3J81N

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j81N02
4B3TO 2UXDO 1NS1A 4DR2O 4DV5O 1F7YA 5IWAO 4GKJO 1N34O 4JI4O 3RT3C 3M8AA 4LF4O 4A5UB 4OPAA 3T1YO 4JI2O 4DR6O 2JRIA 1N33O 4LF9O 4LF8O 1IBKO 4DV0O 4JV5O 4X62O 5H5NA 4X66O 2F4VO 2UXBO 2HHHO 4GKKO 3T1HO 2UU9O 4X65O 1FYJA 2ZKOA 4DR4O 4JI6O 5BXZA 1KUQA 3R66A 2ZM6O 1FJGO 4DR1O 4DV4O 1HR0O 4JI0O 5LL6Y 3J7AU 1XNQO 1AB3A 4JI8O 4K0KO 4OPHA 4DV2O 1A32A 1FKAO 4LFBO 4LF7O 1AILA 2FKXA 1HNXO 5BY1A 5A2QN 2DOSA 1X59A 4X64O 1IBMO 4DV3O 4JI7O 4DV1O 5LMUO 2E5LO 2UUAO 5BR8O 4NXNO 4DUYO 4LF6O 4DUZO 4JI1O 4JYAO 4NXMO 2N74A 4DR7O 2DJVA 4YHHO 3SDLA 1IBLO 4B3SO 5FLXN 1I94O 5LMNO 1DK1A 4DR3O 4LF5O 4LFCO 1R1BA 3J81N 1YZBA 4B3RO 3F5TA 1HNWO 1R6TA 1HNZO 1XNRO 4JI5O 2AGAA 4JI3O 4B3MO 4DV6O 4OX9O 2Z0AA 2UUCO 5IT9N 1J5EO 3OTOO 2UUBO 4LFAO 1XMOO 1N32O 4AQYO 2UXCO 2VQFO 1XMQO 3JAMN 2LW7A 1XEQA 4DV7O 4DR5O 3O65A 1D2DA 2VQEO 1N36O 4KHPO 1G1XB 4YY3O 3J80N
chains in the Genus database with same CATH superfamily
2ZNIA 2JGDB 1SQFA 4DRXB 3RYCA 4JYAB 4PA9A 2D3OW 1N33O 3L74H 5LMNB 3W7TA 4JV5O 2CTWA 2EJ7A 4JTAB 2ADQB 4E2LA 1M56B 3HR0A 2LJ2A 1EN4A 4NYKA 4FLYA 3VQXA 2X0LA 1PL4A 3I5DA 3W7WA 1AI4A 3P30A 1SESA 4O4IB 3ZJZA 1VQNV 3M7MX 3L73H 4DXWA 3FYEB 2B1GA 5LGNA 4WF9V 1NR7A 1DTOA 1IBMO 4F6RA 3BPZA 1GH6A 1GM8A 1H2MA 1I94B 4PELA 1WPXA 3MDSA 1BGYH 1YJNV 1QLEB 4J80A 3JSNA 1DF5A 1VIBA 5LHHA 3BHPA 3OT7A 5EBLC 1WP8A 2Z3YA 4UCOA 4J9YB 3SDLA 1V9PA 2OTJV 2WLJA 3ML0A 1DK1A 1NT2B 1R1BA 1Y74B 5TISZ 3R65A 3F7YC 5IY5B 3H1KH 5KHIA 5CBHA 4J10A 5IY5C 4PDLA 3CCUV 3TXQA 1XMOO 2Y0PA 1H38A 1G6UA 4B08A 3WFVA 5AG2A 2QJ1A 3A2FA 3FFQA 4CS4A 5IYBO 3ZHSA 1JPXA 3JAKB 3OMAB 1WP7A 1PL0A 4KHPO 3J80N 4K0KB 1Y66A 1Q6HA 4B3TO 4FM1A 3LDDA 4W4LA 4PHZA 3OD4A 1VARA 1K5QA 4DR6O 2ZXWC 4LF8O 4DV0O 4J7KA 2IU3A 2Q5ZA 2H8PC 1XBLA 4TUYA 4O4LB 5K1XA 1Q81W 1YEWA 3PJSK 4JTCB 4O4HA 3FB6C 1Z5WA 1Y6XA 1L0LH 3TGUH 4K0KO 4OPHA 1TGOA 1M4UA 1SERA 4J42A 4RUEA 5B1AB 5BY1A 4DO2A 1CP9A 1F51A 4O4LA 4QJFB 4GT1A 4DW0A 5KX5B 3E83A 2ZDIA 3ETDA 1ZWIC 4LP8A 5BMVB 1I08A 1NTKH 2UUAO 3CHXA 1KECA 4GUNA 5JCOC 3DSQA 3LDCA 1SQPH 2LFSA 4IYHA 5IYZB 2AHYA 3I56V 3RYHA 2UUBB 1W59A 4FVMA 5L3GA 4F4LA 3OW2U 3JD4A 5LMUB 1P49A 4PI2A 3MHHC 3H1JH 3OUFA 5EYPB 4PA7A 3LNNA 4WBNA 2XAFA 3TETA 4HNAB 1HNWO 5EK0A 5KHGA 3S3WA 5LGTA 4CH6A 3EHBB 3OTOB 3K5LA 1KQSU 3ASOC 3E22B 4NB5A 2DWEC 5CA1A 1KP3A 2Q69A 1PNLA 4X88A 4LH7A 2UXDB 2A3QA 5IWAB 1P7GA 1XMQO 1Q82W 3ASNC 1S76D 2C2AA 2BTQB 4G28B 4QPJA 1I7FA 1M5IA 2GTSA 1N36O 4I9WA 4MVMA 1M57C 4D6TH 3FKSG 4YY3O 4DV0B 2UXCB 1NS1A 2JEUA 3OTFA 3F7VC 2VQFB 3BAAA 4I5SA 1R3JC 1OCZB 3T1YO 3Q4HA 3OEHG 1YHQV 2Y4TA 3CEIA 2UXBO 5CA0B 2ZIOA 5JJEB 5E1AC 4JI6O 3CPWU 4RAIA 5FPRA 4UB8Z 4JI0O 2XOKG 4YIPA 2YXHA 1U97A 3BRCA 4L87A 4JF3A 1AILA 4Z1MG 4YIOA 3MD0A 4K8XA 2XAQA 1NI8A 3T1HB 2UXBB 2DN9A 2ZE5A 1RM1C 3CB2A 3OEEG 4LNUA 2H94A 1TUEB 4I0XA 4DK1A 4U3FH 1AI5A 3ZRSA 2Q73A 1H2KA 1M9NA 3E22A 2ZR3A 4DR7O 1WA8A 5CA3A 2R9RB 1DF4A 4LWSA 3FAVB 3B40A 5KHHA 3EVKA 1TVKA 2WLMA 3BFRA 1I94O 4HZ3A 4X20B 4UCTA 3N27A 2DWDC 2PTMA 2Q9LA 1RFYA 2Y0IA 4JGSA 5KAIZ 1EN5A 3D36C 3WG7C 4WFBV 3CRQA 1MSDA 3BABA 4B3MO 3JATA 4DV6O 2Z0AA 1S5LZ 4TV8B 1KKDA 3HKBA 3JARB 5LBQA 3HKCA 4N23A 3OFNG 5H6QA 5KAFZ 2F23A 2X6AA 3E2EA 1X4TA 1WLEA 1W2BU 4FLUA 1YCIA 1K8AW 4Q6GA 1BMFG 1D2DA 3FX7A 1OCZC 1JX9A 4P2ZA 1MABG 2YIAA 4K8ZA 2L6LA 5LP6C 1NTMH 4JI8B 4UCUA 1L1FA 1MOFA 4LF4O 4A5UB 1VQ6V 5GONB 5E79Z 1PV0A 3ABLB 4RQFA 4TSFG 1LUWA 4Z1VA 2Q0AA 4X66B 4JI8O 3FB5C 3QVNA 2KSDA 4LFBO 2Y48A 3A0HZ 3SPGA 4B3RB 2JGUA 2FKXA 5JVDB 2K1EA 2ETNA 2RQ6A 3K06A 2V7QG 2P5OA 2V4DA 4UUJC 2R9AA 3H1LH 2CTPA 4TQFA 3SPCA 4BAYA 3K9AA 3UT5B 1M93A 1Q3EA 1RP3B 5B1AC 5JVDA 2UXXA 2IJHA 5B1BB 4LR3A 3ABKC 1O9HA 2LO1A 2VRZA 4IGGA 5LYJB 3JD1A 1YZBA 3ABUA 1UJWB 1XNQB 4OXSA 5LXTB 4MW8A 4JI5O 2B9ZA 1KC8W 3HB3B 3ZRVA 3CWBH 4KXRA 4WFFA 1K4CC 5JWPA 3OTOO 1WAZA 2R70A 1IDSA 4LF4B 4NTYA 3ZCCA 5FNVB 3RYIB 4DV7O 4DR5O 3OGIB 3ICXA 3B8MA 1R73A 1FFXA 3IJ4A 2UXNA 4DV5O 1K5SA 1Z2GA 2G38A 5A9GA 1NR1A 4JI2O 1SKVA 2W6JG 1XMQB 2WLKA 2ZINA 1B06A 4QE7A 1OHHG 1H2GA 1URFA 2P4VA 1VQLV 1FYJA 4KP4A 4PDRA 5D5PA 1OCCC 2OWOA 4DV4B 4WCEV 1Y67A 3K58A 1THZA 3ZX6A 4B3MB 3B4SA 1NVPD 5CMUA 2DYRB 1GM9A 5GW7A 4JPRA 