3J81N

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j81N02
1XMOO 1R1BA 1I94O 4LF4O 4OX9O 1NS1A 3O65A 4JI5O 4DV2O 4JYAO 2DOSA 4LFCO 1N34O 2F4VO 4B3SO 4DV0O 4NXNO 4X66O 4LFAO 4YY3O 5BR8O 4DV7O 4B3RO 4JI1O 4DR5O 4JI3O 3SDLA 4JI6O 2VQEO 1XNRO 1R6TA 3J81N 3T1YO 3J80N 1FYJA 2UXDO 3J7AU 2UXBO 2N74A 1HNZO 3RT3C 4LF5O 4DR4O 1HR0O 1F7YA 4JI2O 1IBMO 4KHPO 2UU9O 1J5EO 4LFBO 2ZM6O 2JRIA 4DUZO 3JAMN 4LF8O 1YZBA 4LF6O 3M8AA 4DV3O 2Z0AA 4GKKO 4A5UB 4JI7O 4X62O 4DUYO 5BXZA 4DV6O 4JI0O 2E5LO 4OPHA 4DR1O 1KUQA 1N32O 2UUAO 4K0KO 4JV5O 1G1XB 4DV5O 2UUBO 2AGAA 5BY1A 4DR7O 5FLXN 4X65O 1IBKO 3F5TA 1N36O 1N33O 4JI4O 4DR3O 1HNXO 2LW7A 3R66A 5LMNO 1A32A 5LMUO 4B3TO 5A2QN 5IT9N 2ZKOA 1FKAO 4AQYO 4GKJO 1IBLO 1DK1A 4DR6O 5LL6Y 2UXCO 4OPAA 4YHHO 2FKXA 3OTOO 1XNQO 4LF9O 5IWAO 1X59A 4DV1O 2VQFO 2HHHO 1D2DA 1HNWO 4X64O 1XEQA 4LF7O 4B3MO 5H5NA 3T1HO 1XMQO 2UUCO 1AILA 4DV4O 1AB3A 1FJGO 4NXMO 2DJVA 4DR2O 4JI8O
chains in the Genus database with same CATH superfamily
4FLYA 5JCOC 1E1QG 1S5HC 4TV8A 5C93A 2N05A 4K35A 2CK3G 3QTCA 2HVKC 4NTXA 2ZE6A 4DR5O 1R3IC 4LF7B 3B8NA 3W7WA 4DYLA 4DO2A 3K0GA 2LJ2A 4X1IA 3SPJA 3CXCU 3N2KB 3CX5F 3E35A 4JI2O 2CTRA 5IY5B 4YJ2A 3ZHTA 3B77A 4UVAA 1I0HA 3CJHB 2P90A 4DV7B 2EINC 2P6JA 4EB6B 1NKDA 3JAMN 1YZBA 2BSKA 4A5UB 5BXZA 4U7NA 4N23A 1OCZB 2UUAO 1F23A 3JD1A 4X1YA 2P06A 4LF5B 4IL6Z 1BL8A 2F66C 4LWSA 1RP3B 1YJWV 1V54B 5J2UB 4EFBA 4LC1A 1SQPH 4F6RA 4B3TO 5IT9N 2QWQB 1PNKA 3RYHA 2XAQA 2W6JG 5EIBC 3OD4A 4JI1B 1H2KA 1H2NA 2WLIA 3I5DA 2PF4E 4GCZA 5E1AC 3A0HZ 2AZ2A 3IJ4A 4Z1VA 1JFFB 1XL6A 1ENVA 2QM7A 1DTOA 3BVOA 5LMUB 5BR8B 3VQWA 5L3EA 3FB8C 1ZL8A 3G67A 4G28B 3P3PA 1LR1A 2Y69C 4DR2O 5LGTA 5EZYA 3E8GA 