3J80i

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
PKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j80i00
1IBLQ 2I0QA 1YBYA 1CKNA 2ZJRA 5IP7G 2HHHQ 2Q2HA 5K36G 1RIPA 4JI0L 1PH7A 4PMWA 3GDEA 1VQAA 5IP9G 3OTOL 3JAMi 2IY5B 2UXDQ 3RR5A 4LF7Q 1VQ8A 1HZ9A 1LM0A 1DGSA 2PQAB 1EFWA 4GLXA 2BH2A 4YY3Q 3RZOH 3HOUG 3CCVA 1VQDA 4DUZL 2JA5H 1N9WA 1WI5A 2FXQA 1IBMQ 4DR7L 2VNUD 1X54A 2R92H 5H1SE 4DV0L 4GOPA 1W2BA 4BY7G 5IY0A 2JE6I 4DR6L 2PMZE 2Q2TA 3KLWA 4NXNQ 5IYDG 1YJ9A 1OTCA 1E3PA 4JI2L 4APVA 1MJEA 2C35B 5IYDH 3HOXH 1B70B 4X66L 3KF8B 2R6GA 2NN6I 4DK3C 4HIDA 4BBSH 3BU2A 2UUAL 3S2DH 4DR6Q 3ULJA 3NENA 1KQSA 4HIOA 1XNRL 1SROA 1IBML 1OXVA 4BY7H 5GAGC 1CUKA 2JQOA 1VQLA 4DNIA 4JBWA 4B3MQ 1IBKQ 2YYZA 4UY8C 4A3KG 3A74A 4JI8L 1N33L 1WYDA 3EBEA 3K80C 4R4TA 1Q82C 3L2PA 3EN2A 1XMOL 1EQQA 3FHWA 4X64L 2E2JH 1K8GA 1A0IA 3AFQA 1G6PA 1A63A 2UUBQ 4IPGA 1QZGA 4B3RL 2NZOA 5JJLA 3RLNA 1I6HH 1BBUA 3S1RH 3KYHC 3CC7A 4KLKA 2VW9A 1K8AC 3TRZA 4A3KH 1E1TA 3AQQA 3W1GA 4A76A 4C3HH 4DV5L 1Y1WG 1CKNB 1YEZA 3G48A 3I4OA 1N34Q 2KBNA 4JI3L 3RLOA 5ELNA 3CPFA 4HJ7A 2R7ZH 3F2BA 1IXRA 4BBRG 1GO3E 1A62A 4BBSG 2MQHA 2H5XA 4GKJL 3D0FA 1IYJB 4JBKA 3M4PA 5FJ8H 3GTJH 2CCZA 4ALPA 1VQ9A 3A5ZB 2N78A 4B3TQ 1CKOA 2Y0SG 1HJPA 2VY3A 2E8GA 3GO5A 2NVQH 3S1MH 1HNWQ 4MNOA 3HOVH 4A93H 3CCSA 2R93G 1K73C 1M1KC 4LWCA 4LF5L 1K3RA 3G6EA 5IYCH 3L7ZC 1X3GA 4P71A 2EXDA 1M90C 4BXXG 1HNXQ 4IJHA 1PH5A 4JV5L 1E7ZA 2VUMG 2K14A 2N3SA 1UE6A 3F8TA 2A1AA 5IYBH 3OTOQ 2D0OA 3ULPA 1TWFH 2CKZB 3JC66 4JI0Q 2HT1A 3U58A 4DV1Q 5IP9H 3PSIA 2BA1A 1HZBA 1V1QA 1XMOQ 1K9MC 2EQSA 2WB1G 4BA1I 3PIOA 4LF6L 1AE2A 4WJ3M 4YCVA 3T1HQ 1Q86C 5C44G 2R7ZG 1D8LA 4GLVB 2UUCQ 3B6YA 1QZHA 4KHPQ 4LF5Q 4DV7L 3OW2A 2UU9L 2Y0SE 2ID0A 4YWLA 4YHHQ 3FKIH 4XIGS 2AHOB 2Q2IA 4DR5Q 4JG2A 4IOAA 1J6QA 3UDGA 1NBWA 1EYGA 1P16A 3GTKH 2GN5A 2BH8A 2MNAA 1Y1VH 1HR0W 3NBHB 4DV2Q 4IJLA 2WFWA 1XPOA 1X3EA 2Z6KA 1C7YA 4BA2I 3I7FA 4OWWB 2MFIA 1JJCB 1EOVA 3UE0A 5C0XG 1PH6A 2E2HH 2E2IH 1QUQB 4P74A 3F2DA 1SRUA 4LF7L 4A3CH 4DUYQ 1KRTA 4DV7Q 5M5XH 3SGIA 4QGUA 5IT9c 1QVGA 3GTGH 1O7IA 5AJ3Q 1XMQQ 1Q8KA 1U5KA 1YIJA 4DV4Q 2LXKA 4QJFA 1R9TH 1XPRA 2RF4A 4BY1H 3HOXG 4A3BH 1HR0Q 1MJCA 5IYBG 2JA7H 3AYHB 2JJQA 3M4OH 2Z6KC 3KDFB 1E1OA 2NVXH 4X62L 1WJJA 3KF6B 1BKBA 1Y1WH 2A8VA 5AJ3L 1L1OA 1E22A 3T1YL 4A3JG 4QQBX 1Q7YC 3KDFA 1NE3A 4DV6Q 3STBC 4LFCQ 2GVAA 4DAYB 2ZM6L 1HZCA 4JI4Q 4L5RC 3AFPA 3CPWA 4HJ8A 4DKAC 4DK6C 3J7ZC 4A3MG 2CWPA 3J81j 2OQKA 4JI5Q 4LFAQ 4OWTB 1PH4A 1BVSA 1GKHA 5LMNL 1HNZL 4JI7L 2OCEA 2A19A 2OQ0A 3KJPA 2VQEQ 1JE5A 4LFAL 4DUZQ 3A0JA 3CCMA 2K52A 4LUVA 2JK8A 3M3YH 3PIPA 1VQNA 2UXBL 2AWOA 1GM5A 4LFCL 4GN3B 1GVPA 1S3OA 1MKHA 3U4ZA 4DAMA 3PO3H 3NEMA 4YWKA 1VS0A 2IT1A 4DR7Q 2I5MX 3T1HL 4FDBA 3HOWH 2I5LX 3TQYA 4HIKA 4L5QA 2JA8G 4C3JH 1SFOH 1IBLL 2NN6G 1VQ6A 1V43A 2B29A 5LMUL 4EQ5A 3CCLA 2HIVA 3PUZA 4A93G 1UWVA 2R93H 5IWAQ 4GNXB 1NMFA 1N8RC 1FJGQ 3CCUA 2HIXA 2HHHL 5GAEC 1C0AA 1L1OC 4LF8Q 3HOZH 1YI2A 4IFDG 1JJ2A 3Q8DA 3W1BA 4JI6Q 2JA8H 3S17H 2K50A 4LF9L 2PNHA 4JI1L 1VQBA 2RHSB 1I94L 3I4MG 4DV2L 4AH6A 3HOUH 1EQRA 2R92G 1L1OB 2JEBI 3BJUA 1KC8C 4JI7Q 3PO3G 1FL0A 2ES2A 3GD7A 4JI5L 1KRSA 4R4CA 4HJAA 1Q81C 4QL5A 4NXNL 1X9NA 1FVIA 2F52A 4OX9L 4LFBQ 2WP8J 3H15A 1FGUA 5M3FH 1Q1BA 3CP0A 2R7DA 1S40A 1L2FA 2B63H 4JI3Q 4JI1Q 2MO1A 2UUCL 1X56A 4XTCS 5JEAJ 3GTMH 1KL9A 3RN5A 4R4QA 1KXLA 4A3FG 4JI6L 2YU9H 3PF5A 1K83H 2CFMA 2ZJPA 1JJGA 1U0LA 3KOJA 2CQOA 3CC4A 4IOCA 1S72A 1PYBA 1Z9FA 1G51A 3PUVA 5JEAG 3GTLH 2UXCL 1Q46A 4LFBL 4NXMQ 4X64Q 3K7AH 1TXYA 1WCMH 4IFDJ 3MEFA 3M9BA 3TEHB 3I4MH 3CMEA 3DM3A 2V1CC 4JI8Q 1UE5A 1IBKL 4IPHA 3I2ZA 4A3MH 1PH2A 2E5LL 1N33Q 4ME3A 5ELOA 4GOPC 3CXCA 3HOZG 4R4OA 4A3BG 3J7A5 1VQMA 1AH9A 1VQFA 2IX1A 1G291 2NVYH 1VQPA 1RL2A 4PZ7A 4A75A 2UXBQ 3CF5A 1EIFA 2KCMA 1EIYB 1TWHH 4DV3Q 5C0XI 1E24A 4JI2Q 4P72A 3BZKA 2VQEL 1B7YB 4X6AH 4JBMA 5IYCG 1NY4A 1LUZA 1TWAH 4PG3A 4BY1G 4DV5Q 4IO9A 1N36L 2JA6G 3S15H 1VQCA 3D31A 2RHQB 3TREA 3MXNB 1ASZA 1H95A 3CCRA 4QY7A 3ZJYC 3M85A 5HY6A 2E5LQ 2DUDA 1VQJA 4L5TA 1PYSB 2LSSA 1OXSC 2F4VL 1KHIA 3CQZH 4UPAA 1WCMG 4UP9A 2QEXA 3ICEA 1SR3A 2D62A 4KI0A 2UUBL 4GKKQ 4B3RQ 4DPGA 5IWAL 5C3EG 1UE7A 1B8AA 3CCEA 3BZCA 4J15A 1VQIA 2EIFA 1YJWA 2PI2A 1JT8A 1XNQQ 1W3SA 1YHQA 2YV5A 4JCVE 3RZDH 1SLJA 4IPCA 1N32L 1OXUA 3AEVA 5M3MG 1OXXK 5J3BA 4DV4L 3PO2H 4R4IA 4LUOA 1VQHA 1PVOA 1XMQL 5C4XH 1XNRQ 4HJ9A 2UUAQ 4MZ9A 4X66Q 4B3SQ 1QUQA 1CSQA 1WFQA 3KJOA 4OX9Q 3PGZA 2ATWA 2B3GA 3LGJA 1ASYA 2VUMH 4JYAL 5M5WH 2ASBA 4MTNA 3I4NG 5GAHC 4HIMA 5GROA 2PQAA 5M5YH 3ULLA 1PA6A 2GVBA 3PUWA 3CCQA 2VQFQ 2Q2UA 4O0AA 4JOIC 4OONA 1CSPA 4JI4L 3HOYH 3WWVA 4DR2Q 3E0EA 1KD1C 4LF8L 4AYBG 5FJ8G 2K75A 3PF4A 1VCIA 3DLLA 4TVAB 2UXDL 5BR8L 5FLMG 2XTIA 1X3FA 4RMFA 4POFA 4DV1L 4C2MH 4JBJA 4OO1G 4L5SA 4IPDA 4NXML 2K5NA 2UXCQ 4DR3L 4DR4L 1CKMA 2YTVA 1Y1VG 4PZ8A 5BR8Q 3HKSA 2HQLA 4DR2L 4IFDI 1HR0L 4LF4Q 3S1QH 1TWCH 1BBWA 2VZAA 4BBRH 1Z47A 2VQFL 4A4IA 1I5FA 2VL6A 4OWXB 1UE1A 1X55A 5M3FG 2ZJQA 2K5VA 1TWGH 1Y14B 1YZ6A 2IX0A 2B63G 3PV0A 2KHIA 4GLAC 3U4VA 5IP7H 4A3EG 3S2HH 3PCOB 2RCNA 2YTXA 1I3QH 1PH8A 2L15A 1C9OA 2VS1A 5C0XJ 5JJIA 1D7QA 1IZ6A 2N49A 3E9IA 4UP7A 4JC0A 1K0RA 1LTLA 5E7NA 1EWIA 4AYBE 2QGQA 4OXPA 5FLMH 4A3IH 1QVFA 4A3DH 2LXJA 1SN8A 4EX5A 5LMNQ 3A5UA 4JYAQ 3S1NH 2ZTEA 2CWAA 4YY3L 2WAQE 3M7NA 2ZM6Q 1VQEA 1LYLA 3RLFA 3CAMA 4A3JH 2I5HA 1FJGL 4YWMA 3CC2A 1YITA 2MO0A 4YCUA 1WOCA 1T9HA 2IHFA 3S16H 3KF6A 2JA5G 1PFSA 1JB7A 4OO1I 2N8NA 1EUJA 3H3VI 4GKKL 4JOIA 3HOYG 1Q1EA 1UEBA 4QIWE 3JAMc 4LF6Q 2F4VQ 1VQ7A 2AKWB 2KCTA 3F1ZA 3HOWG 1XNQL 3S14H 5LMNW 2BA0A 1KAWA 1KIXA 3U50C 4B3ML 2NVTH 4Y52H 3I55A 3L0OA 4P75A 1X65A 3RNUA 3H3VH 1QVCA 4POGA 3K81C 3W5OA 4HJ5A 4A3CG 1NTGA 1HZAA 3EIVA 3CD6A 4NB3A 3HKZG 1L0WA 2OTJA 3HFZB 1HNXL 1OXTA 4X65L 4DR1L 4DV3L 4NPSA 4Y7NH 2AMCB 4AQYL 3PUXA 5HGQA 4A3EH 2WAQG 3S24A 1X6OA 3UDIA 3J80c 3K8AA 4LW1A 1N36Q 1P8LA 3K7UC 3PO2G 4RG1A 1A8VA 4WJ4A 4DV0Q 3VDYA 5M3MH 3G4SA 1PHJA 2JA9A 1HNZQ 5GADC 4LF9Q 3TS0A 3OYYA 4P73A 1IL2A 3KFUA 5C4XG 4AQYQ 4GN5A 4X65Q 1XJVA 4A3FH 1PH1A 1PH3A 3ERSX 3PUYA 1SE8A 4DR1Q 1SMXA 1XTDA 3CMAA 4A3GG 5C3EH 2K5HA 4A3LG 1N34L 2DGYA 3T1YQ 4KHZA 4YCWA 2XGTA 5FLXc 1YJNA 4UP8A 4KHPL 1MIUA 1NMGA 2IHEA 2KENA 5DLQE 3J81i 4X62Q 3GTOH 2AWNA 1YNXA 4AIMA 4LNQA 3UDFA 3HKZE 3J80i 1AE3A 1Q12A 5C4JH 3I56A 4DR3Q 5IE8A 2NZHA 4GOPB 1XPUA 2JA7G 2WB1E 4DR4Q 3FP9A 2PI2E 3H0GH 2OWOA 4C3IH 4GNXC 2JA6H 3I4NH 3NELA 4JV5Q 4DUYL 1J5EQ 2KHJA 1JMCA 3STBD 4GNXA 1YHBA 2OTLA 3CCJA 4K0KQ 4BXXH 2ALYB 1PH9A 3HOVG 3UDXA 4LUZA 4H02A 3RN2A 3CW2C 3TS2A 4TQUS 1V9PA 3G71A 3GTPH 2R7FA 1GD7A 3H0GG 1I94Q 4A3GH 2Z0SA 2K4KA 1HNWL 5JJKA 3J81c 4B3TL 2JEAI 4A3LH 1VQGA 1NJIC 4DR5L 4GKJQ 3FKIG 3F2CA 1PV4A 4YHHL 2YTYA 3ER0A 4R1JA 3E9HA 1YVCA 2QA4A 1J5EL 5EAYA 1VQ5A 3UE1A 4DV6L 1VQOA 4B3SL 2UU9Q 4GN4B 5GQOA 1VQ4A 1HH2P 2ZTCA 2ZTDA 2F3IA 4O2DA 4PZ6A 4A3IG 3GTQH 4A3DG 4K0KL 4GS3A 4LF4L 2D0PA 3IRBA 5LMUQ 1N32Q 1YHAA 5C44H 3K0XA 1VQKA 1I50H 3M4QA
chains in the Genus database with same CATH superfamily
2I0QA 1CTMA 2B2WC 4C56C 1W6JA 5CC4A 2Q2HA 2HHHQ 4HN7A 5E4XA 2DY7A 3OTOL 3U9SA 1YNND 1TS3A 2A6ED 2IY5B 3NQTA 1WTXA 1HZ9A 3BG3A 5ISRA 2PQAB 1EFWA 4GLXA 2BH2A 1VQDA 4DUZL 1WI5A 5A2QL 3V96A 1X54A 2LKVA 4DV0L 4BY7G 5IY0A 2JE6I 3I70A 4CDCC 4NXNQ 5IYDH 3S15B 1YJ9A 1MJEA 3U9OA 4M8AA 3KF8B 1D5XC 1EEID 3DWQA 4HIOA 1B9MA 1QOHA 1OXVA 5BN5A 4DK1A 4UY8C 1G6ZA 2YYZA 4A3KG 2D5DA 4R4TA 2NN6H 1Q82C 3L2PA 3EN2A 2JN4A 1XMOL 1Z7TA 4K2KA 2KOLA 4S3SA 5EPJA 1G6PA 3AFQA 1A63A 2UUBQ 2BE5D 4B3RL 5JJLA 2K7VA 2WIIB 3RLNA 1I6HH 2CQAA 4QCLA 2A69C 2RBMA 1EYDA 1BBUA 3GTQB 3CC7A 2VW9A 3AQQA 1Y1WG 2VUMB 2CVRA 1YEZA 5ELNA 3F2BA 1IXRA 4ZUJA 1A62A 1PTOF 3D0FA 1F9PA 5C5MA 3GTJH 4FVMA 3SK8A 1Y8PB 2BE5C 2EYHA 1CKOA 1HJPA 3S1MH 3NTHA 1HNWQ 4MNOA 5JVG3 5E3FA 1KABA 3OIPA 4A93H 1K73C 1JOKA 1BUVT 1TWHB 3F8TA 3V05A 2A1AA 2D0OA 4G7HC 1B50A 2IJ0A 1F2LA 2HT1A 3EROA 2O5IC 1K9MC 2WB1G 1G8ZD 4FP5D 3E0JA 1Q86C 5D14A 1D8LA 3T51B 1LTGD 1QZHA 2B2YC 2V4DA 4HMJA 1PFMA 2UU9L 1CM9A 4JG2A 1J6QA 2BH8A 2MNAA 4U68A 3NBHB 1LT4D 2WFWA 3MVVA 1XPOA 2K33A 4BA2I 4OWWB 3Q24A 3UE0A 1LACA 1SAPA 1KRTA 5M5XH 4KKUA 4DV4Q 5JVH3 1MJCA 2EXZA 5IYBG 3KLSX 5DAUA 1E1OA 2F0UA 1E2VA 2A6HD 3VR4A 1BKBA 4XYOA 3D4WA 3T1YL 2NVXB 1BQQT 3STBC 2ZM6L 1HZCA 3J7ZC 1DONA 4JI5Q 3TP8A 4LFAQ 1PH4A 1GKHA 5A2QE 3GP7A 1EY0A 1Q3LA 4JI7L 2OCEA 2WACA 1K8MA 1JE5A 3E5SA 4DUZQ 1NSNS 2A6HC 3A7LA 3HG9A 2JK8A 3M3YH 3PIPA 1A3TA 1TS2A 4LFCL 1S3OA 1WCMB 1SFOB 2B2VC 1TU2B 3NEMA 1Y8NB 4JPBW 5FO7B 3NK9A 3TBIB 4HIKA 2EVBA 3J7AV 3UI2A 2JA8G 4B08A 4C3JH 2AQ1B 3GV3A 1VQ6A 1T5EA 4IQZA 4EQ5A 3MXGA 5IWAQ 5T1GA 1LTSD 1D2BA 5EPKA 1QE6A 2L11A 5M5XB 1C0AA 3S16B 1L1OC 4LF8Q 5FO8B 1JJ2A 3VR2A 2JA8H 3S17H 3WOFA 4XDXA 3S14B 1TKWB 3I4MG 1EIHA 4DV2L 3MXUA 4WRDA 5M9OA 3BJUA 5COYA 1KC8C 2B63B 1CFMA 5JAVA 3TMEA 5IGEA 3H15A 2F3WA 4JI3Q 3RD4A 4RA8A 4OIJA 4FF1A 3GTMH 1SEBD 1KL9A 3I73A 4A3FG 4JI6L 2YU9H 1B2TA 1U0LA 1V1PA 3IFDA 1H9JA 3K6OA 2CQOA 2KJXA 4C3HB 1SE3A 1G2SA 1GUSA 1Z9FA 2WKDA 5JEAG 1MBYA 1ZEQX 2KHSA 3DM1A 4X64Q 3TEHB 3R8BA 4WORA 3CMEA 1BCPC 3FPPA 2V1CC 1UE5A 3C1EA 5C4HA 5ELCA 4A3MH 3I2ZA 1N33Q 1ICWA 5EPLA 3HOZG 1IL8A 2Z4HA 1Q90A 3J7A5 1VQMA 4FXKC 3NWTA 1G291 1VQPA 1RL2A 4PZ7A 3WDNA 4DFAA 3MTSA 1QJOA 2VQEL 1A6XA 1LUZA 1TWAH 3E6ZX 2SNSA 