3J81N

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j81N02
1N34O 4DR7O 4DR6O 2UU9O 3OTOO 4DR2O 1G1XB 1I94O 4DR3O 4JI3O 2UUCO 1HNXO 5LMNO 3SDLA 1XMOO 1KUQA 2N74A 1FJGO 1FKAO 3R66A 5LMUO 3M8AA 4DV2O 1IBMO 4DV5O 4LF9O 4DV4O 1X59A 1N36O 2HHHO 4OX9O 2LW7A 4B3SO 1AILA 4LF4O 4OPHA 3O65A 1HR0O 5IT9N 3J7AU 1A32A 2UXBO 4JI1O 4DR1O 3T1YO 4DV3O 5FLXN 3RT3C 1N33O 1R1BA 4JI4O 5A2QN 4LF6O 4DUZO 2DOSA 4NXNO 1XNQO 2DJVA 4LF7O 1AB3A 1NS1A 4JYAO 4AQYO 2F4VO 4X65O 3J80N 4GKJO 2UXDO 2FKXA 4DUYO 2E5LO 4LFCO 5BXZA 4LF8O 4GKKO 1XMQO 4DV0O 4B3MO 1XNRO 1J5EO 1FYJA 2Z0AA 4JI6O 2VQEO 4B3RO 1HNWO 2VQFO 4LFAO 4DV7O 5BY1A 1HNZO 1D2DA 4B3TO 4A5UB 2UUBO 4OPAA 3JAMN 3T1HO 4X62O 4NXMO 2AGAA 2UXCO 2JRIA 5IWAO 4K0KO 5H5NA 4LF5O 4DR4O 2ZKOA 1IBKO 1F7YA 4LFBO 1N32O 4YHHO 4KHPO 3J81N 4JI5O 4JI8O 5LL6Y 4DV6O 2ZM6O 4JI2O 4JI0O 4DR5O 3F5TA 5BR8O 1DK1A 1IBLO 4JI7O 2UUAO 4YY3O 4DV1O 4X66O 1R6TA 1XEQA 4JV5O 4X64O 1YZBA
chains in the Genus database with same CATH superfamily
1S72V 4GCZA 4TSFG 1VQKV 5TISZ 1UFIA 3C3SA 4IGGA 1HNXO 2QWNB 3W7TA 3S3XA 5B1NA 5CA0A 1YEWA 2KKWA 3K08A 4JZGA 2D2CB 2A0LA 2YC0A 5LXTA 3FB6C 1R6KA 4CZZA 3IC7A 3RYIA 3PN1A 4EKWA 2R9AA 3FFQA 3RT3C 1NI8A 4MTOA 1Y66A 5FPRA 2YXLA 1XNQO 2DJVA 1NS1A 2UU9B 4TWKA 3CJHA 3K58A 2UXDO 1YTFB 1KECA 2AXTZ 3SJBC 1MZEA 2EIMB 3L73H 2LQTA 4NKGB 1DTOA 1FXKA 3TGUH 3L75H 5B1BB 4FLXA 4B3SB 4IL6Z 5CA1B 5JWPA 4GLXA 2GDSA 1EZJA 1Z5VA 2WPDG 3B09A 3T1HO 3T1YB 3CRCA 5EIBC 1H2LA 3D3IA 2VWJA 4WFBV 1QVFU 5KHHA 2HG5C 1AR5A 2EILC 2XAQA 4J42A 1FPOA 2P4KA 2DQ0A 1RFYA 2HHHB 4DV6O 1TUBA 4O4IB 3W7SA 4OGQB 4OX9B 4FFBA 4D7TA 1GO3F 2BE3A 1WNSA 4LF4B 4J7JA 1VQLV 2UUAO 3K59A 3LDCA 3ZHUA 1TVKA 2E75B 1U97A 1O9HA 2ITCC 4Q6GA 1MSWD 1PPJH 2XOKG 3T1CA 4DR7O 2GUZA 4CC5A 3STZC 1KU9A 4P30A 3WG7C 2UUCO 1XOUA 1XREA 4HNAA 3ETGA 4DV5O 4JI8B 4O4HB 2EINC 3TCUA 3JCZA 3W7WA 4CH4A 1D5AA 4RQFA 1BS3A 1A32A 1AVMA 2QTOA 2JEUA 4UB8Z 4O2BB 4LP8A 2B1GA 3K5LA 1N34B 3AK2A 1IDSA 1IXBA 4DO2A 4LWSA 3B77A 3AG7A 3ZHRA 3ASOB 2ZD9A 4JI2B 2DE0X 4J7ZA 4O4JA 4DW1A 2BSKA 3ABKC 3HKBB 3VQXA 4LFCO 5D5QA 4MVMA 1XUQA 4O4LA 3WB2A 1N36B 4X66B 3LNMB 2QTSA 4R8CA 4B3RO 1ROPA 1AR1B 5IYCO 5L3FA 3OMNB 3AK1A 3OM3B 1P7BA 1XI1A 4BIZA 1HNZO 2ZNIA 2Y0IA 3B4SA 3JAMN 1Y6XA 4J10A 3A0BZ 3GWOA 4PA6A 4K0KO 4LF6B 4QNHB 4RUEA 1OJHA 4FM1A 4MW8A 4BW5A 1JQ0A 1EBOA 4EFBA 2ZM6O 3CXHF 4UV9A 2HR3A 2KSDA 1Q6HA 3CYOA 3JARA 1SZTA 2JS3A 3QTCA 4JAVA 1MMMA 2PZSA 3M99B 3BCCH 4PDMA 5C8YB 3KCXA 3CS5A 2E3CA 2ZXWB 5L3BA 1G1XB 2UUBB 3N2GB 1JR9A 1FKAO 1JVMA 4FMTA 3CCEV 1MA1A 3E22A 1XL4A 3QVNA 1N32B 4C7UA 3E8GA 1J5EB 3OT7A 2YXYA 2ZR3A 4JI6B 1E1QG 2DN9A 1K3EA 1AILA 3SR2C 5BR8B 2JS5A 5J2TA 3MHSC 1SZXA 1URFA 1GRJA 4H13B 5H6QA 4I4TB 1DF5A 1P7GA 1H38A 1R6NA 3E8HA 5FLXN 2V7QG 4UVBA 2ODMA 3R65A 2C2AA 1R1BA 4MW3A 4F6EA 4CS4A 4JYAO 3CEIA 1QCEA 2IU3A 1SQVH 4X1KB 3BPZA 3SJQC 1B3QA 3A2FA 1VF7A 4YJ3B 1Y74B 4LF8O 4H44B 3JATB 2Y4TA 1S5LZ 4NTWA 4FM2A 4I9WA 4HYOA 1M90W 2FTKA 1PP9H 5DEDA 1EN6A 1H2KA 3LSSA 2QR4A 2IU0A 3CD6V 4HAMA 5KX5B 2CH7B 3ZRSA 3JSLA 3SGIA 1Y76B 4KHPO 3FYIB 4TV8B 3THOA 3BVOA 4GX0A 3WB1A 3K9SA 3OUFA 1SC5B 1M93A 3HB3B 2DMXA 5CA1A 1K34A 3JD1A 1COWG 2L35A 1XEQA 3K9AA 1F51A 3HPLC 2P6JA 4FLWA 2XAJA 2JJ1G 1KP3A 2Q6AA 4X62B 1RSOB 5KAIZ 2Y69C 4O4IA 1PKXA 1YDXA 1IBKB 1VQ8V 2N04A 3NXSA 2OWOA 1KP2A 2QKCA 5IY5B 4DK0A 2X6CA 4W4KA 3ZEDA 1DGSA 3H1LH 2GTAA 3ZHTA 4B7KA 5LGTA 1S0VA 3B8NA 2IJHA 1Y67A 1FD9A 3ASOC 3ZMVA 1MSDA 1OCCB 2CAZC 3ABMC 4X65O 4LR3A 1IURA 4J7KA 5DM6V 4O4HA 4MVUA 4R50A 2NN4A 2XT9A 1VQOV 3IJ4A 1HWYA 1YCIA 2AHYA 1VEWA 1VQ7V 4J80A 5EBWC 5HFLA 3E89A 4Z1MG 4O2BA 4MTGA 4LFAO 2BTQB 5FPOA 5CBGA 5LA6A 3FB5C 2HP8A 3BABA 4OPAA 4XDLA 2X6AA 1BQ0A 2F1MA 5CN0A 2JRIA 5H5NA 3OMIB 4FVMA 4NXNB 5L3EA 3HKBA 4MSWC 2ZDIC 4ASUG 3ZN0A 4YIPA 3J81N 4AQYB 1AI5A 3S3WA 3CPWU 3CCQV 3JALB 2LW1A 3SJAC 4BW9A 5EZYB 4MVZA 2BOCC 5LHGA 2W0FC 4TOIA 1M1KW 1BHBA 4YJ2B 1AI7A 2DYSB 2ZXWC 3AG3B 3JAWB 2Q68A 1VMGA 2Q7EA 1Z2GA 4DXWA 4TT3G 3FYEB 3QO7A 3BFRA 3RN4A 2WWWA 3AG4B 5LHHA 3E8BA 3ZMSA 3EFFK 3K5OA 2OT5A 2ZDIA 1X59A 1MZFA 2QM8A 4R6ZA 2Q7GA 2HHHO 3OR6C 4OX9O 2LW7A 2GTSA 4TV9B 3D36C 4LF4O 4DYLA 4KP4A 4NTYA 1IBLB 4I55B 1GN2A 4JI7B 1RM1B 3BA9A 2P4VA 4KL1A 4FIPC 3KKYA 1D5NA 4JTAB 