1R3LC 2Q67A 1IX9A 2LGQA 3OUSA 3QO8A 1H38A 4WBNA 2YSUB 1AI4A 1SQGA 2IH1C 1SA0B 3CE2A 3OE7G 4TV8B 1Y4MA 1FPOA 4PA3A 3J7AU 4PA6A 1IXMA 1W59A 1Z5VA 3CCQV 4X1KB 2Q7HA 5CB4A 1V9PA 1M57C 3T1CA 3X2QC 1XUQA 4FPPA 5CA1A 4F4LA 3FB5C 3FYIB 1RSOA 2RQ6A 1QQCA 5EBMC 1FXKB 2GDSA 5LP6C 2Y4TA 3M8AA 2F43G 4BIZA 1CP9A 5B1BB 4UB8Z 5F2VO 4EFEA 3CJHA 3K5MA 3JYCA 5CA3A 4O2AA 2IW5A 4CH6A 2BSKB 1Q7YW 5JVDB 3RYFA 1V55C 1QR8A 3UO2A 2BTOA 3GWOA 4Q20A 3CC7V 1VQ4V 1M9NA 1FKAO 2Y48A 2EILB 3B4SA 3AG4C 2CGNA 4ZHQA 3JAKB 1NTZH 1R3JC 1QU7A 4I4TB 3AK2A 2WLKA 2BE3A 4I50A 2EJRA 4X1IB 3S3WA 4ABMA 3H1LH 2DWEC 4DV4B 2YUAA 1YCIA 1VQPV 1XMOB 3CC4V 2IJIA 3F5WC 4WFEA 3JASB 2LP7A 5LA6A 3MAQA 2PYLA 1Y6XA 1NI8A 1GTOA 5K1XA 2LFRA 1Q6UA 2GUZB 1FXVA 2GSMB 1SERA 1Z5WA 1H2LA 3T1HO 3ETDA 1AILA 3ABMB 3L9DA 4TV9A 4X1YB 2XAFA 3ZHQA 4QE7A 3AG3B 4RUFA 1YF2A 1GMGA 3ZX6A 1AJNA 2Q6AA 4JI5O 3H1JH 3IGAC 4GX1A 5DEDA 4DV7O 1YTFD 4BAYA 1YIJV 4J7ZA 4PA4A 2VQEO 4CH3A 3I55V 3N2GA 1FYJA 2UXBO 1IBLB 1YVWA 1GK9A 3A2FA 4FLXA 2WLLA 1SA0A 2JS5A 1B04A 2EZOA 2NLJC 4O2BB 2IJHA 2UU9O 4LF6B 5IWAB 3Q4HA 4NR1A 4JYBA 4DW0A 2P22C 2OWOA 1PL4A 2JEXA 3EHBB 4JI6B 1KUQA 4CZZA 3T1YB 4UB6Z 3OTOB 1NR1A 5EZYB 4GX2A 2OTLV 4LF9B 4GZRB 2QTOA 1TUBB 1Q6IA 3TXQA 3ZN1A 5A2QN 4AQYO 1Y76B 2Q0OC 3E8BA 4LWSB 1YDXA 4JTAB 3ABUA 1WLEA 5CB4B 1OV9A 3QVNA 4OPAA 5J9PC 1XNQB 4UV8A 1WPBA 1MZFA 4KHPB 1RSOB 1S5JA 3LDCA 1XOUA 1RPOA 2XOKG 3DGEA 3E83A 3SYCA 1X59A 1AI6A 4K0KB 3OEHG 1XEQA 3ETEA 2DYRC 5L3FA 4UVCA 2E5LB 2UXXA 2QM4A 3HKEB 4U3FH 1SF9A 2L6LA 3UO3A 1Q90D 4O2AB 2R9IA 4DRXA 2X0LA 2M6YA 4LF4B 1U97A 2Q8VA 4FVMA 5LXTA 2G38A 5IJ9B 4MVRA 4U7OA 1URFA 4LFAO 2UXNA 4UUJC 2DYSB 3H01A 3ZRXA 3B8MA 4BIOA 2RNBA 