1L0XB 3D31A 3MXNB 3CCRA 1LTAD 5HY6A 1IHZA 2F4VL 1WCMG 1QNKA 3MZ5A 4UP9A 4KI0A 3SEBA 4DPGA 5C3EG 1B8AA 3S2HB 1EY6A 1PDQA 1SNCA 1F9QA 4IPCA 1N32L 3PIP3 1WTRA 2BDOA 4DV4L 1FYCA 1VQHA 5D3IB 1I4QA 2F0HA 2K28A 2KA7A 4DN4M 1XNRQ 4JK1C 4F88A 4KY5A 3D8GA 4X66Q 3KJOA 4CJ2C 4OX9Q 3PGZA 4FXDA 2EOTA 4K5WA 1ASYA 4JYAL 1BR9A 3DHQA 5GAHC 4HIMA 2EYFA 1CI3M 3PUWA 4IUUA 2K32A 5C5LA 1SYDA 2VQFQ 4RCOA 4JOIC 4HCSA 4JI4L 5CV6A 4CKCA 4FF3A 2IW3A 4ZCKA 4AYBG 4K6DA 1VCIA 3HOVB 4TVAB 1A2TA 3T56B 1F77A 1B53A 4E6IA 4BS9A 1ICFB 4NXML 1O7YA 4HAEA 2KUMA 1Y1VG 4FF4A 2RA4A 1FNVA 1LT5D 4DR2L 4IFDI 2VL6A 3K5OA 3GTKB 4OWXB 1WTVA 3BDCA 4RGOS 1EWHA 1TWGH 2B63G 2EPBA 2KHIA 1I3QH 2RCNA 4RGMA 2VS1A 5C0XJ 1IZ6A 2R3ZA 2WKCA 4JI7Q 5E7NA 1LTLA 4AYBE 1EWIA 3TP6A 4L6TB 1SN8A 3GTGB 5E1FA 2CWAA 4YY3L 5JPMC 1LYLA 3AB9A 3VR5A 1FJGL 4G4KA 4YWMA 3CC2A 3TSSA 4YCUA 4BWGB 1T9HA 4IURA 5EKLA 2FMMA 1Q1EA 4LF6Q 3F2UA 1J9OA 3P20A 3S14H 1KAWA 1KIXA 1PYWD 1EY8A 3K81C 2DJGC 4A3CG 4HJ5A 3GQBA 1WTOA 4NB3A 2RDGA 1NR2A 1HNXL 4DR1L 4DV3L 3H94A 4AQYL 4UHVA 1X6OA 1DXMA 1A8VA 5M3MH 3G4SA 1I50B 2XWJB 3OYYA 4P73A 4K2LA 3TS0A 1IL2A 4X65Q 1PH1A 2HUGA 1PH3A 4DNRB 1SMXA 1XTDA 2AQ2B 1SYEA 3VYTA 1YNJC 2I46A 4A3IB 4DXFA 4ZYSA 1AE3A 3I56A 4DR4Q 3HOWB 2PI2E 4G7ZC 3BZDB 2F0DA 2JA6H 3I4NH 1ET9A 4JV5Q 4MHEA 2E2DC 4KMUC 2MUYA 4BY1B 4PQXA 1EEFD 4BXXH 2ALYB 1RTNA 3Q6SA 3HOVG 4LUZA 1V9PA 4A3GH 1I94Q 2K4KA 1HNWL 3J81c 2JEAI 2Z6BA 1LLRD 1VQGA 3IFTA 1NJIC 4GKJQ 1GUNA 2E2JB 1ONLA 4R1JA 3E9HA 1LV9A 1FNUA 5FOBB 4Y7NB 1VQOA 4CJ1B 1SXTA 5GQOA 3AMUA 2VXWA 3C1FA 1DYQA 2ZTCA 2VB3X 1Q8IA 1SMYC 5LMUQ 1LTTD 2NB0A 3M4QA 1YBYA 3A54A 2ZJRA 5KGUA 3SR1A 5IP7G 1M8AA 4UDUC 4PMWA 1NAPA 3GDEA 3QB3A 5C4ZA 1SBBB 3TDQA 3J80E 2XRQD 5C3WA 4LF7Q 1QG7A 3RZOH 1H95A 2VNUD 1KNAA 2FXQA 3NBIA 4MIUA 1W2BA 2R92H 2RCFA 3W2DA 2E75C 1X32A 4LMQD 4JI2L 1E3PA 4XT3B 2C35B 1L0YB 4DU9A 3HOXH 4X3TA 3NHHA 3I4LA 2R6GA 4J8QA 2KVMA 3S2DH 1G2TA 2H1EA 1KQSA 1BCPF 2F0NA 1SROA 1IBML 3T16A 2JQOA 3I90A 1IBKQ 1WYDA 3K80C 3MWYW 5K5PA 1G91A 1CK1A 1H9MA 4X64L 1K8GA 4I7AA 1AFPA 4IPGA 3PIO3 3KYHC 2YU9B 4H7BA 3W1GA 2NZ1D 5IGGA 4A76A 4C3HH 4DV5L 3G48A 1N34Q 2KBNA 2Q8RE 4HJ7A 4BBRG 3SVMA 1IYJB 4CJ0B 4A3JB 5FJ8H 5G3LD 2CCZA 1VQ9A 2N78A 3A5ZB 4B3TQ 1IKLA 4LWCA 2NWGA 2X69A 4J6HA 1K3RA 4P71A 2EXDA 4BXXG 1PTOB 1HNXQ 1DM0B 1LTRD 1E7ZA 3OMGA 2N3SA 1KDCA 1PRTC 2J7ZA 3U58A 3FPUB 4G57A 2EQSA 3PIOA 4BA1I 4RCNA 1AE2A 4WJ3M 1STNA 4O42A 3R3OA 4LF5Q 2CHBD 4DV7L 3OW2A 2ID0A 4A3FB 4YWLA 2Q2IA 2I07B 4WJWA 1EYGA 1P16A 2GN5A 1Y1VH 4NDXA 5CV4A 4HCEA 4DAVA 4IJLA 5C6AA 4RFBA 2NUCA 2HDMA 1LO5D 1D1KA 1X3EA 2Z6KA 1C7YA 1JJCB 5DM73 5C0XG 2E2HH 1QUQB 4P74A 3F2DA 2KEEA 3CKIB 1BF4A 4AYBB 3GTGH 4MTKA 3S1MB 4QUCA 2LXKA 4QJFA 3HOXG 1XYIA 2JA7H 2JJQA 4OELB 1MSHA 2Z6KC 1H9SB 3KDFB 1WJJA 3NUCA 1EZ6A 3D4RA 3VYRA 4HTHA 1Y1WH 2SNMA 1IYUA 2L1BA 5D3DA 2BDNA 4A3EB 2K1BA 2RDHA 3NSWA 4LFCQ 1DCZA 3EA6A 4JI4Q 4L5RC 3EVQA 4HJ8A 4DKAC 2CWPA 3J81j 1HTPA 1HNZL 4BBRB 1LT6D 2WV6D 1TR5A 3PO3B 2WINB 4LFAL 2O5JC 1JC7A 2K52A 4LUVA 4RAUC 5IOCA 3MAQA 1VQNA 1JCKB 2AWOA 4GN3B 1TQOA 1MKHA 3U4ZA 4YWKA 1VS0A 2I5MX 3HKZB 3T1HL 3HOWH 2I5LX 2ZXPA 3TQYA 4L5QA 3RZOB 3C3LA 2G5DA 3LNNA 2C9OA 1S5BD 5DM63 5LMUL 5AFWA 5I2XA 3CCLA 4GNXB 1X3QA 1NMFA 1N8RC 2KECA 5GAEC 2XRSD 4MN3A 1YI2A 3Q8DA 1GUGA 3I4NB 4JI1L 2DJFC 4C3HG 1VQBA 2RHSB 4OIKA 5TSSA 5EBDA 4AH6A 3HOUH 1EQRA 1LTBD 1MGSA 2R92G 1KNEA 5JJZA 3K5MA 1FL0A 4CBVA 3GD7A 1Q81C 1X9NA 1W6KA 1FVIA 3VYUA 5LHY1 1K3BC 3CP0A 3BVMA 4ILWA 5C44B 2R7DA 1GUOA 1L2FA 3TP5A 1JICA 2B63H 4F8MA 2B2TC 4XTCS 2UUCL 4R4QA 3HS0C 1KXLA 2PNRC 3OWEB 5EQ0A 1JJGA 3KOJA 1KDAA 1HTLD 3CC4A 1DOKA 1PYBA 5IGDA 2DNCA 1ZXTA 4NXMQ 5C3XA 3K57A 3M9BA 4M1UB 3I4MH 2F0QA 3DM3A 5M5WB 4P2CB 4IUVA 1EIGA 4IPHA 1PH2A 4ME3A 2L5TA 4KKTA 4JVZA 1AH9A 3KLRA 2IX1A 4RH6A 1PRTF 2NVYH 1EY9A 3DMUA 4A75A 1RODA 3CF5A 1EIFA 2KCMA 4DV3Q 3K0YA 4JI2Q 2NTSA 3R2IA 2PYKA 4JBMA 2OEOA 5T1IA 3HOXB 4QY7A 3ZJYC 2E5LQ 1JWSD 2PZWA 1GHKA 2IWHA 4KD3A 4C1NI 5F2DA 1NNXA 2CH4A 1KHIA 3CQZH 4ZAIA 1SR3A 3MXNA 4GKKQ 1VQIA 2PI2A 5KNBA 3I3CA 1O80A 3GTMB 1CT1D 3AEVA 4O1NA 4IUPA 4K5XA 5I4DA 3SK5A 1PVOA 2EY5A 3RZDB 3S1NB 3GTLB 4MZ9A 4B3SQ 2E2IB 1WFQA 3FRPB 2O4XA 3OHXC 1A3VA 5M5WH 3I4NG 2IX3A 5M5YH 4CKBA 4N9TA 4WFN3 2GVBA 3URYA 4Q0FA 1IYVA 4O0AA 1RCVD 1AZPA 3HOYH 5CV7A 1PTOD 2JYOA 3DLLA 2UXDL 5BR8L 2XTIA 1X3FA 3Q0AA 4DV1L 3I72A 3KF8A 4L5SA 4ZRZA 5CR3A 2K5NA 2KQ3A 4DR3L 4DR4L 1B9NA 1CKMA 3HKSA 4C2MB 1HR0L 4KK7A 1TWFB 4LF4Q 3S1QH 1BBWA 2VZAA 3IKJA 1Z47A 4A4IA 2EY1A 3HZXA 1QNUA 3VYSA 1UE1A 1X55A 5CV8A 2K5VA 1YZ6A 2IX0A 1ZYRC 2SOBA 3U4VA 5IP7H 4PNYA 1TWCB 2YTXA 5JJIA 1D7QA 1GJXA 2N49A 3E9IA 3QR8A 3LWUA 5BN4A 4A3DH 2QGQA 1RTOA 2LXJA 2A74C 2QILA 3IAYA 4EX5A 3GTOB 2QKIC 5C4XB 2PQEA 2ICEC 3CAMA 4RKBA 5A35A 2B2UC 3M4OB 1H9SA 1K0SA 1PFSA 2B2WA 2QCPX 3A56A 5BN3A 3KLSA 4QIWE 3JAMc 2F4VQ 2AKWB 3BVGA 3HOWG 2G9DA 3NE5B 3TN2A 4EVOA 4B3ML 3HOUB 2F0KA 3J7YW 2KEDA 5KYIA 3RNUA 1QVCA 4C1NK 3W5OA 1HZAA 3CD6A 2OTJA 3D6CA 2NBFA 1I6VC 4N9PA 2AMCB 3PUXA 3HEJA 1XXGA 4ODGA 1P8LA 4R8NA 4RG1A 2E74C 4DV0Q 5GADC 3KFUA 2TMPA 4A3FH 2FMCA 3ERSX 4A3GG 2ZXRA 4A3LG 3H91A 2DGYA 3T1YQ 4PMCA 3DXJC 4KHPL 1MIUA 1B1ZA 1TY2A 3DEPA 4LK1C 1HCZA 1RF2D 5C3EB 3CRKC 2AWNA 1YNXA 2EYMA 4AIMA 1EWCA 5C4JH 1Q12A 5JOBA 3SDZA 1XPUA 1VF5C 3NTIA 3DEOA 3H0GH 1BCPB 4C3IG 3K5NA 1J5EQ 2KHJA 1JMCA 3STBD 2EDGA 1VDZA 1A2UA 1YHBA 3NQIA 2TSSA 5D65A 5ELFA 3CCJA 4K0KQ 1PH9A 3QWNA 4H02A 3CW2C 2FFKB 1GD7A 2R7FA 3H0GG 3I8ZA 2L55A 2Z8LA 1UEAB 5KNCA 1DD2A 4OGQC 3F2CA 1I4GA 2YTYA 1J5EL 1YVCA 3UE1A 3GV6A 2UU9Q 4GN4B 1VQ4A 2ZTDA 2F3IA 4O2DA 4PZ6A 2JSOA 4A3IG 3GTQH 4GS3A 4LF4L 2QW7A 3IRBA 1I50H 1K8OA 1IBLQ 3V2TA 3M3YB 4EQNA 1JORA 1RIPA 4JI0L 3CU7A 3QJYA 1HQRD 1O78A 2EYPA 1AN8A 4A3MB 1ILPA 1VQAA 3PQIA 1C8CA 2UXDQ 3RR5A 1VQ8A 5FKAC 5M5YB 1T5XD 4YY3Q 2JA5H 1N9WA 1IBMQ 1FD7D 2RDFA 3N6RA 1I4RA 5J39A 4DR6L 1II3A 1KLGD 2Q8IB 2PMZE 2Q2TA 3KLWA 1OTCA 4APVA 1Z6HA 4X66L 4DK3C 3HGBA 3BU2A 2UUAL 3ULJA 3NENA 1QB5D 1RHPA 5LL6S 3KUPA 3J80L 4BY7H 5GAGC 1CUKA 4XXEA 1VQLA 4B3MQ 4JBWA 1TVXA 3A74A 4JI8L 1N33L 1B4OA 1SJED 3A8IE 3FHWA 5KIXA 4RHRA 1QZGA 1I3QB 1R4PB 1SE2A 3Q22A 4KLKA 1K8AC 1O7LA 2B2YA 3TRZA 4A3KH 1E1TA 2LMCB 2X6LA 3S1RB 4JI3L 4OEMB 1GO3E 4GKJL 3PO2B 1DOMA 3M4PA 4JBKA 3ONAB 2BCOA 5HURA 4ALPA 2NVQH 2K01A 3GO5A 5I9OA 3CCSA 3DUZA 2R92B 4C3JG 1ML0D 5IYCH 5ELEA 1X3GA 3G6EA 4IJHA 1BO0A 1PH5A 4JV5L 2EZVA 4B9XA 1UE6A 3MXPA 1SMYD 3NP8A 5IYBH 3OTOQ 1SYGA 4QMGA 1TWFH 2CKZB 4JI0Q 4DV1Q 5IP9H 2AUKA 2PW5A 2N88A 2LS01 2H4OA 4YCVA 3T1HQ 5I6YA 1E0BA 5C44G 1PZID 3B6YA 2Q8TA 2IL8A 2XNAC 2XIWA 2Y0SE 2B2VA 3FKIH 4XIGS 1EY5A 2AHOB 4IOAA 3UDGA 1PTOC 2WAQB 3H3VC 1PMRA 1S5FD 4QUFA 3S9WA 3C46A 1HR0W 4DV2Q 4JW0A 4A3KB 1HPCA 4ME5A 4KN4C 3I7FA 1Y8OB 2MFIA 4K6LA 1SRUA 5CYUA 4LF7L 4A3CH 4DUYQ 1D6EC 3SGIA 5IT9c 1O7IA 5AJ3Q 2MGSA 2NVQB 4I65A 1YIJA 1U5KA 1GOZA 1WTHA 1KDBA 4A3BH 5EGTA 1HR0Q 4GZYC 2L4NA 5J22A 2NVXH 4X62L 2PPBC 1ESRA 2A8VA 1L1OA 1UUPA 4ZLTF 1Q7YC 3BYYB 2PW7A 3KDFA 4EQPA 5CMDA 1WVLA 1CHQD 5FLXE 2OQKA 4OWTB 1BVSA 5LMNL 2NYZD 3ND8A 4RWSC 1SYCA 2A19A 2OQ0A 4CDDC 2VQEQ 1TY0A 4XYQA 3FDTA 2K03A 2RSOA 3CCMA 1TWGB 3QOLA 2UXBL 2F0GA 4X3UA 1GM5A 1GVPA 4DAPA 3PO3H 2WB1B 3SK4A 5CBEE 4DR7Q 2IT1A 4UAIA 1GUTA 1C4QA 2KCCA 1HFNA 1IBLL 1SFOH 2NN6G 2G9HD 1NCVA 1KTKA 1V43A 4A93G 2HIVA 1UWVA 4HEDA 5LL6X 1GXDC 3CCUA 2HIXA 4OO1H 4XQNA 2L0CA 4X3SA 1R9TB 5FO9B 3HOZH 3H09A 4IFDG 4JI6Q 3HP3A 1WTWA 2B2TA 2K50A 2D2CC 1E2ZA 3MEHA 3FVQA 1MD2D 1L1OB 4V190 2MHVA 5C0XH 4IALA 4JI5L 1KRSA 2FJ2A 4HJAA 3IL8A 4NXNL 2F52A 3PMFA 4OX9L 4DAYA 5IGCA 1TIID 1Q1BA 1S40A 3TZDA 1EQVA 1X56A 5JEAJ 3RN5A 2RQXA 3PF5A 1SNMA 4NW2A 5DEHA 4OHJA 2PO4A 3T53B 3VR6A 3J81E 1S72A 1SJHD 3EFXD 2UXCL 1Q46A 2XSCA 1I4XA 1HFGA 1TXYA 1WCMH 3MEFA 5ELBA 1IBKL 1F2MA 3K7AB 1B44D 5ELOA 3K58A 4A3BG 2F0JA 1STEA 1VQFA 3QIAA 4BBSB 2IPKD 3HOYB 5CV5A 1TWAB 1BXTA 5I6WA 2UXBQ 4XQJA 4ZKBB 1EIYB 1J8IA 1JQYD 1A15A 1ET6A 3HOZB 1B7YB 3DWPA 2EE1A 4X6AH 1NY4A 2LFNA 4PG3A 4R8IA 4IO9A 2HD3A 2JA6G 3S15H 1VQCA 2RHQB 3TREA 1ASZA 3SHLA 2SDFA 4DXGA 5K36H 1ESFA 3S2DB 1PYSB 2LSSA 1OXSC 3KK7A 1SYBA 1U4RA 2UUBL 3E3XA 4B9WA 2F0WA 2JP1A 1UE7A 3BZCA 2EIFA 2OXPA 2JXMB 4N8X1 2ZXOA 1JT8A 1YHQA 2FINB 2YV5A 4JCVE 1SLJA 4OL7A 1HQMC 3NBHA 4ZK9B 4KHVA 1OXXK 2L12A 4KV6A 4R4IA 3GTJB 2X6GA 2UUAQ 2M00A 2MPMA 3OIQA 1F2ZA 2AQ3B 3G7LA 2F0SA 2EJFC 2B3GA 3LGJA 3FMCA 2ATWA 2VUMH 2ASBA 5FLXL 5GROA 4CHTB 2PQAA 4KKSA 1PA6A 1E2WA 1QILA 2QDLA 2Q2UA 4KN7C 4LF8L 1KD1C 3PF4A 2K75A 4A93B 5FLMG 4QB4A 4FNFA 2F0LA 2GA4B 4RMFA 3BDOA 4IPDA 2EJMA 4FO2A 4XQQA 5BR8Q 3SXHA 2HQLA 1AW7A 4KJNA 1VMCA 1WTQA 2PMZB 1U9RA 1LABA 4BBRH 3MA2B 1I5FA 2F0VA 5M3FG 3CRLC 5JPNC 2A73B 3PV0A 1S5CD 4K5VA 4A3EG 5IGFA 4J1MA 3PCOB 1I6HB 1PH8A 2L15A 1C9OA 3A7AB 4HSVA 4UP7A 4JC0A 1K0RA 1SNQA 4OXPA 5CGKA 1QVFA 5LMNQ 3A5UA 4JYAQ 2ZTEA 3M7NA 2WAQE 2XN9C 2ZM6Q 1VQEA 4H0LC 4X3KA 2I5HA 1PXUA 3LWEA 1MI2A 1WOCA 2IHFA 3S16H 1JB7A 2N8NA 1EUJA 2EYJA 3H3VI 4GKKL 2Z9HA 4JOIA 3HOYG 1VQ7A 3F1ZA 1AZQA 1CQVA 1YNNC 3U50C 3I55A 1JWUD 2AUJD 1EY4A 3L0OA 1OO9B 1B3QA 4CGYB 1NTGA 2K5WA 3OW7A 3HKZG 3VA5A 3ZYYX 1OXTA 2K5QA 5M3FB 4NPSA 5IT9E 1PZJD 4A3EH 2WAQG 4LW1A 5JEAH 1FNWA 3K7UC 1EU3A 1HNZQ 4YIJA 1PHJA 3T13A 2F0FA 5KYLA 4AQYQ 4LAAA 3EQLC 2LY7A 2PZUA 3PUYA 4DR1Q 3P7JA 2F1MA 