3J81A

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
207
structure length
207
Chain Sequence
SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 44
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3j81A01
2CXQA 2PGIA 3BCHA 3IFSA 4LFCB 2UUCB 2VF5X 4DR1B 1KOJA 4DV2B 1JXAA 2I2WA 2UUAB 3OOJA 4TOIA 5LL6P 3TRJA 5LMUB 4U6NA 4JI4B 4LF6B 2UXCB 5LMNB 3T1YB 1N8TA 2V4MA 4M0DA 4B3RB 1IRIA 4NXMB 4DR3B 3I0ZA 2J6HA 4YY3B 2ZM6B 1NUHA 2A3NA 2VQFB 4B3SB 3FF1A 3C3JA 3PR3A 2E5LB 4JI3B 4DV7B 2WU8A 3EUAA 3FXAA 3G68A 4IVNA 3ETNA 3Q88A 3QKIA 4X62B 1HNZB 2O2CA 5FLXA 1ZZGA 3JAMA 2CXOA 2XHZA 1JIQA 1IATA 1JLHA 1C7RA 3NBUA 3J81A 1N36B 2UU9B 1XMOB 4LZJA 3BJZA 4DV3B 1T10A 2CXTA 1IBKB 2ZJ4A 3SHOA 1J5EB 2UUBB 4S12A 5IT9A 1U0GA 4JI0B 4GKJB 4JYAB 1MOSA 3T1HB 4JI2B 4X66B 4DV0B 4LFAB 1X94A 3LJKA 1B0ZA 2O2DA 2F4VB 2E5FA 4LF9B 2YVAA 2CXUA 2DECA 2CVPA 1WIWA 1VIMA 3FJ1A 1TK9A 2CXNA 4DV6B 2VQEB 4B3MB 2CXRA 1XNQB 1U0FA 2AMLA 3Q7IA 5A2QA 4DR2B 1GZDA 1MORA 2PUWA 1NRIA 2I22A 3HJBA 4AQYB 2DF8A 2HHHB 4YHHB 1U0EA 4DR7B 3HBAA 4AMVA 3TBFA 2UXDB 3M5PA 2UXBB 5IWAB 4X65B 1XNRB 1JEOA 4DR5B 1VI5A 5BY2A 3CVJA 1GZVA 4JI7B 1VIVA 4JI8B 4DV1B 4DUZB 4LF7B 4LF5B 1J5XA 1TZBA 1DQRA 3J80A 1N33B 1XTBA 2CXPA 2POCA 4DUYB 1XMQB 3JX9A 1HOXA 1FJGB 2PUTA 4JI1B 1G98A 4JV5B 4B3TB 1IBMB 4OX9B 3FKJA 3J7AC 4LFBB 4DR6B 1C7QA 1M3SA 4X64B 1HNWB 1VI6A 3UJHA 1HM5A 4GKKB 2Q8NA 2PUVA 2ZJ3A 3KNZA 4JI5B 1I94B 1N32B 1N34B 1IBLB 1X9HA 4EM6A 1MOQA 4KHPB 4JI6B 2VF4X 3OTOB 4S1WA 5I01A 1X92A 4DV4B 5BR8B 1Q50A 1X9IA 2CXSA 3ODPA 4K0KB 2XBLA 1HR0B 1HNXB 4LF8B 1TZCA 4NXNB 4LF4B 4DR4B 4DV5B 2X3YA 2CB0A
chains in the Genus database with same CATH superfamily
4RLHA 5I3CA 4O1HA 2KLHA 4FC6A 1J8QA 1UJMA 2GYUA 3P96A 4LX8A 1HEIA 5AXAA 4GOOD 4E31A 2HJWA 1YQUA 3BCUA 4DRXA 3MK31 1WXHA 2X0FA 3ME5A 4UU1A 4N41A 1VE5A 2RGNA 1OLOA 1GQYA 2VHXA 3FSGA 1B43A 1L8OA 1YCDA 3EVDA 4RGVA 3FRIA 4N7JA 1AKEA 5FL7A 4G4GA 4PYIA 3B2EA 3HNPA 3IESA 4ISCA 4EABA 1LNQA 1V8ZA 2FXVA 4M1ZA 2DPMA 3LHIA 3WJ7A 3AKZA 3I4CA 2QI9C 1BDIA 3SS7X 1XB2A 2DHEA 2R4TA 5P21A 2QZPA 1E32A 4R7GA 1UP7A 4JLMA 2HMSA 4YPFA 1FRZA 3HU2A 4EA9A 5IT5A 2R6AA 1R64A 3QKIA 4E4YA 3VR6A 2V7TA 4RX1A 1T2UA 2QE7A 4D4HA 4DCCA 4DIDA 1SIWA 3NWPA 3C3EA 1ZRNA 2W2TA 3EBPA 1KAGA 1NFFA 4LCJA 1SD2A 4B4DA 3THXB 4C7MA 2DEUA 1BN6A 2N42A 3D8BA 4ZI5A 1H05A 3WMFA 4CNQA 2O2HA 3KTOA 3T94A 1CERA 3TAUA 4EBFA 2LP4Y 3ZDZB 2MDTA 1IZZA 2RK4A 1Q91A 3MIZA 3FDXA 4HQLA 4ZAVA 1KDTA 2G63A 1KFEB 5DNUA 2FX2A 2H4HA 5J40A 1ZR2A 4UATA 4FFLA 1PJCA 3OLZA 1KZ9A 1T8UA 1XJCA 2TECE 3T9DA 4EL0A 2IEGA 1S96A 2GFQA 3DMPA 2X5NA 1P73A 3DTVD 2EC5A 3MVEA 4FU0A 1A4RA 3MJHA 4MJ7A 4TS4A 4Y3UA 2FUEA 1SR8A 1LW7A 3GAZA 4Y1GA 1YDHA 1NR5A 2HMWA 4WCFA 3PFNA 5SZIA 5CA1F 3TJZA 3QMPA 2ERXA 4R1TA 2CUTA 3RE1A 2YV1A 3D1VA 5LQAA 5JADA 3QJYA 4XLTA 4BKPA 3TW4A 3KQHA 1PW7A 3U4DA 1VJDA 2IDJA 2IPOA 4WADA 4C1BA 3U44A 2C5BA 1NNUA 2XUIA 2I6UA 3DVLA 3ZU3A 2I8CA 4G8JA 4B74A 4LTMA 5JAHA 1LTQA 5CAEA 4QFMA 1L8AA 1S01A 2I33A 5T5QA 3KWMA 3WRVA 3IMEA 2F3PA 1PEAA 2X14A 1TC1A 4GVLA 2CLEB 3BGVA 4HG2A 5I8ZA 2BDTA 1RPAA 1KSJA 2J8ZA 3AEUB 4N0DA 2P67A 1ZDMA 1PJ3A 3COYA 4XA8A 3RK1A 3WDSA 1N78A 3MUEA 3ZY6A 3QPCA 1OY1A 5ITVA 1ILEA 2JFQA 2I4IA 1AV7A 1SURA 3B89A 3O1LA 2QUAA 2WYOA 3CCBA 1D04A 2V6GA 3HY3A 1P0MA 4Y2QA 4YT8A 5LIRA 4QARA 1M8FA 5KYWB 3ES9A 4NBVA 1YT5A 3LDAA 1N9ZA 3H9UA 4JHXA 2ZRKA 1RKQA 4KXXA 2WPNA 1E79A 2H5EA 3Q87B 2J9YB 4R9NA 2BGWA 2C7VA 2COEA 1K27A 2HA4A 4IDPA 3FLEA 5JWRA 2F1OA 4KACA 2YY5A 3OZ7A 1KHHA 4BFTA 2Z4TA 3RHTA 1DJLA 2ZB8A 3RR2A 1OW3B 1K2WA 3ADOA 4KAAA 3L77A 2QUIA 1RLTA 5BN3B 4WFIA 4DLAA 2D1SA 4G24A 4JQYA 3TQRA 1U7XA 5ABPA 4CQMD 5KKCA 2JHGA 2IHYA 3SMQA 3BS4A 3QE9Y 4RTJA 1P0QA 1P75A 4F3TA 4TKUA 2ODBA 1FLVA 4MVJE 5JSUA 5GJBA 4XZ3A 1WXDA 1Q57A 2JCVA 4N9QA 1T2NA 5JBIA 4AROA 1CS0B 4NU0A 4EF6A 1QWOA 5IUJC 4LRWA 4BECA 3EFEA 1TQ2A 4CDNA 5K8JB 3VU3A 4LHEA 4DMHA 1IB0A 2IYVA 3IQZA 4L0QA 2RCNA 2JJMA 4IIXA 4PYNA 2DPXA 3OM9A 3VUEA 2F8MA 4HAZA 1N5LA 4X8HA 2CHEA 3EG5A 2J5XA 2ZQ5A 3QF4B 3WRWA 4CF3A 2OXIA 4ZHQA 4ZK6A 1VOTA 3JAKA 2FLVA 3WZLA 2IUEA 1L8LA 1NBIA 3CJTA 4A36A 3WAKA 4KSCA 2EGGA 2A1UA 3AESA 3DFIA 4M9CA 3LCMA 2I7TA 5GQSA 5A4IS 3BFVA 2DPHA 3F7OA 2RGEA 2XNSA 1MENA 1KAOA 4LOHA 3W2GA 3WLIA 4CCSA 1G3UA 1P0PA 3DUWA 3TDNA 1AS0A 3O4VA 2IZZA 4E2FA 4U00A 2E4XA 1U3UA 1XF1A 3UJ3X 1DHTA 5SYMA 1GL3A 4WZZA 1GO2A 1NAHA 2WJIA 1JP7A 2AX4A 2BGNA 2D2EA 3E0QA 3MQ4A 4JCOA 5H4HA 2G4CA 4E32A 4E2XA 1ZCBA 1XUOA 2UYOA 4GSYA 4BQOA 4ZO9A 3I04A 3B9QA 4CKEB 4UHBA 5AI6A 3FSJX 4GDMA 3AU9A 3GH1A 5DYWA 3SC4A 4UFPA 1EESA 1EWQA 1UPBA 1X1CA 4CM8A 4NRDA 2RH5A 5BSUA 2FB9A 3AUSA 3IAM1 2VNAA 3FM9A 3RJTA 2P9EA 4UBKA 2CXRA 1KVTA 4K28A 3MCUA 2YHSA 5IW8A 2CDCA 2IS6A 1BN7A 1YB2A 2Q9CA 1SHUX 3VM6A 2WSMA 1NJ2A 3WL3A 1BDHA 2PEYA 1B0UA 3LL7A 2G9VA 2Y1OA 3MT9A 3R7DA 5ITZB 2FPIB 3GB9A 6ADHA 1Y9ZA 3Q8WA 3SOPA 3U5ZB 1NR1A 1V37A 2FEOA 4YAIA 5D5HA 4D8XA 4KAXA 1T3SA 3BMCB 4HDKA 2Z3WA 4EUHA 4UQLA 5EJ4A 1C4KA 1W4AA 4DUPA 4IZ6A 5G4KB 3EVZA 3EYAA 3P5SA 2DR2A 3G89A 4FJ2A 2NO4A 2II6A 3DLPX 