3ZX6A 3M7MX 1R3IC 1BE3H 2DWEC 5CBHA 2EIKB 3JAKB 2UXCB 5EBLC 1ZUQA 2CUGA 3TK1A 4WFEA 4B08A 5JCOC 1S5JA 1AJPA 1XMOB 1RPRA 3ETQA 4B7EA 4F6RB 4JGSA 3CRAA 1W0KG 4IYHA 1V54B 4I4TA 5LGNA 2QEXV 1FFXB 3JD2A 2M6YA 4WF9V 5GONA 3FB8C 3SYCA 1D2DA 2AW9A 4UV8A 1CEZA 2ZCEA 1JJOA 4MT8A 2YI8A 4X1KA 5IWAO 1BL8A 1HDJA 3N27A 2NNUA 4YJ3A 3G71V 5JCOA 3OEHG 1Y74A 2F4VB 4JI5O 5LL6Y 3UT5B 4JI2O 2JDIG 2WSSG 4PDLA 4UXNA 3FX7A 4DW0A 1PD3A 2X6BA 4FFKA 1XMQB 4DV0B 4X66O 1XNRB 2K1EA 2X0LA 3OMAB 1E79G 1K97A 2PGGA 4NB5A 3HKDB 4NYKA 1F4MA 1YXBA 5KX5A 3TXQA 2CH7A 1CP9A 4ZIBA 2QKAA 1Y76A 5LMNO 4TV8A 1KUQA 5IY5C 2IH1C 2JJ2G 4LF5B 2IJIA 1S76D 4DV4O 1B04A 3CRQA 1K4DC 1Q5OA 2ARHA 5KUKA 3UQ8A 4JI0B 1R73A 1HR0O 2R72A 3DTUB 5J2UA 2OIGA 3K04A 4ZI7B 1G4YB 2YUAA 1I7FA 1BQZA 2HVKC 4RWUA 1VQ4V 2YIBD 3RVYA 3SPHA 5L3GA 2FMLA 1RSOA 5B5EZ 1SA0B 3ETEA 3D3QA 1BMFG 2EIJB 1I94B 4DR3B 3OE7G 1FXKC 3L72H 2EJ7A 2E76B 1JX9A 4U3JB 5LYJB 1KMIZ 1YIJV 3O9OA 3RYHB 1J5EO 2QE7G 4JI6O 1SQPH 2EZPA 3T4ZA 1EN5A 4DV7O 4CH3A 3H1HH 1WB8A 3OTOB 4DV3B 1Q86W 1NQTA 3SPGA 4JI4B 4DR4O 3K57A 4LFBO 2IBZH 5HFMA 1Q6UA 3JCUZ 2V4DA 1N0JA 5B66Z 1OCZB 4CS2A 1DK1A 3SJCC 5KUMA 5KA6A 4GKKB 3TJTA 1GM7A 1M4UA 1QLEC 2BTQA 2Q4PA 1QU7A 4XDJA 1WN7A 2F93B 4X64O 2IH3C 3K3WA 1YZBA 1TA8A 1OV9A 1THZA 2R9RB 4OXSA 1XHXA 4EB6B 5BMVB 1YTFD 2QSAA 1WAZA 4UFZA 2RN9A 4QPJA 3JALA 3KZIZ 5CB4B 5E1AC 2D3OW 5EZYA 1PNLA 3ABLC 3WFVA 2Q0OC 4FPPA 4D7SA 4YJ2A 4R7CA 2Q69A 3J7AU 4EFEA 2EX3A 1WPBA 4TQFA 2R9IA 4JYBA 4DR1O 3K5NA 1SQQH 1K7DA 4JV5B 4UUJC 4UCSA 5FNVB 3CCMV 3CCLV 4BIOA 2YXHA 4LF7O 1FS0G 4DR2B 5H2FZ 5IE9A 4TUYB 4JAAA 1VQNV 3CC4V 5B3SB 4DR5B 4W4LA 1V54C 4TV9A 1YF2A 1M57B 4B3MO 4YY3B 1IZ3A 2VQEO 1ZTEA 3C3TA 3RW0A 3JAKA 1P4RA 3HKEB 2WLMA 1VQ9V 2XAGA 1AP5A 3MDSA 1ZLZA 4ZKIA 4PHZA 4QIWF 1VF6A 1R3JC 1JMKC 3QF7A 2QWQB 1W2BU 4CH5A 2CTQA 4DUZB 4I0XB 3ZIAG 2IW5A 5DN6G 3I56V 2YICA 4F6RA 1L1FA 2E5LB 2IM9A 2CTPA 1GKFA 3CCJV 4AILC 3RYFB 2R70A 2DWDC 4DV1O 1FFXA 1Q8IA 3AG1B 4KUMA 5CMUA 2Q0AA 4QE9A 4DRXB 1JA8A 3IAYA 3ZHSA 4X1YA 3CSXA 1Y4MA 3HR0A 4FLZA 1OCOB 4WBNB 4NR1A 4K8ZA 4IHJB 1P49A 3UT5A 1KQSU 3L9DA 2JEXA 3ZHVA 3BHPA 4Q20A 4X8AA 2WLJA 1PM9A 4UVAA 1V9PA 3BRCA 4FLTA 1ZL8A 1WP8A 1LR1A 2WAMA 2YIBA 4I9QA 1CXZB 4HZ3A 4NXMB 1YJNV 2HKOA 4NVPA 3RBZA 5CBFA 2LFSA 3MD0A 4JZ2A 3SPCA 4J9ZB 4DUYO 1MNGA 1UPGA 4FLYA 2F43G 3RYCB 4QE7A 3OW2U 1HNWO 4PA7A 1XL6A 2DW4A 1OCRB 5B1AB 2VQFO 2ADPA 3SPIA 2NLJC 1SA0A 1TUEB 5LOVB 3QO8A 2EIMC 2UXCO 2CK3G 4RQEA 4DV2B 4KXRA 1VQPV 1IBMB 2P7TC 2ATKC 4U3JA 5LYJA 1XNQB 1U96A 5B1BC 3FB7C 2B5UA 2LP7A 3GWKC 1GK9A 2ZE8A 2UXNA 2Q73A 2UXDB 3RYHA 5KAFZ 1ENVA 3SYPA 4IYIA 3F5TA 1N0NA 3DGEA 5ITZB 4GX1A 4MVOA 2XHBA 4YXWG 2Q5ZA 1VF5B 2HJFC 4G2KA 5JVDB 3JD0A 2HLDG 5A9GA 4JASA 5KHGA 4X89A 4JI3O 3T1HB 2L6LA 4L8JA 1FJGO 1SKVA 5IYZB 5LMUO 1R3LC 3OGCC 3BA8A 3FKSG 1F4NA 2XAHA 4JF3A 3JD3A 3K79A 3X2QB 4QPKA 1I0HA 2UUAB 2UXBO 1DLBA 1K8AW 4JI1O 4Z1VA 4B3TB 4IIJB 4EB6A 2CGOA 5BMVA 2P06A 4K35A 1H8HG 4DR7B 1JJ2U 4H33A 3CE2A 2RDCA 5B3SC 1T5EA 1NVPB 3UCSC 4UCVA 4GKJO 1M57C 5CB4A 4O2AB 5J9PC 5LP6B 3W7UA 4I7ZB 2ZT9B 2EBOA 3OR7C 3MHHC 4DV5B 2WLHA 5EBMC 5GTHZ 2ZINA 5JJEB 2ZE6A 3UM7A 2PF4E 3ZMZA 4P9OA 5B1OA 2YEVB 3W7XA 3RGBA 5LGUA 5IJ9B 4JPRA 2RMKB 3OD4A 1NVPD 1BCCH 5KA5A 3NR7A 1V55B 3GVMA 3U11A 4MTFA 1FFTB 1OZ0A 3AG1C 3JYCA 1VARA 2ZIOA 2DQ3A 4LH7A 2ZE5A 5L3DA 3HKEA 3L70H 1N8RW 4B3RB 1OCOC 1DF4A 2LO1A 4WCEV 3K03A 2UU9O 3OTOO 1B6QA 1HNZB 5IJ0B 1H2GA 4K0KB 4UVCA 1BZKA 1KD1W 4TQDA 5K1PA 1XDCA 3CP1A 1GMGA 3RYFA 2CDYA 2OTJV 4B3SO 3WU2Z 5GW7A 3HKCB 1TUBB 1VQ5V 3AEIA 3JD4A 3TETA 3T1YO 1LUWA 1H2MA 3CMEV 1F23A 3I55V 4WBNA 3SYQA 2XAFA 1XHZA 4FJCC 4IHJA 3ZMUA 3B40A 3RWRD 3OTFA 3LSUA 1YJWV 2HFEC 2YIAA 4UB6Z 3WB0A 3UO2A 3ZHQA 2DYRB 1AP6A 2HEPA 5B1AC 1Q82W 2Z0AA 2EILB 5C8YA 3E2EA 2BOBC 2ZR2A 3G67A 2P90A 3QNEA 1KBHA 1TGOA 3PJSK 3FAVB 3N2GA 4HBNA 1GAXA 2VS0A 3CWBH 3B2EE 4A5UB 4AHCA 5IYDO 2OYQA 4XDKA 2WLIB 3ZBHA 1VQ6V 1F7YA 3T2MA 3RYCA 1AI6A 4JYAB 1CPYA 3IC9A 2Z5UA 4JI8O 2OTLV 5LHIA 1MG1A 4DR5O 3F7YC 5KHIA 4LWSB 4MS2A 3WG7B 3G6BA 4YY3O 2A79B 3SYAA 3EHBB 2BCCH 3ZCCA 1N33B 4O4LB 5LOVA 2QA4V 1ZX3A 2QM4A 1N34O 4X9QA 3H1KH 1H2SB 2UXXA 3JATA 1NTMH 2GSMB 2LGWA 2LJ2A 4KHPB 1N36O 5ITZA 1S5HC 3DXRB 1WA8B 