3J81N 4DV5B 1NR7A 4ZKIA 1QR9A 4I55A 4F6EA 3STZC 1WP7A 3TXSA 4BIUA 3LNMB 2F23A 1K33A 4FM1A 3CRQA 2L35A 4JYAB 3L72H 4FLWA 4G27B 1J5EB 4YY3B 2ZM6O 1OCCC 3M99B 2BTQB 4GKKO 5CA1B 1OCOC 4LBEC 2JJ1G 1M1KW 3ZCCA 4N21A 5B1OA 1CEZA 5KMGB 4MT8A 4IYHA 2IBZH 4X8AA 3W7SA 1S5LZ 2GTAA 5KX5A 1ROPA 3HKDB 1VQMV 2A79B 2QDOA 2QKAA 2ZQMA 5KLVH 3ZRWA 2UXCO 3ASNB 3ZRSA 4UVBA 5IJ0B 5JH7B 3H1IH 2FB5A 4X20A 4FLZA 5FPOA 4I4TA 2H3OA 2EIJB 4NB5A 5DECA 3WG7C 3B40A 4DV1O 4DUZB 4O4JB 1OCOB 2GV9A 3OFNG 3JATA 1IDSA 3JCZA 5LP6B 2WA3A 1VQ9V 3E2EA 4XBFA 1L0LH 1AI5A 2VWKA 1XMOO 3RYFB 5JVDA 2A06H 2R9RB 3JALA 4JAUA 3W7TA 1VF6A 5AG2A 4AI8A 4JI3O 4B3RB 4L87A 4ZOLA 4X62B 3WB0A 3JAKA 1J95A 1HR0B 3C3SA 2KKWA 4FZ0A 2DYSC 2QJ1A 4TQFA 1KP3A 5LOVA 3MDSA 4J41A 3BPZA 3QNEA 5FNVB 4E4EA 2HG5C 1VP7A 1R73A 4EEQA 2PI5A 2AZ0A 5L3GA 3ZHRA 4JAAA 1QLNA 2ZE5A 2H8PC 2K1EA 1WA8B 1GN6A 3G4SV 5KHJA 1NVPB 3QO5A 1PM9A 4J80A 4X65O 1SQBH 2ZIOA 5FL7G 1MABG 2F1MA 4X66B 2WLHA 4WFFA 3R66A 3RFRA 4J10A 3K9AA 5KHHA 3FB7C 3H1HH 2NN4A 4PJ0Z 3D36C 4JV5B 2JIZG 5BZBA 1LUWA 1RM1B 4YHHO 3HR0A 5KX5B 2ZDIC 1Q81W 4P9OA 2XNDG 3ZHUA 1SRYA 5CA0A 1W2BU 5CN0A 1SQQH 1EZVH 4UCUA 1OCRC 2EBOA 4X20B 4DV1B 1SQXH 4C7UA 4PHZA 3AG1C 3AG3C 5H5NA 2QR4A 3WB1A 2QEXV 4DR6B 2K9PA 4IIJB 4RQEA 3GVMA 1T5EA 3WG7B 5KMGA 4NVPA 4O4HA 4HAMA 3K3WA 1I5XA 4ZI7A 1S77D 4JASA 2XAGA 3K79A 1WB8A 1IVSA 5BR8O 3T4DA 1PD3A 2W0XA 5B5EZ 4P30A 3CMAV 4FZ1A 1Q43A 2M7WA 3CCJV 3U0ZA 3CB2A 3LSSA 3W7UA 1HR0O 4H33A 2YICA 2WWWA 2VRZA 1UPGA 4WFGA 2CTWA 3K06A 4GUNA 2HJDA 2LW1A 3CD6V 4DV3O 4GT1A 1GM8A 1H8HG 4JI7O 4GX0A 3AG1B 4NKGB 4YJ2B 1F51A 4JZGA 2UXDB 1O9GA 4K0KO 4AILC 4FLTA 1FXKC 3D8CA 4DRXB 3U11A 3A0BZ 3UT5B 5B1BC 2QTSA 1AP5A 