3MAJA 5AVSA 4LF7B 3V33A 1A8HA 1DXOA 1U8AA 4Q19A 1F7VA 3E81A 4EZEA 5CITA 2CJYA 2OV3A 3KV1A 4NNOA 5C35A 3BREA 4ALJA 1GTL1 2ZAOA 3I6QA 1RYHA 4I1VA 1KMQA 4M49A 2G4LA 1KERA 1VPVA 2NU6A 2NXCA 3F78A 3BXGA 3M4JA 2EBWA 3OA0A 1OV6A 3UMSA 4AVYA 4I9FA 1UBOS 3USES 1E66A 1VGVA 3LRPA 2XX3A 4E09A 3IXMA 4W7HA 2BBSA 4G0NA 5IM4A 1TRHA 3R4VA 4RF5A 4WX2B 4MS1B 3SF0A 2EWVA 4DBLE 4H31A 4R9UC 1RSZA 3BRSA 3U7IA 5D2CA 3KZ1E 1IY8A 2P2YA 2NV2B 3AM4A 3OOYA 4KU4A 4PZ9A 3V1MA 1X3LA 3WVNA 4ZCIA 4C4XA 5FBVB 3TFOA 5EPUA 5BT8A 3PQFA 2PS1A 4MLZA 4ZQEA 3OSUA 4ZC1A 5UKDA 5F35A 4YREA 3DKKA 2IUUA 3BMOA 3IAXA 1OLSB 3UG7A 5F7OA 3AY3A 1JAHA 2G5GX 2OBNA 4B6QA 3K5HA 5GJWC 4O33A 3HO8A 4L7QA 4LOAA 5I7OA 2V74B 4XIJA 3LFUA 5IAJA 5JQGB 3FAKA 5AK4A 3STYA 5DHPA 1H8EA 3K0FA 1JW9B 1X70A 2CC2A 4RMHA 2JFNA 4XXHA 3ESBA 3PC3A 4QDJA 3BWMA 3GAMA 5BUQA 4E03A 3TO5A 5EHGA 3M70A 2MMCA 3DAPA 3VDMA 1D0IA 1J9ZA 1GLGA 1E62A 4TVBA 4C4TA 4EZBA 4BJ5A 4DC0A 2Z9CA 2QM3A 2YFYA 2VA9A 2CYAA 4MQMA 4JN6B 4OBEA 2HRRA 2PUAA 5FH9A 4JJ4A 4MICA 4S1NA 4QXPA 3ZK8A 5LJLA 2D06A 3IELA 2FMIA 1QKJA 1W87A 5F2EA 2KB0A 2ZTMA 5AI4A 1EA7A 3OQIA 4MW5A 4G8CA 5H16A 3M6FA 2B2CA 1JWBB 1JJ7A 1FQKA 2X13A 3NM5A 2KW5A 1R8SA 3CJQA 2J7PA 4YP6A 2IX9A 1EVEA 2IIQA 3GVHA 2QWXA 5K3FB 4E13A 4QZVA 3FW1A 1Z4NA 3IS3A 4GICA 5C4IA 1RPJA 3KYDB 3OZTA 4ZVTA 4YT5A 1J9GA 4DJAA 3G0BA 1KFKB 1NN3A 3A9WA 4X54A 3PKZA 3A1CA 2CVFA 1QAMA 3C1OA 1EEHA 5MN6A 1RCTE 2FQYA 2J3DA 3ETLA 5B58T 3UUEA 2A9RA 1T0IA 2ZBRA 4ZD6A 1EJBA 2FSVC 2HY7A 2NVUA 2JJ8A 1TZKA 2Q49A 2VPXA 3IEIA 2RH9B 3P9NA 2DY1A 1IUPA 2V58A 3Q7IA 3KLNA 2A88A 1CQJB 1AN9A 1AM4D 1B1CA 3JQ7A 3MS2A 1XU4A 3HSSA 1FTWA 1YIAA 3TQOA 2R9VA 3VPSA 1JEQA 1EWKA 4KGXA 3RRZA 4NESA 1VLMA 5JAPA 5HK8A 3O8LA 1XDWA 2FWBA 2NSLA 2B20A 4IOLA 3NHZA 1EUZA 4FFPA 4Y2YA 4L9SA 3LOQA 4P86A 3ZCRA 2BGLA 2W98A 1CY2A 4J0GA 1B73A 3I73A 3V5NA 3OX2A 2NZ2A 4IL5A 2GPWA 1UXJA 3CUVA 4IDHA 3HVKA 1B0AA 1ZUIA 3L02A 1EKXA 3O4GA 4BZXA 4EPTA 5PNTA 1HYQA 1S2DA 2FPUA 2GN8A 4IDDA 2GZRA 1YUMA 2XXBA 1URPA 4FFWA 4QPDA 1T9GR 3NBKA 2YY6A 1Q3TA 1U1EA 1AGXA 2C4UA 1CUSA 3BSSA 1Y4ZA 4JLWA 2GEDA 4B44A 4B3DA 2FVYA 2JI4A 1M83A 4CTNA 4ZCRA 5C4MA 4B5KA 1T0PA 3DZBA 1Y34E 2WIGA 5KYXB 2QDKA 5AM1A 3K96A 2BRUC 1G5HA 1HBJA 3L1IA 4OA5A 4GW3A 1JTFA 1S3GA 4YXWD 1OX6A 1O95A 2V6FA 4RSHA 1BW9B 1N2XA 4E3ZA 2H8GA 4MP8A 4FXOA 2NYRA 1PR1A 2FOIA 3RUEA 4UMVA 1QVVA 4D8WA 5CW1A 3AOGA 1H0HA 3CB4A 3K53A 2BP7A 2P4QA 2CT8A 3T1VA 4BQQA 4DYHA 5A5DA 4C4RA 3NGLA 2FR8A 2WAAA 5ALTA 5HBRA 4JJ6A 1F3LA 3AYZB 3L0OA 4N03A 4R1SA 3V2GA 3BJIC 2H2GA 3CVUA 1A9TA 4L0CA 1HLFA 3LC0A 4C78A 4CMHA 1K1EA 4YP5A 4DILA 4EMSA 4Q0MA 5DRTA 1IHPA 1Z15A 3RFTA 3FYCA 4RY0A 4Y30A 2YNMA 3PUKA 2R751 1N8TA 4FP9A 3M3DA 2ZIGA 1WXGA 4XPIA 1ATIA 5EHNA 1X7DA 2Q4RA 1V6SA 3JVVA 1UBKS 1XL1A 2O8FA 1LY1A 1KYZA 1Q20A 2PBFA 3AHJA 4O6VA 4OH7A 4Y6GB 4ITVA 3QPAA 4LN1A 1UK8A 5HIKA 1RU3A 4B4WA 3CCFA 4G1EB 4V38A 5FOSA 5KYVA 3EC2A 4RTPA 4Q4AB 5B12A 5FFFA 1L7EA 2ARKA 1SCAA 2NZXA 1KP2A 3LNTA 1ZM9A 1IY2A 1CY1A 1SZCA 4MCJA 5DEOA 3TCXB 4E5DA 9LDTA 3VX3A 3AFOA 4JT9A 3QNWA 4YJFB 3H8WA 1QBKC 4GI5A 1X14A 5EP1A 2VUHB 4UFOA 2FPLA 3ZY5A 1O8CA 4WBNA 3NM4A 2BZ1A 1C0PA 2C20A 2EJUA 4NZZA 3ITKA 3UKOA 3L6CA 1Y4SA 1TMKA 4GIBA 5E7MA 1OZ0A 3R20A 4RXMA 4NK4A 2WVAA 1D7AA 2V7PA 1WPGA 2RG1A 1HE4A 2ACWA 4LYGA 4Z3KA 1YMUA 2LPMA 2P4HX 3MLAA 3L7NA 1QSGA 1MIOA 2ZAGA 3DP9A 1JJVA 3H8JA 3CZPA 2Q4EA 1TVKB 4H7DA 4N82A 5ALOA 4EG3A 2A33A 3G2HA 3U6KA 1RM5A 3GGJA 3VHQA 1RQLA 2XNDD 4LQ4A 3RRMA 1NRIA 1X2BA 3AW8A 4B7CA 2QTLA 1VIYA 1YRHA 3MF4A 3UHPA 1KJYA 1YR1A 4N76A 1YGYA 4RPLA 3LH5A 4JJ7A 3PEWA 7MHTA 2Y1GA 1XXHA 2Z3ZA 3LUDA 5ELMA 2JVIA 1ESNA 2OZLA 1T2CA 2PUCA 2PX4A 2Y76A 4LWOA 5EJ7A 3S8EA 4PC7A 4JZKA 1XU7A 1KAHA 2IYQA 2QJWA 3TINA 4OLAA 4L4XA 1IK6A 2C84A 2QJOA 4JJZA 5EZSA 1AKUA 1GLNA 4EI9A 5HR5A 4B3TB 5JJIA 3NAZA 4Q4DA 4QO7A 4UHHA 3RT9A 5HIIA 3DAGA 4CT0A 2B98A 1LLQA 2ZPUA 1VC2A 2Q1TA 3AEZA 3CUTA 3O4FA 4K6KA 1UFRA 4UNIA 3WK7A 1FNMA 1QE5A 3ICPA 1A8PA 3DVQX 3K0CA 5E4YA 2HNBA 2RKWA 3FNFA 1N8SA 3CR7A 4QRHA 1BKDR 4IFTA 2CMFA 1SC4A 4AF8A 2VF4X 4RK0A 5M04A 3ASVA 4BVGA 1ZGAA 5I01A 4E7OA 3PGLA 3O93A 1DKNA 1KAEA 5E1DA 4DLZA 3AI1A 1YV9A 4J3JA 1RS0A 1E1QA 1EZ1A 3L01A 4P32A 4RHTA 1F1BA 1JZTA 3QEJA 4C0JA 2M9MA 1SD5A 1P62B 3QMMA 2VDVE 2XXAA 3PC8C 1X80B 4I81A 2XUFA 4V2UA 1UPCA 3QBJA 4LMAA 3IGFA 5HOQA 4WW0A 2BMEA 4TTPA 4AY4A 1YZVA 4D7AA 1M2KA 2ZIAA 1UM8A 2HLDD 1BH6A 1I30A 1JB9A 4YRQA 1U9IC 3DZCA 3NQ41 3GJTA 4IFEA 2YWRA 1J20A 1DX9A 5EJAA 4TS9A 1Q22A 4UXHA 1NP6A 4TTRA 4NXMB 4QPZA 1QC5B 3VTFA 2QLLA 1MLDA 4ALIA 3B1ZA 3EHDA 4RAOA 1G60A 4ALNA 2UYHA 1ZMOA 2AOUB 1TIKA 3UG6A 2VAVA 3MJVA 2OB1A 1I7SB 1ZK4A 1K6IA 3R5XA 5BNTA 5IXSA 2ZCJA 4Z4HA 1O4VA 5DW3A 3EQ6A 1G63A 3A10A 4LY9A 2F90A 1B14A 3FBGA 3LPAA 1ADYA 1YD7A 3P9CA 3QGMA 4HJRA 4J6EA 3RFCA 2CVHA 3B1FA 4HAUA 4GP9A 4LY3A 3DM9B 4OJKA 4AJKA 4HZUA 3OIFA 3ZHXA 4O63O 1XOIA 3WGHA 4OP3A 3S2IA 4RK4A 3EGIA 2ZT5A 3SJBA 3NHUA 4NFHA 4J2HA 4PLYA 4CI9A 3P97A 2ZROA 2ANCA 2Q1XA 2Q3CA 1CB7A 4O3FA 1EXNA 1R10A 4YV1A 1RJEA 1PR3A 2EG9A 2XWPA 