  4A3J G;  4DR6 L;  2Q2H A;  4OO1 G;  4C2M B;  3VR4 A;  1PVO A;  1DM0 B;  3JAM i;  2ZXP A;  3T51 B;  3HFZ B;  3S24 A;  3CC7 A;  4QIW E;  2WKD A;  2R93 G;  2QEX A;  3U4V A;  2F0N A;  2B8F A;  1PRT D;  1H9J A;  4YWL A;  4A3K H;  1DCZ A;  5FO9 B;  2CQO A;  1VCI A;  3IFT A;  1QZG A;  1PH6 A;  3I72 A;  1X55 A;  2GVA A;  1PHJ A;  1E1O A;  1XNR Q;  4KMU C;  2IX3 A;  1DOM A;  4C3H B;  2VUM B;  2J7Z A;  3PUX A;  3WWV A;  1SNP A;  4AYB G;  2EZV A;  3DLL A;  2NVT B;  4F88 A;  4JI1 Q;  3NPP A;  3K6O A;  5IYC G;  5IP7 G;  4DV0 Q;  4DV3 L;  4FF1 A;  1BR9 A;  1Q46 A;  4N9P A;  3TRZ A;  4LUO A;  3S17 H;  1IYJ B;  2BA0 A;  3H09 A;  4LFC Q;  3M4O B;  1YVC A;  4YCW A;  5LL6 X;  2UU9 L;  1LTI D;  1JJG A;  4POF A;  3S1R B;  1SNO A;  1J8I A;  5D65 A;  4IPH A;  1PYB A;  3VYR A;  1PTO F;  2M00 A;  1GUT A;  2VQF L;  1F9S A;  1QE6 A;  4AQY L;  1BBX C;  4V19 0;  1HZC A;  1N32 Q;  1SSO A;  4X65 L;  3V2T A;  3PUZ A;  3Q22 A;  1JMC A;  2ICI A;  3K57 A;  3OIQ A;  1NTG A;  1WJJ A;  1G29 1;  1X3E A;  2DUD A;  4IUU A;  3V96 A;  2WB1 E;  3J80 c;  4X66 L;  3FHW A;  1V8Q A;  2YV5 A;  1T5E A;  2V4D A;  3HG9 A;  4XDX A;  3CHB D;  2PCF B;  1LTS D;  4I7A A;  3OMC A;  4R4C A;  1X3P A;  5G3L D;  1QNU A;  1TKW B;  1Y8P B;  4B3T L;  1SJH D;  2Z4I A;  1EYC A;  2QDB A;  4OO1 I;  3JAM E;  2EYF A;  1BBU A;  2MJ8 A;  5IYB G;  1VMC A;  3OTO Q;  1YIT A;  3A54 A;  3CKI B;  2BA1 A;  4WOR A;  2ZTE A;  4B9W A;  2E2H B;  2LKV A;  1SNC A;  3SVM A;  2N8N A;  4FNF A;  3M4P A;  1VMP A;  3AQQ A;  4OWT B;  3SDZ A;  1E1T A;  4KK7 A;  4NPS A;  1SJE D;  1TWC B;  1CSQ A;  1BNZ A;  3FKI B;  1YNJ D;  4BBR B;  4B3M L;  5HY6 A;  1F9Q A;  2Z8L A;  2EOT A;  4JYA L;  2NVX B;  4YIJ A;  3HOV B;  4A3B G;  2ZJR A;  4DR5 L;  1M90 C;  3GTP H;  3N6R A;  1JB3 A;  4BXX G;  2JEB I;  3H15 A;  2UUC L;  1EFW A;  4A3M B;  1YZ6 A;  1XWE A;  3PMF A;  3AEV A;  1JT8 A;  4DK1 A;  1A6X A;  1C4Q A;  2E74 C;  1YNN C;  1X65 A;  4DAM A;  4JBJ A;  4A3G B;  3MXN B;  1R4P B;  2K7V A;  3J80 i;  4Q5V A;  1QZH A;  1X3G A;  3R2I A;  2A69 D;  3GTJ B;  3VR6 A;  4DAY B;  1A3U A;  3NEN A;  3KDF A;  4R4Q A;  4XXE A;  1Q1E A;  3GV6 A;  3H94 A;  1B3A A;  3I56 A;  1SNQ A;  4DUY L;  3S14 