2BOBC 4WF9V 1N33O 1YXBA 4R6ZA 2X7RB 2P4KA 4LR3A 1A32A 3BAAA 1QLEB 2YIAA 1FS0G 2JVDA 1FXHA 1XMQB 3K03A 1RPRA 3FKSG 3FD9A 4DR7B 1JR9A 2FKXA 5LGNA 1KKCA 1XQ8A 2DYRB 4IYIA 4LF9O 3DC5A 4MVOA 4YJ3B 4O4LA 2Z5UA 2D3OW 2DN9A 3ZMUA 1KYOF 4WFAV 4UXNA 3ZMZA 1WA8A 2JJ2G 4J7KA 1Q86W 1ZAUA 3A8TA 4JI2B 4UCTA 3F7YC 3H9VA 1L8DA 4O4JA 3ZMTA 3JATB 2ZNJA 4NXNB 1BHBA 1Y74A 3NR7A 5L3CA 5FPRA 1XREA 4JI1O 3K0DA 2Q69A 3JSLA 4TOIA 1O9HA 2Y4UA 2EIMC 1XNRO 4FFBA 2YC0A 3CEIA 2B1GA 2N74A 1YTFB 5J2TA 4LF5O 3G80A 3CP1A 1OCCB 5J2UA 4KHPO 1P4RA 2OIEA 4F6RB 5CBFA 3T2MA 4DV6B 2EIKB 4R8CA 1G6UA 4X62O 2E5LO 2UXBB 3UCSC 2PYJA 4DV5O 1BQZA 1M90W 1AJPA 3ABTA 3R65A 2QWNB 4DR3B 2Q4PA 1JQ0A 1MSWD 5JJEB 4JYYA 4BW5A 5BMVB 3UT5A 3AK1A 4ICGA 4GLXA 4GKKB 3BA8A 5LL6Y 4Q6GA 5HFMA 4QPJA 5DN6G 4LNUB 4K8ZA 5LGUA 5KAIZ 4MVZA 4HZ3A 4KP4A 3DXRB 3DC6A 2H94A 1EN5A 3UM7A 1H2MA 2EINB 3FAVA 4RQFA 2RJZA 4Z1MG 3SJQC 3I56V 2UUCO 1AB3A 1XBLA 4JI8O 2UXCB 4QIWF 1G8MA 3L74H 1D5AA 4JYAO 4JTCB 4DV0O 3AG4B 4X66O 4TV9B 1NTMH 3JARA 1E79G 1SZTA 1NH2D 4MTXA 1I7FA 2QA4V 3T1YO 1XNRB 5GONA 4DR4O 1IURA 1W0KG 3VQYA 1QBZA 3CMEV 1JX9A 1IBMO 3K04A 4R50A 2ZDIA 1IXBA 2YIDA 2Q0AA 3TK1A 3PN1A 3F7VC 4ZHQB 5H2FZ 2YIBD 3A0RA 2A7WA 1ZWIC 4X1KA 3KKYA 3ZMVA 2YI8A 5L3BA 2DE0X 3GWKC 4FLUA 1I94B 1P49A 3ZIAG 4HNAA 5K1PA 1B6QA 3D3IA 1RM1C 4MVUA 2IM9A 4GKJO 2PI4A 3ZHSA 3CCUV 3LSUA 4Z2WA 2A0LA 2Q7EA 4X9QA 2HJFC 1OCRB 1BSMA 4JI4B 4I50B 3CRRA 2Y69B 4FFKA 2GTSA 3RGBA 2DWDC 3UQ8A 2R72A 3BCCH 1Q82W 4DV4O 5JJJB 1UJWB 1FJGO 2UUCB 2GUZA 3SR2C 2F93B 2WLLB 2ZR2A 5D5QA 4H0LB 1FFXB 3JD0A 2F4VO 2OTJV 4AQYB 1H8EG 1HDJA 3FYEB 1SESA 4JI6O 2LQTA 1N0NA 1M56B 2XASA 3OT7A 3SPCA 1SQVH 2XUMA 1HNZO 3FB6C 4FMTA 