2NYVA 1QS0B 2FKNA 4HCJA 2RGBA 4MX8A 4Q39A 1PI3A 1JT2A 2OAQ1 3V6LA 3UXHA 4NBNA 3P2MA 3ADPA 5E8RA 2ZREA 3LUCA 3PP8A 1YVUA 4WEQA 4GS5A 4ER5A 4KFSA 4F91B 3C6KA 5EJIA 2GLUA 1JFLA 2H7XA 2NZ8A 3L05A 2ILTA 4PHCA 2CKMA 4UULA 4F56A 1NIPA 1V4NA 1KO5A 4NMLA 4AY5A 2PBLA 1YMQA 4C43A 1ZD4A 3C5CA 2F1RA 2M6KA 5KTOA 2B8WA 1ZL2A 4Q9HA 1YKGA 2QRHA 2HMAA 3C1UA 2PZGA 1YQQA 1DQRA 1CRWG 1YZUA 4N1AA 1JEDA 2MYTA 3PFIA 1KJ8A 1Q14A 4GMXA 1L9XA 3IALA 1XVTA 1E2DA 3PQ4A 1H4QA 2GN2A 3A25A 4C08A 3EXIB 3INRA 4B32A 2W6JD 1EVIA 3AZPA 3IEPA 4UPVA 1G291 1MKYA 1JQEA 4ZTUB 3VVLA 3RM3A 5IFKA 1YFJA 4KGVA 1NVBA 1GV1A 2ZCUA 2H59A 3FGNA 2AQIA 3G17A 3OQ6A 1ZR4A 3W2HA 1VKRA 3QFTA 5TX7A 3I52A 4U2KA 1Y1SA 3BWYA 4H3SA 1O1YA 3L7AA 1CVIA 4KWEA 2A6PA 2FUNB 1RJGA 4K9QA 4WASA 1N2EA 5J59A 1YBHA 3COWA 1GIAA 5JYEA 1GVNB 2CK3A 1RE1A 1XT6A 1EXVA 3LOPA 5EIXA 5ARBA 1P4AA 4HNRA 3TRIA 5BNWA 4ARCA 4HPJB 3HRIA 4PZZA 1QDLB 1C5KA 4C05A 4KXYA 3NHYA 4J91A 4EVSA 2ID8A 3UCXA 1OBOA 1QGYA 4LK2A 1IXYA 2XYHA 1JXOA 2J3JA 1E1RD 2RMKA 1WU8A 3KQVA 3ODGA 1ZX1A 2AB0A 3P94A 4Q1VA 4BMXA 2OWEA 1V7PC 2BFNA 5C80A 2GYVA 2HJSA 2YMMA 1H0RA 4N49A 3IL2A 3ZDCA 1S1CA 2Z95A 7REQA 2AFVA 2ZT7A 1ELOA 4N39A 4AJNA 5I7WA 1H1LA 3OZUA 4JLUA 1GJRA 1UWCA 1II9A 3HP1A 3R3HA 5LA6B 1VLJA 3FTEA 3B3QA 4YUYA 4XVCA 1ODKA 4D9CA 1MB9A 1E5TA 1MX1A 3VXKA 1L4BA 2Y1KA 1OT5A 3M1YA 1GZSA 1I7NA 1K7FB 1L5WA 1OLXA 1TJ5A 2FX5A 4QXAA 1H5QA 2D3TA 4QU0A 3QA3E 3TD6A 4O4LF 1PP4A 2I1LA 3N5CA 4G67A 5LQUA 1EGQA 1KMIY 4GEGA 4C7OA 1R4ZA 2XDWA 1TOAA 1B6RA 2HM7A 3K8QA 5FKJA 4GM0A 5CH8A 2IY8A 1VRVA 1K6XA 4DLUA 2GI4A 3GZNB 3UWMA 5TVGA 1ZFNA 1UH5A 1KBZA 1RM3A 4ZDJA 1V11B 1FP6A 3GFOA 4RADA 4W5WA 2IH5A 1UADA 4UTRA 1V41E 4IHAA 4M46A 2NNWB 3WLKX 5IVKA 1ZM3A 2GHQA 4DQ0A 2RI6A 2XQGA 1Z6TA 3W6OA 1XMJA 4I8XA 5AESA 1F14A 4JASB 4X90A 2HHAA 3N05A 3B1JA 4M9ZA 3WLOA 4AULA 3CHYA 1H69A 2WT9A 1SVKA 3HO6A 4H7EA 3HJHA 1UKAA 2J5QA 2NO5A 3HN6A 3MSXA 1L5VA 5FPYA 3KJHA 4XX0A 5HILA 3SJCA 5HXAA 1N5IA 1RQPA 2B34A 2R8XA 3I9OA 1J8YF 2YZKA 2ZSEA 1JEOA 1PHPA 5AJTA 3V8VA 4ALMA 1R50A 1N1EA 3RADC 4B7XA 5FQNA 2GBGA 4CU2A 2B3TA 3K9NA 4G37A 3BAFA 3L1JA 4NDZA 1M2VB 3ZQ4A 2WF9A 4HEA1 2AXQA 5GIPE 3EFOA 3LC1O 1O6GA 2ZWPA 5HZKA 3C3MA 1L5HA 1WVIA 2YJ3A 2DYKA 4F9TA 4MV8A 1SA0A 2O20A 4BMSA 1ULBA 3K15A 3DDSA 3QUTA 4I08A 3W90A 1E7RA 1HT1E 3KBOA 3B38A 3CLRC 1U2SA 3BICA 5I9BA 1WAMA 3W5JA 2DFVA 1BDJA 1M75A 2ZBVA 2ZE6A 2WTMA 3B51X 1YACA 1QIFA 2O5RA 1C29B 3OBBA 4ZOAA 1JFSA 3AVWA 4DIUA 1TNDA 4GUAA 5TV2A 3D8TA 3VKHA 3OUZA 3W04A 1NF8A 3ZKWB 2DFNA 1P74A 3HA7A 4LSZA 2C5AA 5LMCA 5FBLB 3FWYA 2AK2A 2HDWA 4OO3A 3P7MA 1DBQA 4GYYA 1K97A 4NECA 3V3KA 4CV0A 1G20E 1G8PA 4ZQFA 1UP6A 1UXIA 2RHMA 1DDIA 1PTJA 4M53A 2PK3A 1KRHA 2F3TA 1YRAA 3BMQB 4PLTA 3KDPA 2AT1A 2WKSA 2IDMA 4PE5B 2OKCA 3NC4A 3AFNA 3PBKA 1US8A 2I7VA 2XE4A 4O2BB 3NFYA 1MX9A 1LPBB 3PIDA 5K6TA 1F2TB 3DBRA 5M7EA 2Q27A 3GA7A 4RTOA 3ZJUA 2O7SA 2OQVA 1NLYA 3I6IA 4C9BA 3AGPA 3RROA 3TQHA 1EG2A 3PF8A 2XA9A 3LX6A 4RVGA 3WQRA 4BVHA 4WKPA 1X1DA 2FZVA 2FMFA 3LQ1A 4XSHA 1QYXA 3PEFA 4LQLA 4Y2JA 2REQB 3DNPA 1FBNA 3DOCA 4QG3A 1SU6A 3ZHVA 2B4QA 3I9JA 2RI1A 3MXOA 5ECDA 4I46A 3AP3A 2WT8A 1TF7A 3PNKA 1V0JA 1GSHA 2OD2A 1AUPA 1QRTA 3I8OA 3NRCA 3WB1A 1XD2A 4P0PB 3P19A 3DOUA 3FDIA 3M2PA 1T1JA 4F9EA 1Z4MA 2J09A 4HXGA 4ZZ0A 2CVQA 5JH7A 1J25A 1FXUA 3FDZB 4DSZA 2PANA 3EXEB 2VPQA 4TV8F 4HRXA 3MRVA 2SBTA 5FPQA 1FX1A 1SZJG 1T3TA 2HX1A 1PFWA 3FKSA 5FPTA 1NBME 3SHOA 1J5EB 2OFFA 4B75A 2DLNA 3WRYC 2BKXA 1RXUA 3SLKA 1U28C 2PJZA 4GPBA 4G89A 1E2EA 1SCIA 1ZM2A 2I3ZA 4PIMA 2IZ1A 2KSQA 3C4QA 4F12A 4YVFA 4IV5A 4JYMA 1LC3A 4REQB 1J49A 4Y9RA 4BVEA 4ETWA 3JQCA 3RUFA 4CFYA 5ILQA 2FRXA 1WDLA 2Q5HA 1L1EA 4B71A 4BUZA 4GH5A 3CF0A 1A50B 1OZAA 1UKBA 1JLLA 4DQVA 3BOSA 4HWKA 4XVHA 3TE7A 5J2TB 4NOMA 3G2KA 3M0EA 1AE1A 3PNQA 4IKOA 4CCYA 3O26A 3TZEA 2FZWA 4EAAA 5JMOA 1HRDA 2ZI4A 3DD5A 4FGZA 4OSPA 3DZDA 3F7NA 4IYRA 1DCTA 1NMXA 2CUNA 1Q44A 1PYGA 5EWJA 2GPBA 2WYUA 2IZ5A 1XWIA 2Q29A 4EHLA 1JR3D 1SRQA 2VP3A 4LYHA 2P3SA 3PU6A 3I3OA 2BM9A 2WAMA 2ZYDA 3KHSA 1ESMA 1XKQA 3QMVA 1BRTA 3N59A 3QI2A 1TD1A 4C2AA 1YWGO 3L8CA 1OAAA 1U0JA 4AD8A 2HNAA 3NDJA 1H0SA 4G9BA 3WXMA 4COKA 3VYUB 1G98A 1Y3DE 4HRAA 3R0XA 5KX5A 4TTAA 5AQEA 4YTEA 1ACJA 1J21A 2BWJA 2VLBA 3DCIA 4YR9A 4L3VA 2YJ4A 2QBYB 5KNDH 2H16A 2ORED 2A84A 1AKTA 1HM5A 3NC0C 3Q3CA 4JB0A 4FB5A 1DAIA 4KBFA 5LLTA 3IVAA 1QLWA 1A96A 2KPOA 1SZPA 3OQMA 5CT4A 4EG7A 3WJ2A 1A5SB 3O7MA 1QPBA 1SXJB 1GL6A 4TTQA 3BB3A 3GELA 6LDHA 3CX6A 4RPIA 4YI3A 2CFIA 2B30A 5FP0A 5HZGA 3UB4A 1KETA 1CYEA 2YUTA 1FP7A 5BYBA 4P2BA 2KLBA 2ERCA 3SZGA 1XX6A 2ZRDA 3BK7A 3ND6A 3VGPA 3VDNB 4ETMA 2LIPA 2C4VA 4MR8A 4MV1A 5AJVB 3C74A 3GNSA 3IIKA 3OZDA 1GLVA 2Y0EA 1UXGA 1AK9A 3GARA 3KZMA 4FR2A 1NBAA 3B1VA 1EK0A 4MB0A 4EECA 2UYCA 5LDHA 2JAQA 2Z2JA 4K1XA 5EKTA 3TQIA 3JZFA 1X8LA 2C1EA 1B8UA 4FOOA 2Z2YA 3M5DA 1IDOA 3U7QB 3ZD8A 4EQ6B 1JZQA 1WB4A 4P2GA 5F7JA 1FZTA 1XDDA 3ADDA 3NIDB 2BUAA 1TVEA 2FEWB 4UE3S 2XWJI 5EGNA 5IDXA 3GLSA 3JRXA 3OF2A 1M2GA 5AK3A 1A71A 2POQX 4KKXB 3UO8B 3DTVA 1RHRA 4I4NA 5I8PA 3E70C 