B;  1YJ9 A;  1STH A;  1HNW Q;  4DXF A;  2Z6K C;  3S2H B;  4RGM A;  2E76 C;  2ICE C;  3LNN A;  1RJT A;  4RFB A;  2QIL A;  1KNA A;  4HID A;  5IGF A;  5KGU A;  1WTW A;  1PFB A;  1SXT A;  3F2U A;  2H4O A;  3GTG B;  3TS2 A;  1HHV A;  1B3Q A;  2PZW A;  5IOC A;  3MWY W;  4RH6 A;  1CA5 A;  4X62 L;  3TN2 A;  2NZO A;  2HUG A;  5FLX L;  1KDC A;  3QB3 A;  5IGC A;  2BH2 A;  4ZRZ A;  4H02 A;  1QVG A;  3T56 B;  3CU7 A;  1FL0 A;  1LT3 D;  1PRT C;  4PV1 C;  1ZKO A;  1K28 A;  1MJC A;  1BCP F;  3PUY A;  2OXP A;  4BA1 I;  2AHO B;  2VB3 X;  2Z1C A;  5A35 A;  3K5O A;  1VQ6 A;  1Z9F A;  1XMO L;  3K8A A;  1ENA A;  1ILQ A;  4DK3 C;  2OCE A;  2D0O A;  3I8Z A;  4JI4 L;  1TWH B;  4JBK A;  3TP5 A;  2A8V A;  1QUQ B;  3OIP A;  2IHE A;  4HMJ A;  4KI0 A;  3Q6S A;  3X3N A;  2F0U A;  2R93 B;  2F3W A;  1W6K A;  3S1Q B;  2XNA C;  1VF7 A;  2AQ1 B;  4JPB W;  4DV2 Q;  2K33 A;  2WV6 D;  1X3F A;  3E0E A;  2K05 A;  3A7L A;  2K50 A;  2B2U A;  1VQJ A;  3J80 E;  3NTK A;  2OQK A;  4HCE A;  4DXG A;  3CCE A;  3RNU A;  2LY7 A;  3LGJ A;  4GKK L;  2HHH L;  1W3S A;  5M5W B;  2CCZ A;  2I07 B;  1VQI A;  5ELC A;  1FYC A;  1O7I A;  3FRP B;  4EVO A;  2FJ2 A;  3PSI A;  4LWC A;  3T1H Q;  1EYG A;  5ELN A;  2NTS A;  2VW9 A;  1VQD A;  3TP6 A;  3S1N B;  1NE3 A;  2N88 A;  4UP8 A;  4JI3 L;  3I4N H;  3I55 A;  1GUG A;  3A55 A;  4C3J H;  1XJV A;  3OW2 A;  4XYQ A;  4RMF A;  2NVQ B;  1HZ9 A;  5IIF A;  2F0S A;  4JI8 Q;  3DXJ C;  2IX0 A;  1PTO D;  1STY A;  2RVL A;  2LMC B;  2JK8 A;  4R8I A;  4OL7 A;  4TRD A;  2E2I B;  1RIP A;  1SN8 A;  2B29 A;  1II3 A;  2B2T C;  1I6H B;  1EU3 A;  4ODG A;  3J7A 5;  2XIW A;  4N8X 1;  4MHE A;  5DEH A;  4FDB A;  2PNR C;  5E1F A;  2Y0S E;  2HDL A;  2ALY B;  1VDZ A;  5I2Y A;  2MPM A;  4HSP A;  3HOY H;  2XGT A;  1B9M A;  3GTK B;  1I4G A;  1YNJ C;  3LWE A;  4RG1 A;  3UDG A;  1LYL A;  2OEO A;  4ZYS A;  1J6Q A;  3IAY A;  4HAE A;  5EKK A;  5JEA G;  1EIH A;  1S5B D;  3MFY A;  1AE3 A;  2IT1 A;  4A3L H;  1PTO B;  1TWF B;  1DOL A;  4LF5 L;  2IX1 A;  1CKM A;  4DGZ A;  2RCN A;  1N36 Q;  4QB4 A;  1H9R A;  1LUZ A;  4K6D A;  3JAM L;  4BS9 A;  1UE1 A;  2I46 A;  2IW3 A;  4KY5 A;  5I4D A;  4Y7N H;  4KD4 A;  3K0Y A;  1WCM B;  2CW0 C;  3M9B