5HGTA 3G6JB 1N34L 1A3UA 4YCWA 1VMPA 2XGTA 1YJNA 4UP8A 4A3DB 1NMGA 2IHEA 2B8GA 2KENA 2SEBD 3H0GB 3J81i 1Y69U 3P75A 4LNQA 3UDFA 3HKZE 4ZUIA 2Y0SB 3J80i 4GOPB 4IFDJ 3OPOA 2NZHA 5J1ZA 2WB1E 3FP9A 1KLUD 2OWOA 4C3IH 4C3JB 4EQOA 4QF4A 3NWSA 2HCIA 2FHTA 2OTLA 2JA7B 3J7AF 3UDXA 1F9SA 1ZYRD 3RN2A 3TS2A 4TQUS 1EZ8A 2Z0SA 5JJKA 3N52A 3O13A 4IZ8A 1GUWA 4DR5L 4YHHL 3ER0A 2K5DA 4A3GB 5KNDA 2QA4A 2P5ZX 4QIWB 5EAYA 1VQ5A 4B3SL 1SNDA 2F0EA 3MC0B 2RKSA 4K0KL 1N32Q 2L9HA 3K0XA 1CKNA 5G3LF 5K36G 1PH7A 2R7ZB 4CDFC 5IP9G 3JAMi 1TS4A 1D5MC 3M7GA 1JOOA 1LM0A 1DGSA 2EY2A 2J0TD 3HOUG 3CCVA 4DR7L 1H9RA 5H1SE 1STGA 4GOPA 1LT3D 3NPPA 2JA6B 5IYDG 1SYFA 1B70B 4DA2A 4HIDA 2NN6I 3K59A 1WD0A 4BBSH 4DR6Q 2NVYB 4G7OC 2F0OA 1XNRL 5E4WC 3QO2A 4DNIA 1D1IA 3EBEA 4K8JA 2QEJC 1FGBD 1EQQA 3OWFA 1KAAA 2E2JH 1A0IA 1CZWA 2NZOA 3CQZB 4XT1B 3S1RH 1GHJA 2B8FA 2K04A 4Z9CB 1XX8A 1CKNB 3I4OA 2CW0C 5IODA 2R7ZH 3RLOA 3OMCA 3CPFA 3KBXA 4BBSG 2MQHA 2H5XA 2PZTA 3I4MB 2OF1A 3D3RA 1LTID 4KJOA 2Y0SG 2VY3A 2E8GA 1BNZA 3LX0A 3HOVH 2R93G 3H6MA 4H13C 5I2YA 1BDOA 1M1KC 4LF5L 3L7ZC 3P1HA 1Y1WB 2VUMG 3J81L 3W3AA 2K14A 4IN3A 1ENFA 1C48A 3ULPA 3JC66 1SE4A 4EGVA 1EY7A 3PSIA 1PFBA 2BA1A 2F03A 1HZBA 1V1QA 1XMOQ 4BY7B 4LF6L 4ZKCB 4PMBA 2R7ZG 1IW7D 4GLVB 2UUCQ 4KHPQ 5M3MB 4IUNA 5KRUA 2N55A 1I4HA 2DY8A 4YHHQ 4DR5Q 1H9KA 1EFID 1UAPA 3GTKH 1NBWA 4TSSA 4Q5VA 2PCFB 5NUCA 2E76C 4RGNA 2J4XA 1EOVA 2F0TA 1PH6A 1MHWC 2E2IH 2R93B 2BOSA 2Z4IA 1IKMA 2CH4W 4DV7Q 4QGUA 1QVGA 1XMQQ 2NVTB 1Q8KA 1R9TH 1XPRA 4LFBQ 5CORA 2RF4A 4BY1H 4F7XA 3AYHB 3M4OH 3S17B 2VB2X 3KF6B 3VA7A 4NMZA 5AJ3L 1E22A 1TT2A 4A3JG 4QQBX 1NE3A 4HSPA 4DV6Q 2GVAA 4DAYB 4KY6A 3M4YA 3AFPA 3CPWA 5IIFA 4DK6C 4A3MG 2OT2A 1PFNA 4TKOB 5EKKA 3KJPA 1XTCD 1TS5A 3L9AX 3RUZA 1SNOA 3A0JA 3QG1A 1O7ZA 3TP7A 4N8FA 4IUTA 4H44C 4DAMA 5CV9A 3BVZA 5C4JB 1BBXC 4ABNA 4FDBA 4C3IB 2NTTA 3RMHA 1JOQA 1STAA 1STYA 4RKLA 2B29A 2R93H 3PUZA 2QDBA 1F2YA 2ICIA 1FJGQ 2A68C 2HHHL 1PLFA 1ENAA 2ZT9C 1EU4A 2R61A 1DOLA 4A3BB 3W1BA 2C5CA 2EYOA 2EJGC 1ILQA 1S5ED 3A55A 4LF9L 2PNHA 1I94L 1XWEA 2A5HA 1QCBD 1HA5A 1JWMD 2JEBI 4CKEA 3PO3G 2ES2A 1RDPD 4R4CA 4QL5A 1U4MA 2A68D 2WP8J 1S4ZA 5M3FH 1FGUA 1HA6A 4JI1Q 2MO1A 3WOEA 3R93A 1K83H 2CFMA 3A8JE 1NUCA 2ZJPA 3CHBD 3X3NA 4U673 4F87A 4IOCA 1HUMA 1G51A 2M2LA 3PUVA 3GTLH 4LFBL 5EBCA 3K7AH 1K83B 3SE0A 1IW7C 2D9UA 4JI8Q 2A69D 1JE4A 1DZ1A 2E5LL 2F3VA 4GOPC 1WD1A 3CXCA 1BCPD 1ZKOA 4R4OA 5L37A 4DGZA 1F9RA 4RHSA 1TWHH 5C0XI 1RJTA 1E24A 1U4PA 3DWAA 4DK0A 4P72A 3BZKA 1CHPD 5IYCG 1DJRD 4BY1G 3SK6A 4DV5Q 1N36L 4RGTA 3JAML 2JA8B 2DNEA 3D6WA 3M85A 3L3OC 2DUDA 1VQJA 4L5TA 1RD9D 2HCCA 1D5ZC 4DF7A 3AU7A 4UPAA 3K5LA 2QEXA 4R9WA 1CZGA 2D62A 3ICEA 3NTKA 4B3RQ 1FR3A 2EY6A 2RVLA 2ENBA 3FKIB 5IWAL 3CCEA 4V0BA 2F0IA 4J15A 1CA5A 1YJWA 1XNQQ 1W3SA 3RZDH 1HUNA 5EKIA 1HXYD 3A8KE 1OXUA 4FYDA 5M3MG 4DNTB 1V1PB 1BOSA 5J3BA 3PO2H 4LUOA 3ND9A 1XMQL 5C4XH 4IUQA 4HJ9A 4HMIA 4ZQ3A 1QUQA 3ERQA 1CSQA 4KTAA 4FXGC 1HRJA 4MTNA 4HR7B 2B2UA 2KCNA 3BYTB 3ULLA 3CCQA 1RKNA 2MJ8A 1I4PA 4I7ZC 4OONA 1CSPA 3WWVA 4K8IA 4DR2Q 3E0EA 5FJ8G 3OOCA 2B39A 4IFDH 1ENCA 3KBGA 4POFA 1PRTD 4JBJA 4C2MH 4OO1G 3VR3A 1PTOH 4PV1C 5EJWA 2UXCQ 2HQEA 1STBA 2XVSA 2YTVA 4PZ8A 1V1OA 1SSOA 1QWYA 2A6EC 1TWCH 3EJIA 2VQFL 2CW0D 4ULLA 2ZJQA 1Y1VB 1Y14B 4GLAC 3S2HH 3BS1A 1MSGA 3X3MA 3OSOA 2E2HB 3FEWX 3BDLA 1SNPA 1M90C 3MHBA 4A3IH 5FLMH 4NKLA 4K14A 4L8JA 1JB3A 3S1NH 2F0PA 2F4IA 5CBAE 3RLFA 1NR4A 4A3JH 1YITA 2MO0A 3T4AC 1EL0A 3C2PA 3KF6A 5FK9C 1PRTB 2JA5G 4OO1I 4KY7A 1WTPA 1AP0A 3I91A 3QOJA 1UEBA 2KCTA 2EYLA 1XNQL 5LMNW 2BA0A 2NVTH 4Y52H 2K6AA 1X3PA 2Z1CA 3ITPA 4P75A 1X65A 3H3VH 4POGA 3R2TA 3EIVA 2M9VA 1L0WA 3HFZB 4X65L 2XWBB 4L63B 4Y7NH 1EOTA 5HGQA 3UDIA 3S24A 3J80c 1R4QB 3K8AA 4CDEC 1N36Q 1PZKD 4TRDA 3PO2G 3S1QB 4WJ4A 2RSNA 1S5DD 3VDYA 1EYAA 2JA9A 5C4XG 4LF9Q 1EYCA 4GN5A 1XJVA 3MFYA 1STHA 1V8QA 1SE8A 3CMAA 3NXWA 5C3EH 2K5HA 5ELDA 4KHZA 2K05A 5FLXc 3JAME 5I9PA 1U4LA 1SDFA 4ID6A 2QF7A 5DLQE 1UNSA 5KEEA 3HRZC 4X62Q 1K28A 3GTOH 2JA5B 5IT9L 4DR3Q 5IE8A 2JA7G 2O2LD 4GNXC 1VF7A 3NELA 1YNJD 4DUYL 1B3AA 4NP5A 2HDLA 4KD4A 4GNXA 2DN8A 1AEXA 1CQFA 4LJZC 3G71A 3GTPH 2F0MA 1HHVA 4B3TL 1JR0D 4FF2A 1EQTA 4A3LH 3Q23A 1M4VA 3FKIG 3D4DA 1PV4A 5DNFA 3GTPB 3MFGA 4DV6L 1CA6A 2MP1A 1HH2P 5IGBA 4A3DG 3TZUA 2D0PA 1YHAA 5C44H 1VQKA
chains in the Genus database with same CATH topology
1IBLQ 2I0QA 1YBYA 1CKNA 2ZJRA 5IP7G 2HHHQ 2Q2HA 5K36G 1RIPA 4JI0L 1PH7A 4PMWA 3GDEA 1VQAA 5IP9G 3OTOL 3JAMi 2IY5B 2UXDQ 3RR5A 4LF7Q 1VQ8A 1HZ9A 1LM0A 1DGSA 2PQAB 1EFWA 4GLXA 2BH2A 4YY3Q 3RZOH 3HOUG 3CCVA 1VQDA 4DUZL 2JA5H 1N9WA 1WI5A 2FXQA 1IBMQ 4DR7L 2VNUD 1X54A 2R92H 5H1SE 4DV0L 4GOPA 1W2BA 4BY7G 5IY0A 2JE6I 4DR6L 2PMZE 2Q2TA 3KLWA 4NXNQ 5IYDG 1YJ9A 1OTCA 1E3PA 4JI2L 4APVA 1MJEA 2C35B 5IYDH 3HOXH 1B70B 4X66L 3KF8B 2R6GA 2NN6I 4DK3C 4HIDA 4BBSH 3BU2A 2UUAL 3S2DH 4DR6Q 3ULJA 3NENA 1KQSA 4HIOA 1XNRL 1SROA 1IBML 1OXVA 4BY7H 5GAGC 1CUKA 2JQOA 1VQLA 4DNIA 4JBWA 4B3MQ 1IBKQ 2YYZA 4UY8C 4A3KG 3A74A 4JI8L 1N33L 1WYDA 3EBEA 3K80C 4R4TA 1Q82C 3L2PA 3EN2A 1XMOL 1EQQA 3FHWA 4X64L 2E2JH 1K8GA 1A0IA 3AFQA 1G6PA 1A63A 2UUBQ 4IPGA 1QZGA 4B3RL 2NZOA 5JJLA 3RLNA 1I6HH 1BBUA 3S1RH 3KYHC 3CC7A 4KLKA 2VW9A 1K8AC 3TRZA 4A3KH 1E1TA 3AQQA 3W1GA 4A76A 4C3HH 4DV5L 1Y1WG 1CKNB 1YEZA 3G48A 3I4OA 1N34Q 2KBNA 4JI3L 3RLOA 5ELNA 3CPFA 4HJ7A 2R7ZH 3F2BA 1IXRA 4BBRG 1GO3E 1A62A 4BBSG 2MQHA 2H5XA 4GKJL 3D0FA 1IYJB 4JBKA 3M4PA 5FJ8H 3GTJH 2CCZA 4ALPA 1VQ9A 3A5ZB 2N78A 4B3TQ 1CKOA 2Y0SG 1HJPA 2VY3A 2E8GA 3GO5A 2NVQH 3S1MH 1HNWQ 4MNOA 3HOVH 4A93H 3CCSA 2R93G 1K73C 1M1KC 4LWCA 4LF5L 1K3RA 3G6EA 5IYCH 3L7ZC 1X3GA 4P71A 2EXDA 1M90C 4BXXG 1HNXQ 4IJHA 1PH5A 4JV5L 1E7ZA 2VUMG 2K14A 2N3SA 1UE6A 3F8TA 2A1AA 5IYBH 3OTOQ 2D0OA 3ULPA 1TWFH 2CKZB 3JC66 4JI0Q 2HT1A 3U58A 4DV1Q 5IP9H 3PSIA 2BA1A 1HZBA 1V1QA 1XMOQ 1K9MC 2EQSA 2WB1G 4BA1I 3PIOA 4LF6L 1AE2A 4WJ3M 4YCVA 3T1HQ 1Q86C 5C44G 2R7ZG 1D8LA 4GLVB 2UUCQ 3B6YA 1QZHA 4KHPQ 4LF5Q 4DV7L 3OW2A 2UU9L 2Y0SE 2ID0A 4YWLA 4YHHQ 3FKIH 4XIGS 2AHOB 2Q2IA 4DR5Q 4JG2A 4IOAA 1J6QA 3UDGA 1NBWA 1EYGA 1P16A 3GTKH 2GN5A 2BH8A 2MNAA 1Y1VH 1HR0W 3NBHB 4DV2Q 4IJLA 2WFWA 1XPOA 1X3EA 2Z6KA 1C7YA 4BA2I 3I7FA 4OWWB 2MFIA 1JJCB 1EOVA 3UE0A 5C0XG 1PH6A 2E2HH 2E2IH 1QUQB 4P74A 3F2DA 1SRUA 4LF7L 4A3CH 4DUYQ 1KRTA 4DV7Q 5M5XH 3SGIA 4QGUA 5IT9c 1QVGA 3GTGH 1O7IA 5AJ3Q 1XMQQ 1Q8KA 1U5KA 1YIJA 4DV4Q 2LXKA 4QJFA 1R9TH 1XPRA 2RF4A 4BY1H 3HOXG 4A3BH 1HR0Q 1MJCA 5IYBG 2JA7H 3AYHB 2JJQA 3M4OH 2Z6KC 3KDFB 1E1OA 2NVXH 4X62L 1WJJA 3KF6B 1BKBA 1Y1WH 2A8VA 5AJ3L 1L1OA 1E22A 3T1YL 4A3JG 4QQBX 1Q7YC 3KDFA 1NE3A 4DV6Q 3STBC 4LFCQ 2GVAA 4DAYB 2ZM6L 1HZCA 4JI4Q 4L5RC 3AFPA 3CPWA 4HJ8A 4DKAC 4DK6C 3J7ZC 4A3MG 2CWPA 3J81j 2OQKA 4JI5Q 4LFAQ 4OWTB 1PH4A 1BVSA 1GKHA 5LMNL 1HNZL 4JI7L 2OCEA 2A19A 2OQ0A 3KJPA 2VQEQ 1JE5A 4LFAL 4DUZQ 3A0JA 3CCMA 2K52A 4LUVA 2JK8A 3M3YH 3PIPA 1VQNA 2UXBL 2AWOA 1GM5A 4LFCL 4GN3B 1GVPA 1S3OA 1MKHA 3U4ZA 4DAMA 3PO3H 3NEMA 4YWKA 1VS0A 2IT1A 4DR7Q 2I5MX 3T1HL 4FDBA 3HOWH 2I5LX 3TQYA 4HIKA 4L5QA 2JA8G 4C3JH 1SFOH 1IBLL 2NN6G 1VQ6A 1V43A 2B29A 5LMUL 4EQ5A 3CCLA 2HIVA 3PUZA 4A93G 1UWVA 2R93H 5IWAQ 4GNXB 1NMFA 1N8RC 1FJGQ 3CCUA 2HIXA 2HHHL 5GAEC 1C0AA 1L1OC 4LF8Q 3HOZH 1YI2A 4IFDG 1JJ2A 3Q8DA 3W1BA 4JI6Q 2JA8H 3S17H 2K50A 4LF9L 2PNHA 4JI1L 1VQBA 2RHSB 1I94L 3I4MG 4DV2L 4AH6A 3HOUH 1EQRA 2R92G 1L1OB 2JEBI 3BJUA 1KC8C 4JI7Q 3PO3G 1FL0A 2ES2A 3GD7A 4JI5L 1KRSA 4R4CA 4HJAA 1Q81C 4QL5A 4NXNL 1X9NA 1FVIA 2F52A 4OX9L 4LFBQ 2WP8J 3H15A 1FGUA 5M3FH 1Q1BA 3CP0A 2R7DA 1S40A 1L2FA 2B63H 4JI3Q 4JI1Q 2MO1A 2UUCL 1X56A 4XTCS 5JEAJ 3GTMH 1KL9A 3RN5A 4R4QA 1KXLA 4A3FG 4JI6L 2YU9H 3PF5A 1K83H 2CFMA 2ZJPA 1JJGA 1U0LA 3KOJA 2CQOA 3CC4A 4IOCA 1S72A 1PYBA 1Z9FA 1G51A 3PUVA 5JEAG 3GTLH 2UXCL 1Q46A 4LFBL 4NXMQ 4X64Q 3K7AH 1TXYA 1WCMH 4IFDJ 3MEFA 3M9BA 3TEHB 3I4MH 3CMEA 3DM3A 2V1CC 4JI8Q 1UE5A 1IBKL 4IPHA 3I2ZA 4A3MH 1PH2A 2E5LL 1N33Q 4ME3A 5ELOA 4GOPC 3CXCA 3HOZG 4R4OA 4A3BG 3J7A5 1VQMA 1AH9A 1VQFA 2IX1A 1G291 2NVYH 1VQPA 1RL2A 4PZ7A 4A75A 2UXBQ 3CF5A 1EIFA 2KCMA 1EIYB 1TWHH 4DV3Q 5C0XI 1E24A 4JI2Q 4P72A 3BZKA 2VQEL 1B7YB 4X6AH 4JBMA 5IYCG 1NY4A 1LUZA 1TWAH 4PG3A 4BY1G 4DV5Q 4IO9A 1N36L 2JA6G 3S15H 1VQCA 3D31A 2RHQB 3TREA 3MXNB 1ASZA 1H95A 3CCRA 4QY7A 3ZJYC 3M85A 5HY6A 2E5LQ 2DUDA 1VQJA 4L5TA 1PYSB 2LSSA 1OXSC 2F4VL 1KHIA 3CQZH 4UPAA 1WCMG 4UP9A 2QEXA 3ICEA 1SR3A 2D62A 4KI0A 2UUBL 4GKKQ 4B3RQ 4DPGA 5IWAL 5C3EG 1UE7A 1B8AA 3CCEA 3BZCA 4J15A 1VQIA 2EIFA 1YJWA 2PI2A 1JT8A 1XNQQ 1W3SA 1YHQA 2YV5A 4JCVE 3RZDH 1SLJA 4IPCA 1N32L 1OXUA 3AEVA 5M3MG 1OXXK 5J3BA 4DV4L 3PO2H 4R4IA 4LUOA 1VQHA 1PVOA 1XMQL 5C4XH 1XNRQ 4HJ9A 2UUAQ 4MZ9A 4X66Q 4B3SQ 1QUQA 1CSQA 1WFQA 3KJOA 4OX9Q 3PGZA 2ATWA 2B3GA 3LGJA 1ASYA 2VUMH 4JYAL 5M5WH 2ASBA 4MTNA 3I4NG 5GAHC 4HIMA 5GROA 2PQAA 5M5YH 3ULLA 1PA6A 2GVBA 3PUWA 3CCQA 2VQFQ 2Q2UA 4O0AA 4JOIC 4OONA 1CSPA 4JI4L 3HOYH 3WWVA 4DR2Q 3E0EA 1KD1C 4LF8L 4AYBG 5FJ8G 2K75A 3PF4A 1VCIA 3DLLA 4TVAB 2UXDL 5BR8L 5FLMG 2XTIA 1X3FA 4RMFA 4POFA 4DV1L 4C2MH 4JBJA 4OO1G 4L5SA 4IPDA 4NXML 2K5NA 2UXCQ 4DR3L 4DR4L 1CKMA 2YTVA 1Y1VG 4PZ8A 5BR8Q 3HKSA 2HQLA 4DR2L 4IFDI 1HR0L 4LF4Q 3S1QH 1TWCH 1BBWA 2VZAA 4BBRH 1Z47A 2VQFL 4A4IA 1I5FA 2VL6A 4OWXB 1UE1A 1X55A 5M3FG 2ZJQA 2K5VA 1TWGH 1Y14B 1YZ6A 2IX0A 2B63G 3PV0A 2KHIA 4GLAC 3U4VA 