5U4XA 1T3GA 1D1PA 2FMHA 3VYRB 3BD9A 4W4TA 1AOXA 2CFTA 2RI0A 1HG0A 2XJ9A 2XKKA 4ECAA 3K70B 4CT5A 2ZIEA 2PRYA 3U4MA 1YZTA 1DKMA 1N92A 2Y8EA 1LDMA 3QVLA 4XJXA 1XWFA 2CF6A 4BB5A 1WG8A 1ZYUA 2UUBB 2QRZA 4WKCA 4KMSA 2ZGVA 1CP3A 1UMBB 2FYTA 4AJ4A 3IHTA 5U1PA 4O2AF 1GXSB 4YASA 3G2OA 4EBBA 2Q9UA 3GLFE 4DA7A 2IUTA 2JBAB 3PE6A 3W5IA 5EZYB 5A4MS 3O4HA 4EY5A 1E3SA 2Z08A 3GF4A 1ZS9A 1HKHA 2A5FA 2ODPA 3Q72A 4XWYA 5JMPA 1DX6A 1GTMA 3G8YA 2ZRMA 2CXNA 4FFNA 3ER8A 3U9LA 1CJUC 4DV6B 1A77A 3KU4A 4BU0A 3TQTA 2ABWA 2GZAA 3QE2A 1FL9A 4MXDA 2Q0SA 1I0LA 4X97A 5G1NA 5C34B 3TLEA 4C7BA 4HTAA 5EIEA 1Y6FA 3ICQB 1CF2O 5E3JA 5IZCA 4WJZA 3FTFA 3HN7A 3DWFA 3G2QA 1WCIB 2FRDC 4DLLA 1IZ8A 4NP6A 4YCSA 1QCYA 5IVIA 2XV1A 2Q4TA 4KYUA 5D6NA 2RB5A 4RLSA 3ZDQA 2Q0XA 3H2GA 4YCMA 1LF5A 4KBYA 1HE8B 1U7UA 1LTHR 3B60A 4K6OA 4XYEA 4ZQGA 3RQIA 1LS6A 4BJHB 5HW0A 5KNBD 3M89A 1QHFA 5CJPA 2HWYA 2LRHA 1TZBA 4EY3A 1J0DA 3G2IA 1MB4A 4LJ5A 4LV8B 4IGIA 4Q9KA 2OV6A 2BFDA 1CDOA 3PEVA 1I6MA 3BIWA 4GDFA 3L8EA 4YRKA 2R6DA 1NIJA 1T9KA 1U9YA 2RFLA 1UL1X 2JDID 4TQUS 1MABB 5IZ4A 5JCOC 4S2UA 4LGYA 2P11A 4X64B 1LZLA 2H7YA 4KMMA 3V2IA 4DVGA 5L3QA 9ATCA 4Z49A 5KOYA 4QTZA 5E9WA 1U2GA 4WTOA 2DJIA 2VJNA 1RVV1 3HP7A 3OMXA 3Q3JB 4ILKA 4DQXA 4U2CA 4JX9A 3JD3A 1JG6A 5BOSB 1ZKDA 3A7DA 5DTQA 3KJGA 3B3FA 4TSKA 2F67A 1L7NA 3RB8A 3M4ZA 1DXYA 4II2A 2D0OB 3AG6A 5IKXA 3FMVA 4DMKA 4FSDA 3LLSA 4RQBA 1H2BA 1Z18A 3UJ7A 5I9IA 3ZDBA 2XHEA 1Z4PX 2QMQA 4LNUB 4I55F 1CC1S 1R5NA 4RF2A 5GJCA 3VC7A 1N5JA 1N7IA 1F48A 1J2YA 4PSUA 2MSWA 4N40A 4I5IA 2O8EB 1R0XA 1RLOA 2VZ9A 4OJQA 2BI8A 1U1GA 5KQRA 5G02A 4YJGB 1SRRA 3CRQA 1LKZA 1VZ2A 3D3QA 4RDIA 1ZNQO 4JOBA 2W8BB 1VA4A 3E8MA 3KSUA 4UM7A 5BWOA 3VU0A 5J2UB 1RM0A 5IJ0B 2BR5A 1KDRA 1Q7RA 4I6EA 1EM8A 1OSNA 2HEIA 4NCJA 4PLGA 4DR3B 3VMFA 1B6GA 3E27A 1ABFA 1DQZA 4ZCQA 3TSYA 1MB3A 2QM8A 4EA7A 2GAIA 1RMYA 1TYCA 5K8CA 1DBSA 3A1FA 4K26A 1VMEA 4R2IA 4EG5A 3Q8KA 3WGMA 3FX2A 1Q0ZA 1DO8A 1ZGBA 4O4JF 2F9FA 5IYZB 1NM5A 2J41A 2YH2A 3TOZA 1ORDA 3T38A 1Y3BE 4HQNA 3JAMA 3WSVA 1QQ6A 3ZWVA 4MR9B 4FD2A 1WS6A 4KPUA 2WWXA 4EB6A 1L4KA 2OGUA 1EDOA 3KQKA 2WMYA 2D2VA 4OPMA 1PQYA 2XZLA 3GEHA 2JFBA 1HDCA 2ZSFA 5H5JA 2WWIA 3WKCA 5L7WA 4HLNA 2OFXA 1BE1A 1Z6ZA 1C9EA 1ANKA 5B2FA 1GN8A 2WSSD 1QDEA 3CU5A 3HHPA 3EHEA 3NEJA 3FG9A 3OWOA 1KO4A 3G2NA 4WWHA 5EIAA 3SSNA 1IPFA 2QKYA 2OZEA 3BG5A 1AS3A 3WMRA 1YJBA 2NO9A 3EOAI 1EXWA 1ULTA 4ON9A 3OETA 2JJYA 3RRNA 3UH1A 3BSFA 1AMUA 4KYIB 2J5RA 1P7CA 3Q11A 5EC8A 2WILA 1GPH1 2MCFA 1Y8QA 2H5IA 1Z35A 3U0BA 3ENKA 5AI9A 1P5HA 2RARA 2BFPA 1RJ9A 4CQMA 4ENTA 4HP8A 4MGIR 1TW2A 3K09A 1Z7WA 1LBIA 4CTKA 4RCYA 1V5EA 3FCCA 4YRGA 3A7EA 2ZBFA 4TPKA 4X65B 4DR5B 5ALNA 3VU9A 2BV3A 4Q6BA 4ARVA 1RAIA 1ND6A 2HWXA 1RJWA 3GP5A 2AWOA 4MKFA 1V8BA 1EINA 3R41A 1FMLA 3WLEA 1NLMA 3V9AA 3AYXB 4DDHA 3WK9A 4CFZA 1CJBA 3GXOA 4DCSA 1GHTA 1OVGA 1L3CA 5LLSA 3EXHA 5GWXA 3TLGB 5F3RA 1Y5RA 3OG9A 4EZIA 1D0VA 1EX9A 3D0KA 2VUUA 1N1DA 4NJMB 2C03A 3DLBA 2W43A 1L3BA 4A6EA 1XEWX 1G21E 3NBQA 4Z53A 3LFHA 4IQGA 3L4SO 4RVOA 3OZXA 3LLUA 3W06A 3EA5A 3U4QA 3TR5A 3MWEB 4DWOA 1NMEA 3SEFA 1EFDN 4DQUA 1JVSA 1J4AA 4KHPB 3DL2A 4DQKA 5BN4B 2HBZA 3ZJVA 1GGHA 1Y9EA 3IAUA 2I3GA 4QHTA 1Z4IA 4RD6A 5K0FA 3G8DA 1T8YA 2O3UA 1ODIA 3P26A 4Z1MD 2V96A 1DJNA 4Y9UA 1EUYA 1ODJA 3GJXC 1IN4A 4WUVA 4P53A 2O54A 3AIKA 3L7IA 3ZTWA 5C8YB 2I71A 3LP6A 5EUQB 1J2TA 3E9QA 5FQOA 2ONCA 3SXPA 4RY9A 4B7AA 3VZSA 2Y9MB 1O89A 3HG7A 1E7MA 1M6YA 1R00A 1ZCAA 5CTJA 1Z06A 3OE7D 1UOOA 4AYXA 1R0KA 4UD6A 4A27A 4CF6A 1X42A 2ZBEA 4NBUA 3WL8A 3EBLA 1IIBA 4YS6A 1QIJA 1S3SA 4N01A 4OUDB 1PRYA 1Z2EA 1NKVA 1Y5LA 4UM8B 5B37A 3JQGB 2RJ3A 3FD8A 4MUEA 5CNMA 1I80A 5CCXA 1J8MF 4N8EA 4OHXA 4EP1A 3P0EA 1LDGA 1IUNA 2DM6A 3DONA 3UGQA 1UBHS 1UT6A 3ZNPA 1V16B 4CKCB 2XYVA 4RZHA 4EHHA 1LV7A 2BL4A 2VZLA 2B37A 3N2ZB 3W7BA 5LXTB 1LBHA 2WMNB 1TVMA 1A0OA 1UZMA 3A4TA 4MVJP 4NFSA 5CT9A 4ARZB 3OP1A 2OCKA 3LY8A 2N1MA 4BKUA 4BQEA 4DV7B 2FUG6 4JDPA 2Q1SA 3I28A 4K87A 4G0XA 4Z7OB 3P2KA 2PZBA 3FF4A 1CQWA 4MVWA 4XUGB 2EX0A 4GZ6A 2YKGA 4P3PA 3ZIAD 3ELYA 1IATA 1TIBA 4RPJA 5AHWA 1KZHA 5C1OA 5IABA 3BL5A 5LBUA 1Q95A 2FQQA 3TUJC 3TTXA 1NQTA 3MTDA 1G0NA 4X44A 3OTIA 3BULA 3OO0A 4BPRA 2W2NA 4UQOA 4P0QB 1SCKA 4O4IB 3R9IA 2PGOA 4ZVRA 2VDRB 4CMIA 3KEQA 3TGPA 2O8CA 3ETHA 2OPBA 3WMGA 3BJMA 1YR3A 1W4RA 2FRVA 1Q77A 1UDWA 2LWIA 1SELA 2VPPA 2WKRA 2ZSUA 4RCZA 3A27A 4QQKA 2XB2A 2I4NA 2JLUA 3DAFA 1DQPA 4PSVA 2ZE7A 3L49A 2HCTA 3PZRA 1BYUA 1G20A 1XP8A 2I22A 3HUUA 3VPCA 5KOHA 3R9WA 1BXGA 5TQJA 1GPBA 4WOPA 3PXCX 4D45A 3IODA 1ZIDA 1I0ZA 2ZJ7A 3HVJA 4HMPA 3U1VA 3D6NB 5REQA 2JGIA 5IJXA 3WGTA 1RHMA 1QH1B 3MGGA 5IDQA 4D9MA 1C2YA 2QD5A 2ZI5A 1XZMA 4FSHA 5TGDA 4YONB 9LDBA 1I14A 3LP8A 4JAVC 3EZLA 2ZYRA 4JMPA 4LWQA 5TMDA 3ZXUB 2CYBA 1NN0A 2ZEJA 3GC6A 4UCFA 2JFOA 4UVEA 1KEZA 2XUQA 1QYRA 1JR3E 1KKLA 2ODEA 2ZB4A 3GLGB 2JD1A 3F46A 1P5RA 3RIHA 3J7AC 2R6JA 1PVDA 4JUFA 4YQYA 4M8NE 2J45A 4S04A 1JN0A 4QX6A 4NJEA 1W5AA 1IM2A 3PHCA 4F1KA 1RT9A 4FI3F 2PWZA 4KE9A 2N3ZA 1Y3FE 3ROKA 3FTDA 3PHJA 5CFOA 3DBVO 3ZD7A 1FU4A 4RDXA 1U2DA 