A;  4RA8 A;  4APV A;  2A69 C;  4A3B B;  3ULJ A;  2Z4H A;  1HFG A;  2VQE L;  4IOC A;  4KHZ A;  5FJ8 G;  2E2D C;  5K5P A;  5LMN L;  1JOR A;  1Y1V H;  4GN5 A;  1WTO A;  3OPO A;  4KJN A;  5C5M A;  5ELD A;  2DGY A;  1LTL A;  3HKZ G;  4F7X A;  2I0Q A;  2R7Z H;  4B08 A;  2Q8R E;  3CF5 A;  5GAD C;  2ATW A;  1IL8 A;  3VA5 A;  2NN6 I;  1XNR L;  1JR0 D;  1EY5 A;  3I4M B;  4IUP A;  4R9W A;  5CGK A;  4HCS A;  3NBH B;  4HN7 A;  5BN3 A;  4C3I H;  1V1P A;  4JI1 L;  1ET6 A;  4DK6 C;  4QCL A;  3QJY A;  2QGQ A;  4JC0 A;  3RR5 A;  2B63 H;  4TVA B;  3L2P A;  1VQM A;  2YYZ A;  2OQ0 A;  1D1K A;  1FNU A;  3C46 A;  1K9M C;  1STN A;  4LFC L;  4X3K A;  3GTO B;  3G6J B;  2CWA A;  3HOU H;  2JA5 H;  1SRO A;  2J0T D;  3KBG A;  1ONL A;  2H5X A;  1EQR A;  4A3I H;  1JWS D;  3NP8 A;  2JXM B; 
#chains in the Genus database with same CATH homology
 5E7N A;  1U0L A;  2PI2 E;  5GQO A;  2JA8 G;  1WCM H;  1HH2 P;  1QVC A;  1OXT A;  3SGI A;  1J5E Q;  1YJN A;  4JI5 Q;  4A3B H;  4R1J A;  2NVY H;  1VQP A;  1HR0 W;  2IHF A;  3RLF A;  2Z0S A;  3BZC A;  2JA6 G;  2K14 A;  4JI6 L;  1KRS A;  1UE5 A;  4GLX A;  1SE8 A;  2WFW A;  4BA2 I;  4P73 A;  4LF5 Q;  2Q2U A;  4OWW B;  1FJG Q;  2UXB Q;  4X6A H;  1UE6 A;  1E24 A;  2K75 A;  4L5R C;  4AYB E;  1YHA A;  4PZ7 A;  4B3S L;  4JV5 L;  2JJQ A;  4LF6 L;  2JA7 H;  3TEH B;  5FLM H;  3KOJ A;  3I4N G;  2AWO A;  5K36 G;  1S72 A;  1KL9 A;  3I2Z A;  4DR4 L;  2I5L X;  2F52 A;  2MO0 A;  2WAQ E;  3RN2 A;  1KD1 C;  1S3O A;  3JC6 6;  1VQO A;  5C0X G;  4JI2 L;  2D62 A;  1G51 A;  5C3E H;  1XPR A;  4A3E H;  3KYH C;  1L1O A;  1XMQ Q;  1QVF A;  3I4M H;  4A3J G;  4DR2 L;  2UUB Q;  4DR6 L;  2XTI A;  2Q2H A;  1Y1W H;  4OO1 G;  4YY3 L;  1VS0 A;  3W5O A;  1PVO A;  3JAM i;  4A3D G;  3A5Z B;  4XIG S;  5M3F H;  3OTO L;  3HFZ B;  4AH6 A;  4XTC S;  3S24 A;  4GS3 A;  2JEA I;  3ERS X;  3CC7 A;  4QIW E;  2R93 G;  2QEX A;  3U4V A;  3K7A H;  2UU9 Q;  1KHI A;  3ICE A;  1VQG A;  3KF6 A;  5ELO A;  4YWL A;  3RLO A;  4A3K H;  2MFI A;  1KIX A;  2F4V Q;  2V1C C;  4MZ9 A;  4DR3 L;  2CQO A;  3ULP A;  1VCI A;  1QZG A;  1PV4 A;  2YU9 H;  1N34 Q;  1PH5 A;  3ZJY C;  2MO1 A;  1PH6 A;  1Q1B A;  4PG3 A;  3GTO H;  1X55 A;  1HZA A;  1N8R