3ZJZA 1NJIW 2OIEA 2MW2B 2OCCB 4PA9A 4CH6A 3C90A 3ML0A 5JVDA 5JJNB 3ABKB 3ZRWB 1WJZA 1QQCA 1ZSPA 4ZHQB 4DK1A 3VBBA 4GZRB 4JTCB 1YVWA 1PV0A 3K06A 4LF6O 3JARB 2H3OA 4RO2A 5LP6C 4K3AA 5IYZA 2V1DA 4CS3A 4J9YB 2GHYA 2H8PC 1G6UA 1LNQA 5F2VO 2AHZA 4JYYA 5KHKA 2Q7HA 1ZWIC 4K8XA 4ZBMA 4FM0A 1NH2B 1OCCC 1Q3EA 3QO5A 4IIJA 2YDEA 3AK3A 2PYJA 1IXMA 2VRZA 2UUBO 4NXMO 1PNMA 4O2AA 5LP6A 1HW7A 4MTXA 4LF9B 1N32O 4X65B 1JOYA 1W59A 5BR8O 1NH2D 4D6TH 1EN4A 4GX2A 3E35A 1P84F 4KFMA 2YEVA 3CHXA 4LFAB 2WA4A 4BIUA 5IJ9A 3OEEG 2Q8VA 1L0NH 1L0LH 1NBMG 2YIDA 3L74H 1SQXH 2F66C 5EK0A 4DV2O 1WLEA 1IBMO 4P9PA 1BSMA 1NTKH 3H1JH 2Y0PA 1SF9A 2EULA 2DYSC 1SQFA 3AG3C 1IVSA 5FL7G 5CA3A 2RCVA 1VIBA 5JQGB 4P2ZA 4OPHA 5IT9N 4UCUA 3QG5A 1EFRG 1O9GA 1SRYA 1SS3A 3AG4C 4X1IB 1E1RG 4U3FH 1I5YA 4JYCA 5IJ0A 3F7VC 1BT8A 5GTIZ 3I5DA 3D8CA 1AB3A 4YHHB 2FYUH 3ZRVA 2DYRC 1NU1H 4JTDB 2QKSA 1RM1C 1FAFA 1VQMV 2CE4A 3JAWA 1SESA 4PJ0Z 2EIKC 3HKCA 1Q43A 2EZOA 1I5XA 4N23A 2F23A 2E74B 3VOUA 2KB1A 1IX9A 1VF6C 3P3NA 1K33A 3ZN1A 4B3TO 4DR6B 4H37A 4H0LB 4GX5A 4X62O 2PI5A 2FB5A 4UCTA 1SERA 2AGAA 1JPXA 5KMGB 2KG7B 1IBKO 3BEHA 1EM1A 2JGDB 3Q4HB 2RJZA 4I55A 1NKDA 3RVZA 1YSCA 1XBLA 2PYLA 2G38A 2WLKA 3IGAC 4E4EA 3DSQA 3JSNA 1YJ9V 3ZMTA 4GT1A 2XUMA 1R6TA 2Y69B 3FAVA 2P67A 2VWKA 3G4SV 4QGPA 2WLIA 4I50B 1FXHA 2PUSA 4RUFA 3RFRA 2N74A 1OHHG 5LA6B 5H9CA 5IWAB 1KC8W 4WFAV 4ZOLB 4WFHA 2WLLB 2QJ1A 4LNUB 2OCCC 4MVQA 4JI5B 2PY5A 4ICGA 3STLC 3CC2V 3ABMB 1KKCA 5E79Z 3EVKA 4PDVA 1K73W 1JCHA 3E8FA 1GN6A 2ILMA 2Y48A 3AG2B 3H01A 2Q67A 3G6EV 4NXNO 2HJDA 1N4CA 4AQYO 4ABMA 3CCUV 3APQA 5H6RA 4XBFA 3J80N 2W6IG 5JH7B 4IT5A 2FKXA 5LMNB 1XILA 3BY6A 1GM9A 4WFFA 3DXRA 1WA8A 3HKDA 4DV4B 2HVJC 1NZ6A 1AJNA 3L71H 3P30A 3ZRWA 3N2KB 1NR7A 4ZHQA 2EIJC 1Q90D 1HR0B 4FZ1A 3CC7V 2QWPB 3OFNG 4FLUA 1HNXB 3TXSA 2Z3YA 4I5SA 4X88A 2Q9LA 2YI9A 1Q7YW 1M9NA 1RP3B 1SQBH 2JK5C 1QLNA 5C93A 2IJJA 4ZI7A 4JAUA 4FK5C 1IBLO 2YS8A 4JI7O 2NR5A 1K5SA 4GUNA 1QNMA 1J95A 3LNNA 1QR9A 2A3QA 4DV7B 1QBZA 1OCZC 3OUSA 1MABG 4LC1A 3KG2A 5EYPB 4PELA 1XMOO 1WPXA 4X20B 3T4DA 5EC2C 5GONB 3R66A 4DR4B 3ZS8C 3JASB 2AZ0A 3A8TA 4LFBB 1K5QA 1PNKA 3ASNB 1EZVH 2KQXA 1NTZH 4G28B 4AI8A 1NT2B 3DC5A 2QGNA 1H2NA 1QR8A 4LCUC 3CRMA 4G27B 4PD4F 3ZRXA 1K92A 1TAEA 1KKDA 1N33O 1QHTA 2JGUA 4X64B 5K1XA 2A9HA 5EC1C 1AI4A 1BHAA 1JFFB 3APOA 2F4VO 4N21A 5KLVH 1PL4A 4DV6B 5AG2A 3UO3A 2JIZG 3BAAA 1WP7A 4FZ0A 4BR6A 5JQGA 1XMQO 4WFGA 4DV0O 1XNRO 2QM7A 1HP8A 4X1IA 3H1IH 2B9ZA 2XTAA 2QWOB 1GM8A 1LUVA 4DR1B 3OAAG 5J2UB 1K9MW 1M56B 2FL4A 2UUCB 3A0HZ 2LFRA 4LF5O 2O57A 1H8EG 2ZQMA 4QJFB 4LF7B 3CCRV 2M7WA 3ABUA 3LDEA 1GN3A 5CA0B 4PV1B 4JI0O 1WB7A 4PA3A 3E86A 3LSQA 1SQGA 2PI4A 5FNVA 4B3MB 1VP7A 5LXTB 2WA3A 5D5PA 2VQEB 3RYIB 4TUYA 4L87A 5KMGA 2QWRB 2KG7A 4NTXA 1UJWB 1I94O 4DR3O 4RAIA 1NR1A 2JGDA 3Q4HA 3SDLA 3M8AA 4U7NA 4LF9O 3CJHB 4LFCB 3P3PA 2YSUB 2P22C 3SPJA 2ZNJA 1B06A 1GN4A 2A06H 2A7WA 4PDRA 1US6A 2ITDC 4UCOA 3O65A 4YIOA 2JVDA 4E2LA 3AG2C 1FXKB 1ORQC 2EJRA 1AROP 4DV1B 2ZIMA 4I50A 4DV3O 4I0XA 4BAYA 1YITV 3KCYA 4JI4O 2DOSA 2ZE7A 4PA4A 3CMAV 4ZOLA 2WLLA 4LNUA 1FXVA 1Z5WA 3A0RA 2ZM6B 3F5WC 2Y4UA 1S77D 2ADQB 3CB2A 4DRXA 4GKKO 1S3JA 2QDOA 4FFBB 1W0JG 1Q6IA 3EXAA 3ETDA 1TVKB 3IFXA 2ETNA 5BY1A 1KB9F 3ABTA 2LGQA 2IJKA 5JH7A 2GUZB 1QLEB 2WLNA 2CGNA 1M5IA 2ZKOA 2F95B 3LDDA 2OCHA 4YHHO 2PTMA 1OCRC 4HNAB 1X4TA 3CXCU 4DUYB 3UKMA 1GTOA 1XQ8A 3N2KA 4LBEC 3VQVA 3CRRA 3VQWA 3K5MA 3CCVV 4CC6A 4JV5O 1HNWB 5LBQA 1SETA 4F4LA 2VQFB 1GH6A 2GBOA 3ABLB 4DR6O 4DR2O 4PI2A 3MAQA 3CCSV 1ZAUA 4MVSA 3K0GA 3ASNC 5EIBD 2AZ2A 2H94A 2CTWA 3P32A 4LF8B 3ICXA 2X7RB 3GB7C 4O4JB 4GYCB 2BSKB 4J11A 1Q81W 4Z2WA 5BZBA 3DC6A 1AJQA 1AR4A 2EINB 1KYOF 4MVRA 3K0DA 3D36A 2RNBA 4CBCA 1I08A 4PI0A 3LUTB 5KHJA 5EYPA 5JJJB 2RQ6A 5A2QN 4DUZO 1PL0A 4X20A 5DECA 4J41A 2B1IA 1BGYH 3E83A 2BTOA 3VQYA 3X2QC 3G80A 3JASA 1QVGU 4X1YB 4JI3B 4LH6A 3H9VA 1FJGB 2XASA 2E5LO 5LMUB 5BXZA 2N05A 1FYJA 2MK3A 4U7OA 2W0XA 5IDJA 2GV9A 3SYOA 2P5OA 2CTRA 1M56C 4UCRA 2K9PA 3U10A 5IYBO 1YI2V 4BWAA 2UXBB 2W6JG 1ZL8B 4JI1B 1K4CC 1JFFA 1G8MA 1L8DA 1RPOA 1MOFA 2XNDG 5L3CA 3CX5F 4GKJB 3U0ZA 3E22B 4FLVA 3OGIB 1YHQV 3B8MA 5J2TB 4EEQA 1V55C 3FD9A 1R3KC
chains in the Genus database with same CATH topology