2CCGA 4GSLA 1PFGA 2JH3A 4O2LA 2GZMA 2C61A 4N8SA 5K4AA 3Q12A 2BMFA 1ZJ6A 3CB2A 3UTCA 2H1OA 3IEXA 1J07A 2W2KA 2R5NA 4UHKA 2QUJA 3ESXA 3QWIA 1PFVA 4K03A 4TVSA 1J00A 1V48A 2GM9A 1SCQA 1KI7A 4EG1A 3SD7A 4DNFA 5SZHB 1R0LA 3WLPA 1NBMA 1SXGA 3C85A 4U9UA 5IC4A 1JSXA 5FI5A 3ZDRA 4D92A 2C5FA 2I2WA 1BO6A 3VHXA 5IEJA 1P8AA 2I3AA 4OQNA 1PK7A 3MSCA 1OBVA 3G02A 3V97A 2VHZA 3ANLA 4H7KA 4J75A 3ETGA 4NV3A 2P3LA 4NBTA 3E3NA 4QD3A 5IXJA 2QSZA 1FXWA 4OQXA 3HGMA 4KXVA 4ZAFA 3REFA 4B8YA 3ZGNA 2JH8A 1CVLA 1JPUA 3H6GA 3RWOA 3RT7A 3NC1C 1C1HA 3NVKI 2F6RA 2XYGA 2BEWA 3TPFA 1L9KA 5FIUA 3UJPA 1PKXA 3LGXA 1F51E 4INOA 2O2CA 4F60A 1Z6PA 3CLVA 3I72A 4P92A 3QJ5A 2ZFUA 4DIFA 2CXOA 2JASA 5JCJD 3FCYA 4CEHA 3GEEA 4R84A 4M0LA 2OGWA 1JZSA 4I1SA 4C2TA 4DQDA 2XNDA 5JQGF 4XDZA 2Q6OA 2VNJA 3IMCA 1VJ0A 3IIMA 2P9CA 3DEYX 4CR8A 4LC0A 3KUDA 2N9UA 4TXMA 1QP4A 4QYXA 3E9CA 2JLSA 3Q2IA 3W3AD 1CZOA 3SEAA 4IEIA 1FC0A 2DSNA 2OAP1 5AKLA 1BXZA 1TU0A 3M6UA 1CR2A 1G4HA 3TIIA 2P40A 3ILXA 1W1IA 3ZI0A 4TRMA 1PLLA 1YUBA 3JRNA 1IUKA 4YA6A 3UC5A 3CVXA 3I5YA 4BMPB 1AU9A 4BFVA 2AI3A 2BHSA 4A0RA 2OV8A 4KJXA 2X23A 3NHBA 3ZTTA 4F4UA 3R1IA 3O4RA 5HYVA 4V03A 3L5OA 1JHZA 5EMLA 4OFBA 5ELXA 3FOCA 1U0HC 4MS3A 3DDZX 3KUXA 1XQ1A 5GVRA 4J16C 5AVUA 3ITEA 1GZVA 3DYVA 2C9OA 4KREA 3T1NA 4WCDA 4MW9A 5J5CA 1ZO8A 1N3BA 1XZNA 2IP1A 3FWNA 5EI5A 1I24A 1WCV1 4OBWA 1W47A 1DAFA 3JYLA 4PSCA 4BQIA 4CGYA 1EI9A 5EJ8A 2D6FA 2FF5A 1G5FA 2POCA 3TNFA 2IOFK 3C5HA 3PIRA 5I7VA 1UJ6A 4ZQBA 1QGDA 3DMHA 3H5WA 3PD0A 5D86A 5F33A 2Q5OA 2XRZA 2VF8A 5ESXA 4AXBA 5GM2A 3CPSA 3C0KA 2I6SA 3ULKA 4V1CI 5IN5A 4EG4A 4ID3A 5AXDA 4OMFG 3NAGA 1QLHA 1T5HX 1WUKS 3BL6A 1RWWA 1N57A 2ZVJA 2HLDA 3M82A 3QBVA 4X94A 1E8MA 2WLSA 3TAXA 1Y1QA 4ZYTA 1PJBA 4FINA 3RU2A 3WAGA 3NDBB 2P90A 3SHWA 1KFBB 1BC5A 3AR4A 2QN2A 2XMSA 4YPVA 1VIDA 4WACA 2FEAA 2Q2NA 3OPNA 5A03A 1OQAA 3CCCA 3ZD6A 2M6RA 5BR8B 1H85A 1SC1A 4FOSA 4F72A 3CRW1 1YR6A 1CNMA 4AJ2A 3RCBA 2SNIE 5IAEA 3TOXA 3EGXA 3NO4A 1A1VA 3IBTA 3TTYA 5DH9A 1TLTA 2BT4A 3F8SA 1M1XB 4NMWA 4YP9A 3GO4A 1NQAO 2VKTA 3JSXA 5LB4A 1YDEA 3QX3A 2W58A 2IXTA 1VDZA 4L72A 1G1AA 4B3XA 2GVDC 1ZI6A 2PNJA 3NUZA 2XGMA 3IDQA 2C8KA 4FD3A 4I5EA 3LRTA 3QLTA 1AQ6A 5DGTA 3Q7TA 1N8KA 4MEBA 1QHYA 2VSYA 4OJNA 2BDEA 3AR2A 4H4DA 1P45A 4XM1A 1SOUA 4QGGA 1LLDA 4J94A 2OYRA 5C1DA 5MN4A 3FTQA 4MGYR 5DCWA 2GPAA 4IIJF 3NKVA 1YA8A 1CS4C 2GCNA 1U0NA 3GDHA 4RJTA 3SNHA 3QF7A 2WSIA 4ZHQB 3JAKB 1EA5A 1TCBA 2MHCA 3T9BA 2R8YA 3TMAA 4KQFA 1GUAA 2Q62A 3D6VA 3G23A 2PKWA 1FYDA 4Q7MB 2BE9A 2A1UB 4IMIB 1QIEA 1R88A 3PNPA 2G9ZA 4OXKA 3HO1A 1T2AA 3K3PA 1M1YE 3FXAA 1G5RA 3GOQA 4ENVA 4XGRA 4UHDA 2ZJ2A 4KODA 3NTVA 2O3JA 4K05A 5AI5A 3ZDAA 1YZHA 3G82C 1YFLA 4Y2VA 3A9RA 3W6UA 5BUCA 3RVPA 2H0QA 1Z6GA 4UBOA 3W78A 3ZWAA 5ALGA 4WI1A 3K8ZA 2PJUA 4F3KA 2JI6A 4QFDA 1W5FA 4HL6A 2E3JA 4Z4GA 1MOSA 1QU2A 2Z0MA 1UPAA 3MD0A 3P0IA 4I7EA 4MPTA 3RUHA 4HUTA 5ICCA 1E98A 2VJBA 1VG9B 4N3NA 4FNAA 4AF7A 5EMJA 3S2SA 2E5FA 4OEHA 4DLXA 1NXXA 2XYQA 3IAEA 3LG2A 3PGXA 1MXHA 2AOTB 1KMCA 3AUKA 1L1FA 4D82A 1EQ2A 4Y2RA 5EFZA 2EFGA 3GROA 4GT1A 4BMNA 3MCTA 4JR2A 2GRJA 3CEJA 3GT4A 3ISTA 3TUIC 1OXUA 4BFWA 1MORA 4PONA 3BRCA 5EL0A 5K3AA 2W6JA 1D0SA 1GUDA 1W4BA 4IDNA 4XB6B 1XZKA 1JMVA 2G82A 4ONEA 4UUQA 2XDQA 3SAJA 5E0KB 2AXEA 1YU6A 4ZOEA 2CLFB 4Q47A 1R6UA 4CCAA 1FYXA 2GEJA 2RGAA 5EZQA 2VOJA 1WWKA 2X4LA 4QLOA 3W1EA 3ZKAA 4YDHB 2FN4A 3I1FA 1KGDA 3BEOA 4AZ0B 2OVFA 1UEJA 1H9BA 3NWEA 4B7UA 3KVOA 4ZOLB 1QP0A 1KBOA 1FJGB 2L69A 2NU6B 4Z9AA 1Y81A 1G5TA 3BSYA 1PZNA 1QUEA 2BGIA 2ZUBA 4CMAA 3H2BA 5H3CA 2ETVA 4WXYB 2R65A 1WMFA 1L7OA 4I4CA 4U02A 1B93A 4ZO8A 2P75A 1VZ3A 3FZQA 4ERNA 1ZW6A 4PZPA 3AXSA 3RRFA 3QKWA 4Q7KA 5FNZA 1UKVY 1E1RA 1X1EA 2NTYC 5CX1A 1FF9A 1U7PA 4DKJA 3OO1A 4B5LA 1IUOA 3RYHB 1DG3A 4JJGA 4ND1A 2NZJA 1HTTA 4ZDIA 2PGNA 2HHCA 6YASA 2WWRA 4RORA 3UV3A 2XPCA 1W48A 3HFRA 2VYQA 2YICA 2Y2UA 4HDMA 4LF4B 4WXRA 1DC5A 1U2EA 4U2DA 2HT1A 4OX9Y 5DVZA 1FJ2A 2FPPA 2JIDA 3I1IA 3MBKA 5MF6A 4GXTA 3E7WA 2Q6KA 2V55B 5JO9A 1JJBA 3BZWA 2RKBA 1A5BB 1ZIOA 3A2NA 3QU9A 5HCIA 3RABA 3NHMA 3UM9A 1X7GA 4DTIA 2ZE5A 3CX7A 1YE3A 1WP9A 1VKHA 1N5MA 2AG1A 1PZMA 2VJPA 2XUHA 2C0CA 3GRCA 3CVWA 1H2HA 2EU8A 3KC2A 4OB8A 2OK7A 1RC0A 3ROEA 3IMGA 5ADHA 3KQQA 4M22A 4EL5A 4PC6A 1W49A 3HUTA 1JI3A 2XKBA 3O21A 4BIMA 3P0HA 1F06A 3HKBB 3IV7A 2A3NA 4HLUA 3RK0A 1BJTA 4D57A 5LSAA 1TECE 3C5WP 4DMRA 1G18A 3ZV6A 1DC7A 1W94A 2GJSA 4G0PA 5FOUA 3UGTA 4W1QA 1KA9H 5EP4A 4AMYA 2OBYA 3IVMA 3PTLA 2PX3A 1Z37A 1TTPB 3CMCO 2R1VB 4E07A 1UZUA 4W8HA 4ZI3A 1WXFA 1EFRD 4QELA 1UJ4A 4UCWA 3MRSA 4EVRA 2YOGA 5DHAA 3CURA 2Y4OA 3IHKA 3ZN2A 2Z04A 2FJUA 2WMDA 5ALRA 3GLTA 5C7YA 1OXTA 2WJGA 3KR9A 1U80A 3GNLA 1QLJA 1FS5A 3FPSA 1GGNA 2G08A 3LWZA 5CIWA 4A8HA 1EP3B 1G21A 4OVKA 1XTPA 4RKRA 3RSFA 4CW7A 1SPXA 4H16A 2ZWIA 4MQ5A 3EXG2 4G0WA 1KNQA 5IKMA 4PRZA 4BFZA 4LYYA 5HM6A 5I4IA 1TX4B 3QEMB 4YUZA 1MW9X 1DC3A 4OSOA 3KAQA 1J33A 3TTVA 2E4AA 4QG7A 1T6ZA 3GJ8A 4NHOA 1Z2CA 4FHZA 3THRA 1E94E 1M6VB 2EKBA 3TLBA 5AXBA 2BDUA 1E5LA 1W88A 3OMWA 3SPXA 3U7RA 3JD4A 1FP1D 1N5DA 5KTKA 1JHAA 