3K0GA 3W7XA 2EBOA 4TUYB 2CE4A 2P22C 2W0FC 3AG1B 4XDLA 3JAWA 3OE7G 3JD0A 4DR6B 1SQBH 3DTUB 2E5LO 3X2QC 1AR5A 2LGQA 1NU1H 1ZLZA 1RSOB 1YJWV 3RN4A 2YEVA 1OCRB 2N74A 4RWUA 4PDVA 1XHZA 5GTHZ 3UM7A 3N2KB 2OTLV 2X6BA 3RGBA 1IURA 4LF5O 1XDCA 3F5TA 1WJZA 2E75B 2HP8A 4UVAA 3QO8A 1HNZO 4W4KA 5J2UB 3VBBA 1N32B 2AGAA 3CRMA 4IHJA 1SQXH 1P7BA 2JVDA 1S77D 2UXCO 3K57A 2BSKA 2VQFO 4DV5B 4DR3B 2DYRC 4BW5A 3MAQA 1SRYA 3ETGA 2UUCB 4O2AA 2IH1C 2Y69C 1LR1A 2QTOA 1ZUQA 1GN6A 4KL1A 4R6ZA 5HFMA 2P6JA 1N34B 2WLHA 1BL8A 1QLEC 2HG5C 2QKCA 4MVQA 3T4DA 3FD9A 3CS5A 1VQPV 2JS5A 3HKDB 4C7UA 2ZKOA 4DR4O 2YUAA 3H9VA 4MVSA 2O57A 3QTCA 3LSQA 2PGGA 1GM7A 3S3XA 3N2KA 2DW4A 4MVUA 5LL6Y 3SPHA 1KD1W 2WLIA 4CH5A 5L3EA 5BMVA 1HW7A 1MZEA 4EFEA 3VQVA 3CCVV 2DOSA 2ZDIC 3O9OA 1QR8A 4X64O 1YTFB 5EC1C 1M90W 3D3IA 4MSWC 2Q7GA 3ASOB 1FPOA 3ZHRA 1V55B 1MSWD 3QG5A 5J2UA 4DV6B 2KB1A 2QEXV 2EINB 3OUSA 4RO2A 5L3DA 3U11A 1PKXA 4HAMA 1IBLO 1BQ0A 2HR3A 1ZL8A 4D7SA 1JVMA 1TUBA 2YS8A 1ROPA 4DR1B 4DV3B 2CAZC 2PZSA 4GX2A 1FXKA 4H37A 1SC5B 2GUZA 2ZXWB 3LSSA 3L75H 2QWOB 3HKBB 3JD3A 2Q7EA 3ZMSA 3OMIB 4JAVA 1NH2B 3OMNB 1JOYA 4LFAO 1IXBA 2HEPA 5B3SB 2Y69B 1K34A 3AEIA 2Q6AA 4GYCB 3D3QA 4PA4A 4UVCA 5IJ9A 1QR9A 2FB5A 1ZAUA 1VEWA 2K9PA 1OJHA 1WB7A 2QKSA 3T2MA 4ZOLA 4JI4O 5EIBC 4OPAA 2EILC 3A0BZ 1XMOB 4LF9O 3K03A 3ZHUA 5FPOA 3K0DA 1ORQC 1AJNA 1K33A 2QTSA 4DV4O 2JK5C 5DEDA 4IL6Z 1I5XA 2A7WA 1HWYA 3UO3A 1M56C 4GLXA 1IBMB 3SPJA 2A0LA 3ZIAG 3OR6C 4NXNB 3AK3A 4ZIBA 5EZYA 4FMTA 3LDEA 1VF5B 3VQYA 3K5OA 1TVKB 4GZRB 2LQTA 1VQ5V 1P4RA 2WWWA 5BR8O 4DUZO 4CH4A 5GTIZ 1M57B 2IBZH 4UB6Z 3UO2A 3FYIB 4FFBA 4FLTA 3SYPA 4B3SO 4O4HB 4WFGA 4CBCA 1KP2A 2HKOA 5LMNO 3HKEB 3ZS8C 1SQQH 4X65B 3P3PA 4LFCO 3K59A 3DXRB 4B3RO 3T4ZA 3CCMV 2HJFC 1R3IC 4U7NA 3OM3B 3C3TA 2CTQA 3G6EV 4CC6A 2PI4A 4OX9O 2FMLA 2OCCB 1GO3F 5IYCO 2UUBO 2ZCEA 4I50B 4AQYO 3OGCC 4BIUA 1XNRB 3DC6A 3JAMN 1AR1B 1XEQA 3L72H 2JEXA 3VQWA 5B1NA 1MG1A 2WLLB 2ZE6A 1I5YA 4FM0A 3ZMZA 5IWAO 5BZBA 1RM1B 1GN4A 3AG2C 1EZJA 3RYFA 1NJIW 1IBKO 3B8NA 1BZKA 4JZGA 5KA5A 3APOA 5BXZA 3R66A 2IJJA 4DR1O 4FLWA 3G80A 4X1YA 4ZKIA 4R7CA 4LF7O 3JASA 2UU9B 4H33A 3ZHQA 3WG7B 2PY5A 1N4CA 2HJDA 5KUKA 1DGSA 1D5AA 5LMUO 4B3TB 1F4NA 3LUTB 2GHYA 3RW0A 1QNMA 2CH7A 4X64B 4KHPB 1EZVH 1H8EG 2DJVA 4MVRA 4JI5B 1XILA 4AQYB 3CE2A 4NKGB 5LGUA 1XNRO 4J11A 2YEVB 4P9PA 4NTWA 4FJCC 1JA8A 2GDSA 5KX5A 1NBMG 5JQGB 2BSKB 3IC9A 2GBOA 1GKFA 1AJPA 3A8TA 1FXKB 1R6NA 1US6A 1YITV 1PP9H 4TV9A 4CS2A 1Q90D 4P30A 4DUZB 4H13B 4HBNA 3CCLV 1NKDA 2EIMB 3SYOA 4FM2A 4DRXA 5CB4A 2ADPA 4LF7B 2A79B 2JRIA 1Y4MA 4K3AA 3ZMTA 1PNKA 3W7UA 3T1HO 2W0XA 2E76B 5KMGA 4XDKA 3W7SA 2AW9A 4JAAA 4JZ2A 3CRRA 3UKMA 2GV9A 5F2VO 3J7AU 2EZOA 4UCVA 5J9PC 2HVJC 3AG3B 4BW9A 3WB2A 3CMAV 1AJQA 1G4YB 1M1KW 1Y74A 1QHTA 2QR4A 1JJOA 4I0XB 3CCSV 3ABLC 5JCOA 2YDEA 3IGAC 3QF7A 4B7KA 2YIBD 3AG4B 2E3CA 1VQ8V 2HFEC 3HKEA 5LOVA 4YJ3A 5L3FA 3N2GA 2YXYA 1HDJA 2DQ3A 4FFBB 4CC5A 1WNSA 3AK1A 1PM9A 5C8YB 4LFAB 2AZ0A 4ZHQB 2NNUA 4I4TB 2EJRA 2QWPB 3HKCB 5IJ0A 1XUQA 3ZRWA 5K1PA 5EBWC 4YJ3B 2ZT9B 2ZQMA 1FXKC 4ZOLB 1WPBA 1K9MW 2CGOA 2IU0A 2IW5A 3G6BA 1BT8A 5H2FZ 2QE7G 1S72V 2OT5A 1QLNA 4KFMA 1JMKC 2YC0A 4LF9B 1ENVA 4DR2O 4DV7B 4DR5B 3I55V 4DV2B 2HVKC 5CN0A 2OIGA 1FJGB 1KU9A 3ZHTA 2F93B 3OAAG 3GWKC 5H5NA 1YF2A 1FFTB 2EILB 3E35A 1NTZH 4JYCA 1KUQA 3UCSC 3JSLA 2DMXA 4YJ2B 2B1IA 3EFFK 1OCRC 3WB1A 4X1KA 2XAGA 4EB6B 3G67A 5IE9A 2E74B 1B04A 4DR4B 3H01A 3T1YB 1VQOV 3D8CA 3JASB 3OR7C 2WA3A 4BR6A 4ZI7A 3L70H 5KHKA 3HKDA 1JR9A 5A2QN 3QNEA 1MZFA 4PA6A 1X59A 4JASA 4QE9A 1AROP 1Q43A 1S5HC 1AP5A 3CCRV 4UV8A 1ZTEA 3BY6A 1ZX3A 1EBOA 1WN7A 3P3NA 3KZIZ 3JATB 3IC7A 1P84F 1VQKV 1FFXB 3JALB 2BE3A 5EZYB 2M6YA 4TV9B 1GAXA 2YI9A 4PI0A 1WB8A 5FNVA 2DE0X 1O9GA 1SA0B 1MA1A 2JIZG 4LC1A 2OYQA 1QCEA 2F4VB 4LF5B 4XBFA 1JJ2U 3QO5A 5IT9N 4X9QA 4LFBB 1Q8IA 4FFKA 1GRJA 1XQ8A 1N32O 3KG2A 2OCCC 1ZSPA 1VQ9V 1YSCA 2P67A 3TK1A 4R50A 1G8MA 2Z5UA 1S3JA 4U7OA 3ZEDA 1QQCA 2RN9A 4YHHB 4QIWF 4AI8A 2GTAA 1F4MA 4B3SB 4JI3B 1GTOA 4E4EA 2F43G 1F7YA 2QA4V 5HFLA 1R3LC 3GVMA 4FK5C 1R3KC 1YXBA 3DGEA 2R9IA 4ASUG 4MTFA 2RDCA 2FL4A 1XREA 4OX9B 2NLJC 2QWRB 5IDJA 3JALA 1IX9A 1RPOA 1D5NA 1PPJH 4TWKA 2EINC 1HR0O 1KMIZ 1XHXA 2QM7A 3Q4HB 4X62B 2IM9A 1GN2A 