5IP7H 4A3EG 3S2HH 3PCOB 2RCNA 2YTXA 1I3QH 1PH8A 2L15A 1C9OA 2VS1A 5C0XJ 5JJIA 1D7QA 1IZ6A 2N49A 3E9IA 4UP7A 4JC0A 1K0RA 1LTLA 5E7NA 1EWIA 4AYBE 2QGQA 4OXPA 5FLMH 4A3IH 1QVFA 4A3DH 2LXJA 1SN8A 4EX5A 5LMNQ 3A5UA 4JYAQ 3S1NH 2ZTEA 2CWAA 4YY3L 2WAQE 3M7NA 2ZM6Q 1VQEA 1LYLA 3RLFA 3CAMA 4A3JH 2I5HA 1FJGL 4YWMA 3CC2A 1YITA 2MO0A 4YCUA 1WOCA 1T9HA 2IHFA 3S16H 3KF6A 2JA5G 1PFSA 1JB7A 4OO1I 2N8NA 1EUJA 3H3VI 4GKKL 4JOIA 3HOYG 1Q1EA 1UEBA 4QIWE 3JAMc 4LF6Q 2F4VQ 1VQ7A 2AKWB 2KCTA 3F1ZA 3HOWG 1XNQL 3S14H 5LMNW 2BA0A 1KAWA 1KIXA 3U50C 4B3ML 2NVTH 4Y52H 3I55A 3L0OA 4P75A 1X65A 3RNUA 3H3VH 1QVCA 4POGA 3K81C 3W5OA 4HJ5A 4A3CG 1NTGA 1HZAA 3EIVA 3CD6A 4NB3A 3HKZG 1L0WA 2OTJA 3HFZB 1HNXL 1OXTA 4X65L 4DR1L 4DV3L 4NPSA 4Y7NH 2AMCB 4AQYL 3PUXA 5HGQA 4A3EH 2WAQG 3S24A 1X6OA 3UDIA 3J80c 3K8AA 4LW1A 1N36Q 1P8LA 3K7UC 3PO2G 4RG1A 1A8VA 4WJ4A 4DV0Q 3VDYA 5M3MH 3G4SA 1PHJA 2JA9A 1HNZQ 5GADC 4LF9Q 3TS0A 3OYYA 4P73A 1IL2A 3KFUA 5C4XG 4AQYQ 4GN5A 4X65Q 1XJVA 4A3FH 1PH1A 1PH3A 3ERSX 3PUYA 1SE8A 4DR1Q 1SMXA 1XTDA 3CMAA 4A3GG 5C3EH 2K5HA 4A3LG 1N34L 2DGYA 3T1YQ 4KHZA 4YCWA 2XGTA 5FLXc 1YJNA 4UP8A 4KHPL 1MIUA 1NMGA 2IHEA 2KENA 5DLQE 3J81i 4X62Q 3GTOH 2AWNA 1YNXA 4AIMA 4LNQA 3UDFA 3HKZE 3J80i 1AE3A 1Q12A 5C4JH 3I56A 4DR3Q 5IE8A 2NZHA 4GOPB 1XPUA 2JA7G 2WB1E 4DR4Q 3FP9A 2PI2E 3H0GH 2OWOA 4C3IH 4GNXC 2JA6H 3I4NH 3NELA 4JV5Q 4DUYL 1J5EQ 2KHJA 1JMCA 3STBD 4GNXA 1YHBA 2OTLA 3CCJA 4K0KQ 4BXXH 2ALYB 1PH9A 3HOVG 3UDXA 4LUZA 4H02A 3RN2A 3CW2C 3TS2A 4TQUS 1V9PA 3G71A 3GTPH 2R7FA 1GD7A 3H0GG 1I94Q 4A3GH 2Z0SA 2K4KA 1HNWL 5JJKA 3J81c 4B3TL 2JEAI 4A3LH 1VQGA 1NJIC 4DR5L 4GKJQ 3FKIG 3F2CA 1PV4A 4YHHL 2YTYA 3ER0A 4R1JA 3E9HA 1YVCA 2QA4A 1J5EL 5EAYA 1VQ5A 3UE1A 4DV6L 1VQOA 4B3SL 2UU9Q 4GN4B 5GQOA 1VQ4A 1HH2P 2ZTCA 2ZTDA 2F3IA 4O2DA 4PZ6A 4A3IG 3GTQH 4A3DG 4K0KL 4GS3A 4LF4L 2D0PA 3IRBA 5LMUQ 1N32Q 1YHAA 5C44H 3K0XA 1VQKA 1I50H 3M4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL Q;  2I0Q A;  1YBY A;  1CKN A;  2ZJR A;  5IP7 G;  2HHH Q;  2Q2H A;  5K36 G;  1RIP A;  4JI0 L;  1PH7 A;  4PMW A;  3GDE A;  1VQA A;  5IP9 G;  3OTO L;  3JAM i;  2IY5 B;  2UXD Q;  3RR5 A;  4LF7 Q;  1VQ8 A;  1HZ9 A;  1LM0 A;  1DGS A;  2PQA B;  1EFW A;  4GLX A;  2BH2 A;  4YY3 Q;  3RZO H;  3HOU G;  3CCV A;  1VQD A;  4DUZ L;  2JA5 H;  1N9W A;  1WI5 A;  2FXQ A;  1IBM Q;  4DR7 L;  2VNU D;  1X54 A;  2R92 H;  5H1S E;  4DV0 L;  4GOP A;  1W2B A;  4BY7 G;  5IY0 A;  2JE6 I;  4DR6 L;  2PMZ E;  2Q2T A;  3KLW A;  4NXN Q;  5IYD G;  1YJ9 A;  1OTC A;  1E3P A;  4JI2 L;  4APV A;  1MJE A;  2C35 B;  5IYD H;  3HOX H;  1B70 B;  4X66 L;  3KF8 B;  2R6G A;  2NN6 I;  4DK3 C;  4HID A;  4BBS H;  3BU2 A;  2UUA L;  3S2D H;  4DR6 Q;  3ULJ A;  3NEN A;  1KQS A;  4HIO A;  1XNR L;  1SRO A;  1IBM L;  1OXV A;  4BY7 H;  5GAG C;  1CUK A;  2JQO A;  1VQL A;  4DNI A;  4JBW A;  4B3M Q;  1IBK Q;  2YYZ A;  4UY8 C;  4A3K G;  3A74 A;  4JI8 L;  1N33 L;  1WYD A;  3EBE A;  3K80 C;  4R4T A;  1Q82 C;  3L2P A;  3EN2 A;  1XMO L;  1EQQ A;  3FHW A;  4X64 L;  2E2J H;  1K8G A;  1A0I A;  3AFQ A;  1G6P A;  1A63 A;  2UUB Q;  4IPG A;  1QZG A;  4B3R L;  2NZO A;  5JJL A;  3RLN A;  1I6H H;  1BBU A;  3S1R H;  3KYH C;  3CC7 A;  4KLK A;  2VW9 A;  1K8A C;  3TRZ A;  4A3K H;  1E1T A;  3AQQ A;  3W1G A;  4A76 A;  4C3H H;  4DV5 L;  1Y1W G;  1CKN B;  1YEZ A;  3G48 A;  3I4O A;  1N34 Q;  2KBN A;  4JI3 L;  3RLO A;  5ELN A;  3CPF A;  4HJ7 A;  2R7Z H;  3F2B A;  1IXR A;  4BBR G;  1GO3 E;  1A62 A;  4BBS G;  2MQH A;  2H5X A;  4GKJ L;  3D0F A;  1IYJ B;  4JBK A;  3M4P A;  5FJ8 H;  3GTJ H;  2CCZ A;  4ALP A;  1VQ9 A;  3A5Z B;  2N78 A;  4B3T Q;  1CKO A;  2Y0S G;  1HJP A;  2VY3 A;  2E8G A;  3GO5 A;  2NVQ H;  3S1M H;  1HNW Q;  4MNO A;  3HOV H;  4A93 H;  3CCS A;  2R93 G;  1K73 C;  1M1K C;  4LWC A;  4LF5 L;  1K3R A;  3G6E A;  5IYC H;  3L7Z C;  1X3G A;  4P71 A;  2EXD A;  1M90 C;  4BXX G;  1HNX Q;  4IJH A;  1PH5 A;  4JV5 L;  1E7Z A;  2VUM G;  2K14 A;  2N3S A;  1UE6 A;  3F8T A;  2A1A A;  5IYB H;  3OTO Q;  2D0O A;  3ULP A;  1TWF H;  2CKZ B;  3JC6 6;  4JI0 Q;  2HT1 A;  3U58 A;  4DV1 Q;  5IP9 H;  3PSI A;  2BA1 A;  1HZB A;  1V1Q A;  1XMO Q;  1K9M C;  2EQS A;  2WB1 G;  4BA1 I;  3PIO A;  4LF6 L;  1AE2 A;  4WJ3 M;  4YCV A;  3T1H Q;  1Q86 C;  5C44 G;  2R7Z G;  1D8L A;  4GLV B;  2UUC Q;  3B6Y A;  1QZH A;  4KHP Q;  4LF5 Q;  4DV7 L;  3OW2 A;  2UU9 L;  2Y0S E;  2ID0 A;  4YWL A;  4YHH Q;  3FKI H;  4XIG S;  2AHO B;  2Q2I A;  4DR5 Q;  4JG2 A;  4IOA A;  1J6Q A;  3UDG A;  1NBW A;  1EYG A;  1P16 A;  3GTK H;  2GN5 A;  2BH8 A;  2MNA A;  1Y1V H;  1HR0 W;  3NBH B;  4DV2 Q;  4IJL A;  2WFW A;  1XPO A;  1X3E A;  2Z6K A;  1C7Y A;  4BA2 I;  3I7F A;  4OWW B;  2MFI A;  1JJC B;  1EOV A;  3UE0 A;  5C0X G;  1PH6 A;  2E2H H;  2E2I H;  1QUQ B;  4P74 A;  3F2D A;  1SRU A;  4LF7 L;  4A3C H;  4DUY Q;  1KRT A;  4DV7 Q;  5M5X H;  3SGI A;  4QGU A;  5IT9 c;  1QVG A;  3GTG H;  1O7I A;  5AJ3 Q;  1XMQ Q;  1Q8K A;  1U5K A;  1YIJ A;  4DV4 Q;  2LXK A;  4QJF A;  1R9T H;  1XPR A;  2RF4 A;  4BY1 H;  3HOX G;  4A3B H;  1HR0 Q;  1MJC A;  5IYB G;  2JA7 H;  3AYH B;  2JJQ A;  3M4O H;  2Z6K C;  3KDF B;  1E1O A;  2NVX H;  4X62 L;  1WJJ A;  3KF6 B;  1BKB A;  1Y1W H;  2A8V A;  5AJ3 L;  1L1O A;  1E22 A;  3T1Y L;  4A3J G;  4QQB X;  1Q7Y C;  3KDF A;  1NE3 A;  4DV6 Q;  3STB C;  4LFC Q;  2GVA A;  4DAY B;  2ZM6 L;  1HZC A;  4JI4 Q;  4L5R C;  3AFP A;  3CPW A;  4HJ8 A;  4DKA C;  4DK6 C;  3J7Z C;  4A3M G;  2CWP A;  3J81 j;  2OQK A;  4JI5 Q;  4LFA Q;  4OWT B;  1PH4 A;  1BVS A;  1GKH A;  5LMN L;  1HNZ L;  4JI7 L;  2OCE A;  2A19 A;  2OQ0 A;  3KJP A;  2VQE Q;  1JE5 A;  4LFA L;  4DUZ Q;  3A0J A;  3CCM A;  2K52 A;  4LUV A;  2JK8 A;  3M3Y H;  3PIP A;  1VQN A;  2UXB L;  2AWO A;  1GM5 A;  4LFC L;  4GN3 B;  1GVP A;  1S3O A;  1MKH A;  3U4Z A;  4DAM A;  3PO3 H;  3NEM A;  4YWK A;  1VS0 A;  2IT1 A;  4DR7 Q;  2I5M X;  3T1H L;  4FDB A;  3HOW H;  2I5L X;  3TQY A;  4HIK A;  4L5Q A;  2JA8 G;  4C3J H;  1SFO H;  1IBL L;  2NN6 G;  1VQ6 A;  1V43 A;  2B29 A;  5LMU L;  4EQ5 A;  3CCL A;  2HIV A;  3PUZ A;  4A93 G;  1UWV A;  2R93 H;  5IWA Q;  4GNX B;  1NMF A;  1N8R C;  1FJG Q;  3CCU A;  2HIX A;  2HHH L;  5GAE C;  1C0A A;  1L1O C;  4LF8 Q;  3HOZ H;  1YI2 A;  4IFD G;  1JJ2 A;  3Q8D A;  3W1B A;  4JI6 Q;  2JA8 H;  3S17 H;  2K50 A;  4LF9 L;  2PNH A;  4JI1 L;  1VQB A;  2RHS B;  1I94 L;  3I4M G;  4DV2 L;  4AH6 A;  3HOU H;  1EQR A;  2R92 G;  1L1O B;  2JEB I;  3BJU A;  1KC8 C;  4JI7 Q;  3PO3 G;  1FL0 A;  2ES2 A;  3GD7 A;  4JI5 L;  1KRS A;  4R4C A;  4HJA A;  1Q81 C;  4QL5 A;  4NXN L;  1X9N A;  1FVI A;  2F52 A;  4OX9 L;  4LFB Q;  2WP8 J;  3H15 A;  1FGU A;  5M3F H;  1Q1B A;  3CP0 A;  2R7D A;  1S40 A;  1L2F A;  2B63 H;  4JI3 Q;  4JI1 Q;  2MO1 A;  2UUC L;  1X56 A;  4XTC S;  5JEA J;  3GTM H;  1KL9 A;  3RN5 A;  4R4Q A;  1KXL A;  4A3F G;  4JI6 L;  2YU9 H;  3PF5 A;  1K83 H;  2CFM A;  2ZJP A;  1JJG A;  1U0L A;  3KOJ A;  2CQO A;  3CC4 A;  4IOC A;  1S72 A;  1PYB A;  1Z9F A;  1G51 A;  3PUV A;  5JEA G;  3GTL H;  2UXC L;  1Q46 A;  4LFB L;  4NXM Q;  4X64 Q;  3K7A H;  1TXY A;  1WCM H;  4IFD J;  3MEF A;  3M9B A;  3TEH B;  3I4M H;  3CME A;  3DM3 A;  2V1C C;  4JI8 Q;  1UE5 A;  1IBK L;  4IPH A;  3I2Z A;  4A3M H;  1PH2 A;  2E5L L;  1N33 Q;  4ME3 A;  5ELO A;  4GOP C;  3CXC A;  3HOZ G;  4R4O A;  4A3B G;  3J7A 5;  1VQM A;  1AH9 A;  1VQF A;  2IX1 A;  1G29 1;  2NVY H;  1VQP A;  1RL2 A;  4PZ7 A;  4A75 A;  2UXB Q;  3CF5 A;  1EIF A;  2KCM A;  1EIY B;  1TWH H;  4DV3 Q;  5C0X I;  1E24 A;  4JI2 Q;  4P72 A;  3BZK A;  2VQE L;  1B7Y B;  4X6A H;  4JBM A;  5IYC G;  1NY4 A;  1LUZ A;  1TWA H;  4PG3 A;  4BY1 G;  4DV5 Q;  4IO9 A;  1N36 L;  2JA6 G;  3S15 H;  1VQC A;  3D31 A;  2RHQ B;  3TRE A;  3MXN B;  1ASZ A;  1H95 A;  3CCR A;  4QY7 A;  3ZJY C;  3M85 A;  5HY6 A;  2E5L Q;  2DUD A;  1VQJ A;  4L5T A;  1PYS B;  2LSS A;  1OXS C;  2F4V L;  1KHI A;  3CQZ H;  4UPA A;  1WCM G;  4UP9 A;  2QEX A;  3ICE A;  1SR3 A;  2D62 A;  4KI0 A;  2UUB L;  4GKK Q;  4B3R Q;  4DPG A;  5IWA L;  5C3E G;  1UE7 A;  1B8A A;  3CCE A;  3BZC A;  4J15 A;  1VQI A;  2EIF A;  1YJW A;  2PI2 A;  1JT8 A;  1XNQ Q;  1W3S A;  1YHQ A;  2YV5 A;  4JCV E;  3RZD H;  1SLJ A;  4IPC A;  1N32 L;  1OXU A;  3AEV A;  5M3M G;  1OXX K;  5J3B A;  4DV4 L;  3PO2 H;  4R4I A;  4LUO A;  1VQH A;  1PVO A;  1XMQ L;  5C4X H;  1XNR Q;  4HJ9 A;  2UUA Q;  4MZ9 A;  4X66 Q;  4B3S Q;  1QUQ A;  1CSQ A;  1WFQ A;  3KJO A;  4OX9 Q;  3PGZ A;  2ATW A;  2B3G A;  3LGJ A;  1ASY A;  2VUM H;  4JYA L;  5M5W H;  2ASB A;  4MTN A;  3I4N G;  5GAH C;  4HIM A;  5GRO A;  2PQA A;  5M5Y H;  3ULL A;  1PA6 A;  2GVB A;  3PUW A;  3CCQ A;  2VQF Q;  2Q2U A;  4O0A A;  4JOI C;  4OON A;  1CSP A;  4JI4 L;  3HOY H;  3WWV A;  4DR2 Q;  3E0E A;  1KD1 C;  4LF8 L;  4AYB G;  5FJ8 G;  2K75 A;  3PF4 A;  1VCI A;  3DLL A;  4TVA B;  2UXD L;  5BR8 L;  5FLM G;  2XTI A;  1X3F A;  4RMF A;  4POF A;  4DV1 L;  4C2M H;  4JBJ A;  4OO1 G;  4L5S A;  4IPD A;  4NXM L;  2K5N A;  2UXC Q;  4DR3 L;  4DR4 L;  1CKM A;  2YTV A;  1Y1V G;  4PZ8 A;  5BR8 Q;  3HKS A;  2HQL A;  4DR2 L;  4IFD I;  1HR0 L;  4LF4 Q;  3S1Q H;  1TWC H;  1BBW A;  2VZA A;  4BBR H;  1Z47 A;  2VQF L;  4A4I A;  1I5F A;  2VL6 A;  4OWX B;  1UE1 A;  1X55 A;  5M3F G;  2ZJQ A;  2K5V A;  1TWG H;  1Y14 B;  1YZ6 