C;  1N33 Q;  4HJ5 A;  3HOY G;  1NMG A;  2GVA A;  1PHJ A;  1PH3 A;  4DV5 Q;  5M3M H;  3BJU A;  5IP9 G;  1IZ6 A;  1E1O A;  1YJW A;  3PO3 H;  1XNR Q;  3S16 H;  1S40 A;  1L1O C;  3UDX A;  4QGU A;  4JI7 L;  1OTC A;  1Q8K A;  3CCS A;  5GRO A;  3PUX A;  4PMW A;  3WWV A;  4PZ8 A;  2JQO A;  4AYB G;  1K83 H;  1GKH A;  2OTL A;  3DLL A;  2AMC B;  1QUQ A;  3IRB A;  1JB7 A;  2B3G A;  1C7Y A;  4JI1 Q;  1NBW A;  4A3L G;  1XPO A;  4X66 Q;  2E5L Q;  5IYC G;  5IP7 G;  4DV0 Q;  4DV3 L;  2WAQ G;  3KFU A;  4IFD J;  3AYH B;  1CKN B;  3E9I A;  1Q46 A;  4LUZ A;  4GKJ L;  1SLJ A;  3TRZ A;  3L7Z C;  4LUO A;  3S17 H;  1IYJ B;  2BA0 A;  1VQA A;  4UPA A;  4JI0 Q;  4LFC Q;  3HOV G;  1YVC A;  5FJ8 H;  3M7N A;  3KF8 B;  1T9H A;  3CAM A;  4YCW A;  2UU9 L;  4A3F G;  1KXL A;  1JJG A;  4POF A;  3T1Y Q;  4B3R Q;  1A62 A;  4IPH A;  1PYB A;  2F3I A;  3HOZ H;  4IPG A;  3UDF A;  2E2J H;  3EBE A;  3GDE A;  1VQ8 A;  3PIP A;  2HQL A;  1VQL A;  2VQF L;  4JBM A;  5C4X H;  1Z47 A;  2KEN A;  4X64 L;  1HJP A;  4AQY L;  1YIJ A;  1BBW A;  1HZC A;  1SR3 A;  4C2M H;  3CC2 A;  3HOX G;  3G6E A;  1N32 Q;  4P75 A;  3TRE A;  1Y1V G;  2VL6 A;  4X65 L;  3PUZ A;  1JMC A;  1VQB A;  1D8L A;  2QA4 A;  4OXP A;  1HNW L;  3K0X A;  4LW1 A;  3PO2 H;  2UXD Q;  1Q7Y C;  3J7Z C;  1YBY A;  3U58 A;  2OWO A;  3AFP A;  4A93 G;  1NTG A;  1BVS A;  4DV1 Q;  3TS0 A;  2R7Z G;  1WJJ A;  4B3S Q;  1UE7 A;  4LF6 Q;  1G29 1;  1X3E A;  2DUD A;  3J80 c;  4B3M Q;  2WB1 E;  5C44 G;  4X66 L;  4A4I A;  4UP9 A;  1FVI A;  3F2D A;  4DV0 L;  1VQ4 A;  4QL5 A;  2E5L L;  4JYA Q;  3FHW A;  2YV5 A;  4DR4 Q;  2PQA A;  1JE5 A;  3BZK A;  5AJ3 L;  1FGU A;  1E7Z A;  5C0X I;  4R4C A;  4JI2 Q;  3W1G A;  2K4K A;  4PZ6 A;  4DR1 L;  4B3T L;  3UDI A;  2R92 G;  4C3H H;  4DR2 Q;  2VUM H;  4DR6 Q;  5JJK A;  3T1Y L;  5LMU Q;  4OO1 I;  4YY3 Q;  5JJI A;  1EUJ A;  2E8G A;  1XTD A;  1BBU A;  5IYB G;  2NVT H;  1IBM L;  3HOW G;  3OTO Q;  1YIT A;  3I4O A;  2B63 G;  2R7F A;  4IPC A;  3PF4 A;  3D31 A;  2BA1 A;  3UE1 A;  4LF7 L;  2GN5 A;  2ZTE A;  4HIO A;  1A8V A;  1C9O A;  2JA8 H;  1N32 L;  3I7F A;  3EN2 A;  5BR8 L;  1YI2 A;  1GM5 A;  3FP9 A;  3F8T A;  2N8N A;  4DR3 Q;  4NXM Q;  1Q12 A;  3RZO H;  4OWT