4IT5A 2JJ2G 3C3SA 3N2GB 4ICGA 3BCCH 4J7JA 3E86A 2B5UA 2ITDC 4FPPA 2JJ1G 5BR8B 2EIKB 1NZ6A 2KQXA 3E8BA 1W0KG 1R6KA 4DV1B 4I4TA 1NQTA 4QPKA 3E8FA 4NXNO 3RYFB 1QU7A 3VOUA 1PNMA 1B6QA 4LH6A 1CEZA 1Q5OA 2QSAA 1U96A 1OZ0A 3DC5A 3WB0A 2OCHA 2YIBA 2WAMA 2ZE8A 3G71V 5DECA 4B7EA 3F5WC 3H1HH 3K08A 2R72A 4HYOA 4TOIA 2WLIB 2EZPA 2ARHA 1R6TA 2X6CA 2XASA 4Z2WA 2AZ2A 1BHBA 1FXHA 4R8CA 1YJ9V 1N33B 2XHBA 4WFAV 2H3OA 2XT9A 2LW7A 5JJNB 1BCCH 2BOBC 4DW1A 1E1RG 1N36B 1OCOB 3FB7C 1K92A 2DYSB 4FZ1A 2ZE7A 5D5QA 2Q7HA 4X8AA 2KKWA 4CZZA 1SETA 3RT3C 4X1KB 4OGQB 4J9ZB 3ZMVA 3FB8C 4O2BB 3UT5A 4X62O 2HHHB 4GKKB 3SJQC 2WA4A 1FAFA 3JAKA 3L9DA 2IH3C 1HNWB 4DV2O 1EM1A 4U3JA 2Q68A 3CJHA 4MTGA 1SS3A 2PUSA 1FKAO 4HNAA 2KG7B 5B1OA 3IFXA 5LP6B 3RVZA 4LF8B 2BTQA 3U0ZA 1XL6A 2Y4UA 5H6RA 4L8JA 2QM8A 1L0NH 3CCQV 3ZN0A 1Q6IA 4Q20A 3SJBC 2YI8A 2GSMB 1KKCA 3BA8A 1SF9A 5LP6A 5LOVB 4FLXA 2ZD9A 2V1DA 3CRAA 4X1YB 3ETEA 4YHHO 1Z5VA 2RMKB 2X7RB 2YSUB 3ZRXA 2CDYA 5IJ0B 3J81N 5B66Z 2QWQB 3RYCB 3KCXA 3K5NA 2EIMC 2FTKA 4LFCB 1NVPB 1NH2D 2P06A 3JCZA 4K35A 3RYHB 1YIJV 2N04A 5FL7G 3SR2C 1K73W 2F95B 3AK2A 4PV1B 3SGIA 1BSMA 4U3JB 5KLVH 1XI1A 1HNZB 1H2NA 1I0HA 1JFFA 2VWJA 4UVBA 5DM6V 3AG7A 4J7ZA 4GKJB 5C93A 2VQEO 1N0NA 1EN6A 1F23A 1BHAA 1G1XB 3FAVA 3K3WA 4BWAA 4EB6A 5LA6B 3STLC 4TV8A 4H0LB 1Q86W 3RYIA 4UFZA 3LNMB 3RVYA 4X66O 3D36A 2MK3A 1SZTA 2DQ0A 2QWNB 4LWSB 2EULA 3AG4C 2ZM6O 1COWG 1TUBB 4X20A 2VWKA 1AB3A 4LCUC 2ITCC 1A32A 2IJKA 4JI6B 2Q67A 1IVSA 2XUMA 1V55C 5ITZA 1HNXO 5CA0A 2IJIA 4H44B 4JI0B 2L35A 2M7WA 5CA1B 3SJCC 5C8YA 4GX1A 3GB7C 4JI7B 3CC2V 1BS3A 4DV1O 2LP7A 1UPGA 3H1IH 2EIKC 2W6IG 3E89A 3CRCA 1OCCB 1JQ0A 5LHGA 5KMGB 3SYQA 3JYCA 1HNXB 5J2TA 1SQGA 2YXLA 3JAWB 1W0JG 4MTOA 4MTXA 5LA6A 2PYJA 4O2AB 5H9CA 3K9SA 3K04A 1LNQA 1UFIA 4DR3O 1RSOA 4UXNA 1QBZA 3STZC 3L71H 2WLNA 2BTOA 4LF6B 3GWOA 2ILMA 4JI3O 4BIZA 4DR7B 4IHJB 3ZBHA 4D7TA 5JJJB 3E8GA 3JCUZ 1H2SB 1IBLB 1BE3H 4PD4F 1GN3A 3B77A 3UQ8A 1YTFD 4DYLA 3ABKB 5ITZB 1H2LA 2XAJA 2P7TC 3AG3C 2AXTZ 1AI6A 3IAYA 3T1CA 4AILC 1YDXA 2LGWA 5DN6G 1KBHA 1FD9A 4MW3A 1Q6UA 4JI4B 4O4JB 5L3BA 3B09A 4FLZA 2FYUH 1QVGU 5EIBD 2F4VO 2HHHO 4GKKO 3KCYA 2UU9O 2A06H 4X65O 1VQ7V 1T5EA 1GK9A 3RBZA 1B3QA 4TT3G 1FJGO 3ABMB 3KKYA 5GONA 3ZMUA 4F6RB 2QKAA 1TAEA 1S0VA 2RNBA 1XNQO 3JARA 4IIJA 1EFRG 3BVOA 1V54C 1N8RW 2PF4E 3M99B 3NXSA 3U10A 5CBGA 1OCOC 1V54B 4NXMB 2PYLA 2F1MA 5L3CA 1TA8A 4NTXA 4XDJA 4DV3O 5B1BC 5JQGA 1YVWA 3DXRA 5KA6A 5EYPA 3WU2Z 4I55B 5CB4B 2CH7B 3HPLC 3MHSC 1IBKB 3P32A 3CC7V 4DUYO 2YICA 4LBEC 4MVZA 5B3SC 5JH7B 1L8DA 4UV9A 2CTRA 1KB9F 5IJ9B 4CH3A 1QVFU 2UUAB 5LHIA 4FIPC 2YIDA 4QGPA 2MW2B 5LYJA 4X1IA 3AG1C 4PDMA 4JI1B 4MVOA 4F6EA 1J95A 1SZXA 3CP1A 2ZNJA 4GX5A 3AG2B 3G4SV 2RJZA 2WPDG 5KUMA 3K5MA 2CK3G 4EEQA 1IXMA 4ZBMA 1K7DA 5B5EZ 2XTAA 5JH7A 1N0JA 1SQVH 5CBFA 1OV9A 2WLLA 4PJ0Z 3SYCA 1SA0A 1S5JA 4GKJO 4FZ0A 3SJAC 1N34O 2HLDG 3SYAA 4UCSA 1Y76A 4ABMA 2RCVA 4I7ZB 1HR0B 2QM4A 2EIJC 1K97A 5LXTA 2CGNA 3CD6V 4JI2B 2EX3A 2ZIMA 2JDIG 4G27B 4I9QA 1VMGA 4X89A 2F66C 2Q8VA 2KG7A 1PD3A 3CJHB 1HP8A 2ATKC 2PI5A 4P9OA 5IYDO 3K79A 2P90A 3B2EE 2ZM6B 4JTDB 2LW1A 4JI7O 5EBMC 2AHZA 1AP6A 2JS3A 1FXVA 4O4IA 1IZ3A 2P4KA 4JI1O 4GX0A 4JYAO 3APQA 3RFRA 3TXSA 2E5LB 2XNDG 2Q0OC 1E79G 4YY3B 5FLXN 3CSXA 1Y76B 1JFFB 1K4DC 1XOUA 4I50A 4O4JA 2QGNA 4GCZA 1WA8B 3ABMC 3CYOA 1YI2V 1LUVA 1GMGA 2A9HA 1FS0G 2VQEB 1AVMA 1J5EO 2BOCC 4N21A 1CPYA 3TCUA 2D2CB 1VF7A 1VF6A 2CUGA 2BCCH 1Q7YW 3C90A 3TJTA 1AI7A 4JYBA 2QDOA 2ZR2A 2UXDO 4JAUA 4IIJB 3ZRWB 4J41A 3M8AA 1BQZA 4YXWG 1MNGA 4JYYA 4EKWA 3CX5F 2N05A 4O2BA 1K3EA 3ZN1A 4YJ2A 4FLVA 4LNUB 4ZHQA 4MS2A 3THOA 2NN4A 1H8HG 3CCJV 4I55A 4BIOA 2LFRA 3X2QB 3CXHF 1DLBA 3BA9A 4KUMA 3SPIA 4X1IB 5EC2C 1XL4A 4DR2B 3CC4V 4MT8A 3ETQA 1E1QG 3EXAA 4NVPA 1AR4A 4LF6O 2WSSG 4G2KA 4NR1A 5KHJA 4WBNB 3PN1A 2ODMA 4IYIA 4EFBA 3RWRD 4NXMO 1MMMA 2OIEA 5J2TB 1VQMV 3BEHA 4DUYB 2NR5A 1CXZB 4QNHB 1RPRA 4PA3A 4TQDA 1JCHA 1ZL8B 2DYSC 4WFHA 4RQEA 2EIJB 3ABTA 3ASNB 1J5EB 5IYZA 4AHCA 4ZI7B 1VQ4V 3LSUA 1KYOF 3ZHVA 3NR7A 2GUZB 2Q4PA 2JGDA 2UUCO 4DK0A 3A0RA 3CCEV 3JD2A 2XAHA 3CMEV 4JV5B 2VS0A 4WFEA 1VF6C 4CS3A 3CXCU 3O65A 4UCRA 3QO7A 3E8HA 1VP7A 4RUFA
chains in the Genus database with same CATH topology