A;  2IX0 A;  2B63 G;  3PV0 A;  2KHI A;  4GLA C;  3U4V A;  5IP7 H;  4A3E G;  3S2H H;  3PCO B;  2RCN A;  2YTX A;  1I3Q H;  1PH8 A;  2L15 A;  1C9O A;  2VS1 A;  5C0X J;  5JJI A;  1D7Q A;  1IZ6 A;  2N49 A;  3E9I A;  4UP7 A;  4JC0 A;  1K0R A;  1LTL A;  5E7N A;  1EWI A;  4AYB E;  2QGQ A;  4OXP A;  5FLM H;  4A3I H;  1QVF A;  4A3D H;  2LXJ A;  1SN8 A;  4EX5 A;  5LMN Q;  3A5U A;  4JYA Q;  3S1N H;  2ZTE A;  2CWA A;  4YY3 L;  2WAQ E;  3M7N A;  2ZM6 Q;  1VQE A;  1LYL A;  3RLF A;  3CAM A;  4A3J H;  2I5H A;  1FJG L;  4YWM A;  3CC2 A;  1YIT A;  2MO0 A;  4YCU A;  1WOC A;  1T9H A;  2IHF A;  3S16 H;  3KF6 A;  2JA5 G;  1PFS A;  1JB7 A;  4OO1 I;  2N8N A;  1EUJ A;  3H3V I;  4GKK L;  4JOI A;  3HOY G;  1Q1E A;  1UEB A;  4QIW E;  3JAM c;  4LF6 Q;  2F4V Q;  1VQ7 A;  2AKW B;  2KCT A;  3F1Z A;  3HOW G;  1XNQ L;  3S14 H;  5LMN W;  2BA0 A;  1KAW A;  1KIX A;  3U50 C;  4B3M L;  2NVT H;  4Y52 H;  3I55 A;  3L0O A;  4P75 A;  1X65 A;  3RNU A;  3H3V H;  1QVC A;  4POG A;  3K81 C;  3W5O A;  4HJ5 A;  4A3C G;  1NTG A;  1HZA A;  3EIV A;  3CD6 A;  4NB3 A;  3HKZ G;  1L0W A;  2OTJ A;  3HFZ B;  1HNX L;  1OXT A;  4X65 L;  4DR1 L;  4DV3 L;  4NPS A;  4Y7N H;  2AMC B;  4AQY L;  3PUX A;  5HGQ A;  4A3E H;  2WAQ G;  3S24 A;  1X6O A;  3UDI A;  3J80 c;  3K8A A;  4LW1 A;  1N36 Q;  1P8L A;  3K7U C;  3PO2 G;  4RG1 A;  1A8V A;  4WJ4 A;  4DV0 Q;  3VDY A;  5M3M H;  3G4S A;  1PHJ A;  2JA9 A;  1HNZ Q;  5GAD C;  4LF9 Q;  3TS0 A;  3OYY A;  4P73 A;  1IL2 A;  3KFU A;  5C4X G;  4AQY Q;  4GN5 A;  4X65 Q;  1XJV A;  4A3F H;  1PH1 A;  1PH3 A;  3ERS X;  3PUY A;  1SE8 A;  4DR1 Q;  1SMX A;  1XTD A;  3CMA A;  4A3G G;  5C3E H;  2K5H A;  4A3L G;  1N34 L;  2DGY A;  3T1Y Q;  4KHZ A;  4YCW A;  2XGT A;  5FLX c;  1YJN A;  4UP8 A;  4KHP L;  1MIU A;  1NMG A;  2IHE A;  2KEN A;  5DLQ E;  3J81 i;  4X62 Q;  3GTO H;  2AWN A;  1YNX A;  4AIM A;  4LNQ A;  3UDF A;  3HKZ E;  3J80 i;  1AE3 A;  1Q12 A;  5C4J H;  3I56 A;  4DR3 Q;  5IE8 A;  2NZH A;  4GOP B;  1XPU A;  2JA7 G;  2WB1 E;  4DR4 Q;  3FP9 A;  2PI2 E;  3H0G H;  2OWO A;  4C3I H;  4GNX C;  2JA6 H;  3I4N H;  3NEL A;  4JV5 Q;  4DUY L;  1J5E Q;  2KHJ A;  1JMC A;  3STB D;  4GNX A;  1YHB A;  2OTL A;  3CCJ A;  4K0K Q;  4BXX H;  2ALY B;  1PH9 A;  3HOV G;  3UDX A;  4LUZ A;  4H02 A;  3RN2 A;  3CW2 C;  3TS2 A;  4TQU S;  1V9P A;  3G71 A;  3GTP H;  2R7F A;  1GD7 A;  3H0G G;  1I94 Q;  4A3G H;  2Z0S A;  2K4K A;  1HNW L;  5JJK A;  3J81 c;  4B3T L;  2JEA I;  4A3L H;  1VQG A;  1NJI C;  4DR5 L;  4GKJ Q;  3FKI G;  3F2C A;  1PV4 A;  4YHH L;  2YTY A;  3ER0 A;  4R1J A;  3E9H A;  1YVC A;  2QA4 A;  1J5E L;  5EAY A;  1VQ5 A;  3UE1 A;  4DV6 L;  1VQO A;  4B3S L;  2UU9 Q;  4GN4 B;  5GQO A;  1VQ4 A;  1HH2 P;  2ZTC A;  2ZTD A;  2F3I A;  4O2D A;  4PZ6 A;  4A3I G;  3GTQ H;  4A3D G;  4K0K L;  4GS3 A;  4LF4 L;  2D0P A;  3IRB A;  5LMU Q;  1N32 Q;  1YHA A;  5C44 H;  3K0X A;  1VQK A;  1I50 H;  3M4Q A; 
#chains in the Genus database with same CATH topology
 2I0Q A;  1CTM A;  2B2W C;  4C56 C;  1W6J A;  5CC4 A;  2Q2H A;  2HHH Q;  4HN7 A;  5E4X A;  2DY7 A;  3OTO L;  3U9S A;  1YNN D;  1TS3 A;  2A6E D;  2IY5 B;  3NQT A;  1WTX A;  1HZ9 A;  3BG3 A;  5ISR A;  2PQA B;  1EFW A;  4GLX A;  2BH2 A;  1VQD A;  4DUZ L;  1WI5 A;  5A2Q L;  3V96 A;  1X54 A;  2LKV A;  4DV0 L;  4BY7 G;  5IY0 A;  2JE6 I;  3I70 A;  4CDC C;  4NXN Q;  5IYD H;  3S15 B;  1YJ9 A;  1MJE A;  3U9O A;  4M8A A;  3KF8 B;  1D5X C;  1EEI D;  3DWQ A;  4HIO A;  1B9M A;  1QOH A;  1OXV A;  5BN5 A;  4DK1 A;  4UY8 C;  1G6Z A;  2YYZ A;  4A3K G;  2D5D A;  4R4T A;  2NN6 H;  1Q82 C;  3L2P A;  3EN2 A;  2JN4 A;  1XMO L;  1Z7T A;  4K2K A;  2KOL A;  4S3S A;  5EPJ A;  1G6P A;  3AFQ A;  1A63 A;  2UUB Q;  2BE5 D;  4B3R L;  5JJL A;  2K7V A;  2WII B;  3RLN A;  1I6H H;  2CQA A;  4QCL A;  2A69 C;  2RBM A;  1EYD A;  1BBU A;  3GTQ B;  3CC7 A;  2VW9 A;  3AQQ A;  1Y1W G;  2VUM B;  2CVR A;  1YEZ A;  5ELN A;  3F2B A;  1IXR A;  4ZUJ A;  1A62 A;  1PTO F;  3D0F A;  1F9P A;  5C5M A;  3GTJ H;  4FVM A;  3SK8 A;  1Y8P B;  2BE5 C;  2EYH A;  1CKO A;  1HJP A;  3S1M H;  3NTH A;  1HNW Q;  4MNO A;  5JVG 3;  5E3F A;  1KAB A;  3OIP A;  4A93 H;  1K73 C;  1JOK A;  1BUV T;  1TWH B;  3F8T A;  3V05 A;  2A1A A;  2D0O A;  4G7H C;  1B50 A;  2IJ0 A;  1F2L A;  2HT1 A;  3ERO A;  2O5I C;  1K9M C;  2WB1 G;  1G8Z D;  4FP5 D;  3E0J A;  1Q86 C;  5D14 A;  1D8L A;  3T51 B;  1LTG D;  1QZH A;  2B2Y C;  2V4D A;  4HMJ A;  1PFM A;  2UU9 L;  1CM9 A;  4JG2 A;  1J6Q A;  2BH8 A;  2MNA A;  4U68 A;  3NBH B;  1LT4 D;  2WFW A;  3MVV A;  1XPO A;  2K33 A;  4BA2 I;  4OWW B;  3Q24 A;  3UE0 A;  1LAC A;  1SAP A;  1KRT A;  5M5X H;  4KKU A;  4DV4 Q;  5JVH 3;  1MJC A;  2EXZ A;  5IYB G;  3KLS X;  5DAU A;  1E1O A;  2F0U A;  1E2V A;  2A6H D;  3VR4 A;  1BKB A;  4XYO A;  3D4W A;  3T1Y L;  2NVX B;  1BQQ T;  3STB C;  2ZM6 L;  1HZC A;  3J7Z C;  1DON A;  4JI5 Q;  3TP8 A;  4LFA Q;  1PH4 A;  1GKH A;  5A2Q E;  3GP7 A;  1EY0 A;  1Q3L A;  4JI7 L;  2OCE A;  2WAC A;  1K8M A;  1JE5 A;  3E5S A;  4DUZ Q;  1NSN S;  2A6H C;  3A7L A;  3HG9 A;  2JK8 A;  3M3Y H;  3PIP A;  1A3T A;  1TS2 A;  4LFC L;  1S3O A;  1WCM B;  1SFO B;  2B2V C;  1TU2 B;  3NEM A;  1Y8N B;  4JPB W;  5FO7 B;  3NK9 A;  3TBI B;  4HIK A;  2EVB A;  3J7A V;  3UI2 A;  2JA8 G;  4B08 A;  4C3J H;  2AQ1 B;  3GV3 A;  1VQ6 A;  1T5E A;  4IQZ A;  4EQ5 A;  3MXG A;  5IWA Q;  5T1G A;  1LTS D;  1D2B A;  5EPK A;  1QE6 A;  2L11 A;  5M5X B;  1C0A A;  3S16 B;  1L1O C;  4LF8 Q;  5FO8 B;  1JJ2 A;  3VR2 A;  2JA8 H;  3S17 H;  3WOF A;  4XDX A;  3S14 B;  1TKW B;  3I4M G;  1EIH A;  4DV2 L;  3MXU A;  4WRD A;  5M9O A;  3BJU A;  5COY A;  1KC8 C;  2B63 B;  1CFM A;  5JAV A;  3TME A;  5IGE A;  3H15 A;  2F3W A;  4JI3 Q;  3RD4 A;  4RA8 A;  4OIJ A;  4FF1 A;  3GTM H;  1SEB D;  1KL9 A;  3I73 A;  4A3F G;  4JI6 L;  2YU9 H;  1B2T A;  1U0L A;  1V1P A;  3IFD A;  1H9J A;  3K6O A;  2CQO A;  2KJX A;  4C3H B;  1SE3 A;  1G2S A;  1GUS A;  1Z9F A;  2WKD A;  5JEA G;  1MBY A;  1ZEQ X;  2KHS A;  3DM1 A;  4X64 Q;  3TEH B;  3R8B A;  4WOR A;  3CME A;  1BCP C;  3FPP A;  2V1C C;  1UE5 A;  3C1E A;  5C4H A;  5ELC A;  4A3M H;  3I2Z A;  1N33 Q;  1ICW A;  5EPL A;  3HOZ G;  1IL8 A;  2Z4H A;  1Q90 A;  3J7A 5;  1VQM A;  4FXK C;  3NWT A;  1G29 1;  1VQP A;  1RL2 A;  4PZ7 A;  3WDN A;  4DFA A;  3MTS A;  1QJO A;  2VQE L;  1A6X A;  1LUZ A;  1TWA H;  3E6Z X;  2SNS A;  1L0X B;  3D31 A;  3MXN B;  3CCR A;  1LTA D;  5HY6 A;  1IHZ A;  2F4V L;  1WCM G;  1QNK A;  3MZ5 A;  4UP9 A;  4KI0 A;  3SEB A;  4DPG A;  5C3E G;  1B8A A;  3S2H B;  1EY6 A;  1PDQ A;  1SNC A;  1F9Q A;  4IPC A;  1N32 L;  3PIP 3;  1WTR A;  2BDO A;  4DV4 L;  1FYC A;  1VQH A;  5D3I B;  1I4Q A;  2F0H A;  2K28 A;  2KA7 A;  4DN4 M;  1XNR Q;  4JK1 C;  4F88 A;  4KY5 A;  3D8G A;  4X66 Q;  3KJO A;  4CJ2 C;  4OX9 Q;  3PGZ A;  4FXD A;  2EOT A;  4K5W A;  1ASY A;  4JYA L;  1BR9 A;  3DHQ A;  5GAH C;  4HIM A;  2EYF A;  1CI3 M;  3PUW A;  4IUU A;  2K32 A;  5C5L A;  1SYD A;  2VQF Q;  4RCO A;  4JOI C;  4HCS A;  4JI4 L;  5CV6 A;  4CKC A;  4FF3 A;  2IW3 A;  4ZCK A;  4AYB G;  4K6D A;  1VCI A;  3HOV B;  4TVA B;  1A2T A;  3T56 B;  1F77 A;  1B53 A;  4E6I A;  4BS9 A;  1ICF B;  4NXM L;  1O7Y A;  4HAE A;  2KUM A;  1Y1V G;  4FF4 A;  2RA4 A;  1FNV A;  1LT5 D;  4DR2 L;  4IFD I;  2VL6 A;  3K5O A;  3GTK B;  4OWX B;  1WTV A;  3BDC A;  4RGO S;  1EWH A;  1TWG H;  2B63 G;  2EPB A;  2KHI A;  1I3Q H;  2RCN A;  4RGM A;  2VS1 A;  5C0X J;  1IZ6 A;  2R3Z A;  2WKC A;  4JI7 Q;  5E7N A;  1LTL A;  4AYB E;  1EWI A;  3TP6 A;  4L6T B;  1SN8 A;  3GTG B;  5E1F A;  2CWA A;  4YY3 L;  5JPM C;  1LYL A;  3AB9 A;  3VR5 A;  1FJG L;  4G4K A;  4YWM A;  3CC2 A;  3TSS A;  4YCU A;  4BWG B;  1T9H A;  4IUR A;  5EKL A;  2FMM A;  1Q1E A;  4LF6 Q;  3F2U A;  1J9O A;  3P20 A;  3S14 H;  1KAW A;  1KIX A;  1PYW D;  1EY8 A;  3K81 C;  2DJG C;  4A3C G;  4HJ5 A;  3GQB A;  1WTO A;  4NB3 A;  2RDG A;  1NR2 A;  1HNX L;  4DR1 L;  4DV3 L;  3H94 A;  4AQY L;  4UHV A;  1X6O A;  1DXM A;  1A8V A;  5M3M H;  3G4S A;  1I50 B;  2XWJ B;  3OYY A;  4P73 A;  4K2L A;  3TS0 A;  1IL2 A;  4X65 Q;  1PH1 A;  2HUG A;  1PH3 A;  4DNR B;  1SMX A;  1XTD A;  2AQ2 B;  1SYE A;  3VYT A;  1YNJ C;  2I46 A;  4A3I B;  4DXF A;  4ZYS A;  1AE3 A;  3I56 A;  4DR4 Q;  3HOW B;  2PI2 E;  4G7Z C;  3BZD B;  2F0D A;  2JA6 H;  3I4N H;  1ET9 A;  4JV5 Q;  4MHE A;  2E2D C;  4KMU C;  2MUY A;  4BY1 B;  4PQX A;  1EEF D;  4BXX H;  2ALY B;  1RTN A;  3Q6S A;  3HOV G;  4LUZ A;  1V9P A;  4A3G H;  1I94 Q;  2K4K A;  1HNW L;  3J81 c;  2JEA I;  2Z6B A;  1LLR D;  1VQG A;  3IFT A;  1NJI C;  4GKJ Q;  1GUN A;  2E2J B;  1ONL A;  4R1J A;  3E9H A;  1LV9 A;  1FNU A;  5FOB B;  4Y7N B;  1VQO A;  4CJ1 B;  1SXT A;  5GQO A;  3AMU A;  2VXW A;  3C1F A;  1DYQ A;  2ZTC A;  2VB3 X;  1Q8I A;  1SMY C;  5LMU Q;  1LTT D;  2NB0 A;  3M4Q A;  1YBY A;  3A54 A;  2ZJR A;  5KGU A;  3SR1 A;  5IP7 G;  1M8A A;  4UDU C;  4PMW A;  1NAP A;  3GDE A;  3QB3 A;  5C4Z A;  1SBB B;  3TDQ A;  3J80 E;  2XRQ D;  5C3W A;  4LF7 Q;  1QG7 A;  3RZO H;  1H95 A;  2VNU D;  1KNA A;  2FXQ A;  3NBI A;  4MIU A;  1W2B A;  2R92 H;  2RCF A;  3W2D A;  2E75 C;  1X32 A;  4LMQ D;  4JI2 L;  1E3P A;  4XT3 B;  2C35 B;  1L0Y B;  4DU9 A;  3HOX H;  4X3T A;  3NHH A;  3I4L A;  2R6G A;  4J8Q A;  2KVM A;  3S2D