1N34O 4DR7O 4DR6O 2UU9O 3OTOO 4DR2O 1G1XB 1I94O 4DR3O 4JI3O 2UUCO 1HNXO 5LMNO 3SDLA 1XMOO 1KUQA 2N74A 1FJGO 1FKAO 3R66A 5LMUO 3M8AA 4DV2O 1IBMO 4DV5O 4LF9O 4DV4O 1X59A 1N36O 2HHHO 4OX9O 2LW7A 4B3SO 1AILA 4LF4O 4OPHA 3O65A 1HR0O 5IT9N 3J7AU 1A32A 2UXBO 4JI1O 4DR1O 3T1YO 4DV3O 5FLXN 3RT3C 1N33O 1R1BA 4JI4O 5A2QN 4LF6O 4DUZO 2DOSA 4NXNO 1XNQO 2DJVA 4LF7O 1AB3A 1NS1A 4JYAO 4AQYO 2F4VO 4X65O 3J80N 4GKJO 2UXDO 2FKXA 4DUYO 2E5LO 4LFCO 5BXZA 4LF8O 4GKKO 1XMQO 4DV0O 4B3MO 1XNRO 1J5EO 1FYJA 2Z0AA 4JI6O 2VQEO 4B3RO 1HNWO 2VQFO 4LFAO 4DV7O 5BY1A 1HNZO 1D2DA 4B3TO 4A5UB 2UUBO 4OPAA 3JAMN 3T1HO 4X62O 4NXMO 2AGAA 2UXCO 2JRIA 5IWAO 4K0KO 5H5NA 4LF5O 4DR4O 2ZKOA 1IBKO 1F7YA 4LFBO 1N32O 4YHHO 4KHPO 3J81N 4JI5O 4JI8O 5LL6Y 4DV6O 2ZM6O 4JI2O 4JI0O 4DR5O 3F5TA 5BR8O 1DK1A 1IBLO 4JI7O 2UUAO 4YY3O 4DV1O 4X66O 1R6TA 1XEQA 4JV5O 4X64O 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 O;  4DR7 O;  4DR6 O;  2UU9 O;  3OTO O;  4DR2 O;  1G1X B;  1I94 O;  4DR3 O;  4JI3 O;  2UUC O;  1HNX O;  5LMN O;  3SDL A;  1XMO O;  1KUQ A;  2N74 A;  1FJG O;  1FKA O;  3R66 A;  5LMU O;  3M8A A;  4DV2 O;  1IBM O;  4DV5 O;  4LF9 O;  4DV4 O;  1X59 A;  1N36 O;  2HHH O;  4OX9 O;  2LW7 A;  4B3S O;  1AIL A;  4LF4 O;  4OPH A;  3O65 A;  1HR0 O;  5IT9 N;  3J7A U;  1A32 A;  2UXB O;  4JI1 O;  4DR1 O;  3T1Y O;  4DV3 O;  5FLX N;  3RT3 C;  1N33 O;  1R1B A;  4JI4 O;  5A2Q N;  4LF6 O;  4DUZ O;  2DOS A;  4NXN O;  1XNQ O;  2DJV A;  4LF7 O;  1AB3 A;  1NS1 A;  4JYA O;  4AQY O;  2F4V O;  4X65 O;  3J80 N;  4GKJ O;  2UXD O;  2FKX A;  4DUY O;  2E5L O;  4LFC O;  5BXZ A;  4LF8 O;  4GKK O;  1XMQ O;  4DV0 O;  4B3M O;  1XNR O;  1J5E O;  1FYJ A;  2Z0A A;  4JI6 O;  2VQE O;  4B3R O;  1HNW O;  2VQF O;  4LFA O;  4DV7 O;  5BY1 A;  1HNZ O;  1D2D A;  4B3T O;  4A5U B;  2UUB O;  4OPA A;  3JAM N;  3T1H O;  4X62 O;  4NXM O;  2AGA A;  2UXC O;  2JRI A;  5IWA O;  4K0K O;  5H5N A;  4LF5 O;  4DR4 O;  2ZKO A;  1IBK O;  1F7Y A;  4LFB O;  1N32 O;  4YHH O;  4KHP O;  3J81 N;  4JI5 O;  4JI8 O;  5LL6 Y;  4DV6 O;  2ZM6 O;  4JI2 O;  4JI0 O;  4DR5 O;  3F5T A;  5BR8 O;  1DK1 A;  1IBL O;  4JI7 O;  2UUA O;  4YY3 O;  4DV1 O;  4X66 O;  1R6T A;  1XEQ A;  4JV5 O;  4X64 O;  1YZB A; 
#chains in the Genus database with same CATH topology
 1S72 V;  4GCZ A;  4TSF G;  1VQK V;  5TIS Z;  1UFI A;  3C3S A;  4IGG A;  1HNX O;  2QWN B;  3W7T A;  3S3X A;  5B1N A;  5CA0 A;  1YEW A;  2KKW A;  3K08 A;  4JZG A;  2D2C B;  2A0L A;  2YC0 A;  5LXT A;  3FB6 C;  1R6K A;  4CZZ A;  3IC7 A;  3RYI A;  3PN1 A;  4EKW A;  2R9A A;  3FFQ A;  3RT3 C;  1NI8 A;  4MTO A;  1Y66 A;  5FPR A;  2YXL A;  1XNQ O;  2DJV A;  1NS1 A;  2UU9 B;  4TWK A;  3CJH A;  3K58 A;  2UXD O;  1YTF B;  1KEC A;  2AXT Z;  3SJB C;  1MZE A;  2EIM B;  3L73 H;  2LQT A;  4NKG B;  1DTO A;  1FXK A;  3TGU H;  3L75 H;  5B1B B;  4FLX A;  4B3S B;  4IL6 Z;  5CA1 B;  5JWP A;  4GLX A;  2GDS A;  1EZJ A;  1Z5V A;  2WPD G;  3B09 A;  3T1H O;  3T1Y B;  3CRC A;  5EIB C;  1H2L A;  3D3I A;  2VWJ A;  4WFB V;  1QVF U;  5KHH A;  2HG5 C;  1AR5 A;  2EIL C;  2XAQ A;  4J42 A;  1FPO A;  2P4K A;  2DQ0 A;  1RFY A;  2HHH B;  4DV6 O;  1TUB A;  4O4I B;  3W7S A;  4OGQ B;  4OX9 B;  4FFB A;  4D7T A;  1GO3 F;  2BE3 A;  1WNS A;  4LF4 B;  4J7J A;  1VQL V;  2UUA O;  3K59 A;  3LDC A;  3ZHU A;  1TVK A;  2E75 B;  1U97 A;  1O9H A;  2ITC C;  4Q6G A;  1MSW D;  1PPJ H;  2XOK G;  3T1C A;  4DR7 O;  2GUZ A;  4CC5 A;  3STZ C;  1KU9 A;  4P30 A;  3WG7 C;  2UUC O;  1XOU A;  1XRE A;  4HNA A;  3ETG A;  4DV5 O;  4JI8 B;  4O4H B;  2EIN C;  3TCU A;  3JCZ A;  3W7W A;  4CH4 A;  1D5A A;  4RQF A;  1BS3 A;  1A32 A;  1AVM A;  2QTO A;  2JEU A;  4UB8 Z;  4O2B B;  4LP8 A;  2B1G A;  3K5L A;  1N34 B;  3AK2 A;  1IDS A;  1IXB A;  4DO2 A;  4LWS A;  3B77 A;  3AG7 A;  3ZHR A;  3ASO B;  2ZD9 A;  4JI2 B;  2DE0 X;  4J7Z A;  4O4J A;  4DW1 A;  2BSK A;  3ABK C;  3HKB B;  3VQX A;  4LFC O;  5D5Q A;  4MVM A;  1XUQ A;  4O4L A;  3WB2 A;  1N36 B;  4X66 B;  3LNM B;  2QTS A;  4R8C A;  4B3R O;  1ROP A;  1AR1 B;  5IYC O;  5L3F A;  3OMN B;  3AK1 A;  3OM3 B;  1P7B A;  1XI1 A;  4BIZ A;  1HNZ O;  2ZNI A;  2Y0I A;  3B4S A;  3JAM N;  1Y6X A;  4J10 A;  3A0B Z;  3GWO A;  4PA6 A;  4K0K O;  4LF6 B;  4QNH