3JZDA 5CU7A 1LPNA 3NG1A 4RFSA 3U19A 3LDFA 4INAA 3UWPA 1O6FA 5BSKA 3N76A 4OGKA 4DXAA 2XEXA 2B1GA 3WYAA 1PR9A 1ZGJA 3BHMA 1UPXA 1N2BA 3R5TA 2ODAA 2R6ZA 3GR6A 2IYWA 2PZEA 1XALA 3TYXA 1XL0A 1OJLA 4LISA 1NPDA 5EKSA 4ZVSA 1RPZA 4Q66C 2Y6VA 2J9FB 4WA8A 4D41A 2Y66A 3QM1A 3LKDA 4UDXX 4U7HA 3WGLA 3PHBE 2INGX 1HZZC 4W9NA 1Z0FA 1CUXA 1OPRA 3VMMA 4TT8A 4BRZA 1DIAA 1GP2A 3QXJA 5JDIC 4BPBA 3P2IA 2V0NA 3KCNA 4XQ9A 4AX4A 4U7TB 1U5CA 1WUYA 3Q2KA 1IZYA 3H19A 1TKRA 3E2MA 4C4OA 4LRYA 2BFAA 4AP9A 1D2RA 1FY2A 3ODPA 2DXIA 4J3NA 5JSFA 2BP7B 3PHIA 4NXNB 2WHEA 3AHEA 3HKCA 4WBXC 3LOUA 3OX1A 4TN1A 2CCJA 1D03A 2GBPA 2LV8A 2P4UA 1V6AA 3COZA 2ON6A 1TDJA 3S2GA 3F8TA 3SS9X 3WL7A 5GONA 1UJNA 2QRLA 3SDSA 3H0EA 3BE4A 1OXVA 1XKXA 3B53X 4GGMX 4FS8A 4CM9D 2XKAA 3RIGA 3SU8A 4AM8A 1QORA 1GFZA 4BCCA 2BONA 2X6TA 2G04A 4IVPA 1RI1A 1Q1NA 3PE4A 4P5EA 2D1RA 2RIRA 4WLOA 1XD9A 2BGJA 3HS3A 3WIBA 4CM3A 3WO0A 2FOLA 1N2GA 2EYUA 4G5FA 5JS1A 3IKLA 4MAMA 3KELA 1KDZA 4QDUA 3LKBA 2Y05A 4IUBS 2WTBA 2WY2D 2QNIA 5I7AA 3TTWA 3B82A 3WNZA 1RPTA 3EPLA 2PKCA 1AD2A 2ONKA 2FPSA 2VT7A 3NAMA 4OIFA 5L4LA 3RYCA 4V0NA 3ZWDA 1BFDA 2EJCA 2PQ6A 4FMCF 4N5MA 4MDEA 1HLDA 4WJKB 3L8HA 1K8QA 5ESWA 3PCTA 4FDTA 4RELA 3O2NA 1GM5A 1KEEA 3TRKA 1IHYA 5EINA 3T5GA 5AHKA 3UANA 3WXBA 2OCBA 2IYAA 2J0UA 1KH1A 1PEDA 2CHVA 3OQJA 5AOVA 4Z0HO 3B12A 1Y4AE 5FTKA 4QOHA 2REXB 1W59A 4D56A 1G7TA 3W8EA 4C3OB 2PKQP 5SZKB 2W93A 1S89A 1IIRA 3OICA 5B2ZA 1JR3A 1Z8NA 1ZIPA 3N74A 4NE9A 3JQBC 1GZ6A 1CE8B 1V26A 2YL2A 2XVAA 3RKUA 1S6YA 3HYLA 4IGFA 4QBTA 2ZZKA 1YBMA 3W79A 3UUGA 5FFNA 4RTRA 5A4DA 1MIOB 5LA6F 1LRKA 5HF6A 1WXEA 4CMGA 2WJPA 1ECJA 5ERYA 5T41A 5AM4A 1IHDA 4GYJA 3MOIA 3I1YA 4CL8A 4EYEA 1KQOA 3QU4A 5K3SA 3FYDA 4TTTS 3W8DA 2XUJA 2RGWA 2G71A 1DC6A 3R5HA 4G1BA 4HXEB 4YJKA 1II8A 5AOCA 5A1TA 2CJXA 2GOYA 4GOXA 5LQCA 2C2HA 3CH6A 1VSTA 1XXHB 2XR1A 5CT8A 3S5JA 2PE5A 3UFXA 5FI3A 2OZLB 5CA0A 4EQZA 5B1DA 2H06A 4JITA 4R0NA 4RWZA 2WQ6A 2UV8A 2WIAA 3DHVA 5HJEA 1M10A 1CZKA 3DGEC 4OSEA 3K6RA 4HKTA 2HA7A 1P1CA 1SKYE 2JGKA 3M1IA 1CJTC 1Y0BA 3GFFA 3B6EA 4J7XA 3WICA 4ACBA 1E0KA 5SV2A 3W5HA 1ABEA 4LRSB 4LBZA 2QD2A 3DDNA 1NHGA 1Z2NX 1Y48E 1FFBA 4D5EA 3B78A 3F49S 4X1IB 3W9BA 5DZSA 3HJRA 5BPFA 4RD0A 4F7WA 1PL6A 3FNRA 4PAOA 1IEQA 2FN8A 2QX9A 3W0LB 1MH9A 1IAQA 5DDIP 5ESDA 1XPJA 2PX2A 1SQ0A 2W22A 3L7MA 3EIUA 2ZYWX 1RAEA 4CDRA 3C8UA 1C7EA 2XXJA 1JFFA 2H4JA 1O0CA 3BPSA 4LDZA 3I6BA 2WJZB 2WUGA 4FR5A 1OA0A 3O1IC 4TL9A 1DKOA 1O57A 2OHOA 5DNVA 1QV7A 2FMUA 3MJRA 1O0SA 1XA4A 3EH2A 4Z7NB 1I4OA 1X15A 3DE2X 4D5GA 2OWDA 4L73A 3K4PA 1AKRA 4U2FA 2C29D 5D84A 1SOVA 4CBVA 3VAAA 2ZG6A 4RIEA 3MWJA 2QUKA 4OG2A 3H0KA 4BQNA 3IBYA 3R7WB 2YHBA 4YJDA 1JBKA 3VU1A 1ZGGA 2O2ZA 2B8NA 2IXEA 2JJ2D 3SBEA 8ATCA 1UF9A 1Z0AA 4Y0NA 1A2QA 3V42A 1YRWA 1RBQA 4UEQA 2IYPA 3WYFA 3A1DA 5CLGA 1SKBA 5BWLA 1WNFA 3GPBA 4KI7A 3WAJA 5LMNB 4OXIA 3VKGA 3GAFA 3HCAA 4OAOA 3EIWA 4YT2A 4J8PA 4B6FA 4H6XA 5JAMA 1Q1GA 4MRAA 1OPXA 1KPGA 1E2UA 3PR1A 1OU0A 2JF0A 3FNIA 4HB0A 4PU0A 4XM2A 4ZGWA 7GPBA 3BN3A 4FWTA 1MV5A 2H7VA 3QRWA 1F5SA 1H4SA 2TRSB 4RY2A 1NU6A 2ZE8A 5ALQA 2QU7A 2H92A 2QHXA 2GSWA 1CBUA 3ENVA 2VJCA 3GU3A 1ZZGA 4IJKA 2OLKA 3JWJA 5AIAA 1WY7A 1Z82A 3ZS8A 4KOAA 2D5AA 3MD9A 4ZPJA 2X2EA 2ZYUX 2A5JA 2CXTA 1I4DD 2AFIE 1DAEA 3B7WA 3MM4A 3F5MA 5GAJA 1UBGA 5KHLB 2J67A 2OO5A 5CK5A 5TRTA 2ALJA 4NH4A 4MTLA 4LZWA 4CLEA 3QFCA 5FV7A 5DRYA 4YCDA 3ANNA 4H7PA 4MPJA 4JR0A 3G6KA 4JK3A 1CPYA 2XD9A 3LT2A 3VISA 2O50A 4UZFA 4ZYZA 1PG0A 4RF4A 5KNBA 3FGPA 3JTMA 4JB2A 1JG3A 2VDNB 3FUVA 4D43A 2ZW9A 3FVQA 2EFDB 3NTRA 2ZIXB 3U09A 1D5CA 3VNRA 4B7ZA 1JIJA 1S2OA 2UDPA 2BMDA 4AW9A 1Y8CA 2QP3A 4QGHA 2DWPA 3S29A 5CD1A 5ALVA 4LX0A 5DMXA 4F9FA 3MT8A 4K6HA 2EP7A 4TL6A 2HMUA 2UZ1A 4DDKA 3UPTA 4AQYB 1HFKA 1I1QB 1NLFA 1XLTA 3HWSA 3E61A 3IR6A 3R0QA 4JSYA 1Z4QA 3TLYA 1NXOA 4PX3A 3AVPA 3H5OA 4PBTA 4OHYA 3HABA 3UCEA 5L9AA 3M6XA 1A8UA 1SUBA 3KKKA 3U7GA 2WE7A 3T8YA 5A9TA 2Q99A 3QBEA 5EQTA 4BFYA 3HB0A 4JP5A 4WQMA 4L8VA 2UZ4A 1KAQA 3T7JA 3CE9A 4OHVA 3E4CA 4PLWA 1NJSA 3OJOA 4UU8A 4ZODA 2GXSA 2QQEA 4JNKA 4XOIA 4M1TA 3VO8A 3FHJA 4BUCA 3GJZA 3SSAA 4LSGA 3UK2A 2C5LA 3RS7A 3WZMA 4J7UA 3ROGA 1AXRA 2HSEA 2IY9A 2JIBA 3AXTA 4UTPA 2IYFA 4H59A 4ZVOA 1Y42X 1RXYA 3N28A 3NTUA 1V7QA 2IYUA 1CJSA 2I1QA 1R6XA 4OUKX 2EBHX 1WETA 3AG5A 3TECE 3CF4A 1C3VA 4TKZA 3PWTA 4YWHA 3GGPA 4NONA 1Q17A 1RJFA 5KWVA 3KT3A 5FFMA 2NSJA 1GQFA 2E9SA 3LBNA 1TUGA 5LR6A 2A78A 2WG1A 3VNVA 4DDUA 1P1IA 1KEWA 4NAHA 4IV8A 5FLKA 3M5WA 1W25A 5A0TA 3GCXA 3KSRA 4NZYA 2XOKD 3QE3A 3HXLA 4MUGA 1Z4LA 3TH5A 3FHLA 1PVOA 2VVTA 2I4MA 3LT0A 4QPJC 1U9JA 3FUWA 3KWLA 1JG1A 5BORA 1JXAA 3A14A 4PCLA 1NMZA 4YACA 2A9FA 4D4KA 4A10A 2GN0A 3KDSE 4XR4A 3T0FA 5I7EA 4Q01A 3NORA 4U6NA 1J8VA 2Y6UA 4E4RA 4NABA 6PFKA 1O96B 4MW7A 4PCAA 3QTBA 3WIEA 1H1LB 1XPOA 2C7QA 4OHCA 4ZN6A 1ZVMA 1FW8A 1N2OA 3G85A 1B00A 1IFXA 3P20A 4R1MA 4XQGA 3JYOA 1KZ6A 2ZJ1A 1GCUA 3CEPB 3CMMA 1L5YA 2R2AA 1C30A 3F6SA 1LK0A 3RWMB 3LSYA 5A0FA 1OLXB 1Y1LA 2GARA 3WLSA 4E5YA 3GIDA 1FCJA 2Q8QA 4ES6A 2A4MA 1QUFA 4RJKA 3ZG6A 4TZ6A 1IQRA 4LJAA 