B;  3M4P A;  3AQQ A;  3HOU G;  2JA9 A;  4L5T A;  4HIK A;  1E1T A;  3F2C A;  4NPS A;  3M4O H;  2UXD L;  1CSQ A;  4P74 A;  3W1B A;  1IL2 A;  4DV1 L;  4A75 A;  3S1R H;  4A3C H;  1B8A A;  3RN5 A;  3CMA A;  2ASB A;  1VQ5 A;  4Y52 H;  4LF4 Q;  1PH7 A;  4B3M L;  5HY6 A;  4DUY Q;  3KLW A;  4JI7 Q;  4JYA L;  4A3B G;  4OX9 L;  4BY1 H;  2N78 A;  2ZJR A;  4DR5 L;  1M90 C;  3GTP H;  4WJ3 M;  2WB1 G;  4BBS H;  4BXX G;  2NN6 G;  1CUK A;  2JEB I;  1GD7 A;  3H15 A;  3M4Q A;  5J3B A;  1EWI A;  3GD7 A;  1VQE A;  2N49 A;  1EFW A;  2UUC L;  4NXN Q;  4DV3 Q;  3PGZ A;  2Z6K A;  1YHQ A;  4OON A;  1YZ6 A;  5LMU L;  3AEV A;  1YNX A;  1ASY A;  4A3J H;  1JT8 A;  2JA7 G;  5FLM G;  3CCL A;  4JG2 A;  4GKJ Q;  4GOP C;  4DAM A;  1X65 A;  4A3D H;  1YHB A;  4JBJ A;  3MXN B;  1Q82 C;  3J80 i;  1QZH A;  1X3G A;  3G4S A;  4DUZ L;  1JJ2 A;  1IBL L;  2PNH A;  4L5Q A;  3CCR A;  4JCV E;  3KJO A;  5C3E G;  1BKB A;  4A3E G;  5JEA J;  4NXM L;  1I3Q H;  4LNQ A;  4DKA C;  4DAY B;  4EQ5 A;  2CFM A;  3J81 c;  1EOV A;  3NEN A;  1Y1W G;  3KDF A;  2VQF Q;  4R4Q A;  1H95 A;  1MIU A;  1Q1E A;  4X64 Q;  3STB C;  4IJH A;  4AQY Q;  1VQN A;  5M3F G;  4IOA A;  2OTJ A;  3B6Y A;  5IT9 c;  3GTQ H;  1N9W A;  3I56 A;  4LF4 L;  4X65 Q;  3CCQ A;  4MTN A;  4DUY L;  1YJ9 A;  1P8L A;  1GVP A;  3A5U A;  3T1H L;  2LXK A;  1HNW Q;  2Z6K C;  3A0J A;  4KLK A;  4A3K G;  3H0G H;  2E2H H;  4JOI A;  4AIM A;  1L1O B;  4HID A;  1VQK A;  4NXN L;  5IWA L;  3Q8D A;  2UUA L;  3GO5 A;  3PUW A;  1PH4 A;  2K5N A;  1KAW A;  1TWC H;  1L0W A;  4JI8 L;  5IYC H;  5IP7 H;  3PO3 G;  5M5X H;  3TS2 A;  3FKI H;  5AJ3 Q;  2R6G A;  4BBR H;  4DV6 L;  1K73 C;  4BY7 H;  4R4T A;  2GVB A;  5DLQ E;  1HNZ L;  4DR1 Q;  2Q2T A;  4B3T Q;  2NVX H;  4K0K Q;  3K81 C;  1OXX K;  4X62 L;  3HOV H;  1K8A C;  2NZO A;  4QQB X;  3KF6 B;  2WP8 J;  1ASZ A;  1VQH A;  4LUV A;  2BH2 A;  4H02 A;  3CCU A;  1QVG A;  1IBM Q;  2CWP A;  1FL0 A;  3CPF A;  4ALP A;  5IY0 A;  1MJC A;  4NB3 A;  3PUY A;  4BA1 I;  3NEL A;  2N3S A;  1PYS B;  3NEM A;  2AHO B;  4GN4 B;  4GNX A;  1R9T H;  1IBK Q;  4A3M H;  2ES2 A;  4LF7 Q;  4IFD G;  1WOC A;  2NZH A;  5BR8 Q;  3M85 A;  4HJA A;  1VQ6 A;  4JOI C;  1Z9F A;  4DNI A;  1XMO