B;  4RUE A;  1OJH A;  4FM1 A;  4MW8 A;  4BW5 A;  1JQ0 A;  1EBO A;  4EFB A;  2ZM6 O;  3CXH F;  4UV9 A;  2HR3 A;  2KSD A;  1Q6H A;  3CYO A;  3JAR A;  1SZT A;  2JS3 A;  3QTC A;  4JAV A;  1MMM A;  2PZS A;  3M99 B;  3BCC H;  4PDM A;  5C8Y B;  3KCX A;  3CS5 A;  2E3C A;  2ZXW B;  5L3B A;  1G1X B;  2UUB B;  3N2G B;  1JR9 A;  1FKA O;  1JVM A;  4FMT A;  3CCE V;  1MA1 A;  3E22 A;  1XL4 A;  3QVN A;  1N32 B;  4C7U A;  3E8G A;  1J5E B;  3OT7 A;  2YXY A;  2ZR3 A;  4JI6 B;  1E1Q G;  2DN9 A;  1K3E A;  1AIL A;  3SR2 C;  5BR8 B;  2JS5 A;  5J2T A;  3MHS C;  1SZX A;  1URF A;  1GRJ A;  4H13 B;  5H6Q A;  4I4T B;  1DF5 A;  1P7G A;  1H38 A;  1R6N A;  3E8H A;  5FLX N;  2V7Q G;  4UVB A;  2ODM A;  3R65 A;  2C2A A;  1R1B A;  4MW3 A;  4F6E A;  4CS4 A;  4JYA O;  3CEI A;  1QCE A;  2IU3 A;  1SQV H;  4X1K B;  3BPZ A;  3SJQ C;  1B3Q A;  3A2F A;  1VF7 A;  4YJ3 B;  1Y74 B;  4LF8 O;  4H44 B;  3JAT B;  2Y4T A;  1S5L Z;  4NTW A;  4FM2 A;  4I9W A;  4HYO A;  1M90 W;  2FTK A;  1PP9 H;  5DED A;  1EN6 A;  1H2K A;  3LSS A;  2QR4 A;  2IU0 A;  3CD6 V;  4HAM A;  5KX5 B;  2CH7 B;  3ZRS A;  3JSL A;  3SGI A;  1Y76 B;  4KHP O;  3FYI B;  4TV8 B;  3THO A;  3BVO A;  4GX0 A;  3WB1 A;  3K9S A;  3OUF A;  1SC5 B;  1M93 A;  3HB3 B;  2DMX A;  5CA1 A;  1K34 A;  3JD1 A;  1COW G;  2L35 A;  1XEQ A;  3K9A A;  1F51 A;  3HPL C;  2P6J A;  4FLW A;  2XAJ A;  2JJ1 G;  1KP3 A;  2Q6A A;  4X62 B;  1RSO B;  5KAI Z;  2Y69 C;  4O4I A;  1PKX A;  1YDX A;  1IBK B;  1VQ8 V;  2N04 A;  3NXS A;  2OWO A;  1KP2 A;  2QKC A;  5IY5 B;  4DK0 A;  2X6C A;  4W4K A;  3ZED A;  1DGS A;  3H1L H;  2GTA A;  3ZHT A;  4B7K A;  5LGT A;  1S0V A;  3B8N A;  2IJH A;  1Y67 A;  1FD9 A;  3ASO C;  3ZMV A;  1MSD A;  1OCC B;  2CAZ C;  3ABM C;  4X65 O;  4LR3 A;  1IUR A;  4J7K A;  5DM6 V;  4O4H A;  4MVU A;  4R50 A;  2NN4 A;  2XT9 A;  1VQO V;  3IJ4 A;  1HWY A;  1YCI A;  2AHY A;  1VEW A;  1VQ7 V;  4J80 A;  5EBW C;  5HFL A;  3E89 A;  4Z1M G;  4O2B A;  4MTG A;  4LFA O;  2BTQ B;  5FPO A;  5CBG A;  5LA6 A;  3FB5 C;  2HP8 A;  3BAB A;  4OPA A;  4XDL A;  2X6A A;  1BQ0 A;  2F1M A;  5CN0 A;  2JRI A;  5H5N A;  3OMI B;  4FVM A;  4NXN B;  5L3E A;  3HKB A;  4MSW C;  2ZDI C;  4ASU G;  3ZN0 A;  4YIP A;  3J81 N;  4AQY B;  1AI5 A;  3S3W A;  3CPW U;  3CCQ V;  3JAL B;  2LW1 A;  3SJA C;  4BW9 A;  5EZY B;  4MVZ A;  2BOC C;  5LHG A;  2W0F C;  4TOI A;  1M1K W;  1BHB A;  4YJ2 B;  1AI7 A;  2DYS B;  2ZXW C;  3AG3 B;  3JAW B;  2Q68 A;  1VMG A;  2Q7E A;  1Z2G A;  4DXW A;  4TT3 G;  3FYE B;  3QO7 A;  3BFR A;  3RN4 A;  2WWW A;  3AG4 B;  5LHH A;  3E8B A;  3ZMS A;  3EFF K;  3K5O A;  2OT5 A;  2ZDI A;  1X59 A;  1MZF A;  2QM8 A;  4R6Z A;  2Q7G A;  2HHH O;  3OR6 C;  4OX9 O;  2LW7 A;  2GTS A;  4TV9 B;  3D36 C;  4LF4 O;  4DYL A;  4KP4 A;  4NTY A;  1IBL B;  4I55 B;  1GN2 A;  4JI7 B;  1RM1 B;  3BA9 A;  2P4V A;  4KL1 A;  4FIP C;  3KKY A;  1D5N A;  4JTA B;  3ZX6 A;  3M7M X;  1R3I C;  1BE3 H;  2DWE C;  5CBH A;  2EIK B;  3JAK B;  2UXC B;  5EBL C;  1ZUQ A;  2CUG A;  3TK1 A;  4WFE A;  4B08 A;  5JCO C;  1S5J A;  1AJP A;  1XMO B;  1RPR A;  3ETQ A;  4B7E A;  4F6R B;  4JGS A;  3CRA A;  1W0K G;  4IYH A;  1V54 B;  4I4T A;  5LGN A;  2QEX V;  1FFX B;  3JD2 A;  2M6Y A;  4WF9 V;  5GON A;  3FB8 C;  3SYC A;  1D2D A;  2AW9 A;  4UV8 A;  1CEZ A;  2ZCE A;  1JJO A;  4MT8 A;  2YI8 A;  4X1K A;  5IWA O;  1BL8 A;  1HDJ A;  3N27 A;  2NNU A;  4YJ3 A;  3G71 V;  5JCO A;  3OEH G;  1Y74 A;  2F4V B;  4JI5 O;  5LL6 Y;  3UT5 B;  4JI2 O;  2JDI G;  2WSS G;  4PDL A;  4UXN A;  3FX7 A;  4DW0 A;  1PD3 A;  2X6B A;  4FFK A;  1XMQ B;  4DV0 B;  4X66 O;  1XNR B;  2K1E A;  2X0L A;  3OMA B;  1E79 G;  1K97 A;  2PGG A;  4NB5 A;  3HKD B;  4NYK A;  1F4M A;  1YXB A;  5KX5 A;  3TXQ A;  2CH7 A;  1CP9 A;  4ZIB A;  2QKA A;  1Y76 A;  5LMN O;  4TV8 A;  1KUQ A;  5IY5 C;  2IH1 C;  2JJ2 G;  4LF5 B;  2IJI A;  1S76 D;  4DV4 O;  1B04 A;  3CRQ A;  1K4D C;  1Q5O A;  2ARH A;  5KUK A;  3UQ8 A;  4JI0 B;  1R73 A;  1HR0 O;  2R72 A;  3DTU B;  5J2U A;  2OIG A;  3K04 A;  4ZI7 B;  1G4Y B;  2YUA A;  1I7F A;  1BQZ A;  2HVK C;  4RWU A;  1VQ4 V;  2YIB D;  3RVY A;  3SPH A;  5L3G A;  2FML A;  1RSO A;  5B5E Z;  1SA0 B;  3ETE A;  3D3Q A;  1BMF G;  2EIJ B;  1I94 B;  4DR3 B;  