2BBOA 3FBWA 2UU9B 3HUFA 1QAOA 2PXXA 2WOJA 1T8TA 4E6EA 3MHTA 2ZI9A 3DHEA 3RTDA 2R86A 4FE4A 3W2FA 4PWZA 1PWXA 1NV9A 2ET6A 1NT4A 2GCEA 5T3YA 4G6ZA 4X61A 3ZGLA 2X2OA 1K89A 1HA3A 5AW3A 3GCWA 2H0RA 5AYVA 2I4RA 1OXBB 2XMBA 4PYKA 2DTDA 3ZUPA 3IC5A 4EY6A 5CB0A 1EWYA 4L5AA 2D1FA 3UA4A 2VLIA 1AO3A 2CNNA 2YJNA 1SUIA 3W6PA 3AL0C 2XNCA 2RCYA 5NLLA 2AD1A 1RP1A 4PSKA 2K7ZA 2Q8PA 2ZRHA 5FBQB 1M8PA 2CNWD 4U7PB 5AHXA 3MTAA 1RQ2A 1N6IA 1PS0A 3EZNA 3HEMA 4IZHA 4XX0B 4PYMA 3AIIA 1BMFD 1S7GA 5FLYA 5K2MA 4OGGA 5DTMA 2HHHB 1KFJB 1RHJA 3V4ZA 5BVGB 3D8SA 1C4OA 1RR6A 3PHHA 4ZC8A 3IOYA 5C1BA 1UMDB 1ABBA 1I2CA 1Y7LA 1GFIA 3V4RA 1BXRA 2QTAA 3RUPA 4XRRA 3EFOB 4J0DA 4HFJA 2OXTA 5J63A 5JHHB 1FU8A 1AF4A 2GDJA 3ESRA 3ROFA 4E5MA 3U7FB 2XBUA 1WPXA 1RYDA 1CUIA 2CXPA 3GFVA 5CVUA 4BJ6A 3U3JA 4PZCA 1L5FA 1NVWQ 4BEVA 2CZGA 5ES4B 2QVYX 2VC2B 4JU8A 1T5DX 4LBVA 1C0IA 2NYAA 1ZSNA 1ZUNA 2QNBA 1Y8ZA 4MWGA 1UAYA 3ZTYA 2Q5FA 3OE7A 4MRPA 4O8ZA 3SJ7A 1CRPA 1SC3A 3DEZA 1ENZA 2Q8NA 4PAMA 4TMXA 2H3EA 5FPPA 1E9RA 4KW7A 1X7YA 4CIXA 1XRJA 4RYDA 4CM5A 2L42A 3PYLA 4GOJA 3CR8A 3K2IA 5DGCA 2Z2ZA 4DIBA 2WLTA 4EHAA 3EZYA 4IX1A 4DG8A 3QKUA 3DLAA 5B1YA 4KPEC 2QGZA 4UUNA 1Q1AA 4M98A 3OCCA 2OC4A 1QE0A 4X6YA 1R3DA 3VR5A 2XVMA 3RSZA 1SCDA 4E1BA 1KQ3A 4IOJA 5JMWA 2PFGA 4BZZA 1JL3A 4RKFA 4R40A 3DBRB 3S27A 4BRWA 4BNVA 1WHTA 4QASA 2PH3A 1Z25A 4QUKA 5E2AA 3IP1A 1Z7YA 4HH1A 2ISSD 2VRCD 4BB9A 2Z09A 3IT0A 4RDCA 2GF2A 5DGIA 5C18A 1U81A 5FWYB 3O7WA 1BROA 5BSVA 5FHQA 2EFHB 1XROA 3O8OA 1Z0UA 4AJOA 2GK3A 2OHIA 1A4UA 4RMNA 1DWPA 2NG1A 3RVOA 4UVGA 5GY7A 1ZXBA 1L5OA 1GGVA 4R8SA 4G85A 2NUPA 2PS0A 1XAJA 2P68A 3AR9A 1VECA 3Q7QA 1X3SA 2J3QA 2J59A 1D2EA 1P7ZA 4ME6A 2I9PA 2PCJA 2X1MA 2ZTLA 3ZU6A 4PN7A 1ADFA 3SKXA 4TXJA 4PPGA 1WZIA 3BAZA 2C3PA 4JYPA 4NOKA 4P80A 2HXGA 4HYTA 1PQWA 5COAA 5DHSA 1IB6A 4V1CB 5IT0A 1HNZB 3GJYA 2BGRA 1FLDA 2WVGA 3T7DA 4FWIB 1IDN1 3UMVA 2D1YA 1ORIA 3QOYA 1KC1A 2X4GA 3CEHA 4JYCA 5SYNA 4HWGA 3UGJA 1UFVA 1XVLA 1L4LA 1DBIA 5LZ8A 3ZGYA 3QSGA 1ONSA 3RS0A 5FDFA 3ESYA 5KYUA 5KYTA 5B3LA 4W1RA 4MYCA 1B3BA 3GLVA 3WLQA 3V1UA 3CZ5A 1TGYA 3S44A 4WINA 4I5FA 3AHGA 3JATB 4NCBA 4PFJA 3ORRA 3R0JA 3MIIA 3QFRA 3LO8A 1N6LA 3B20A 3ZZ1A 3WLRA 3GK3A 5DN9A 2H9YA 5EIHA 5HFAA 1IMJA 1ZU4A 5JALA 5DLQC 1SCUA 2CSUA 1Q2XA 3FPAA 2W90A 4L76A 4YDRA 1M0EA 3RC8A 3T3HA 1JKMA 3AWDA 3ZY2A 4JA2A 4AQ7A 4AO7A 1M5RA 3SKVA 5B3JC 5DX0A 3A11A 1SOMA 3DVSX 4H6PA 5JS2A 4CCYB 3DZKA 2DFLA 4FVTA 1UZLA 4D74A 1WF6A 4ACAA 1U3TA 4KVAA 1PGPA 3KVYA 5IC6A 2XODA 4JZYA 1I51A 4JNCA 2WYWA 4KMOA 1WHSB 3MTQA 4WD3A 2ZZNA 1GNQA 4YDSA 2FV8A 2BJVA 2WU3A 3MINA 1WUTA 5C4GB 4G4JA 5EJ2A 3UEOA 1B8VA 10MHA 5E3HA 5DT2A 1FVHA 4LSMA 2BR3A 4MWTA 4UEOA 1H22A 2I67A 5TMEA 4F84A 2P69A 4JLSA 4TV9F 2O0JA 5C1PA 1ZCFA 4IR7A 3EF0A 1BCRB 3UMFA 5H3HA 1CHNA 1YQDA 1TEZA 1QF7A 5CEEA 1N5RA 1J0EA 2VQDA 3Q3IA 2Z58A 1QIDA 1SXJC 5BSMA 2V6JA 3UN1A 5HK9A 2VSQA 5AKEA 2EL7A 2BW0A 3D1LA 2NUAB 4N3BA 2AC4A 1DSSG 4CM4B 5CLJA 3KPYA 1VM6A 4Z5XA 4L8GA 1XZAA 4HQ6A 5TB5A 1YU9A 2AEFA 4QULA 1RAFA 5HJ2A 5TQVA 3W6ZA 4ADSG 3BF8A 4WCVA 1XZQA 2C1ZA 1TAGA 4J3FA 4YRRA 4KUHA 4HWPA 4ARBA 4OA8A 1BQEA 2XA2A 3RAEC 4WZBE 1YRYE 1GA4A 2P7IA 4MWSA 5DM70 2FPGB 2WWTA 3BM5A 2JAWA 5JDCC 2XMQA 1YVRA 4MNTA 5CT5A 1QYDA 3WLTA 3D4LA 3PJGA 1GR0A 3GRYA 3NR2A 4YRFA 3HCOA 4CG0A 4WLVA 3TD9A 4RZIA 4G0UA 1P6UA 4F0JA 3IE0A 3EVEA 4RJIA 3TVDA 1ZN7A 4RK5A 1XMSA 4P3XA 3KDAA 1F4PA 2X15A 4W7SA 2DAPA 3M1LA 3WSWA 1W29A 2R5WA 2RAUA 2I03A 2NAFA 1E8DA 3VZQA 4FGWA 5G3YA 4BIIA 1XA0A 3T3PB 1MO5A 2Y68A 1ACMA 1UXKA 2SHKA 1XDBA 1VMDA 4UMFA 3VKFA 4I8IA 1S2IA 1SUWA 2A1IA 2JD0A 1QH0A 4LCBA 3JRWA 4MKZA 4QEZA 4KB5A 2FP3A 4LVUA 4J90A 3EZGA 4ZAWA 3DNFA 5TJHA 3I0ZA 4BP1A 1O8BA 1TCCA 2I5PO 2VSFA 4NOLA 3W3AA 4YJ3F 3DTVB 3AKDA 3AR3A 3UKDA 3SNKA 4ZWNA 4B9AA 2AG0A 3HV0A 4QA9A 2VR1A 5JZMA 3WYNA 3UK6A 1P6QA 3PNOA 3E35A 1NZFA 3NVDA 3PPXA 4MRRA 4PRKA 4R9RA 5A5FA 5K0GA 2H1VA 5K6AC 1D3AA 2AZMA 4PYQA 2RHHA 5CFQA 5ADVA 1FQWA 3L5KA 1B26A 1OE0A 1Z7BA 3LZCA 3OEWA 1NAIA 5FEMA 5TVKA 2ZAMA 2ZYTX 4XARA 2XOEA 4Z99A 2J4CA 2CEKA 5A6SB 1U0OC 4RWEA 4YDQA 1E1KA 1L1QA 3ZZNA 4KE6A 3BHNA 3R5FA 2QENA 4KN9S 4BMCA 1QRSA 5DP2A 3P5BA 1BOFA 1NQXA 2FE4A 1FX0A 3JU3A 3QWBA 4NCIA 4PZDA 4C7VA 2Z6UA 2FW7A 1ULUA 1TT5B 2ODWA 1FLNA 4OHKA 4ZQHA 4EARA 1JA0A 4TMVA 1D2GA 2Z5LA 5ED0A 3PC4A 2Q5IA 4F3CA 2PZ8A 4KGZA 3HBLA 4YJHB 3ZVKA 4G97A 1I8TA 3FOAA 2AFHE 4BYGA 1THZA 4RKYA 2QROA 4LAFA 3WA7A 2AZXA 1A5ZA 2NT3A 3KYBA 2V7UA 3ZV3A 4FLMA 3NNNA 1Z56C 2V97A 4D0SA 1GRQA 3UMBA 3QSYA 3F47A 4DA8A 1WXWA 2UXDB 2GEBA 4XRGA 2A59A 1T5IA 2WPDA 4GQBA 2X8JB 2WJ4A 1QIIA 2A9QA 3EVAA 3RYIB 1NG9A 1H6BA 4COOA 2C2XA 1TJ4A 2VAMA 4LTDA 4B4OA 2BFDB 2HMTA 2BFBB 2WWGA 5C37A 4HNHA 1TCUA 4P7GA 4R1OA 2BMAA 2XUPA 3H99A 2BLNA 3C4JA 3JQFA 4RHUA 1Q0LA 3L0ZA 4XTCS 2VCYA 4LXHA 2FFAA 4GUDA 3K4QA 5HCUA 2BMWA 5IHPA 2CLKB 2GA9A 2X9NA 2W7TA 4ASUD 2RHBA 3V7UA 3ORSA 3X0DA 3T9AA 3ZXSA 3HMKA 3GLQA 3JD2A 4L0DA 1COZA 2DVMA 2CLSA 3PJEA 3BSWA 4FE7A 4C6RA 6NULA 3INGA 3MUOA 2Z1MA 3G8AA 2NM0A 1STOA 1VB3A 4OXNA 5LDGA 3TKLA 3V2UA 