4B3TO 2UXDO 1NS1A 4DR2O 4DV5O 1F7YA 5IWAO 4GKJO 1N34O 4JI4O 3RT3C 3M8AA 4LF4O 4A5UB 4OPAA 3T1YO 4JI2O 4DR6O 2JRIA 1N33O 4LF9O 4LF8O 1IBKO 4DV0O 4JV5O 4X62O 5H5NA 4X66O 2F4VO 2UXBO 2HHHO 4GKKO 3T1HO 2UU9O 4X65O 1FYJA 2ZKOA 4DR4O 4JI6O 5BXZA 1KUQA 3R66A 2ZM6O 1FJGO 4DR1O 4DV4O 1HR0O 4JI0O 5LL6Y 3J7AU 1XNQO 1AB3A 4JI8O 4K0KO 4OPHA 4DV2O 1A32A 1FKAO 4LFBO 4LF7O 1AILA 2FKXA 1HNXO 5BY1A 5A2QN 2DOSA 1X59A 4X64O 1IBMO 4DV3O 4JI7O 4DV1O 5LMUO 2E5LO 2UUAO 5BR8O 4NXNO 4DUYO 4LF6O 4DUZO 4JI1O 4JYAO 4NXMO 2N74A 4DR7O 2DJVA 4YHHO 3SDLA 1IBLO 4B3SO 5FLXN 1I94O 5LMNO 1DK1A 4DR3O 4LF5O 4LFCO 1R1BA 3J81N 1YZBA 4B3RO 3F5TA 1HNWO 1R6TA 1HNZO 1XNRO 4JI5O 2AGAA 4JI3O 4B3MO 4DV6O 4OX9O 2Z0AA 2UUCO 5IT9N 1J5EO 3OTOO 2UUBO 4LFAO 1XMOO 1N32O 4AQYO 2UXCO 2VQFO 1XMQO 3JAMN 2LW7A 1XEQA 4DV7O 4DR5O 3O65A 1D2DA 2VQEO 1N36O 4KHPO 1G1XB 4YY3O 3J80N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T O;  2UXD O;  1NS1 A;  4DR2 O;  4DV5 O;  1F7Y A;  5IWA O;  4GKJ O;  1N34 O;  4JI4 O;  3RT3 C;  3M8A A;  4LF4 O;  4A5U B;  4OPA A;  3T1Y O;  4JI2 O;  4DR6 O;  2JRI A;  1N33 O;  4LF9 O;  4LF8 O;  1IBK O;  4DV0 O;  4JV5 O;  4X62 O;  5H5N A;  4X66 O;  2F4V O;  2UXB O;  2HHH O;  4GKK O;  3T1H O;  2UU9 O;  4X65 O;  1FYJ A;  2ZKO A;  4DR4 O;  4JI6 O;  5BXZ A;  1KUQ A;  3R66 A;  2ZM6 O;  1FJG O;  4DR1 O;  4DV4 O;  1HR0 O;  4JI0 O;  5LL6 Y;  3J7A U;  1XNQ O;  1AB3 A;  4JI8 O;  4K0K O;  4OPH A;  4DV2 O;  1A32 A;  1FKA O;  4LFB O;  4LF7 O;  1AIL A;  2FKX A;  1HNX O;  5BY1 A;  5A2Q N;  2DOS A;  1X59 A;  4X64 O;  1IBM O;  4DV3 O;  4JI7 O;  4DV1 O;  5LMU O;  2E5L O;  2UUA O;  5BR8 O;  4NXN O;  4DUY O;  4LF6 O;  4DUZ O;  4JI1 O;  4JYA O;  4NXM O;  2N74 A;  4DR7 O;  2DJV A;  4YHH O;  3SDL A;  1IBL O;  4B3S O;  5FLX N;  1I94 O;  5LMN O;  1DK1 A;  4DR3 O;  4LF5 O;  4LFC O;  1R1B A;  3J81 N;  1YZB A;  4B3R O;  3F5T A;  1HNW O;  1R6T A;  1HNZ O;  1XNR O;  4JI5 O;  2AGA A;  4JI3 O;  4B3M O;  4DV6 O;  4OX9 O;  2Z0A A;  2UUC O;  5IT9 N;  1J5E O;  3OTO O;  2UUB O;  4LFA O;  1XMO O;  1N32 O;  4AQY O;  2UXC O;  2VQF O;  1XMQ O;  3JAM N;  2LW7 A;  1XEQ A;  4DV7 O;  4DR5 O;  3O65 A;  1D2D A;  2VQE O;  1N36 O;  4KHP O;  1G1X B;  4YY3 O;  3J80 N; 
#chains in the Genus database with same CATH topology
 2ZNI A;  2JGD B;  1SQF A;  4DRX B;  3RYC A;  4JYA B;  4PA9 A;  2D3O W;  1N33 O;  3L74 H;  5LMN B;  3W7T A;  4JV5 O;  2CTW A;  2EJ7 A;  4JTA B;  2ADQ B;  4E2L A;  1M56 B;  3HR0 A;  2LJ2 A;  1EN4 A;  4NYK A;  4FLY A;  3VQX A;  2X0L A;  1PL4 A;  3I5D A;  3W7W A;  1AI4 A;  3P30 A;  1SES A;  4O4I B;  3ZJZ A;  1VQN V;  3M7M X;  3L73 H;  4DXW A;  3FYE B;  2B1G A;  5LGN A;  4WF9 V;  1NR7 A;  1DTO A;  1IBM O;  4F6R A;  3BPZ A;  1GH6 A;  1GM8 A;  1H2M A;  1I94 B;  4PEL A;  1WPX A;  3MDS A;  1BGY H;  1YJN V;  1QLE B;  4J80 A;  3JSN A;  1DF5 A;  1VIB A;  5LHH A;  3BHP A;  3OT7 A;  5EBL C;  1WP8 A;  2Z3Y A;  4UCO A;  4J9Y B;  3SDL A;  1V9P A;  2OTJ V;  2WLJ A;  3ML0 A;  1DK1 A;  1NT2 B;  1R1B A;  1Y74 B;  5TIS Z;  3R65 A;  3F7Y C;  5IY5 B;  3H1K H;  5KHI A;  5CBH A;  4J10 A;  5IY5 C;  4PDL A;  3CCU V;  3TXQ A;  1XMO O;  2Y0P A;  1H38 A;  1G6U A;  4B08 A;  3WFV A;  5AG2 A;  2QJ1 A;  3A2F A;  3FFQ A;  4CS4 A;  5IYB O;  3ZHS A;  1JPX A;  3JAK B;  3OMA B;  1WP7 A;  1PL0 A;  4KHP O;  3J80 N;  4K0K B;  1Y66 A;  1Q6H A;  4B3T O;  4FM1 A;  3LDD A;  4W4L A;  4PHZ A;  3OD4 A;  1VAR A;  1K5Q A;  4DR6 O;  2ZXW C;  4LF8 O;  4DV0 O;  4J7K A;  2IU3 A;  2Q5Z A;  2H8P C;  1XBL A;  4TUY A;  4O4L B;  5K1X A;  1Q81 W;  1YEW A;  3PJS K;  4JTC B;  4O4H A;  3FB6 C;  1Z5W A;  1Y6X A;  1L0L H;  3TGU H;  4K0K O;  4OPH A;  1TGO A;  1M4U A;  1SER A;  4J42 A;  4RUE A;  5B1A B;  5BY1 A;  4DO2 A;  1CP9 A;  1F51 A;  4O4L A;  4QJF B;  4GT1 A;  4DW0 A;  5KX5 B;  3E83 A;  2ZDI A;  3ETD A;  1ZWI C;  4LP8 A;  5BMV B;  1I08 A;  1NTK H;  2UUA O;  3CHX A;  1KEC A;  4GUN A;  5JCO C;  3DSQ A;  3LDC A;  1SQP H;  2LFS A;  4IYH A;  5IYZ B;  2AHY A;  3I56 V;  3RYH A;  2UUB B;  1W59 A;  4FVM A;  5L3G A;  4F4L A;  3OW2 U;  3JD4 A;  5LMU B;  1P49 A;  4PI2 A;  3MHH C;  3H1J H;  3OUF A;  5EYP B;  4PA7 A;  3LNN A;  4WBN A;  2XAF A;  3TET A;  4HNA B;  1HNW O;  5EK0 A;  5KHG