H;  1G2T A;  2H1E A;  1KQS A;  1BCP F;  2F0N A;  1SRO A;  1IBM L;  3T16 A;  2JQO A;  3I90 A;  1IBK Q;  1WYD A;  3K80 C;  3MWY W;  5K5P A;  1G91 A;  1CK1 A;  1H9M A;  4X64 L;  1K8G A;  4I7A A;  1AFP A;  4IPG A;  3PIO 3;  3KYH C;  2YU9 B;  4H7B A;  3W1G A;  2NZ1 D;  5IGG A;  4A76 A;  4C3H H;  4DV5 L;  3G48 A;  1N34 Q;  2KBN A;  2Q8R E;  4HJ7 A;  4BBR G;  3SVM A;  1IYJ B;  4CJ0 B;  4A3J B;  5FJ8 H;  5G3L D;  2CCZ A;  1VQ9 A;  2N78 A;  3A5Z B;  4B3T Q;  1IKL A;  4LWC A;  2NWG A;  2X69 A;  4J6H A;  1K3R A;  4P71 A;  2EXD A;  4BXX G;  1PTO B;  1HNX Q;  1DM0 B;  1LTR D;  1E7Z A;  3OMG A;  2N3S A;  1KDC A;  1PRT C;  2J7Z A;  3U58 A;  3FPU B;  4G57 A;  2EQS A;  3PIO A;  4BA1 I;  4RCN A;  1AE2 A;  4WJ3 M;  1STN A;  4O42 A;  3R3O A;  4LF5 Q;  2CHB D;  4DV7 L;  3OW2 A;  2ID0 A;  4A3F B;  4YWL A;  2Q2I A;  2I07 B;  4WJW A;  1EYG A;  1P16 A;  2GN5 A;  1Y1V H;  4NDX A;  5CV4 A;  4HCE A;  4DAV A;  4IJL A;  5C6A A;  4RFB A;  2NUC A;  2HDM A;  1LO5 D;  1D1K A;  1X3E A;  2Z6K A;  1C7Y A;  1JJC B;  5DM7 3;  5C0X G;  2E2H H;  1QUQ B;  4P74 A;  3F2D A;  2KEE A;  3CKI B;  1BF4 A;  4AYB B;  3GTG H;  4MTK A;  3S1M B;  4QUC A;  2LXK A;  4QJF A;  3HOX G;  1XYI A;  2JA7 H;  2JJQ A;  4OEL B;  1MSH A;  2Z6K C;  1H9S B;  3KDF B;  1WJJ A;  3NUC A;  1EZ6 A;  3D4R A;  3VYR A;  4HTH A;  1Y1W H;  2SNM A;  1IYU A;  2L1B A;  5D3D A;  2BDN A;  4A3E B;  2K1B A;  2RDH A;  3NSW A;  4LFC Q;  1DCZ A;  3EA6 A;  4JI4 Q;  4L5R C;  3EVQ A;  4HJ8 A;  4DKA C;  2CWP A;  3J81 j;  1HTP A;  1HNZ L;  4BBR B;  1LT6 D;  2WV6 D;  1TR5 A;  3PO3 B;  2WIN B;  4LFA L;  2O5J C;  1JC7 A;  2K52 A;  4LUV A;  4RAU C;  5IOC A;  3MAQ A;  1VQN A;  1JCK B;  2AWO A;  4GN3 B;  1TQO A;  1MKH A;  3U4Z A;  4YWK A;  1VS0 A;  2I5M X;  3HKZ B;  3T1H L;  3HOW H;  2I5L X;  2ZXP A;  3TQY A;  4L5Q A;  3RZO B;  3C3L A;  2G5D A;  3LNN A;  2C9O A;  1S5B D;  5DM6 3;  5LMU L;  5AFW A;  5I2X A;  3CCL A;  4GNX B;  1X3Q A;  1NMF A;  1N8R C;  2KEC A;  5GAE C;  2XRS D;  4MN3 A;  1YI2 A;  3Q8D A;  1GUG A;  3I4N B;  4JI1 L;  2DJF C;  4C3H G;  1VQB A;  2RHS B;  4OIK A;  5TSS A;  5EBD A;  4AH6 A;  3HOU H;  1EQR A;  1LTB D;  1MGS A;  2R92 G;  1KNE A;  5JJZ A;  3K5M A;  1FL0 A;  4CBV A;  3GD7 A;  1Q81 C;  1X9N A;  1W6K A;  1FVI A;  3VYU A;  5LHY 1;  1K3B C;  3CP0 A;  3BVM A;  4ILW A;  5C44 B;  2R7D A;  1GUO A;  1L2F A;  3TP5 A;  1JIC A;  2B63 H;  4F8M A;  2B2T C;  4XTC S;  2UUC L;  4R4Q A;  3HS0 C;  1KXL A;  2PNR C;  3OWE B;  5EQ0 A;  1JJG A;  3KOJ A;  1KDA A;  1HTL D;  3CC4 A;  1DOK A;  1PYB A;  5IGD A;  2DNC A;  1ZXT A;  4NXM Q;  5C3X A;  3K57 A;  3M9B A;  4M1U B;  3I4M H;  2F0Q A;  3DM3 A;  5M5W B;  4P2C B;  4IUV A;  1EIG A;  4IPH A;  1PH2 A;  4ME3 A;  2L5T A;  4KKT A;  4JVZ A;  1AH9 A;  3KLR A;  2IX1 A;  4RH6 A;  1PRT F;  2NVY H;  1EY9 A;  3DMU A;  4A75 A;  1ROD A;  3CF5 A;  1EIF A;  2KCM A;  4DV3 Q;  3K0Y A;  4JI2 Q;  2NTS A;  3R2I A;  2PYK A;  4JBM A;  2OEO A;  5T1I A;  3HOX B;  4QY7 A;  3ZJY C;  2E5L Q;  1JWS D;  2PZW A;  1GHK A;  2IWH A;  4KD3 A;  4C1N I;  5F2D A;  1NNX A;  2CH4 A;  1KHI A;  3CQZ H;  4ZAI A;  1SR3 A;  3MXN A;  4GKK Q;  1VQI A;  2PI2 A;  5KNB A;  3I3C A;  1O80 A;  3GTM B;  1CT1 D;  3AEV A;  4O1N A;  4IUP A;  4K5X A;  5I4D A;  3SK5 A;  1PVO A;  2EY5 A;  3RZD B;  3S1N B;  3GTL B;  4MZ9 A;  4B3S Q;  2E2I B;  1WFQ A;  3FRP B;  2O4X A;  3OHX C;  1A3V A;  5M5W H;  3I4N G;  2IX3 A;  5M5Y H;  4CKB A;  4N9T A;  4WFN 3;  2GVB A;  3URY A;  4Q0F A;  1IYV A;  4O0A A;  1RCV D;  1AZP A;  3HOY H;  5CV7 A;  1PTO D;  2JYO A;  3DLL A;  2UXD L;  5BR8 L;  2XTI A;  1X3F A;  3Q0A A;  4DV1 L;  3I72 A;  3KF8 A;  4L5S A;  4ZRZ A;  5CR3 A;  2K5N A;  2KQ3 A;  4DR3 L;  4DR4 L;  1B9N A;  1CKM A;  3HKS A;  4C2M B;  1HR0 L;  4KK7 A;  1TWF B;  4LF4 Q;  3S1Q H;  1BBW A;  2VZA A;  3IKJ A;  1Z47 A;  4A4I A;  2EY1 A;  3HZX A;  1QNU A;  3VYS A;  1UE1 A;  1X55 A;  5CV8 A;  2K5V A;  1YZ6 A;  2IX0 A;  1ZYR C;  2SOB A;  3U4V A;  5IP7 H;  4PNY A;  1TWC B;  2YTX A;  5JJI A;  1D7Q A;  1GJX A;  2N49 A;  3E9I A;  3QR8 A;  3LWU A;  5BN4 A;  4A3D H;  2QGQ A;  1RTO A;  2LXJ A;  2A74 C;  2QIL A;  3IAY A;  4EX5 A;  3GTO B;  2QKI C;  5C4X B;  2PQE A;  2ICE C;  3CAM A;  4RKB A;  5A35 A;  2B2U C;  3M4O B;  1H9S A;  1K0S A;  1PFS A;  2B2W A;  2QCP X;  3A56 A;  5BN3 A;  3KLS A;  4QIW E;  3JAM c;  2F4V Q;  2AKW B;  3BVG A;  3HOW G;  2G9D A;  3NE5 B;  3TN2 A;  4EVO A;  4B3M L;  3HOU B;  2F0K A;  3J7Y W;  2KED A;  5KYI A;  3RNU A;  1QVC A;  4C1N K;  3W5O A;  1HZA A;  3CD6 A;  2OTJ A;  3D6C A;  2NBF A;  1I6V C;  4N9P A;  2AMC B;  3PUX A;  3HEJ A;  1XXG A;  4ODG A;  1P8L A;  4R8N A;  4RG1 A;  2E74 C;  4DV0 Q;  5GAD C;  3KFU A;  2TMP A;  4A3F H;  2FMC A;  3ERS X;  4A3G G;  2ZXR A;  4A3L G;  3H91 A;  2DGY A;  3T1Y Q;  4PMC A;  3DXJ C;  4KHP L;  1MIU A;  1B1Z A;  1TY2 A;  3DEP A;  4LK1 C;  1HCZ A;  1RF2 D;  5C3E B;  3CRK C;  2AWN A;  1YNX A;  2EYM A;  4AIM A;  1EWC A;  5C4J H;  1Q12 A;  5JOB A;  3SDZ A;  1XPU A;  1VF5 C;  3NTI A;  3DEO A;  3H0G H;  1BCP B;  4C3I G;  3K5N A;  1J5E Q;  2KHJ A;  1JMC A;  3STB D;  2EDG A;  1VDZ A;  1A2U A;  1YHB A;  3NQI A;  2TSS A;  5D65 A;  5ELF A;  3CCJ A;  4K0K Q;  1PH9 A;  3QWN A;  4H02 A;  3CW2 C;  2FFK B;  1GD7 A;  2R7F A;  3H0G G;  3I8Z A;  2L55 A;  2Z8L A;  1UEA B;  5KNC A;  1DD2 A;  4OGQ C;  3F2C A;  1I4G A;  2YTY A;  1J5E L;  1YVC A;  3UE1 A;  3GV6 A;  2UU9 Q;  4GN4 B;  1VQ4 A;  2ZTD A;  2F3I A;  4O2D A;  4PZ6 A;  2JSO A;  4A3I G;  3GTQ H;  4GS3 A;  4LF4 L;  2QW7 A;  3IRB A;  1I50 H;  1K8O A;  1IBL Q;  3V2T A;  3M3Y B;  4EQN A;  1JOR A;  1RIP A;  4JI0 L;  3CU7 A;  3QJY A;  1HQR D;  1O78 A;  2EYP A;  1AN8 A;  4A3M B;  1ILP A;  1VQA A;  3PQI A;  1C8C A;  2UXD Q;  3RR5 A;  1VQ8 A;  5FKA C;  5M5Y B;  1T5X D;  4YY3 Q;  2JA5 H;  1N9W A;  1IBM Q;  1FD7 D;  2RDF A;  3N6R A;  1I4R A;  5J39 A;  4DR6 L;  1II3 A;  1KLG D;  2Q8I B;  2PMZ E;  2Q2T A;  3KLW A;  1OTC A;  4APV A;  1Z6H A;  4X66 L;  4DK3 C;  3HGB A;  3BU2 A;  2UUA L;  3ULJ A;  3NEN A;  1QB5 D;  1RHP A;  5LL6 S;  3KUP A;  3J80 L;  4BY7 H;  5GAG C;  1CUK A;  4XXE A;  1VQL A;  4B3M Q;  4JBW A;  1TVX A;  3A74 A;  4JI8 L;  1N33 L;  1B4O A;  1SJE D;  3A8I E;  3FHW A;  5KIX A;  4RHR A;  1QZG A;  1I3Q B;  1R4P B;  1SE2 A;  3Q22 A;  4KLK A;  1K8A C;  1O7L A;  2B2Y A;  3TRZ A;  4A3K H;  1E1T A;  2LMC B;  2X6L A;  3S1R B;  4JI3 L;  4OEM B;  1GO3 E;  4GKJ L;  3PO2 B;  1DOM A;  3M4P A;  4JBK A;  3ONA B;  2BCO A;  5HUR A;  4ALP A;  2NVQ H;  2K01 A;  3GO5 A;  5I9O A;  3CCS A;  3DUZ A;  2R92 B;  4C3J G;  1ML0 D;  5IYC H;  5ELE A;  1X3G A;  3G6E A;  4IJH A;  1BO0 A;  1PH5 A;  4JV5 L;  2EZV A;  4B9X A;  1UE6 A;  3MXP A;  1SMY D;  3NP8 A;  5IYB H;  3OTO Q;  1SYG A;  4QMG A;  1TWF H;  2CKZ B;  4JI0 Q;  4DV1 Q;  5IP9 H;  2AUK A;  2PW5 A;  2N88 A;  2LS0 1;  2H4O A;  4YCV A;  3T1H Q;  5I6Y A;  1E0B A;  5C44 G;  1PZI D;  3B6Y A;  2Q8T A;  2IL8 A;  2XNA C;  2XIW A;  2Y0S E;  2B2V A;  3FKI H;  4XIG S;  1EY5 A;  2AHO B;  4IOA A;  3UDG A;  1PTO C;  2WAQ B;  3H3V C;  1PMR A;  1S5F D;  4QUF A;  3S9W A;  3C46 A;  1HR0 W;  4DV2 Q;  4JW0 A;  4A3K B;  1HPC A;  4ME5 A;  4KN4 C;  3I7F A;  1Y8O B;  2MFI A;  4K6L A;  1SRU A;  5CYU A;  4LF7 L;  4A3C H;  4DUY Q;  1D6E C;  3SGI A;  5IT9 c;  1O7I A;  5AJ3 Q;  2MGS A;  2NVQ B;  4I65 A;  1YIJ A;  1U5K A;  1GOZ A;  1WTH A;  1KDB A;  4A3B H;  5EGT A;  1HR0 Q;  4GZY C;  2L4N A;  5J22 A;  2NVX H;  4X62 L;  2PPB C;  1ESR A;  2A8V A;  1L1O A;  1UUP A;  4ZLT F;  1Q7Y C;  3BYY B;  2PW7 A;  3KDF A;  4EQP A;  5CMD A;  1WVL A;  1CHQ D;  5FLX E;  2OQK A;  4OWT B;  1BVS A;  5LMN L;  2NYZ D;  3ND8 A;  4RWS C;  1SYC A;  2A19 A;  2OQ0 A;  4CDD C;  2VQE Q;  1TY0 A;  4XYQ A;  3FDT A;  2K03 A;  2RSO A;  3CCM A;  1TWG B;  3QOL A;  2UXB L;  2F0G A;  4X3U A;  1GM5 A;  1GVP A;  4DAP A;  3PO3 H;  2WB1 B;  3SK4 A;  5CBE E;  4DR7 Q;  2IT1 A;  4UAI A;  1GUT A;  1C4Q A;  2KCC A;  1HFN A;  1IBL L;  1SFO H;  2NN6 G;  2G9H D;  1NCV A;  1KTK A;  1V43 A;  4A93 G;  2HIV A;  1UWV A;  4HED A;  5LL6 X;  1GXD C;  3CCU A;  2HIX A;  4OO1 H;  4XQN A;  2L0C A;  4X3S A;  1R9T B;  5FO9 B;  3HOZ H;  3H09 A;  4IFD G;  4JI6 Q;  3HP3 A;  1WTW A;  2B2T A;  2K50 A;  2D2C C;  1E2Z A;  3MEH A;  3FVQ A;  1MD2 D;  1L1O B;  4V19 0;  2MHV A;  5C0X H;  4IAL A;  4JI5 L;  1KRS A;  2FJ2 A;  4HJA A;  3IL8 A;  4NXN L;  2F52 A;  3PMF A;  4OX9 L;  4DAY A;  5IGC A;  1TII D;  1Q1B A;  1S40 A;  3TZD A;  1EQV A;  1X56 A;  5JEA J;  3RN5 A;  2RQX A;  3PF5 A;  1SNM A;  4NW2 A;  5DEH A;  4OHJ A;  2PO4 A;  3T53 B;  3VR6 A;  3J81 E;  1S72 A;  1SJH D;  3EFX D;  2UXC L;  1Q46 A;  2XSC A;  1I4X A;  1HFG A;  1TXY A;  1WCM H;  3MEF A;  5ELB A;  1IBK L;  1F2M A;  3K7A B;  1B44 D;  5ELO A;  3K58 A;  4A3B G;  2F0J A;  1STE A;  1VQF A;  3QIA A;  4BBS B;  2IPK D;  3HOY B;  5CV5 A;  1TWA B;  1BXT A;  5I6W A;  2UXB Q;  4XQJ A;  4ZKB B;  1EIY B;  1J8I A;  1JQY D;  1A15 A;  1ET6 A;  3HOZ B;  1B7Y B;  3DWP A;  2EE1 A;  4X6A H;  1NY4 A;  2LFN A;  4PG3 A;  4R8I A;  4IO9 A;  2HD3 A;  2JA6 G;  3S15 H;  1VQC A;  2RHQ B;  3TRE A;  1ASZ A;  3SHL A;  2SDF A;  4DXG A;  5K36 H;  1ESF A;  3S2D B;  1PYS B;  2LSS A;  1OXS C;  3KK7 A;  1SYB A;  1U4R A;  2UUB L;  