L;  4LFA L;  3CCM A;  3K8A A;  4DK3 C;  2OCE A;  2D0O A;  2RHQ B;  4JI4 L;  4A3G H;  3K80 C;  1SFO H;  1M1K C;  4JBK A;  3RLN A;  3CD6 A;  2A8V A;  1QUQ B;  4R4O A;  4YCU A;  2IHE A;  2IY5 B;  4KI0 A;  4HJ7 A;  3GTJ H;  5C4X G;  1AH9 A;  3EIV A;  1KQS A;  5GAG C;  4YWM A;  4OX9 Q;  2MNA A;  1B7Y B;  2EIF A;  3J81 i;  4IO9 A;  4DR5 Q;  2I5H A;  3CME A;  1N36 L;  2VY3 A;  4J15 A;  5LMN W;  5IYD H;  3AFQ A;  5EAY A;  1Q86 C;  2A19 A;  4YHH L;  2UUC Q;  4DV2 Q;  3S14 H;  4K0K L;  4LFB L;  5IE8 A;  4GNX C;  5FLX c;  1X3F A;  3E0E A;  3S2H H;  2K50 A;  1A0I A;  1VQ7 A;  2LXJ A;  3ER0 A;  3MEF A;  1VQJ A;  3CW2 C;  4OWX B;  2OQK A;  5GAH C;  4POG A;  1IBK L;  2EQS A;  2YTV A;  1EIY B;  4DUZ Q;  1IBL Q;  3CCE A;  3RNU A;  4GN3 B;  1C0A A;  3CQZ H;  3GTG H;  2KHI A;  5JJL A;  3LGJ A;  4LF8 L;  2HIX A;  4GOP A;  3GTM H;  4GKK L;  2HHH L;  1W3S A;  2JA5 G;  2VUM G;  2CCZ A;  2JA6 H;  4GLA C;  1VQI A;  1OXS C;  1VQC A;  2L15 A;  1KRT A;  1O7I A;  4A3I G;  3CC4 A;  3CP0 A;  2JE6 I;  4LF9 L;  3CCJ A;  1WCM G;  3PSI A;  4LWC A;  4DV7 L;  3T1H Q;  1EYG A;  5ELN A;  2VW9 A;  1VQD A;  1NE3 A;  2PQA B;  4UP8 A;  1X54 A;  4JI3 L;  3H3V I;  3I4N H;  1DGS A;  3I55 A;  4C3J H;  1OXU A;  1EIF A;  2C35 B;  5C0X J;  3STB D;  1XJV A;  2HT1 A;  3OW2 A;  2D0P A;  5M5Y H;  2KCT A;  3A74 A;  5IWA Q;  4DV2 L;  2UUA Q;  4RMF A;  4BXX H;  1HZ9 A;  1E22 A;  4A3C G;  3CCV A;  1TWH H;  4KHP L;  4JI8 Q;  1Y14 B;  1LM0 A;  2IX0 A;  1RL2 A;  2UXC L;  1X56 A;  4DV6 Q;  4JBW A;  4GLV B;  2ZM6 L;  4YCV A;  2JK8 A;  4BY1 G;  4L5S A;  3GTL H;  1HNZ Q;  1XNQ Q;  1RIP A;  4X62 Q;  1SN8 A;  2B29 A;  2R93 H;  4BBS G;  1NJI C;  3J7A 5;  3S1Q H;  4GOP B;  3I4M G;  2BH8 A;  3M3Y H;  3BU2 A;  4FDB A;  1VQF A;  1HNX L;  3G48 A;  1I50 H;  2Y0S E;  1I5F A;  4IFD I;  1PH1 A;  2ALY B;  4R4I A;  2VQE Q;  3ULL A;  1CKN A;  3HOY H;  3HKZ E;  2XGT A;  1HZB A;  1WFQ A;  1XMO Q;  1PH2 A;  4LFA Q;  1I94 L;  4WJ4 A;  4IJL A;  3G71 A;  5LMN Q;  5IP9 H;  1UEB A;  4HIM A;  4JI4 Q;  2YTY A;  1VQ9 A;  1KC8 C;  1NY4 A;  1J5E L;  4JI5 L;  4RG1 A;  3UDG A;  1LYL A;  1IXR A;  4ME3 A;  1A63 A;  3H3V H;  1J6Q A;  1XPU A;  1TWG H;  1NMF A;  2LSS A;  1WI5 