3OE7 G;  1FXK C;  3L72 H;  2EJ7 A;  2E76 B;  1JX9 A;  4U3J B;  5LYJ B;  1KMI Z;  1YIJ V;  3O9O A;  3RYH B;  1J5E O;  2QE7 G;  4JI6 O;  1SQP H;  2EZP A;  3T4Z A;  1EN5 A;  4DV7 O;  4CH3 A;  3H1H H;  1WB8 A;  3OTO B;  4DV3 B;  1Q86 W;  1NQT A;  3SPG A;  4JI4 B;  4DR4 O;  3K57 A;  4LFB O;  2IBZ H;  5HFM A;  1Q6U A;  3JCU Z;  2V4D A;  1N0J A;  5B66 Z;  1OCZ B;  4CS2 A;  1DK1 A;  3SJC C;  5KUM A;  5KA6 A;  4GKK B;  3TJT A;  1GM7 A;  1M4U A;  1QLE C;  2BTQ A;  2Q4P A;  1QU7 A;  4XDJ A;  1WN7 A;  2F93 B;  4X64 O;  2IH3 C;  3K3W A;  1YZB A;  1TA8 A;  1OV9 A;  1THZ A;  2R9R B;  4OXS A;  1XHX A;  4EB6 B;  5BMV B;  1YTF D;  2QSA A;  1WAZ A;  4UFZ A;  2RN9 A;  4QPJ A;  3JAL A;  3KZI Z;  5CB4 B;  5E1A C;  2D3O W;  5EZY A;  1PNL A;  3ABL C;  3WFV A;  2Q0O C;  4FPP A;  4D7S A;  4YJ2 A;  4R7C A;  2Q69 A;  3J7A U;  4EFE A;  2EX3 A;  1WPB A;  4TQF A;  2R9I A;  4JYB A;  4DR1 O;  3K5N A;  1SQQ H;  1K7D A;  4JV5 B;  4UUJ C;  4UCS A;  5FNV B;  3CCM V;  3CCL V;  4BIO A;  2YXH A;  4LF7 O;  1FS0 G;  4DR2 B;  5H2F Z;  5IE9 A;  4TUY B;  4JAA A;  1VQN V;  3CC4 V;  5B3S B;  4DR5 B;  4W4L A;  1V54 C;  4TV9 A;  1YF2 A;  1M57 B;  4B3M O;  4YY3 B;  1IZ3 A;  2VQE O;  1ZTE A;  3C3T A;  3RW0 A;  3JAK A;  1P4R A;  3HKE B;  2WLM A;  1VQ9 V;  2XAG A;  1AP5 A;  3MDS A;  1ZLZ A;  4ZKI A;  4PHZ A;  4QIW F;  1VF6 A;  1R3J C;  1JMK C;  3QF7 A;  2QWQ B;  1W2B U;  4CH5 A;  2CTQ A;  4DUZ B;  4I0X B;  3ZIA G;  2IW5 A;  5DN6 G;  3I56 V;  2YIC A;  4F6R A;  1L1F A;  2E5L B;  2IM9 A;  2CTP A;  1GKF A;  3CCJ V;  4AIL C;  3RYF B;  2R70 A;  2DWD C;  4DV1 O;  1FFX A;  1Q8I A;  3AG1 B;  4KUM A;  5CMU A;  2Q0A A;  4QE9 A;  4DRX B;  1JA8 A;  3IAY A;  3ZHS A;  4X1Y A;  3CSX A;  1Y4M A;  3HR0 A;  4FLZ A;  1OCO B;  4WBN B;  4NR1 A;  4K8Z A;  4IHJ B;  1P49 A;  3UT5 A;  1KQS U;  3L9D A;  2JEX A;  3ZHV A;  3BHP A;  4Q20 A;  4X8A A;  2WLJ A;  1PM9 A;  4UVA A;  1V9P A;  3BRC A;  4FLT A;  1ZL8 A;  1WP8 A;  1LR1 A;  2WAM A;  2YIB A;  4I9Q A;  1CXZ B;  4HZ3 A;  4NXM B;  1YJN V;  2HKO A;  4NVP A;  3RBZ A;  5CBF A;  2LFS A;  3MD0 A;  4JZ2 A;  3SPC A;  4J9Z B;  4DUY O;  1MNG A;  1UPG A;  4FLY A;  2F43 G;  3RYC B;  4QE7 A;  3OW2 U;  1HNW O;  4PA7 A;  1XL6 A;  2DW4 A;  1OCR B;  5B1A B;  2VQF O;  2ADP A;  3SPI A;  2NLJ C;  1SA0 A;  1TUE B;  5LOV B;  3QO8 A;  2EIM C;  2UXC O;  2CK3 G;  4RQE A;  4DV2 B;  4KXR A;  1VQP V;  1IBM B;  2P7T C;  2ATK C;  4U3J A;  5LYJ A;  1XNQ B;  1U96 A;  5B1B C;  3FB7 C;  2B5U A;  2LP7 A;  3GWK C;  1GK9 A;  2ZE8 A;  2UXN A;  2Q73 A;  2UXD B;  3RYH A;  5KAF Z;  1ENV A;  3SYP A;  4IYI A;  3F5T A;  1N0N A;  3DGE A;  5ITZ B;  4GX1 A;  4MVO A;  2XHB A;  4YXW G;  2Q5Z A;  1VF5 B;  2HJF C;  4G2K A;  5JVD B;  3JD0 A;  2HLD G;  5A9G A;  4JAS A;  5KHG A;  4X89 A;  4JI3 O;  3T1H B;  2L6L A;  4L8J A;  1FJG O;  1SKV A;  5IYZ B;  5LMU O;  1R3L C;  3OGC C;  3BA8 A;  3FKS G;  1F4N A;  2XAH A;  4JF3 A;  3JD3 A;  3K79 A;  3X2Q B;  4QPK A;  1I0H A;  2UUA B;  2UXB O;  1DLB A;  1K8A W;  4JI1 O;  4Z1V A;  4B3T B;  4IIJ B;  4EB6 A;  2CGO A;  5BMV A;  2P06 A;  4K35 A;  1H8H G;  4DR7 B;  1JJ2 U;  4H33 A;  3CE2 A;  2RDC A;  5B3S C;  1T5E A;  1NVP B;  3UCS C;  4UCV A;  4GKJ O;  1M57 C;  5CB4 A;  4O2A B;  5J9P C;  5LP6 B;  3W7U A;  4I7Z B;  2ZT9 B;  2EBO A;  3OR7 C;  3MHH C;  4DV5 B;  2WLH A;  5EBM C;  5GTH Z;  2ZIN A;  5JJE B;  2ZE6 A;  3UM7 A;  2PF4 E;  3ZMZ A;  4P9O A;  5B1O A;  2YEV B;  3W7X A;  3RGB A;  5LGU A;  5IJ9 B;  4JPR A;  2RMK B;  3OD4 A;  1NVP D;  1BCC H;  5KA5 A;  3NR7 A;  1V55 B;  3GVM A;  3U11 A;  4MTF A;  1FFT B;  1OZ0 A;  3AG1 C;  3JYC A;  1VAR A;  2ZIO A;  2DQ3 A;  4LH7 A;  2ZE5 A;  5L3D A;  3HKE A;  3L70 H;  1N8R W;  4B3R B;  1OCO C;  1DF4 A;  2LO1 A;  4WCE V;  3K03 A;  2UU9 O;  3OTO O;  1B6Q A;  1HNZ B;  5IJ0 B;  1H2G A;  4K0K B;  4UVC A;  1BZK A;  1KD1 W;  4TQD A;  5K1P A;  1XDC A;  3CP1 A;  1GMG A;  3RYF A;  2CDY A;  2OTJ V;  4B3S O;  3WU2 Z;  5GW7 A;  3HKC B;  1TUB B;  1VQ5 V;  3AEI A;  3JD4 A;  3TET A;  3T1Y O;  1LUW A;  1H2M A;  3CME V;  1F23 A;  3I55 V;  4WBN A;  3SYQ A;  2XAF A;  1XHZ A;  4FJC C;  4IHJ A;  3ZMU A;  3B40 A;  3RWR D;  3OTF A;  3LSU A;  1YJW V;  2HFE C;  2YIA A;  4UB6 Z;  