3E3X A;  4B9W A;  2F0W A;  2JP1 A;  1UE7 A;  3BZC A;  2EIF A;  2OXP A;  2JXM B;  4N8X 1;  2ZXO A;  1JT8 A;  1YHQ A;  2FIN B;  2YV5 A;  4JCV E;  1SLJ A;  4OL7 A;  1HQM C;  3NBH A;  4ZK9 B;  4KHV A;  1OXX K;  2L12 A;  4KV6 A;  4R4I A;  3GTJ B;  2X6G A;  2UUA Q;  2M00 A;  2MPM A;  3OIQ A;  1F2Z A;  2AQ3 B;  3G7L A;  2F0S A;  2EJF C;  2B3G A;  3LGJ A;  3FMC A;  2ATW A;  2VUM H;  2ASB A;  5FLX L;  5GRO A;  4CHT B;  2PQA A;  4KKS A;  1PA6 A;  1E2W A;  1QIL A;  2QDL A;  2Q2U A;  4KN7 C;  4LF8 L;  1KD1 C;  3PF4 A;  2K75 A;  4A93 B;  5FLM G;  4QB4 A;  4FNF A;  2F0L A;  2GA4 B;  4RMF A;  3BDO A;  4IPD A;  2EJM A;  4FO2 A;  4XQQ A;  5BR8 Q;  3SXH A;  2HQL A;  1AW7 A;  4KJN A;  1VMC A;  1WTQ A;  2PMZ B;  1U9R A;  1LAB A;  4BBR H;  3MA2 B;  1I5F A;  2F0V A;  5M3F G;  3CRL C;  5JPN C;  2A73 B;  3PV0 A;  1S5C D;  4K5V A;  4A3E G;  5IGF A;  4J1M A;  3PCO B;  1I6H B;  1PH8 A;  2L15 A;  1C9O A;  3A7A B;  4HSV A;  4UP7 A;  4JC0 A;  1K0R A;  1SNQ A;  4OXP A;  5CGK A;  1QVF A;  5LMN Q;  3A5U A;  4JYA Q;  2ZTE A;  3M7N A;  2WAQ E;  2XN9 C;  2ZM6 Q;  1VQE A;  4H0L C;  4X3K A;  2I5H A;  1PXU A;  3LWE A;  1MI2 A;  1WOC A;  2IHF A;  3S16 H;  1JB7 A;  2N8N A;  1EUJ A;  2EYJ A;  3H3V I;  4GKK L;  2Z9H A;  4JOI A;  3HOY G;  1VQ7 A;  3F1Z A;  1AZQ A;  1CQV A;  1YNN C;  3U50 C;  3I55 A;  1JWU D;  2AUJ D;  1EY4 A;  3L0O A;  1OO9 B;  1B3Q A;  4CGY B;  1NTG A;  2K5W A;  3OW7 A;  3HKZ G;  3VA5 A;  3ZYY X;  1OXT A;  2K5Q A;  5M3F B;  4NPS A;  5IT9 E;  1PZJ D;  4A3E H;  2WAQ G;  4LW1 A;  5JEA H;  1FNW A;  3K7U C;  1EU3 A;  1HNZ Q;  4YIJ A;  1PHJ A;  3T13 A;  2F0F A;  5KYL A;  4AQY Q;  4LAA A;  3EQL C;  2LY7 A;  2PZU A;  3PUY A;  4DR1 Q;  3P7J A;  2F1M A;  5HGT A;  3G6J B;  1N34 L;  1A3U A;  4YCW A;  1VMP A;  2XGT A;  1YJN A;  4UP8 A;  4A3D B;  1NMG A;  2IHE A;  2B8G A;  2KEN A;  2SEB D;  3H0G B;  3J81 i;  1Y69 U;  3P75 A;  4LNQ A;  3UDF A;  3HKZ E;  4ZUI A;  2Y0S B;  3J80 i;  4GOP B;  4IFD J;  3OPO A;  2NZH A;  5J1Z A;  2WB1 E;  3FP9 A;  1KLU D;  2OWO A;  4C3I H;  4C3J B;  4EQO A;  4QF4 A;  3NWS A;  2HCI A;  2FHT A;  2OTL A;  2JA7 B;  3J7A F;  3UDX A;  1F9S A;  1ZYR D;  3RN2 A;  3TS2 A;  4TQU S;  1EZ8 A;  2Z0S A;  5JJK A;  3N52 A;  3O13 A;  4IZ8 A;  1GUW A;  4DR5 L;  4YHH L;  3ER0 A;  2K5D A;  4A3G B;  5KND A;  2QA4 A;  2P5Z X;  4QIW B;  5EAY A;  1VQ5 A;  4B3S L;  1SND A;  2F0E A;  3MC0 B;  2RKS A;  4K0K L;  1N32 Q;  2L9H A;  3K0X A;  1CKN A;  5G3L F;  5K36 G;  1PH7 A;  2R7Z B;  4CDF C;  5IP9 G;  3JAM i;  1TS4 A;  1D5M C;  3M7G A;  1JOO A;  1LM0 A;  1DGS A;  2EY2 A;  2J0T D;  3HOU G;  3CCV A;  4DR7 L;  1H9R A;  5H1S E;  1STG A;  4GOP A;  1LT3 D;  3NPP A;  2JA6 B;  5IYD G;  1SYF A;  1B70 B;  4DA2 A;  4HID A;  2NN6 I;  3K59 A;  1WD0 A;  4BBS H;  4DR6 Q;  2NVY B;  4G7O C;  2F0O A;  1XNR L;  5E4W C;  3QO2 A;  4DNI A;  1D1I A;  3EBE A;  4K8J A;  2QEJ C;  1FGB D;  1EQQ A;  3OWF A;  1KAA A;  2E2J H;  1A0I A;  1CZW A;  2NZO A;  3CQZ B;  4XT1 B;  3S1R H;  1GHJ A;  2B8F A;  2K04 A;  4Z9C B;  1XX8 A;  1CKN B;  3I4O A;  2CW0 C;  5IOD A;  2R7Z H;  3RLO A;  3OMC A;  3CPF A;  3KBX A;  4BBS G;  2MQH A;  2H5X A;  2PZT A;  3I4M B;  2OF1 A;  3D3R A;  1LTI D;  4KJO A;  2Y0S G;  2VY3 A;  2E8G A;  1BNZ A;  3LX0 A;  3HOV H;  2R93 G;  3H6M A;  4H13 C;  5I2Y A;  1BDO A;  1M1K C;  4LF5 L;  3L7Z C;  3P1H A;  1Y1W B;  2VUM G;  3J81 L;  3W3A A;  2K14 A;  4IN3 A;  1ENF A;  1C48 A;  3ULP A;  3JC6 6;  1SE4 A;  4EGV A;  1EY7 A;  3PSI A;  1PFB A;  2BA1 A;  2F03 A;  1HZB A;  1V1Q A;  1XMO Q;  4BY7 B;  4LF6 L;  4ZKC B;  4PMB A;  2R7Z G;  1IW7 D;  4GLV B;  2UUC Q;  4KHP Q;  5M3M B;  4IUN A;  5KRU A;  2N55 A;  1I4H A;  2DY8 A;  4YHH Q;  4DR5 Q;  1H9K A;  1EFI D;  1UAP A;  3GTK H;  1NBW A;  4TSS A;  4Q5V A;  2PCF B;  5NUC A;  2E76 C;  4RGN A;  2J4X A;  1EOV A;  2F0T A;  1PH6 A;  1MHW C;  2E2I H;  2R93 B;  2BOS A;  2Z4I A;  1IKM A;  2CH4 W;  4DV7 Q;  4QGU A;  1QVG A;  1XMQ Q;  2NVT B;  1Q8K A;  1R9T H;  1XPR A;  4LFB Q;  5COR A;  2RF4 A;  4BY1 H;  4F7X A;  3AYH B;  3M4O H;  3S17 B;  2VB2 X;  3KF6 B;  3VA7 A;  4NMZ A;  5AJ3 L;  1E22 A;  1TT2 A;  4A3J G;  4QQB X;  1NE3 A;  4HSP A;  4DV6 Q;  2GVA A;  4DAY B;  4KY6 A;  3M4Y A;  3AFP A;  3CPW A;  5IIF A;  4DK6 C;  4A3M G;  2OT2 A;  1PFN A;  4TKO B;  5EKK A;  3KJP A;  1XTC D;  1TS5 A;  3L9A X;  3RUZ A;  1SNO A;  3A0J A;  3QG1 A;  1O7Z A;  3TP7 A;  4N8F A;  4IUT A;  4H44 C;  4DAM A;  5CV9 A;  3BVZ A;  5C4J B;  1BBX C;  4ABN A;  4FDB A;  4C3I B;  2NTT A;  3RMH A;  1JOQ A;  1STA A;  1STY A;  4RKL A;  2B29 A;  2R93 H;  3PUZ A;  2QDB A;  1F2Y A;  2ICI A;  1FJG Q;  2A68 C;  2HHH L;  1PLF A;  1ENA A;  2ZT9 C;  1EU4 A;  2R61 A;  1DOL A;  4A3B B;  3W1B A;  2C5C A;  2EYO A;  2EJG C;  1ILQ A;  1S5E D;  3A55 A;  4LF9 L;  2PNH A;  1I94 L;  1XWE A;  2A5H A;  1QCB D;  1HA5 A;  1JWM D;  2JEB I;  4CKE A;  3PO3 G;  2ES2 A;  1RDP D;  4R4C A;  4QL5 A;  1U4M A;  2A68 D;  2WP8 J;  1S4Z A;  5M3F H;  1FGU A;  1HA6 A;  4JI1 Q;  2MO1 A;  3WOE A;  3R93 A;  1K83 H;  2CFM A;  3A8J E;  1NUC A;  2ZJP A;  3CHB D;  3X3N A;  4U67 3;  4F87 A;  4IOC A;  1HUM A;  1G51 A;  2M2L A;  3PUV A;  3GTL H;  4LFB L;  5EBC A;  3K7A H;  1K83 B;  3SE0 A;  1IW7 C;  2D9U A;  4JI8 Q;  2A69 D;  1JE4 A;  1DZ1 A;  2E5L L;  2F3V A;  4GOP C;  1WD1 A;  3CXC A;  1BCP D;  1ZKO A;  4R4O A;  5L37 A;  4DGZ A;  1F9R A;  4RHS A;  1TWH H;  5C0X I;  1RJT A;  1E24 A;  1U4P A;  3DWA A;  4DK0 A;  4P72 A;  3BZK A;  1CHP D;  5IYC G;  1DJR D;  4BY1 G;  3SK6 A;  4DV5 Q;  1N36 L;  4RGT A;  3JAM L;  2JA8 B;  2DNE A;  3D6W A;  3M85 A;  3L3O C;  2DUD A;  1VQJ A;  4L5T A;  1RD9 D;  2HCC A;  1D5Z C;  4DF7 A;  3AU7 A;  4UPA A;  3K5L A;  2QEX A;  4R9W A;  1CZG A;  2D62 A;  3ICE A;  3NTK A;  4B3R Q;  1FR3 A;  2EY6 A;  2RVL A;  2ENB A;  3FKI B;  5IWA L;  3CCE A;  4V0B A;  2F0I A;  4J15 A;  1CA5 A;  1YJW A;  1XNQ Q;  1W3S A;  3RZD H;  1HUN A;  5EKI A;  1HXY D;  3A8K E;  1OXU A;  4FYD A;  5M3M G;  4DNT B;  1V1P B;  1BOS A;  5J3B A;  3PO2 H;  4LUO A;  3ND9 A;  1XMQ L;  5C4X H;  4IUQ A;  4HJ9 A;  4HMI A;  4ZQ3 A;  1QUQ A;  3ERQ A;  1CSQ A;  4KTA A;  4FXG C;  1HRJ A;  4MTN A;  4HR7 B;  2B2U A;  2KCN A;  3BYT B;  3ULL A;  3CCQ A;  1RKN A;  2MJ8 A;  1I4P A;  4I7Z C;  4OON A;  1CSP A;  3WWV A;  4K8I A;  4DR2 Q;  3E0E A;  5FJ8 G;  3OOC A;  2B39 A;  4IFD H;  1ENC A;  3KBG A;  4POF A;  1PRT D;  4JBJ A;  4C2M H;  4OO1 G;  3VR3 A;  1PTO H;  4PV1 C;  5EJW A;  2UXC Q;  2HQE A;  1STB A;  2XVS A;  2YTV A;  4PZ8 A;  1V1O A;  1SSO A;  1QWY A;  2A6E C;  1TWC H;  3EJI A;  2VQF L;  2CW0 D;  4ULL A;  2ZJQ A;  1Y1V B;  1Y14 B;  4GLA C;  3S2H H;  3BS1 A;  1MSG A;  3X3M A;  3OSO A;  2E2H B;  3FEW X;  3BDL A;  1SNP A;  1M90 C;  3MHB A;  4A3I H;  5FLM H;  4NKL A;  4K14 A;  4L8J A;  1JB3 A;  3S1N H;  2F0P A;  2F4I A;  5CBA E;  3RLF A;  1NR4 A;  4A3J H;  1YIT A;  2MO0 A;  3T4A C;  1EL0 A;  3C2P A;  3KF6 A;  5FK9 C;  1PRT B;  2JA5 G;  4OO1 I;  4KY7 A;  1WTP A;  1AP0 A;  3I91 A;  3QOJ A;  1UEB A;  2KCT A;  2EYL A;  1XNQ L;  5LMN W;  2BA0 A;  2NVT H;  4Y52 H;  2K6A A;  1X3P A;  2Z1C A;  3ITP A;  4P75 A;  1X65 A;  3H3V H;  4POG A;  3R2T A;  3EIV A;  2M9V A;  1L0W A;  3HFZ B;  4X65 L;  2XWB B;  4L63 B;  4Y7N H;  1EOT A;  5HGQ A;  3UDI A;  3S24 A;  3J80 c;  1R4Q B;  3K8A A;  4CDE C;  1N36 Q;  1PZK D;  4TRD A;  3PO2 G;  3S1Q B;  4WJ4 A;  2RSN A;  1S5D D;  3VDY A;  1EYA A;  2JA9 A;  5C4X G;  4LF9 Q;  1EYC A;  4GN5 A;  1XJV A;  3MFY A;  1STH A;  1V8Q A;  1SE8 A;  3CMA A;  3NXW A;  5C3E H;  2K5H A;  5ELD A;  4KHZ A;  2K05 A;  5FLX c;  3JAM E;  5I9P A;  1U4L A;  1SDF A;  4ID6 A;  2QF7 A;  5DLQ E;  1UNS A;  5KEE A;  3HRZ C;  4X62 Q;  1K28 A;  3GTO H;  2JA5 B;  5IT9 L;  4DR3 Q;  5IE8 A;  2JA7 G;  2O2L D;  4GNX C;  1VF7 A;  3NEL A;  1YNJ D;  4DUY L;  1B3A A;  4NP5 A;  2HDL A;  4KD4 A;  4GNX A;  2DN8 A;  1AEX A;  1CQF A;  4LJZ C;  3G71 A;  3GTP H;  2F0M A;  1HHV A;  4B3T L;  1JR0 D;  4FF2 A;  1EQT A;  4A3L H;  3Q23 A;  1M4V A;  3FKI G;  3D4D A;  1PV4 A;  5DNF A;  3GTP B;  3MFG A;  4DV6 L;  1CA6 A;  2MP1 A;  1HH2 P;  5IGB A;  4A3D G;  3TZU A;  2D0P A;  1YHA A;  5C44 H;  1VQK A; 
#chains in the Genus database with same CATH homology