1GWNA 2Q4OA 3HKDB 5JARA 3LFTA 4GWKA 3DDCA 3VYWA 1VJ1A 1N2ZA 3DAOA 3H97A 4G4IA 5ETJA 1OWLA 3PX2A 3FCUB 1MU0A 2D7JA 3TJRA 3TJMA 4E7PA 5IH7A 1NXPA 1NONA 5FXMA 2B4KA 5F1PA 1HNXB 3OUUA 2J5KA 3U80A 1HDRA 4WK0B 1VCOA 2BF4A 3SC2B 3MGCA 2AFIA 5KKAA 4QGSA 4RJJA 3PNLA 1MO6A 1PT6A 2GBFA 3PB3A 2PTGA 5T3UA 2DX7A 4HATA 3D43A 2HYIC 3DWEX 2IP4A 3LYUA 2OCDA 3PICA 3DKVA 2ZQYA 1UJCA 3SG0A 3T1OA 2AWNA 4JY7A 1POXA 1C3LA 2DUNA 2P27A 1K6EA 4MWDA 5EESA 3RS3A 5FJJA 3TSAA 4XB1A 5K0LA 4HQOA 1I3LA 3V1YA 1OB5A 5F98A 1W93A 1KI6A 3BQNB 2BSQA 3G0HA 2I3BA 3VGJA 4PBSA 1B2RA 4B4KA 4OI0A 5KEIA 1BCSA 2GFHA 3DDHA 3EVCA 1OAOC 3K6SB 2G5PA 2WAYA 3N8KA 5KVQA 2QOEA 3SR4A 4J1QA 4FILA 2MR6A 2PBRA 4B2YA 4ZO6A 4YMIA 3WE7A 1ZIXA 2QX8A 4F5YA 5FAKA 3C7TA 2O59A 4Z4QA 3DW1X 1EP1B 1E5VA 2DOKA 4KPUB 4OLBA 1OZHA 4JLVA 1LRJA 2R8OA 1YQ9A 4UDYX 3FUCA 2AI1A 3ZH9B 1KYVA 4R8KA 4BFSA 3AC0A 4B09A 4C87A 4RETA 4MVXA 2VQ3A 3X1YA 2R85A 2CKDA 1U5BA 3WYEA 4IJWA 2Q5JA 4QBGB 4YP1A 1Z08A 2OHJA 4MV4A 3RHFA 5FNVA 5HQ3A 4OJTA 5H80A 2P62A 3KT8A 3TZLA 3ZQ6A 2V98A 3BDAA 3GLHE 2NU7A 3N2KB 3R0IA 4IDOA 4EW1A 2YVAA 5HHTA 1E2QA 4B3IA 1KVQA 5DFAA 3CZ9A 4LJ4A 4LI3X 2HSGA 3F3MA 4F2WA 2YN2A 2O8BB 3QE4A 1OYWA 5H70A 3IDAA 3HPQA 1JRLA 5LQMA 2PX8A 4CQMB 3ZE2B 3GJRA 1T1GA 3IJ5A 1V3QE 5CM8B 1Z45A 1EX7A 4B73A 3ONVA 3T5PA 2IP2A 5CR9A 1NF3A 5G53C 3RD5A 3AFIA 5HFNA 2P0AA 3H3XA 3VU9B 3T3OA 1GA1A 2FCAA 2QLNA 3IKVA 4FONA 2FFRA 4HLDA 4BCDA 3NZEA 2WRZA 4Y7DA 2GEKA 4GLLA 4HNTA 3O73A 1VIVA 2TMYA 4Q3AA 1AG9A 1RXSA 1ZUHA 4UXJA 3W4IA 3PFKA 2Y67A 1QIMA 2ZXFA 1ILWA 3P0JA 1GPYA 3TOCA 3EXHB 1NDHA 1JDTA 1K5DA 2OMEA 2GCIA 2IYZA 1T8RA 1X13A 2NO1A 1ESCA 3B1YA 3OKPA 4BP9A 1U90A 3UBMA 2K5UA 3OF5A 4TWIA 3G1WA 1YC5A 2WIKA 5AOAA 3FKJA 4RZQA 5FOWA 3CH4B 1G8AA 4I1YA 4YB8A 2RDMA 1R6TA 1M5TA 1WZEA 2GA8A 3SZ3A 3WNVA 3G8BA 5AP9A 4GECA 1XNHA 2PSDA 3NBXX 5KMGB 2V4ZA 1HL3A 5KCMA 4EDHA 5C7IO 3KD3A 1DI0A 4ZREA 2IH4A 3E9DA 2DTEA 1EDBA 4TRNA 5LOVA 3V4OA 2V03A 4E14A 1T5SA 1J2UA 1VMIA 4Y2GA 5KKNB 2XGSA 3FWKA 4LGVA 5EPOA 2G25A 1NZJA 1RLMA 2X5KO 4LHXA 3INNA 3WBBA 5ERGB 1F38A 4D4JA 2E1RA 3KUKA 4KJZA 2JGNA 2V7WA 5HF5A 2YWDA 1KDYA 3P45A 5DWQA 2AW3A 4BO7A 5K8LA 5CXXA 4PZ0A 4G5OA 721PA 1PDOA 1DG1G 3A32A 3KQMA 3QV1A 3MEQA 4LOJA 4UUPA 1Z4OA 4X45A 4RULA 4Z4FA 4B8ZA 2C2OA 3ZIDA 1ADBA 4PHTA 1EFRA 2ZRQA 3CT6A 3U26A 4JBYA 4P7FA 3ZXXA 1ZVVA 1UKCA 2VEOA 3O94A 3KS9A 1GNRA 1PQPA 5TPZD 3UAVA 1Q6ZA 1E1YA 1GNVA 5FBWB 4C0LA 4YIHA 3DCNA 2C7GA 1ZMXA 4X60A 1QHXA 3H86A 4BE7B 2GVZC 2YHIA 3I4FA 1RYZA 3K72B 2YXNA 4HXFB 2GERA 2A0UA 2XB6A 3ANSA 3P4YA 3JWIA 4ENRA 2JLAA 1V45E 2HZ7A 1E58A 1OWOA 1BDMA 2E5LB 2WABA 1IVSA 3EUAA 4Z0TA 2IBTA 2QLJA 2IFTA 3ABSB 1MAAA 3T4XA 5EQFA 1NPYA 3TLZA 1VRCA 1V1RB 3L6BA 2CMKA 4GX1A 4R2JA 1KYTA 3EQ9A 3EGDA 1Z33A 4BC1A 1E6EA 1NHWA 2AHRA 3UJNA 1MP0A 3OOSA 5IVHA 5DYIA 1NTRA 1T5LA 3EPPA 4D42A 2HHJA 2X0KA 1PD0A 1RI5A 1M2NA 2IHKA 1PNOA 3HRKA 4S1VA 5KVCA 1Z5NA 1EWVA 2X0JA 2YS6A 3RSHA 3X1XA 2EKQA 5C81A 4W1SA 1TEXA 3DFFA 1DP4A 5EE5B 3QWAA 5CBPA 4ZHQF 4G41A 1W85A 3E5NA 3WFZA 4EJSB 1U11A 3R9KA 5LJIA 5JNUA 1IHXA 5EJMA 3WNBA 1JE0A 2HSJA 2Q3HA 3O2QB 1MAVA 1PT7A 2CDBA 3K9LA 3T12A 4INJA 5EWMB 4GMHA 3EW9A 3PQ5A 3SLRA 2PXCA 4HX9A 4R6WA 2PQ0A 1BXGB 2A86A 3VR3D 1JQDA 2PRJA 1E1CB 4HAXA 3RSOA 3DULA 3X2SA 3Q9UA 3SEZA 3HU3A 2N47A 3OZEA 3FCAA 4LRUA 5K8VA 2H4YA 2I1VB 1G6OA 3I45A 2NW6A 4Q6WA 1LLFA 2Y0DA 5DEIA 1N25A 3FYUC 4I19A 3Q6NA 1LNSA 4JT4A 5FL3A 1CY4A 3LX4A 1RLJA 3OHMA 3EWNA 3OY7A 3TIFA 3TX6A 1N1MA 2DSTA 4BXOA 1IXKA 1NUUA 1UJ2A 3LVRE 3MGBA 1KE2A 3D81A 1SM4A 1SMKA 2PWPA 1QH9A 1WSAA 4EK9A 3FUUA 4D9EA 5CTAA 3HB1A 4KQ2A 1YE5A 1JXMA 3L1HA 3NTQA 4R2LA 4L75A 4B79A 5J4KA 3WLMA 2PMFA 3FVWA 4F97A 1YS1X 2ERYA 1C7IA 2OXCA 1EXDA 1OBHA 1FBTA 1Z13A 5ULLA 1ZOOA 4ZEVA 4YN3A 4YCAA 3AW9A 2H48A 4MINA 2JLXA 4CEJA 5E6RB 2NUTA 3M9WA 3ZHZA 4YNBA 2B92A 3EB9A 2VDLB 2F8LA 2EZUA 3RIXA 2ZYHA 3GDOA 2FSVA 4JX8A 4JH0A 3QVKA 1U3GA 1WSDA 4DR4B 1BS2A 3TVYA 2IEDA 3VOTA 4DARA 3GMSA 3D7LA 1XSEA 4DKXA 4MTCA 4D4LA 2I2CA 1H42A 5B1EA 4K46A 2DTXA 3DFKA 1QV6A 1SBZA 1AMOA 5HDQA 1LLCA 4BJ3A 5FHRA 1QG2A 2CJWA 2VH1A 2KBFA 1ZH4A 2ATXA 2JKZA 2PLFA 2QAIA 4NK5A 3QK7A 3FSGD 2PVCA 4GP6A 2ZPAA 2A94A 1G6Q1 5E4FA 3VO2A 5JXIA 5K3OA 5IM4F 1YQTA 1B6SA 1AB6A 3GJQA 2C07A 2ODQA 2KQUA 2H08A 1CR4A 2FFJA 1Z7GA 3NDIA 1XJWA 4GWGA 4JUBA 5CNIA 5K3EA 1LD3A 4JXKA 4GQAA 1R16A 1LBQA 2A35A 1FTYA 4W9RA 3CLTD 3JASA 4JVOA 1DT3A 4GX5A 6CHYA 2FEXA 1NNEA 3OKCA 4MUXA 1M0TA 3CISA 3DHYA 4W5RA 4CM7A 2Y71A 2QE7D 3V8QA 2D7DA 5IC5A 4NFYA 3VYTB 4JBLA 2XWBF 4ICIA 2E4WA 1OLUA 2ZVQX 1U6JA 3A06A 3MJ4A 2MJLA 1WV1A 4HX5A 4K8OA 5LBTA 4I4IA 3V7WA 4CEHB 3A6HA 4X41A 3G0OA 1Q1QA 2DHRA 1GT91 3CYFA 5CT6A 3IE1A 1JLHA 2BRUA 5GADl 3HJAA 3HFJA 2F43A 1CVRA 3MOSA 1NQUA 2O6LA 2W2MA 3GN1A 3V9PA 1CCWA 1WBDA 4MHTA 5AW2A 1U8EA 3RPEA 4RHXA 1XJ0A 1J1UA 3ILVA 4KEAA 4D98A 4F4CA 4ZOBA 7ABPA 2OZKA 1WU7A 1DOHA 1NE2A 4MGZR 5H9WA 4TQGA 4CUZA 4URUR 2Q4DA 1G2QA 1PNQA 3UYKA 3NBFA 3VJMA 3JZMA 3A1SA 2EDAA 1RD4A 3TMYA 4B3JA 3L4BC 5THKA 2H3HA 4BAZA 2MYNA 3M8KA 4NBWA 3UENA 2XTJA