3CC2V 3AG2C 4WFBV 5H9CA 1YEWA 1N34B 4JAVA 5H6QA 3N2GB 2EILC 2Y0PA 1XILA 2YEVA 3SYAA 2CH7B 1R3KC 2JGDA 4P2ZA 1K97A 4YXWG 1KBHA 1NQTA 3DXRA 2JRIA 1K7DA 3HB3B 1Y76A 2PZSA 2Z0AA 3FAVB 3SJAC 1MSDA 1GM9A 4NXMB 2UUBO 5GTIZ 5FLXN 3CRAA 1K4CC 1L0NH 1KKDA 4LFAB 3ZBHA 4J42A 5LMNO 3H1KH 1YJ9V 3Q4HB 1VQNV 1OHHG 1HNWB 1XHXA 1ZLZA 1R6KA 1M93A 1OZ0A 2BOCC 3IFXA 4FIPC 1PP9H 1ZX3A 1HP8A 4PELA 1COWG 4D6TH 2AHZA 3ABKC 4BR6A 1P84F 3MHSC 2EZPA 4JPRA 4MSWC 1W0JG 4B3MO 2EIKC 1XMQO 1VIBA 2X6AA 4YHHB 3E86A 2LGWA 3RYCA 2YI9A 4DR4B 3CWBH 1BE3H 1F4NA 1TGOA 2ARHA 4LFCO 3CCVV 4NXNO 4HNAB 4CC5A 4YY3O 3UKMA 5LBQA 2F4VB 5KUMA 4JI3B 4B3RO 4D7TA 4DV3B 4U3JA 3JAWA 5LXTB 2DQ0A 2GBOA 3CCMV 1K3EA 2UXDO 5JWPA 3QG5A 4IT5A 3HKEA 2XTAA 4BW9A 5GW7A 1F7YA 2CAZC 3CYOA 4XDLA 2Q7GA 2W0FC 3CXHF 1DLBA 3JCUZ 4XDKA 5B3SC 2HKOA 2QKSA 3M7MX 1GH6A 1VARA 1Q8IA 5GONB 2CTQA 5B3SB 2ILMA 4DUYO 2EIMB 2EJ7A 1MA1A 1KD1W 5IYZB 4I55B 3K5OA 1MMMA 3SJCC 4IHJA 2KB1A 1K34A 1H2GA 1CXZB 1P7BA 3LNNA 2FYUH 3AEIA 1EZJA 4DR3O 1GRJA 1OCZC 2LW7A 5JQGB 4HBNA 1VMGA 4X88A 1K5QA 4LFBB 3IC9A 3BA9A 1KECA 4LCUC 1VF7A 4PDRA 5IY5C 1VF6C 4H37A 1M5IA 2ZE7A 5B1AC 3OAAG 5B66Z 3JALB 4I0XB 2QM8A 4TQDA 2JDIG 4PA7A 5D5PA 4PV1B 3VQVA 3KG2A 4QJFB 5EC1C 4LH6A 4PDVA 3G71V 4X64O 4LF7O 3B09A 1BS3A 4TUYB 3ZS8C 2A3QA 2QE7G 1GAXA 4L8JA 1AJQA 1Q3EA 2E75B 1SKVA 1NS1A 2WPDG 4CS4A 4B7KA 1N34O 4TSFG 1WNSA 3VQXA 1QLEC 4DV0B 4LFCB 1JA8A 2LO1A 2OCHA 4JI0B 3SDLA 1EBOA 4I7ZB 3ABKB 2QWRB 4O4HB 2ZXWC 4D7SA 5LHIA 2CUGA 4JZ2A 3SYOA 1GO3F 3KCYA 1N33B 4DK1A 1IBKB 3BRCA 3PJSK 3ZRVA 2ZM6B 4RUEA 3MD0A 3CCLV 4X89A 1YITV 4UCRA 2NNUA 2HVJC 5LHHA 1PKXA 2CH7A 2P67A 3TETA 3KZIZ 4JV5O 3N27A 2WLNA 1KQSU 5E79Z 3F5TA 4G2KA 