 1IBL Q;  2I0Q A;  1YBY A;  1CKN A;  2ZJR A;  5IP7 G;  2HHH Q;  2Q2H A;  5K36 G;  1RIP A;  4JI0 L;  1PH7 A;  4PMW A;  3GDE A;  1VQA A;  5IP9 G;  3OTO L;  3JAM i;  2IY5 B;  2UXD Q;  3RR5 A;  4LF7 Q;  1VQ8 A;  1HZ9 A;  1LM0 A;  1DGS A;  2PQA B;  1EFW A;  4GLX A;  2BH2 A;  4YY3 Q;  3RZO H;  3HOU G;  3CCV A;  1VQD A;  4DUZ L;  2JA5 H;  1N9W A;  1WI5 A;  2FXQ A;  1IBM Q;  4DR7 L;  2VNU D;  1X54 A;  2R92 H;  5H1S E;  4DV0 L;  4GOP A;  1W2B A;  4BY7 G;  5IY0 A;  2JE6 I;  4DR6 L;  2PMZ E;  2Q2T A;  3KLW A;  4NXN Q;  5IYD G;  1YJ9 A;  1OTC A;  1E3P A;  4JI2 L;  4APV A;  1MJE A;  2C35 B;  5IYD H;  3HOX H;  1B70 B;  4X66 L;  3KF8 B;  2R6G A;  2NN6 I;  4DK3 C;  4HID A;  4BBS H;  3BU2 A;  2UUA L;  3S2D H;  4DR6 Q;  3ULJ A;  3NEN A;  1KQS A;  4HIO A;  1XNR L;  1SRO A;  1IBM L;  1OXV A;  4BY7 H;  5GAG C;  1CUK A;  2JQO A;  1VQL A;  4DNI A;  4JBW A;  4B3M Q;  1IBK Q;  2YYZ A;  4UY8 C;  4A3K G;  3A74 A;  4JI8 L;  1N33 L;  1WYD A;  3EBE A;  3K80 C;  4R4T A;  1Q82 C;  3L2P A;  3EN2 A;  1XMO L;  1EQQ A;  3FHW A;  4X64 L;  2E2J H;  1K8G A;  1A0I A;  3AFQ A;  1G6P A;  1A63 A;  2UUB Q;  4IPG A;  1QZG A;  4B3R L;  2NZO A;  5JJL A;  3RLN A;  1I6H H;  1BBU A;  3S1R H;  3KYH C;  3CC7 A;  4KLK A;  2VW9 A;  1K8A C;  3TRZ A;  4A3K H;  1E1T A;  3AQQ A;  3W1G A;  4A76 A;  4C3H H;  4DV5 L;  1Y1W G;  1CKN B;  1YEZ A;  3G48 A;  3I4O A;  1N34 Q;  2KBN A;  4JI3 L;  3RLO A;  5ELN A;  3CPF A;  4HJ7 A;  2R7Z H;  3F2B A;  1IXR A;  4BBR G;  1GO3 E;  1A62 A;  4BBS G;  2MQH A;  2H5X A;  4GKJ L;  3D0F A;  1IYJ B;  4JBK A;  3M4P A;  5FJ8 H;  3GTJ H;  2CCZ A;  4ALP A;  1VQ9 A;  3A5Z B;  2N78 A;  4B3T Q;  1CKO A;  2Y0S G;  1HJP A;  2VY3 A;  2E8G A;  3GO5 A;  2NVQ H;  3S1M H;  1HNW Q;  4MNO A;  3HOV H;  4A93 H;  3CCS A;  2R93 G;  1K73 C;  1M1K C;  4LWC A;  4LF5 L;  1K3R A;  3G6E A;  5IYC H;  3L7Z C;  1X3G A;  4P71 A;  2EXD A;  1M90 C;  4BXX G;  1HNX Q;  4IJH A;  1PH5 A;  4JV5 L;  1E7Z A;  2VUM G;  2K14 A;  2N3S A;  1UE6 A;  3F8T A;  2A1A A;  5IYB H;  3OTO Q;  2D0O A;  3ULP A;  1TWF H;  2CKZ B;  3JC6 6;  4JI0 Q;  2HT1 A;  3U58 A;  4DV1 Q;  5IP9 H;  3PSI A;  2BA1 A;  1HZB A;  1V1Q A;  1XMO Q;  1K9M C;  2EQS A;  2WB1 G;  4BA1 I;  3PIO A;  4LF6 L;  1AE2 A;  4WJ3 M;  4YCV A;  3T1H Q;  1Q86 C;  5C44 G;  2R7Z G;  1D8L A;  4GLV B;  2UUC Q;  3B6Y A;  1QZH A;  4KHP Q;  4LF5 Q;  4DV7 L;  3OW2 A;  2UU9 L;  2Y0S E;  2ID0 A;  4YWL A;  4YHH Q;  3FKI H;  4XIG S;  2AHO B;  2Q2I A;  4DR5 Q;  4JG2 A;  4IOA A;  1J6Q A;  3UDG A;  1NBW A;  1EYG A;  1P16 A;  3GTK H;  2GN5 A;  2BH8 A;  2MNA A;  1Y1V H;  1HR0 W;  3NBH B;  4DV2 Q;  4IJL A;  2WFW A;  1XPO A;  1X3E A;  2Z6K A;  1C7Y A;  4BA2 I;  3I7F A;  4OWW B;  2MFI A;  1JJC B;  1EOV A;  3UE0 A;  5C0X G;  1PH6 A;  2E2H H;  2E2I H;  1QUQ B;  4P74 A;  3F2D A;  1SRU A;  4LF7 L;  4A3C H;  4DUY Q;  1KRT A;  4DV7 Q;  5M5X H;  3SGI A;  4QGU A;  5IT9 c;  1QVG A;  3GTG H;  1O7I A;  5AJ3 Q;  1XMQ Q;  1Q8K A;  1U5K A;  1YIJ A;  4DV4 Q;  2LXK A;  4QJF A;  1R9T H;  1XPR A;  2RF4 A;  4BY1 H;  3HOX G;  4A3B H;  1HR0 Q;  1MJC A;  5IYB G;  2JA7 H;  3AYH B;  2JJQ A;  3M4O H;  2Z6K C;  3KDF B;  1E1O A;  2NVX H;  4X62 L;  1WJJ A;  3KF6 B;  1BKB A;  1Y1W H;  2A8V A;  5AJ3 L;  1L1O A;  1E22 A;  3T1Y L;  4A3J G;  4QQB X;  1Q7Y C;  3KDF A;  1NE3 A;  4DV6 Q;  3STB C;  4LFC Q;  2GVA A;  4DAY B;  2ZM6 L;  1HZC A;  4JI4 Q;  4L5R C;  3AFP A;  3CPW A;  4HJ8 A;  4DKA C;  4DK6 C;  3J7Z C;  4A3M G;  2CWP A;  3J81 j;  2OQK A;  4JI5 Q;  4LFA Q;  4OWT B;  1PH4 A;  1BVS A;  1GKH A;  5LMN L;  1HNZ L;  4JI7 L;  2OCE A;  2A19 A;  2OQ0 A;  3KJP A;  2VQE Q;  1JE5 A;  4LFA L;  4DUZ Q;  3A0J A;  3CCM A;  2K52 A;  4LUV A;  2JK8 A;  3M3Y H;  3PIP A;  1VQN A;  2UXB L;  2AWO A;  1GM5 A;  4LFC L;  4GN3 B;  1GVP A;  1S3O A;  1MKH A;  3U4Z A;  4DAM A;  3PO3 H;  3NEM A;  4YWK A;  1VS0 A;  2IT1 A;  4DR7 Q;  2I5M X;  3T1H L;  4FDB A;  3HOW H;  2I5L X;  3TQY A;  4HIK A;  4L5Q A;  2JA8 G;  4C3J H;  1SFO H;  1IBL L;  2NN6 G;  1VQ6 A;  1V43 A;  2B29 A;  5LMU L;  4EQ5 A;  3CCL A;  2HIV A;  3PUZ A;  4A93 G;  1UWV A;  2R93 H;  5IWA Q;  4GNX B;  1NMF A;  1N8R C;  1FJG Q;  3CCU A;  2HIX A;  2HHH L;  5GAE C;  1C0A A;  1L1O C;  4LF8 Q;  3HOZ H;  1YI2 A;  4IFD G;  1JJ2 A;  3Q8D A;  3W1B A;  4JI6 Q;  2JA8 H;  3S17 H;  2K50 A;  4LF9 L;  2PNH A;  4JI1 L;  1VQB A;  2RHS B;  1I94 L;  3I4M G;  4DV2 L;  4AH6 A;  3HOU H;  1EQR A;  2R92 G;  1L1O B;  2JEB I;  3BJU A;  1KC8 C;  4JI7 Q;  3PO3 G;  1FL0 A;  2ES2 A;  3GD7 A;  4JI5 L;  1KRS A;  4R4C A;  4HJA A;  1Q81 C;  4QL5 A;  4NXN L;  1X9N A;  1FVI A;  2F52 A;  4OX9 L;  4LFB Q;  2WP8 J;  3H15 A;  1FGU A;  5M3F H;  1Q1B A;  3CP0 A;  2R7D A;  1S40 A;  1L2F A;  2B63 H;  4JI3 Q;  4JI1 Q;  2MO1 A;  2UUC L;  1X56 A;  4XTC S;  5JEA J;  3GTM H;  1KL9 A;  3RN5 A;  4R4Q A;  1KXL A;  4A3F G;  4JI6 L;  2YU9 H;  3PF5 A;  1K83 H;  2CFM A;  2ZJP A;  1JJG A;  1U0L A;  3KOJ A;  2CQO A;  3CC4 A;  4IOC A;  1S72 A;  1PYB A;  1Z9F A;  1G51 A;  3PUV A;  5JEA G;  3GTL H;  2UXC L;  1Q46 A;  4LFB L;  4NXM Q;  4X64 Q;  3K7A H;  1TXY A;  1WCM H;  4IFD J;  3MEF A;  3M9B A;  3TEH B;  3I4M H;  3CME A;  3DM3 A;  2V1C C;  4JI8 Q;  1UE5 A;  1IBK L;  4IPH A;  3I2Z A;  4A3M H;  1PH2 A;  2E5L L;  1N33 Q;  4ME3 A;  5ELO A;  4GOP C;  3CXC A;  3HOZ G;  4R4O A;  4A3B G;  3J7A 5;  1VQM A;  1AH9 A;  1VQF A;  2IX1 A;  1G29 1;  2NVY H;  1VQP A;  1RL2 A;  4PZ7 A;  4A75 A;  2UXB Q;  3CF5 A;  1EIF A;  2KCM A;  1EIY B;  1TWH H;  4DV3 Q;  5C0X I;  1E24 A;  4JI2 Q;  4P72 A;  3BZK A;  2VQE L;  1B7Y B;  4X6A H;  4JBM A;  5IYC G;  1NY4 A;  1LUZ A;  1TWA H;  4PG3 A;  4BY1 G;  4DV5 Q;  4IO9 A;  1N36 L;  2JA6 G;  3S15 H;  1VQC A;  3D31 A;  2RHQ B;  3TRE A;  3MXN B;  1ASZ A;  1H95 A;  3CCR A;  4QY7 A;  3ZJY C;  3M85 A;  5HY6 A;  2E5L Q;  2DUD A;  1VQJ A;  4L5T A;  1PYS B;  2LSS A;  1OXS C;  2F4V L;  1KHI A;  3CQZ H;  4UPA A;  1WCM G;  4UP9 A;  2QEX A;  3ICE A;  1SR3 A;  2D62 A;  4KI0 A;  2UUB L;  4GKK Q;  4B3R Q;  4DPG A;  5IWA L;  5C3E G;  1UE7 A;  1B8A A;  3CCE A;  3BZC A;  4J15 A;  1VQI A;  2EIF A;  1YJW A;  2PI2 A;  1JT8 A;  1XNQ Q;  1W3S A;  1YHQ A;  2YV5 A;  4JCV E;  3RZD H;  1SLJ A;  4IPC A;  1N32 L;  1OXU A;  3AEV A;  5M3M G;  1OXX K;  5J3B A;  4DV4 L;  3PO2 H;  4R4I A;  4LUO A;  1VQH A;  1PVO A;  1XMQ L;  5C4X H;  1XNR Q;  4HJ9 A;  2UUA Q;  4MZ9 A;  4X66 Q;  4B3S Q;  1QUQ A;  1CSQ A;  1WFQ A;  3KJO A;  4OX9 Q;  3PGZ A;  2ATW A;  2B3G A;  3LGJ A;  1ASY A;  2VUM H;  4JYA L;  5M5W H;  2ASB A;  4MTN A;  3I4N G;  5GAH C;  4HIM A;  5GRO A;  2PQA A;  5M5Y H;  3ULL A;  1PA6 A;  2GVB A;  3PUW A;  3CCQ A;  2VQF Q;  2Q2U A;  4O0A A;  4JOI C;  4OON A;  1CSP A;  4JI4 L;  3HOY H;  3WWV A;  4DR2 Q;  3E0E A;  1KD1 C;  4LF8 L;  4AYB G;  5FJ8 G;  2K75 A;  3PF4 A;  1VCI A;  3DLL A;  4TVA B;  2UXD L;  5BR8 L;  5FLM G;  2XTI A;  1X3F A;  4RMF A;  4POF A;  4DV1 L;  4C2M H;  4JBJ A;  4OO1 G;  4L5S A;  4IPD A;  4NXM L;  2K5N A;  2UXC Q;  4DR3 L;  4DR4 L;  1CKM A;  2YTV A;  1Y1V G;  4PZ8 A;  5BR8 Q;  3HKS A;  2HQL A;  4DR2 L;  4IFD I;  1HR0 L;  4LF4 Q;  3S1Q H;  1TWC H;  1BBW A;  2VZA A;  4BBR H;  1Z47 A;  2VQF L;  4A4I A;  1I5F A;  2VL6 A;  4OWX B;  1UE1 A;  1X55 A;  5M3F G;  2ZJQ A;  2K5V A;  1TWG H;  1Y14 B;  1YZ6 A;  2IX0 A;  2B63 G;  3PV0 A;  2KHI A;  4GLA C;  3U4V A;  5IP7 H;  4A3E G;  3S2H H;  3PCO B;  2RCN A;  2YTX A;  1I3Q H;  1PH8 A;  2L15 A;  1C9O A;  2VS1 A;  5C0X J;  5JJI A;  1D7Q A;  1IZ6 A;  2N49 A;  3E9I A;  4UP7 A;  4JC0 A;  1K0R A;  1LTL A;  5E7N A;  1EWI A;  4AYB E;  2QGQ A;  4OXP A;  5FLM H;  4A3I H;  1QVF A;  4A3D H;  2LXJ A;  1SN8 A;  4EX5 A;  5LMN Q;  3A5U A;  4JYA Q;  3S1N H;  2ZTE A;  2CWA A;  4YY3 L;  2WAQ E;  3M7N A;  2ZM6 Q;  1VQE A;  1LYL A;  3RLF A;  3CAM A;  4A3J H;  2I5H A;  1FJG L;  4YWM A;  3CC2 A;  1YIT A;  2MO0 A;  4YCU A;  1WOC A;  1T9H A;  2IHF A;  3S16 H;  3KF6 A;  2JA5 G;  1PFS A;  1JB7 A;  4OO1 I;  2N8N A;  1EUJ A;  3H3V I;  4GKK L;  4JOI A;  3HOY G;  1Q1E A;  1UEB A;  4QIW E;  3JAM c;  4LF6 Q;  2F4V Q;  1VQ7 A;  2AKW B;  2KCT A;  3F1Z A;  3HOW G;  1XNQ L;  3S14 H;  5LMN W;  2BA0 A;  1KAW A;  1KIX A;  3U50 C;  4B3M L;  2NVT H;  4Y52 H;  3I55 A;  3L0O A;  4P75 A;  1X65 A;  3RNU A;  3H3V H;  1QVC A;  4POG A;  3K81 C;  3W5O A;  4HJ5 A;  4A3C G;  1NTG A;  1HZA A;  3EIV A;  3CD6 A;  4NB3 A;  3HKZ G;  1L0W A;  2OTJ A;  3HFZ B;  1HNX L;  1OXT A;  4X65 L;  4DR1 L;  4DV3 L;  4NPS A;  4Y7N H;  2AMC B;  4AQY L;  3PUX A;  5HGQ A;  4A3E H;  2WAQ G;  3S24 A;  1X6O A;  3UDI A;  3J80 c;  3K8A A;  4LW1 A;  1N36 Q;  1P8L A;  3K7U C;  3PO2 G;  4RG1 A;  1A8V A;  4WJ4 A;  4DV0 Q;  3VDY A;  5M3M H;  3G4S A;  1PHJ A;  2JA9 A;  1HNZ Q;  5GAD C;  4LF9 Q;  3TS0 A;  3OYY A;  4P73 A;  1IL2 A;  3KFU A;  5C4X G;  4AQY Q;  4GN5 A;  4X65 Q;  1XJV A;  4A3F H;  1PH1 A;  1PH3 A;  3ERS X;  3PUY A;  1SE8 A;  4DR1 Q;  1SMX A;  1XTD A;  3CMA A;  4A3G G;  5C3E H;  2K5H A;  4A3L G;  1N34 L;  2DGY A;  3T1Y Q;  4KHZ A;  4YCW A;  2XGT A;  5FLX c;  1YJN A;  4UP8 A;  4KHP L;  1MIU A;  1NMG A;  2IHE A;  2KEN A;  5DLQ E;  3J81 i;  4X62 Q;  3GTO H;  2AWN A;  1YNX A;  4AIM A;  4LNQ A;  3UDF A;  3HKZ E;  3J80 i;  1AE3 A;  1Q12 A;  5C4J H;  3I56 A;  4DR3 Q;  5IE8 A;  2NZH A;  4GOP B;  1XPU A;  2JA7 G;  2WB1 E;  4DR4 Q;  3FP9 A;  2PI2 E;  3H0G H;  2OWO A;  4C3I H;  4GNX C;  2JA6 H;  3I4N H;  3NEL A;  4JV5 Q;  4DUY L;  1J5E Q;  2KHJ A;  1JMC A;  3STB D;  4GNX A;  1YHB A;  2OTL A;  3CCJ A;  4K0K Q;  4BXX H;  2ALY B;  1PH9 A;  3HOV G;  3UDX A;  4LUZ A;  4H02 A;  3RN2 A;  3CW2 C;  3TS2 A;  4TQU S;  1V9P A;  3G71 A;  3GTP H;  2R7F A;  1GD7 A;  3H0G G;  1I94 Q;  4A3G H;  2Z0S A;  2K4K A;  1HNW L;  5JJK A;  3J81 c;  4B3T L;  2JEA I;  4A3L H;  1VQG A;  1NJI C;  4DR5 L;  4GKJ Q;  3FKI G;  3F2C A;  1PV4 A;  4YHH L;  2YTY A;  3ER0 A;  4R1J A;  3E9H A;  1YVC A;  2QA4 A;  1J5E L;  5EAY A;  1VQ5 A;  3UE1 A;  4DV6 L;  1VQO A;  4B3S L;  2UU9 Q;  4GN4 B;  5GQO A;  1VQ4 A;  1HH2 P;  2ZTC A;  2ZTD A;  2F3I A;  4O2D A;  4PZ6 A;  4A3I G;  3GTQ H;  4A3D G;  4K0K L;  4GS3 A;  4LF4 L;  2D0P A;  3IRB A;  5LMU Q;  1N32 Q;  1YHA A;  5C44 H;  3K0X A;  1VQK A;  1I50 H;  3M4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...