3WB0 A;  3UO2 A;  3ZHQ A;  2DYR B;  1AP6 A;  2HEP A;  5B1A C;  1Q82 W;  2Z0A A;  2EIL B;  5C8Y A;  3E2E A;  2BOB C;  2ZR2 A;  3G67 A;  2P90 A;  3QNE A;  1KBH A;  1TGO A;  3PJS K;  3FAV B;  3N2G A;  4HBN A;  1GAX A;  2VS0 A;  3CWB H;  3B2E E;  4A5U B;  4AHC A;  5IYD O;  2OYQ A;  4XDK A;  2WLI B;  3ZBH A;  1VQ6 V;  1F7Y A;  3T2M A;  3RYC A;  1AI6 A;  4JYA B;  1CPY A;  3IC9 A;  2Z5U A;  4JI8 O;  2OTL V;  5LHI A;  1MG1 A;  4DR5 O;  3F7Y C;  5KHI A;  4LWS B;  4MS2 A;  3WG7 B;  3G6B A;  4YY3 O;  2A79 B;  3SYA A;  3EHB B;  2BCC H;  3ZCC A;  1N33 B;  4O4L B;  5LOV A;  2QA4 V;  1ZX3 A;  2QM4 A;  1N34 O;  4X9Q A;  3H1K H;  1H2S B;  2UXX A;  3JAT A;  1NTM H;  2GSM B;  2LGW A;  2LJ2 A;  4KHP B;  1N36 O;  5ITZ A;  1S5H C;  3DXR B;  1WA8 B;  3ZJZ A;  1NJI W;  2OIE A;  2MW2 B;  2OCC B;  4PA9 A;  4CH6 A;  3C90 A;  3ML0 A;  5JVD A;  5JJN B;  3ABK B;  3ZRW B;  1WJZ A;  1QQC A;  1ZSP A;  4ZHQ B;  4DK1 A;  3VBB A;  4GZR B;  4JTC B;  1YVW A;  1PV0 A;  3K06 A;  4LF6 O;  3JAR B;  2H3O A;  4RO2 A;  5LP6 C;  4K3A A;  5IYZ A;  2V1D A;  4CS3 A;  4J9Y B;  2GHY A;  2H8P C;  1G6U A;  1LNQ A;  5F2V O;  2AHZ A;  4JYY A;  5KHK A;  2Q7H A;  1ZWI C;  4K8X A;  4ZBM A;  4FM0 A;  1NH2 B;  1OCC C;  1Q3E A;  3QO5 A;  4IIJ A;  2YDE A;  3AK3 A;  2PYJ A;  1IXM A;  2VRZ A;  2UUB O;  4NXM O;  1PNM A;  4O2A A;  5LP6 A;  1HW7 A;  4MTX A;  4LF9 B;  1N32 O;  4X65 B;  1JOY A;  1W59 A;  5BR8 O;  1NH2 D;  4D6T H;  1EN4 A;  4GX2 A;  3E35 A;  1P84 F;  4KFM A;  2YEV A;  3CHX A;  4LFA B;  2WA4 A;  4BIU A;  5IJ9 A;  3OEE G;  2Q8V A;  1L0N H;  1L0L H;  1NBM G;  2YID A;  3L74 H;  1SQX H;  2F66 C;  5EK0 A;  4DV2 O;  1WLE A;  1IBM O;  4P9P A;  1BSM A;  1NTK H;  3H1J H;  2Y0P A;  1SF9 A;  2EUL A;  2DYS C;  1SQF A;  3AG3 C;  1IVS A;  5FL7 G;  5CA3 A;  2RCV A;  1VIB A;  5JQG B;  4P2Z A;  4OPH A;  5IT9 N;  4UCU A;  3QG5 A;  1EFR G;  1O9G A;  1SRY A;  1SS3 A;  3AG4 C;  4X1I B;  1E1R G;  4U3F H;  1I5Y A;  4JYC A;  5IJ0 A;  3F7V C;  1BT8 A;  5GTI Z;  3I5D A;  3D8C A;  1AB3 A;  4YHH B;  2FYU H;  3ZRV A;  2DYR C;  1NU1 H;  4JTD B;  2QKS A;  1RM1 C;  1FAF A;  1VQM V;  2CE4 A;  3JAW A;  1SES A;  4PJ0 Z;  2EIK C;  3HKC A;  1Q43 A;  2EZO A;  1I5X A;  4N23 A;  2F23 A;  2E74 B;  3VOU A;  2KB1 A;  1IX9 A;  1VF6 C;  3P3N A;  1K33 A;  3ZN1 A;  4B3T O;  4DR6 B;  4H37 A;  4H0L B;  4GX5 A;  4X62 O;  2PI5 A;  2FB5 A;  4UCT A;  1SER A;  2AGA A;  1JPX A;  5KMG B;  2KG7 B;  1IBK O;  3BEH A;  1EM1 A;  2JGD B;  3Q4H B;  2RJZ A;  4I55 A;  1NKD A;  3RVZ A;  1YSC A;  1XBL A;  2PYL A;  2G38 A;  2WLK A;  3IGA C;  4E4E A;  3DSQ A;  3JSN A;  1YJ9 V;  3ZMT A;  4GT1 A;  2XUM A;  1R6T A;  2Y69 B;  3FAV A;  2P67 A;  2VWK A;  3G4S V;  4QGP A;  2WLI A;  4I50 B;  1FXH A;  2PUS A;  4RUF A;  3RFR A;  2N74 A;  1OHH G;  5LA6 B;  5H9C A;  5IWA B;  1KC8 W;  4WFA V;  4ZOL B;  4WFH A;  2WLL B;  2QJ1 A;  4LNU B;  2OCC C;  4MVQ A;  4JI5 B;  2PY5 A;  4ICG A;  3STL C;  3CC2 V;  3ABM B;  1KKC A;  5E79 Z;  3EVK A;  4PDV A;  1K73 W;  1JCH A;  3E8F A;  1GN6 A;  2ILM A;  2Y48 A;  3AG2 B;  3H01 A;  2Q67 A;  3G6E V;  4NXN O;  2HJD A;  1N4C A;  4AQY O;  4ABM A;  3CCU V;  3APQ A;  5H6R A;  4XBF A;  3J80 N;  2W6I G;  5JH7 B;  4IT5 A;  2FKX A;  5LMN B;  1XIL A;  3BY6 A;  1GM9 A;  4WFF A;  3DXR A;  1WA8 A;  3HKD A;  4DV4 B;  2HVJ C;  1NZ6 A;  1AJN A;  3L71 H;  3P30 A;  3ZRW A;  3N2K B;  1NR7 A;  4ZHQ A;  2EIJ C;  1Q90 D;  1HR0 B;  4FZ1 A;  3CC7 V;  2QWP B;  3OFN G;  4FLU A;  1HNX B;  3TXS A;  2Z3Y A;  4I5S A;  4X88 A;  2Q9L A;  2YI9 A;  1Q7Y W;  1M9N A;  1RP3 B;  1SQB H;  2JK5 C;  1QLN A;  5C93 A;  2IJJ A;  4ZI7 A;  4JAU A;  4FK5 C;  1IBL O;  2YS8 A;  4JI7 O;  2NR5 A;  1K5S A;  4GUN A;  1QNM A;  1J95 A;  3LNN A;  1QR9 A;  2A3Q A;  4DV7 B;  1QBZ A;  1OCZ C;  3OUS A;  1MAB G;  4LC1 A;  3KG2 A;  5EYP B;  4PEL A;  1XMO O;  1WPX A;  4X20 B;  3T4D A;  5EC2 C;  5GON B;  3R66 A;  4DR4 B;  3ZS8 C;  3JAS B;  2AZ0 A;  3A8T A;  4LFB B;  1K5Q A;  1PNK A;  3ASN B;  1EZV H;  2KQX A;  1NTZ H;  4G28 B;  4AI8 A;  1NT2 B;  3DC5 A;  2QGN A;  1H2N A;  1QR8 A;  4LCU C;  3CRM A;  4G27 B;  4PD4 F;  3ZRX A;  1K92 A;  1TAE A;  1KKD A;  1N33 O;  1QHT A;  2JGU A;  4X64 B;  5K1X A;  2A9H