A;  3HKS A;  1P16 A;  5JEA G;  1OXV A;  3J81 j;  3PF5 A;  1AE3 A;  2IT1 A;  5M5W H;  4A3L H;  1EQQ A;  3PIO A;  2Q2I A;  2YTX A;  1YEZ A;  4DV4 Q;  5M3M G;  4LF5 L;  1FJG L;  4EX5 A;  1CKM A;  2IX1 A;  2UXB L;  3F2B A;  1TWA H;  2RCN A;  1N36 Q;  3K7U C;  2ID0 A;  1UWV A;  5H1S E;  1B70 B;  4YHH Q;  3S1M H;  4YWK A;  1XNQ L;  4LFB Q;  1LUZ A;  3H0G G;  2MQH A;  3UE0 A;  3S1N H;  4A3F H;  1TXY A;  1UE1 A;  1GO3 E;  4P71 A;  3RZD H;  2FXQ A;  5GAE C;  3CXC A;  3KDF B;  4Y7N H;  1XMQ L;  2KBN A;  3M9B A;  3KJP A;  2UUB L;  4APV A;  2NVQ H;  4A76 A;  1D7Q A;  3FKI G;  1Q81 C;  2RHS B;  3ULJ A;  1PH8 A;  4BBR G;  2HIV A;  4IPD A;  2VQE L;  4BY7 G;  4IOC A;  4O0A A;  4LF8 Q;  4KHZ A;  1V9P A;  5FJ8 G;  4GKK Q;  3HOX H;  2HHH Q;  5LMN L;  1W2B A;  1PH9 A;  1HR0 Q;  1Y1V H;  2AWN A;  4GN5 A;  2Y0S G;  2EXD A;  1SMX A;  1V1Q A;  2PI2 A;  2RF4 A;  1AE2 A;  3HOZ G;  2E2I H;  3F1Z A;  2VNU D;  2DGY A;  1LTL A;  3HKZ G;  3S2D H;  3L0O A;  2F4V L;  1CSP A;  2VS1 A;  1I6H H;  4A93 H;  1SRU A;  3TQY A;  2AKW B;  2ZJQ A;  4LF9 Q;  2I0Q A;  2R7Z H;  1N34 L;  4DV7 Q;  4DR7 Q;  1G6P A;  3U50 C;  4HJ8 A;  4A3M G;  4QJF A;  1PFS A;  5C44 H;  4P72 A;  4MNO A;  3CF5 A;  4DV4 L;  1U5K A;  4JI3 Q;  5GAD C;  1N33 L;  4DPG A;  2ATW A;  3DM3 A;  4DV5 L;  2NN6 I;  3PO2 G;  4A3G G;  1XNR L;  1X9N A;  2ZTD A;  4JI6 Q;  2KCM A;  3GTK H;  1V43 A;  3JAM c;  2ZTC A;  2R92 H;  2CKZ B;  4KHP Q;  3NBH B;  3VDY A;  2K5V A;  3PUV A;  5C4J H;  2UXC Q;  1CKO A;  1JJC B;  4C3I H;  1PA6 A;  4JV5 Q;  4JI1 L;  2ZM6 Q;  1K0R A;  5IYB H;  3HOW H;  4DK6 C;  1X6O A;  2VZA A;  2QGQ A;  3PCO B;  4JC0 A;  4GNX B;  3RR5 A;  4HJ9 A;  1WYD A;  4QY7 A;  2PMZ E;  5HGQ A;  2ZJP A;  2B63 H;  2R7D A;  4TVA B;  1TWF H;  2K5H A;  3L2P A;  1VQM A;  1E3P A;  2YYZ A;  2OQ0 A;  3E9H A;  3PV0 A;  3OYY A;  3D0F A;  5IYD G;  2K52 A;  1MKH A;  2KHJ A;  1HR0 L;  4UY8 C;  1K9M C;  4JI0 L;  4LFC L;  3S15 H;  2CWA A;  2I5M X;  1K3R A;  1HNX Q;  2A1A A;  2JA5 H;  1L2F A;  3HOU H;  1SRO A;  4B3R L;  1MJE A;  4O2D A;  4UP7 A;  2H5X A;  4TQU S;  1I94 Q;  1EQR A;  1K8G A;  4A3I H;  4DR7 L;  3U4Z A;  3CPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...