2IU0A 1FFXA 2B5UA 4PA9A 2RN9A 1M57B 3X2QB 4GX5A 1TAEA 1TVKA 5EBLC 4DXWA 1VQ8V 3L70H 1JPXA 2LFSA 4I9QA 3O9OA 4DR6O 4CC6A 3ABMC 1N36B 2ZD9A 1UFIA 1XHZA 1KU9A 1QHTA 2HR3A 1NT2B 4DR2B 1K9MW 2N04A 2YEVB 2KG7A 4PI0A 1AR1B 1M56C 2CDYA 2V4DA 3C3TA 1VQOV 4JI7B 1V54C 1KB9F 1BHAA 2HHHO 1JVMA 1KMIZ 1HNWO 2PY5A 3OR7C 1EN4A 4X64B 1TA8A 2E3CA 4NXMO 2F95B 1SQFA 4DV2B 2KSDA 5IE9A 4OX9O 2A9HA 1IBMB 5JQGA 1SZXA 3L73H 1L1FA 4TUYA 1M4UA 1XL4A 1Q6HA 2JEUA 1PPJH 1K92A 3P32A 5LHGA 3E89A 1I5YA 4UFZA 3J80N 1E1RG 2DQ3A 3IC7A 2CE4A 2JK5C 4FLVA 2OYQA 1NH2B 3RVZA 2WLMA 4P9PA 2Y0IA 3AG7A 2ADPA 5B1NA 1FJGB 1GN3A 3JAWB 3JD4A 2ZINA 3E8FA 4UCOA 4ZI7B 4MVQA 3G6BA 3EXAA 1I08A 4PDLA 5EK0A 1KC8W 4DW1A 4LF6O 3OEEG 3P3NA 2OT5A 1G1XB 5IYBO 2OIGA 3STLC 1BQ0A 2PTMA 4DR7O 4MVMA 1GKFA 2ODMA 3AK3A 1G4YB 4MW8A 3DSQA 1OJHA 2YIBA 1R6NA 3IAYA 4YIOA 4MTFA 2XHBA 2KQXA 4OGQB 4DR1B 3ML0A 1WAZA 3JSNA 3NXSA 3JASA 1Y67A 4PI2A 3C90A 3T1HB 1TVKB 2HEPA 2ZR3A 5BMVA 4TWKA 1ORQC 1FFTB 4YIPA 4NTYA 1ZSPA 4O4IA 3ASNC 5CBHA 2ITDC 3ZJZA 4B08A 4GKJB 3D36A 4J9YB 2V7QG 1LNQA 4DUYB 4DK0A 5IYZA 5HFLA 3CHXA 3L71H 4YJ3A 5EYPB 3RYIA 5IDJA 5IYCO 3GB7C 5EIBD 2DJVA 3CS5A 3G6EV 1I94O 5EBWC 3ICXA 4DV2O 3OMAB 4TT3G 4B3SO 1H2SB 1GN2A 5GTHZ 3CPWU 2XAJA 2IJKA 4JYCA 1R6TA 3ZMSA 5H6RA 5C8YA 2Q73A 4O2BA 1Y74B 3RT3C 2UUBB 2DMXA 2QWOB 4FM0A 4H44B 3SPGA 1TUBA 5B1AB 2AHYA 3CCRV 3BEHA 4B3TB 2DW4A 4LF8O 3TGUH 3TJTA 2EX3A 1GM7A 4B3MB 2B1IA 1JJOA 3JD3A 4OXSA 2OCCC 3K08A 1N36O 3HKBB 1HNXB 4JI4O 2FMLA 3FX7A 4UV9A 3P30A 4JI5B 1NVPD 2OCCB 1NJIW 4K8XA 1QVFU 4J7JA 1JCHA 3L75H 1YSCA 2RDCA 1BT8A 2HHHB 4ZBMA 4CBCA 1S72V 1QVGU 4JI8B 5EC2C 1NU1H 3OGIB 4ASUG 4KL1A 2HFEC 1K73W 1WPXA 4H13B 2YXYA 