A;  3S3W A;  5LGT A;  4CH6 A;  3EHB B;  3OTO B;  3K5L A;  1KQS U;  3ASO C;  3E22 B;  4NB5 A;  2DWE C;  5CA1 A;  1KP3 A;  2Q69 A;  1PNL A;  4X88 A;  4LH7 A;  2UXD B;  2A3Q A;  5IWA B;  1P7G A;  1XMQ O;  1Q82 W;  3ASN C;  1S76 D;  2C2A A;  2BTQ B;  4G28 B;  4QPJ A;  1I7F A;  1M5I A;  2GTS A;  1N36 O;  4I9W A;  4MVM A;  1M57 C;  4D6T H;  3FKS G;  4YY3 O;  4DV0 B;  2UXC B;  1NS1 A;  2JEU A;  3OTF A;  3F7V C;  2VQF B;  3BAA A;  4I5S A;  1R3J C;  1OCZ B;  3T1Y O;  3Q4H A;  3OEH G;  1YHQ V;  2Y4T A;  3CEI A;  2UXB O;  5CA0 B;  2ZIO A;  5JJE B;  5E1A C;  4JI6 O;  3CPW U;  4RAI A;  5FPR A;  4UB8 Z;  4JI0 O;  2XOK G;  4YIP A;  2YXH A;  1U97 A;  3BRC A;  4L87 A;  4JF3 A;  1AIL A;  4Z1M G;  4YIO A;  3MD0 A;  4K8X A;  2XAQ A;  1NI8 A;  3T1H B;  2UXB B;  2DN9 A;  2ZE5 A;  1RM1 C;  3CB2 A;  3OEE G;  4LNU A;  2H94 A;  1TUE B;  4I0X A;  4DK1 A;  4U3F H;  1AI5 A;  3ZRS A;  2Q73 A;  1H2K A;  1M9N A;  3E22 A;  2ZR3 A;  4DR7 O;  1WA8 A;  5CA3 A;  2R9R B;  1DF4 A;  4LWS A;  3FAV B;  3B40 A;  5KHH A;  3EVK A;  1TVK A;  2WLM A;  3BFR A;  1I94 O;  4HZ3 A;  4X20 B;  4UCT A;  3N27 A;  2DWD C;  2PTM A;  2Q9L A;  1RFY A;  2Y0I A;  4JGS A;  5KAI Z;  1EN5 A;  3D36 C;  3WG7 C;  4WFB V;  3CRQ A;  1MSD A;  3BAB A;  4B3M O;  3JAT A;  4DV6 O;  2Z0A A;  1S5L Z;  4TV8 B;  1KKD A;  3HKB A;  3JAR B;  5LBQ A;  3HKC A;  4N23 A;  3OFN G;  5H6Q A;  5KAF Z;  2F23 A;  2X6A A;  3E2E A;  1X4T A;  1WLE A;  1W2B U;  4FLU A;  1YCI A;  1K8A W;  4Q6G A;  1BMF G;  1D2D A;  3FX7 A;  1OCZ C;  1JX9 A;  4P2Z A;  1MAB G;  2YIA A;  4K8Z A;  2L6L A;  5LP6 C;  1NTM H;  4JI8 B;  4UCU A;  1L1F A;  1MOF A;  4LF4 O;  4A5U B;  1VQ6 V;  5GON B;  5E79 Z;  1PV0 A;  3ABL B;  4RQF A;  4TSF G;  1LUW A;  4Z1V A;  2Q0A A;  4X66 B;  4JI8 O;  3FB5 C;  3QVN A;  2KSD A;  4LFB O;  2Y48 A;  3A0H Z;  3SPG A;  4B3R B;  2JGU A;  2FKX A;  5JVD B;  2K1E A;  2ETN A;  2RQ6 A;  3K06 A;  2V7Q G;  2P5O A;  2V4D A;  4UUJ C;  2R9A A;  3H1L H;  2CTP A;  4TQF A;  3SPC A;  4BAY A;  3K9A A;  3UT5 B;  1M93 A;  1Q3E A;  1RP3 B;  5B1A C;  5JVD A;  2UXX A;  2IJH A;  5B1B B;  4LR3 A;  3ABK C;  1O9H A;  2LO1 A;  2VRZ A;  4IGG A;  5LYJ B;  3JD1 A;  1YZB A;  3ABU A;  1UJW B;  1XNQ B;  4OXS A;  5LXT B;  4MW8 A;  4JI5 O;  2B9Z A;  1KC8 W;  3HB3 B;  3ZRV A;  3CWB H;  4KXR A;  4WFF A;  1K4C C;  5JWP A;  3OTO O;  1WAZ A;  2R70 A;  1IDS A;  4LF4 B;  4NTY A;  3ZCC A;  5FNV B;  3RYI B;  4DV7 O;  4DR5 O;  3OGI B;  3ICX A;  3B8M A;  1R73 A;  1FFX A;  3IJ4 A;  2UXN A;  4DV5 O;  1K5S A;  1Z2G A;  2G38 A;  5A9G A;  1NR1 A;  4JI2 O;  1SKV A;  2W6J G;  1XMQ B;  2WLK A;  2ZIN A;  1B06 A;  4QE7 A;  1OHH G;  1H2G A;  1URF A;  2P4V A;  1VQL V;  1FYJ A;  4KP4 A;  4PDR A;  5D5P A;  1OCC C;  2OWO A;  4DV4 B;  4WCE V;  1Y67 A;  3K58 A;  1THZ A;  3ZX6 A;  4B3M B;  3B4S A;  1NVP D;  5CMU A;  2DYR B;  1GM9 A;  5GW7 A;  4JPR A;  3K0G A;  3W7X A;  2EBO A;  4TUY B;  2CE4 A;  2P22 C;  2W0F C;  3AG1 B;  4XDL A;  3JAW A;  3OE7 G;  3JD0 A;  4DR6 B;  1SQB H;  3DTU B;  2E5L O;  3X2Q C;  1AR5 A;  2LGQ A;  1NU1 H;  1ZLZ A;  1RSO B;  1YJW V;  3RN4 A;  2YEV A;  1OCR B;  2N74 A;  4RWU A;  4PDV A;  1XHZ A;  5GTH Z;  3UM7 A;  3N2K B;  2OTL V;  2X6B A;  3RGB A;  1IUR A;  4LF5 O;  1XDC A;  3F5T A;  1WJZ A;  2E75 B;  2HP8 A;  4UVA A;  3QO8 A;  1HNZ O;  4W4K A;  5J2U B;  3VBB A;  1N32 B;  2AGA A;  3CRM A;  4IHJ A;  1SQX H;  1P7B A;  2JVD A;  1S77 D;  2UXC O;  3K57 A;  2BSK A;  2VQF O;  4DV5 B;  4DR3 B;  2DYR C;  4BW5 A;  3MAQ A;  1SRY A;  3ETG A;  2UUC B;  4O2A A;  2IH1 C;  2Y69 C;  1LR1 A;  2QTO A;  1ZUQ A;  1GN6 A;  4KL1 A;  4R6Z A;  5HFM A;  2P6J A;  1N34 B;  2WLH A;  1BL8 A;  1QLE C;  2HG5 C;  2QKC A;  4MVQ A;  3T4D A;  3FD9 A;  3CS5 A;  1VQP V;  2JS5 A;  3HKD B;  4C7U A;  2ZKO A;  4DR4 O;  2YUA A;  3H9V A;  4MVS A;  2O57 A;  3QTC A;  3LSQ A;  2PGG A;  1GM7 A;  3S3X A;  3N2K A;  2DW4 A;  4MVU A;  5LL6 Y;  3SPH A;  1KD1 W;  2WLI A;  4CH5 A;  5L3E A;  5BMV A;  1HW7 A;  1MZE A;  4EFE A;  3VQV A;  3CCV V;  2DOS A;  2ZDI C;  3O9O A;  1QR8 A;  4X64 O;  1YTF B;  5EC1 C;  1M90 W;  3D3I A;  4MSW C;  2Q7G A;  3ASO B;  1FPO A;  3ZHR A;  1V55 B;  1MSW D;  3QG5 A;  5J2U A;  4DV6 B;  2KB1 A;  2QEX