A;  5EC1 C;  1AI4 A;  1BHA A;  1JFF B;  3APO A;  2F4V O;  4N21 A;  5KLV H;  1PL4 A;  4DV6 B;  5AG2 A;  3UO3 A;  2JIZ G;  3BAA A;  1WP7 A;  4FZ0 A;  4BR6 A;  5JQG A;  1XMQ O;  4WFG A;  4DV0 O;  1XNR O;  2QM7 A;  1HP8 A;  4X1I A;  3H1I H;  2B9Z A;  2XTA A;  2QWO B;  1GM8 A;  1LUV A;  4DR1 B;  3OAA G;  5J2U B;  1K9M W;  1M56 B;  2FL4 A;  2UUC B;  3A0H Z;  2LFR A;  4LF5 O;  2O57 A;  1H8E G;  2ZQM A;  4QJF B;  4LF7 B;  3CCR V;  2M7W A;  3ABU A;  3LDE A;  1GN3 A;  5CA0 B;  4PV1 B;  4JI0 O;  1WB7 A;  4PA3 A;  3E86 A;  3LSQ A;  1SQG A;  2PI4 A;  5FNV A;  4B3M B;  1VP7 A;  5LXT B;  2WA3 A;  5D5P A;  2VQE B;  3RYI B;  4TUY A;  4L87 A;  5KMG A;  2QWR B;  2KG7 A;  4NTX A;  1UJW B;  1I94 O;  4DR3 O;  4RAI A;  1NR1 A;  2JGD A;  3Q4H A;  3SDL A;  3M8A A;  4U7N A;  4LF9 O;  3CJH B;  4LFC B;  3P3P A;  2YSU B;  2P22 C;  3SPJ A;  2ZNJ A;  1B06 A;  1GN4 A;  2A06 H;  2A7W A;  4PDR A;  1US6 A;  2ITD C;  4UCO A;  3O65 A;  4YIO A;  2JVD A;  4E2L A;  3AG2 C;  1FXK B;  1ORQ C;  2EJR A;  1ARO P;  4DV1 B;  2ZIM A;  4I50 A;  4DV3 O;  4I0X A;  4BAY A;  1YIT V;  3KCY A;  4JI4 O;  2DOS A;  2ZE7 A;  4PA4 A;  3CMA V;  4ZOL A;  2WLL A;  4LNU A;  1FXV A;  1Z5W A;  3A0R A;  2ZM6 B;  3F5W C;  2Y4U A;  1S77 D;  2ADQ B;  3CB2 A;  4DRX A;  4GKK O;  1S3J A;  2QDO A;  4FFB B;  1W0J G;  1Q6I A;  3EXA A;  3ETD A;  1TVK B;  3IFX A;  2ETN A;  5BY1 A;  1KB9 F;  3ABT A;  2LGQ A;  2IJK A;  5JH7 A;  2GUZ B;  1QLE B;  2WLN A;  2CGN A;  1M5I A;  2ZKO A;  2F95 B;  3LDD A;  2OCH A;  4YHH O;  2PTM A;  1OCR C;  4HNA B;  1X4T A;  3CXC U;  4DUY B;  3UKM A;  1GTO A;  1XQ8 A;  3N2K A;  4LBE C;  3VQV A;  3CRR A;  3VQW A;  3K5M A;  3CCV V;  4CC6 A;  4JV5 O;  1HNW B;  5LBQ A;  1SET A;  4F4L A;  2VQF B;  1GH6 A;  2GBO A;  3ABL B;  4DR6 O;  4DR2 O;  4PI2 A;  3MAQ A;  3CCS V;  1ZAU A;  4MVS A;  3K0G A;  3ASN C;  5EIB D;  2AZ2 A;  2H94 A;  2CTW A;  3P32 A;  4LF8 B;  3ICX A;  2X7R B;  3GB7 C;  4O4J B;  4GYC B;  2BSK B;  4J11 A;  1Q81 W;  4Z2W A;  5BZB A;  3DC6 A;  1AJQ A;  1AR4 A;  2EIN B;  1KYO F;  4MVR A;  3K0D A;  3D36 A;  2RNB A;  4CBC A;  1I08 A;  4PI0 A;  3LUT B;  5KHJ A;  5EYP A;  5JJJ B;  2RQ6 A;  5A2Q N;  4DUZ O;  1PL0 A;  4X20 A;  5DEC A;  4J41 A;  2B1I A;  1BGY H;  3E83 A;  2BTO A;  3VQY A;  3X2Q C;  3G80 A;  3JAS A;  1QVG U;  4X1Y B;  4JI3 B;  4LH6 A;  3H9V A;  1FJG B;  2XAS A;  2E5L O;  5LMU B;  5BXZ A;  2N05 A;  1FYJ A;  2MK3 A;  4U7O A;  2W0X A;  5IDJ A;  2GV9 A;  3SYO A;  2P5O A;  2CTR A;  1M56 C;  4UCR A;  2K9P A;  3U10 A;  5IYB O;  1YI2 V;  4BWA A;  2UXB B;  2W6J G;  1ZL8 B;  4JI1 B;  1K4C C;  1JFF A;  1G8M A;  1L8D A;  1RPO A;  1MOF A;  2XND G;  5L3C A;  3CX5 F;  4GKJ B;  3U0Z A;  3E22 B;  4FLV A;  3OGI B;  1YHQ V;  3B8M A;  5J2T B;  4EEQ A;  1V55 C;  3FD9 A;  1R3K C; 
#chains in the Genus database with same CATH homology
 1N34 O;  4DR7 O;  4DR6 O;  2UU9 O;  3OTO O;  4DR2 O;  1G1X B;  1I94 O;  4DR3 O;  4JI3 O;  2UUC O;  1HNX O;  5LMN O;  3SDL A;  1XMO O;  1KUQ A;  2N74 A;  1FJG O;  1FKA O;  3R66 A;  5LMU O;  3M8A A;  4DV2 O;  1IBM O;  4DV5 O;  4LF9 O;  4DV4 O;  1X59 A;  1N36 O;  2HHH O;  4OX9 O;  2LW7 A;  4B3S O;  1AIL A;  4LF4 O;  4OPH A;  3O65 A;  1HR0 O;  5IT9 N;  3J7A U;  1A32 A;  2UXB O;  4JI1 O;  4DR1 O;  3T1Y O;  4DV3 O;  5FLX N;  3RT3 C;  1N33 O;  1R1B A;  4JI4 O;  5A2Q N;  4LF6 O;  4DUZ O;  2DOS A;  4NXN O;  1XNQ O;  2DJV A;  4LF7 O;  1AB3 A;  1NS1 A;  4JYA O;  4AQY O;  2F4V O;  4X65 O;  3J80 N;  4GKJ O;  2UXD O;  2FKX A;  4DUY O;  2E5L O;  4LFC O;  5BXZ A;  4LF8 O;  4GKK O;  1XMQ O;  4DV0 O;  4B3M O;  1XNR O;  1J5E O;  1FYJ A;  2Z0A A;  4JI6 O;  2VQE O;  4B3R O;  1HNW O;  2VQF O;  4LFA O;  4DV7 O;  5BY1 A;  1HNZ O;  1D2D A;  4B3T O;  4A5U B;  2UUB O;  4OPA A;  3JAM N;  3T1H O;  4X62 O;  4NXM O;  2AGA A;  2UXC O;  2JRI A;  5IWA O;  4K0K O;  5H5N A;  4LF5 O;  4DR4 O;  2ZKO A;  1IBK O;  1F7Y A;  4LFB O;  1N32 O;  4YHH O;  4KHP O;  3J81 N;  4JI5 O;  4JI8 O;  5LL6 Y;  4DV6 O;  2ZM6 O;  4JI2 O;  4JI0 O;  4DR5 O;  3F5T A;  5BR8 O;  1DK1 A;  1IBL O;  4JI7 O;  2UUA O;  4YY3 O;  4DV1 O;  4X66 O;  1R6T A;  1XEQ A;  4JV5 O;  4X64 O;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...