V;  2EIN B;  3OUS A;  4RO2 A;  5L3D A;  3U11 A;  1PKX A;  4HAM A;  1IBL O;  1BQ0 A;  2HR3 A;  1ZL8 A;  4D7S A;  1JVM A;  1TUB A;  2YS8 A;  1ROP A;  4DR1 B;  4DV3 B;  2CAZ C;  2PZS A;  4GX2 A;  1FXK A;  4H37 A;  1SC5 B;  2GUZ A;  2ZXW B;  3LSS A;  3L75 H;  2QWO B;  3HKB B;  3JD3 A;  2Q7E A;  3ZMS A;  3OMI B;  4JAV A;  1NH2 B;  3OMN B;  1JOY A;  4LFA O;  1IXB A;  2HEP A;  5B3S B;  2Y69 B;  1K34 A;  3AEI A;  2Q6A A;  4GYC B;  3D3Q A;  4PA4 A;  4UVC A;  5IJ9 A;  1QR9 A;  2FB5 A;  1ZAU A;  1VEW A;  2K9P A;  1OJH A;  1WB7 A;  2QKS A;  3T2M A;  4ZOL A;  4JI4 O;  5EIB C;  4OPA A;  2EIL C;  3A0B Z;  1XMO B;  4LF9 O;  3K03 A;  3ZHU A;  5FPO A;  3K0D A;  1ORQ C;  1AJN A;  1K33 A;  2QTS A;  4DV4 O;  2JK5 C;  5DED A;  4IL6 Z;  1I5X A;  2A7W A;  1HWY A;  3UO3 A;  1M56 C;  4GLX A;  1IBM B;  3SPJ A;  2A0L A;  3ZIA G;  3OR6 C;  4NXN B;  3AK3 A;  4ZIB A;  5EZY A;  4FMT A;  3LDE A;  1VF5 B;  3VQY A;  3K5O A;  1TVK B;  4GZR B;  2LQT A;  1VQ5 V;  1P4R A;  2WWW A;  5BR8 O;  4DUZ O;  4CH4 A;  5GTI Z;  1M57 B;  2IBZ H;  4UB6 Z;  3UO2 A;  3FYI B;  4FFB A;  4FLT A;  3SYP A;  4B3S O;  4O4H B;  4WFG A;  4CBC A;  1KP2 A;  2HKO A;  5LMN O;  3HKE B;  3ZS8 C;  1SQQ H;  4X65 B;  3P3P A;  4LFC O;  3K59 A;  3DXR B;  4B3R O;  3T4Z A;  3CCM V;  2HJF C;  1R3I C;  4U7N A;  3OM3 B;  3C3T A;  2CTQ A;  3G6E V;  4CC6 A;  2PI4 A;  4OX9 O;  2FML A;  2OCC B;  1GO3 F;  5IYC O;  2UUB O;  2ZCE A;  4I50 B;  4AQY O;  3OGC C;  4BIU A;  1XNR B;  3DC6 A;  3JAM N;  1AR1 B;  1XEQ A;  3L72 H;  2JEX A;  3VQW A;  5B1N A;  1MG1 A;  2WLL B;  2ZE6 A;  1I5Y A;  4FM0 A;  3ZMZ A;  5IWA O;  5BZB A;  1RM1 B;  1GN4 A;  3AG2 C;  1EZJ A;  3RYF A;  1NJI W;  1IBK O;  3B8N A;  1BZK A;  4JZG A;  5KA5 A;  3APO A;  5BXZ A;  3R66 A;  2IJJ A;  4DR1 O;  4FLW A;  3G80 A;  4X1Y A;  4ZKI A;  4R7C A;  4LF7 O;  3JAS A;  2UU9 B;  4H33 A;  3ZHQ A;  3WG7 B;  2PY5 A;  1N4C A;  2HJD A;  5KUK A;  1DGS A;  1D5A A;  5LMU O;  4B3T B;  1F4N A;  3LUT B;  2GHY A;  3RW0 A;  1QNM A;  2CH7 A;  4X64 B;  4KHP B;  1EZV H;  1H8E G;  2DJV A;  4MVR A;  4JI5 B;  1XIL A;  4AQY B;  3CE2 A;  4NKG B;  5LGU A;  1XNR O;  4J11 A;  2YEV B;  4P9P A;  4NTW A;  4FJC C;  1JA8 A;  2GDS A;  5KX5 A;  1NBM G;  5JQG B;  2BSK B;  3IC9 A;  2GBO A;  1GKF A;  1AJP A;  3A8T A;  1FXK B;  1R6N A;  1US6 A;  1YIT V;  1PP9 H;  4TV9 A;  4CS2 A;  1Q90 D;  4P30 A;  4DUZ B;  4H13 B;  4HBN A;  3CCL V;  1NKD A;  2EIM B;  3SYO A;  4FM2 A;  4DRX A;  5CB4 A;  2ADP A;  4LF7 B;  2A79 B;  2JRI A;  1Y4M A;  4K3A A;  3ZMT A;  1PNK A;  3W7U A;  3T1H O;  2W0X A;  2E76 B;  5KMG A;  4XDK A;  3W7S A;  2AW9 A;  4JAA A;  4JZ2 A;  3CRR A;  3UKM A;  2GV9 A;  5F2V O;  3J7A U;  2EZO A;  4UCV A;  5J9P C;  2HVJ C;  3AG3 B;  4BW9 A;  3WB2 A;  3CMA V;  1AJQ A;  1G4Y B;  1M1K W;  1Y74 A;  1QHT A;  2QR4 A;  1JJO A;  4I0X B;  3CCS V;  3ABL C;  5JCO A;  2YDE A;  3IGA C;  3QF7 A;  4B7K A;  2YIB D;  3AG4 B;  2E3C A;  1VQ8 V;  2HFE C;  3HKE A;  5LOV A;  4YJ3 A;  5L3F A;  3N2G A;  2YXY A;  1HDJ A;  2DQ3 A;  4FFB B;  4CC5 A;  1WNS A;  3AK1 A;  1PM9 A;  5C8Y B;  4LFA B;  2AZ0 A;  4ZHQ B;  2NNU A;  4I4T B;  2EJR A;  2QWP B;  3HKC B;  5IJ0 A;  1XUQ A;  3ZRW A;  5K1P A;  5EBW C;  4YJ3 B;  2ZT9 B;  2ZQM A;  1FXK C;  4ZOL B;  1WPB A;  1K9M W;  2CGO A;  2IU0 A;  2IW5 A;  3G6B A;  1BT8 A;  5H2F Z;  2QE7 G;  1S72 V;  2OT5 A;  1QLN A;  4KFM A;  1JMK C;  2YC0 A;  4LF9 B;  1ENV A;  4DR2 O;  4DV7 B;  4DR5 B;  3I55 V;  4DV2 B;  2HVK C;  5CN0 A;  2OIG A;  1FJG B;  1KU9 A;  3ZHT A;  2F93 B;  3OAA G;  3GWK C;  5H5N A;  1YF2 A;  1FFT B;  2EIL B;  3E35 A;  1NTZ H;  4JYC A;  1KUQ A;  3UCS C;  3JSL A;  2DMX A;  4YJ2 B;  2B1I A;  3EFF K;  1OCR C;  3WB1 A;  4X1K A;  2XAG A;  4EB6 B;  3G67 A;  5IE9 A;  2E74 B;  1B04 A;  4DR4 B;  3H01 A;  3T1Y B;  1VQO V;  3D8C A;  3JAS B;  3OR7 C;  2WA3 A;  4BR6 A;  4ZI7 A;  3L70 H;  5KHK A;  3HKD A;  1JR9 A;  5A2Q N;  3QNE A;  1MZF A;  4PA6 A;  1X59 A;  4JAS A;  4QE9 A;  1ARO P;  1Q43 A;  1S5H C;  1AP5 A;  3CCR V;  4UV8 A;  1ZTE A;  3BY6 A;  1ZX3 A;  1EBO A;  1WN7 A;  3P3N A;  3KZI Z;  3JAT B;  3IC7 A;  1P84 F;  1VQK V;  1FFX B;  3JAL B;  2BE3 A;  5EZY B;  2M6Y A;  4TV9 B;  1GAX A;  2YI9 A;  4PI0 A;  1WB8 A;  5FNV A;  2DE0 X;  1O9G A;  1SA0 B;  1MA1 A;  2JIZ G;  4LC1 A;  2OYQ A;  1QCE A;  2F4V B;  4LF5 B;  4XBF A;  1JJ2 U;  3QO5 A;  5IT9 N;  4X9Q A;  4LFB B;  1Q8I A;  4FFK A;  1GRJ A;  1XQ8 A;  1N32 O;  3KG2 A;  2OCC C;  1ZSP A;  1VQ9 V;  1YSC A;  2P67 A;  3TK1 A;  4R50 A;  1G8M A;  2Z5U A;  1S3J A;  4U7O A;  3ZED A;  1QQC A;  2RN9 A;  4YHH B;  4QIW F;  4AI8 A;  2GTA A;  1F4M A;  4B3S B;  4JI3 B;  1GTO A;  4E4E A;  2F43 G;  1F7Y A;  2QA4 V;  5HFL A;  1R3L C;  3GVM A;  4FK5 C;  1R3K C;  1YXB A;  3DGE A;  2R9I A;  4ASU G;  4MTF A;  2RDC A;  2FL4 A;  1XRE A;  4OX9 B;  2NLJ C;  2QWR B;  5IDJ A;  3JAL A;  1IX9 A;  1RPO A;  1D5N A;  1PPJ H;  4TWK A;  2EIN C;  1HR0 O;  1KMI Z;  1XHX A;  2QM7 A;  3Q4H B;  4X62 B;  2IM9 A;  1GN2 A;  4IT5 A;  2JJ2 G;  3C3S A;  3N2G B;  4ICG A;  3BCC H;  4J7J A;  3E86 A;  2B5U A;  2ITD C;  4FPP A;  2JJ1 G;  5BR8 B;  2EIK B;  1NZ6 A;  2KQX A;  3E8B A;  1W0K G;  1R6K A;  4DV1 B;  4I4T A;  1NQT A;  4QPK A;  3E8F A;  4NXN O;  3RYF B;  1QU7 A;  3VOU A;  1PNM A;  1B6Q A;  4LH6 A;  1CEZ A;  1Q5O A;  2QSA A;  1U96 A;  1OZ0 A;  3DC5 A;  3WB0 A;  2OCH A;  2YIB A;  2WAM A;  2ZE8 A;  3G71 V;  5DEC A;  4B7E A;  3F5W C;  3H1H H;  3K08 A;  2R72 A;  4HYO A;  4TOI A;  2WLI B;  2EZP A;  2ARH A;  1R6T A;  2X6C A;  2XAS A;  4Z2W A;  2AZ2 A;  1BHB A;  1FXH A;  4R8C A;  1YJ9 V;  1N33 B;  2XHB A;  4WFA V;  2H3O A;  2XT9 A;  2LW7 A;  5JJN B;  1BCC H;  2BOB C;  4DW1 A;  1E1R G;  1N36 B;  1OCO B;  3FB7 C;  1K92 A;  2DYS B;  4FZ1 A;  2ZE7 A;  5D5Q A;  2Q7H A;  4X8A A;  2KKW A;  4CZZ A;  1SET A;  3RT3 C;  4X1K B;  4OGQ B;  4J9Z B;  3ZMV A;  3FB8 C;  4O2B B;  3UT5 A;  4X62 O;  2HHH B;  4GKK B;  3SJQ C;  2WA4 A;  1FAF A;  3JAK A;  3L9D A;  2IH3 C;  1HNW B;  4DV2 O;  1EM1 A;  4U3J A;  2Q68 A;  3CJH A;  4MTG A;  1SS3 A;  2PUS A;  1FKA O;  4HNA A;  2KG7 B;  5B1O A;  3IFX A;  5LP6 B;  3RVZ A;  4LF8 B;  2BTQ A;  3U0Z A;  1XL6 A;  2Y4U A;  5H6R A;  4L8J A;  2QM8 A;  1L0N H;  3CCQ V;  3ZN0 A;  1Q6I A;  4Q20 A;  3SJB C;  2YI8 A;  2GSM B;  1KKC A;  3BA8 A;  1SF9 A;  5LP6 A;  5LOV B;  4FLX A;  2ZD9 A;  2V1D A;  3CRA A;  4X1Y B;  3ETE A;  4YHH O;  1Z5V A;  2RMK B;  2X7R B;  2YSU B;  3ZRX A;  2CDY A;  5IJ0 B;  3J81 N;  5B66 Z;  2QWQ B;  3RYC B;  3KCX A;  3K5N A;  2EIM C;  2FTK A;  4LFC B;  1NVP B;  1NH2 D;  2P06 A;  3JCZ A;  4K35 A;  3RYH B;  1YIJ V;  2N04 A;  5FL7 G;  3SR2 C;  1K73 W;  2F95 B;  3AK2 A;  4PV1 B;  3SGI A;  1BSM A;  4U3J B;  5KLV H;  1XI1 A;  1HNZ B;  1H2N A;  1I0H A;  1JFF A;  2VWJ A;  4UVB A;  5DM6 V;  3AG7 A;  4J7Z A;  4GKJ B;  5C93 A;  2VQE O;  1N0N A;  1EN6 A;  1F23 A;  1BHA A;  1G1X B;  3FAV A;  3K3W A;  4BWA A;  4EB6 A;  5LA6 B;  3STL C;  4TV8 A;  4H0L B;  1Q86 W;  3RYI A;  4UFZ A;  3LNM B;  3RVY A;  4X66 O;  3D36 A;  2MK3 A;  1SZT A;  2DQ0 A;  2QWN B;  4LWS B;  2EUL A;  3AG4 C;  2ZM6 O;  1COW G;  1TUB B;  4X20 A;  2VWK A;  1AB3 A;  4LCU C;  2ITC C;  1A32 A;  2IJK A;  4JI6 B;  2Q67 A;  1IVS A;  2XUM A;  1V55 C;  5ITZ A;  1HNX O;  5CA0 A;  2IJI A;  4H44 B;  4JI0 B;  2L35 A;  2M7W A;  5CA1 B;  3SJC C;  5C8Y A;  4GX1 A;  3GB7 C;  4JI7 B;  3CC2 V;  1BS3 A;  4DV1 O;  2LP7 A;  1UPG A;  3H1I H;  2EIK C;  2W6I G;  3E89 A;  3CRC A;  1OCC B;  1JQ0 A;  5LHG A;  5KMG B;  3SYQ A;  3JYC A;  1HNX B;  5J2T A;  1SQG A;  2YXL A;  3JAW B;  1W0J G;  4MTO A;  4MTX A;  5LA6 A;  2PYJ A;  4O2A B;  5H9C A;  3K9S A;  3K04 A;  1LNQ A;  1UFI A;  4DR3 O;  1RSO A;  4UXN A;  1QBZ A;  3STZ C;  3L71 H;  2WLN A;  2BTO A;  4LF6 B;  3GWO A;  2ILM A;  4JI3 O;  4BIZ A;  4DR7 B;  4IHJ B;  3ZBH A;  4D7T A;  5JJJ B;  3E8G A;  3JCU Z;  1H2S B;  1IBL B;  1BE3 H;  4PD4 F;  1GN3 A;  3B77 A;  3UQ8 A;  1YTF D;  4DYL A;  3ABK B;  5ITZ B;  1H2L A;  2XAJ A;  2P7T C;  3AG3 C;  2AXT Z;  1AI6 A;  3IAY A;  3T1C A;  4AIL C;  1YDX A;  2LGW A;  5DN6 G;  1KBH A;  1FD9 A;  4MW3 A;  1Q6U A;  4JI4 B;  4O4J B;  5L3B A;  3B09 A;  4FLZ A;  2FYU H;  1QVG U;  5EIB D;  2F4V O;  2HHH O;  4GKK O;  3KCY A;  2UU9 O;  2A06 H;  4X65 O;  1VQ7 V;  1T5E A;  1GK9 A;  3RBZ A;  1B3Q A;  4TT3 G;  1FJG O;  3ABM B;  3KKY A;  5GON A;  3ZMU A;  4F6R B;  2QKA A;  1TAE A;  1S0V A;  2RNB A;  1XNQ O;  3JAR A;  4IIJ A;  1EFR G;  3BVO A;  1V54 C;  1N8R W;  2PF4 E;  3M99 B;  3NXS A;  3U10 A;  5CBG A;  1OCO C;  1V54 B;  4NXM B;  2PYL A;  2F1M A;  5L3C A;  1TA8 A;  4NTX A;  4XDJ A;  4DV3 O;  5B1B C;  5JQG A;  1YVW A;  3DXR A;  5KA6 A;  5EYP A;  3WU2 Z;  4I55 B;  5CB4 B;  2CH7 B;  3HPL C;  3MHS C;  1IBK B;  3P32 A;  3CC7 V;  4DUY O;  2YIC A;  4LBE C;  4MVZ A;  5B3S C;  5JH7 B;  1L8D A;  4UV9 A;  2CTR A;  1KB9 F;  5IJ9 B;  4CH3 A;  1QVF U;  2UUA B;  5LHI A;  4FIP C;  2YID A;  4QGP A;  2MW2 B;  5LYJ A;  4X1I A;  3AG1 C;  4PDM A;  4JI1 B;  4MVO A;  4F6E A;  1J95 A;  1SZX A;  3CP1 A;  2ZNJ A;  4GX5 A;  3AG2 B;  3G4S V;  2RJZ A;  2WPD G;  5KUM A;  3K5M A;  2CK3 G;  4EEQ A;  1IXM A;  4ZBM A;  1K7D A;  5B5E Z;  2XTA A;  5JH7 A;  1N0J A;  1SQV H;  5CBF A;  1OV9 A;  2WLL A;  4PJ0 Z;  3SYC A;  1SA0 A;  1S5J A;  4GKJ O;  4FZ0 A;  3SJA C;  1N34 O;  2HLD G;  3SYA A;  4UCS A;  1Y76 A;  4ABM A;  2RCV A;  4I7Z B;  1HR0 B;  2QM4 A;  2EIJ C;  1K97 A;  5LXT A;  2CGN A;  3CD6 V;  4JI2 B;  2EX3 A;  2ZIM A;  2JDI G;  4G27 B;  4I9Q A;  1VMG A;  4X89 A;  2F66 C;  2Q8V A;  2KG7 A;  1PD3 A;  3CJH B;  1HP8 A;  2ATK C;  2PI5 A;  4P9O A;  5IYD O;  3K79 A;  2P90 A;  3B2E E;  2ZM6 B;  4JTD B;  2LW1 A;  4JI7 O;  5EBM C;  2AHZ A;  1AP6 A;  2JS3 A;  1FXV A;  4O4I A;  1IZ3 A;  2P4K A;  4JI1 O;  4GX0 A;  4JYA O;  3APQ A;  3RFR A;  3TXS A;  2E5L B;  2XND G;  2Q0O C;  1E79 G;  4YY3 B;  5FLX N;  3CSX A;  1Y76 B;  1JFF B;  1K4D C;  1XOU A;  4I50 A;  4O4J A;  2QGN A;  4GCZ A;  1WA8 B;  3ABM C;  3CYO A;  1YI2 V;  1LUV A;  1GMG A;  2A9H A;  1FS0 G;  2VQE B;  1AVM A;  1J5E O;  2BOC C;  4N21 A;  1CPY A;  3TCU A;  2D2C B;  1VF7 A;  1VF6 A;  2CUG A;  2BCC H;  1Q7Y W;  3C90 A;  3TJT A;  1AI7 A;  4JYB A;  2QDO A;  2ZR2 A;  2UXD O;  4JAU A;  4IIJ B;  3ZRW B;  4J41 A;  3M8A A;  1BQZ A;  4YXW G;  1MNG A;  4JYY A;  4EKW A;  3CX5 F;  2N05 A;  4O2B A;  1K3E A;  3ZN1 A;  4YJ2 A;  4FLV A;  4LNU B;  4ZHQ A;  4MS2 A;  3THO A;  2NN4 A;  1H8H G;  3CCJ V;  4I55 A;  4BIO A;  2LFR A;  3X2Q B;  3CXH F;  1DLB A;  3BA9 A;  4KUM A;  3SPI A;  4X1I B;  5EC2 C;  1XL4 A;  4DR2 B;  3CC4 V;  4MT8 A;  3ETQ A;  1E1Q G;  3EXA A;  4NVP A;  1AR4 A;  4LF6 O;  2WSS G;  4G2K A;  4NR1 A;  5KHJ A;  4WBN B;  3PN1 A;  2ODM A;  4IYI A;  4EFB A;  3RWR D;  4NXM O;  1MMM A;  2OIE A;  5J2T B;  1VQM V;  3BEH A;  4DUY B;  2NR5 A;  1CXZ B;  4QNH B;  1RPR A;  4PA3 A;  4TQD A;  1JCH A;  1ZL8 B;  2DYS C;  4WFH A;  4RQE A;  2EIJ B;  3ABT A;  3ASN B;  1J5E B;  5IYZ A;  4AHC A;  4ZI7 B;  1VQ4 V;  3LSU A;  1KYO F;  3ZHV A;  3NR7 A;  2GUZ B;  2Q4P A;  2JGD A;  2UUC O;  4DK0 A;  3A0R A;  3CCE V;  3JD2 A;  2XAH A;  3CME V;  4JV5 B;  2VS0 A;  4WFE A;  1VF6 C;  4CS3 A;  3CXC U;  3O65 A;  4UCR A;  3QO7 A;  3E8H A;  1VP7 A;  4RUF A; 
#chains in the Genus database with same CATH homology
 4B3T O;  2UXD O;  1NS1 A;  4DR2 O;  4DV5 O;  1F7Y A;  5IWA O;  4GKJ O;  1N34 O;  4JI4 O;  3RT3 C;  3M8A A;  4LF4 O;  4A5U B;  4OPA A;  3T1Y O;  4JI2 O;  4DR6 O;  2JRI A;  1N33 O;  4LF9 O;  4LF8 O;  1IBK O;  4DV0 O;  4JV5 O;  4X62 O;  5H5N A;  4X66 O;  2F4V O;  2UXB O;  2HHH O;  4GKK O;  3T1H O;  2UU9 O;  4X65 O;  1FYJ A;  2ZKO A;  4DR4 O;  4JI6 O;  5BXZ A;  1KUQ A;  3R66 A;  2ZM6 O;  1FJG O;  4DR1 O;  4DV4 O;  1HR0 O;  4JI0 O;  5LL6 Y;  3J7A U;  1XNQ O;  1AB3 A;  4JI8 O;  4K0K O;  4OPH A;  4DV2 O;  1A32 A;  1FKA O;  4LFB O;  4LF7 O;  1AIL A;  2FKX A;  1HNX O;  5BY1 A;  5A2Q N;  2DOS A;  1X59 A;  4X64 O;  1IBM O;  4DV3 O;  4JI7 O;  4DV1 O;  5LMU O;  2E5L O;  2UUA O;  5BR8 O;  4NXN O;  4DUY O;  4LF6 O;  4DUZ O;  4JI1 O;  4JYA O;  4NXM O;  2N74 A;  4DR7 O;  2DJV A;  4YHH O;  3SDL A;  1IBL O;  4B3S O;  5FLX N;  1I94 O;  5LMN O;  1DK1 A;  4DR3 O;  4LF5 O;  4LFC O;  1R1B A;  3J81 N;  1YZB A;  4B3R O;  3F5T A;  1HNW O;  1R6T A;  1HNZ O;  1XNR O;  4JI5 O;  2AGA A;  4JI3 O;  4B3M O;  4DV6 O;  4OX9 O;  2Z0A A;  2UUC O;  5IT9 N;  1J5E O;  3OTO O;  2UUB O;  4LFA O;  1XMO O;  1N32 O;  4AQY O;  2UXC O;  2VQF O;  1XMQ O;  3JAM N;  2LW7 A;  1XEQ A;  4DV7 O;  4DR5 O;  3O65 A;  1D2D A;  2VQE O;  1N36 O;  4KHP O;  1G1X B;  4YY3 O;  3J80 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...