4OX9B 4DR5B 1BGYH 4W4LA 1PV0A 2FTKA 3ASOC 4B7EA 3OM3B 1MG1A 1N4CA 3THOA 1EN6A 1CPYA 5IJ9A 2W6IG 3RBZA 3BFRA 1S76D 2WSSG 1PNMA 1FAFA 2B9ZA 2Z3YA 2JS3A 2WLJA 4LNUA 3OW2U 2GHYA 4J11A 1F4MA 2DOSA 5KHKA 2VQFB 5EYPA 3SGIA 2P4VA 1BMFG 2D2CB 5KHIA 2ZT9B 1HWYA 1NBMG 5JCOA 4J9ZB 1QNMA 1Z2GA 2IJJA 1VQ6V 3JARB 2HP8A 4WCEV 2BTQA 1VEWA 2VS0A 2ZNIA 3K5LA 1N8RW 5TISZ 2XAHA 5KA5A 2VWJA 3LDEA 4LF8B 4JI0O 2ZXWB 3HKCB 4QPKA 1AI7A 4DR1O 2UUAB 3ZEDA 1VQ7V 1RFYA 1TUEB 1B3QA 3OR6C 5IJ0A 5JH7A 2C2AA 3JD2A 1THZA 3HKDA 3KCXA 3S3XA 5LMNB 3RWRD 3AG2B 2NR5A 3LSQA 1YJNV 1K8AW 1N32B 4JGSA 1D5NA 4MVSA 4XDJA 1ZTEA 3SPHA 5ITZB 3APOA 4KUMA 1Q5OA 1DK1A 1U96A 5C8YB 4CH5A 2YDEA 3K9SA 4CS3A 3RW0A 1SC5B 3QO7A 3D3QA 4K3AA 3QF7A 3OTOO 1XNQO 2WAMA 3OTFA 4UCVA 3SYQA 3VBBA 3K59A 4W4KA 1AP6A 2ETNA 4EB6A 2AW9A 1PL0A 4ZOLB 1MZEA 5CBGA 3APQA 1LUVA 2PGGA 2VQEB 2YS8A 1HNZB 2P5OA 1WP8A 2ZE8A 4JF3A 4CH4A 2ZIMA 2QKCA 4CS2A 2Q9LA 3U10A 1R1BA 1S3JA 1V55B 4LF4O 3O65A 3DTUB 1X4TA 2IU3A 4MTGA 3RYHB 5LOVB 4LP8A 3TCUA 4E2LA 3OMIB 1KP2A 2R9AA 2CGOA 3ASOB 3K57A 2E76B 1MOFA 4NTWA 4MW3A 3CRCA 1SS3A 2YXLA 2V1DA 5KHGA 1XDCA 4U3JB 3K5NA 1DGSA 2QSAA 2RMKB 5KUKA 4O4IB 1VQ5V 1J5EO 3WB2A 5LYJB 4RAIA 1US6A 5IYDO 3EVKA 3RVYA 2XT9A 3RYIB 3OGCC 1SETA 2EIJC 3FFQA 3T4ZA 1IBKO 1DF5A 1MNGA 2R70A 3HKCA 5CA0B 2JGDB 2O57A 4KXRA 1WJZA 3ZRWB 5LMUO 1Y66A 3ETQA 3E22B 4B3SB 3K58A 3CSXA 3HKBA 3HPLC 1K5SA 2CTPA 3SJBC 1JFFA 3W7XA 4IIJA 4MTOA 1PNLA 4QNHB 4UCSA 3RYCB 4AHCA 2Q68A 2ATKC 2ZCEA 5LP6A 4NYKA 1JOYA 4IGGA 4KFMA 3BHPA 3ZHVA 4ZIBA 4WFHA 3BABA 1EM1A 2VQFO 3LDDA 3RN4A 5KA6A 2ITCC 4I0XA 1DF4A 2WA4A 3B2EE 1IZ3A 4R7CA 1GN4A 5CMUA 1VQKV 2BCCH 3ABLC 4GYCB 4X65B 2FL4A 3CRMA 1AR4A 2IH3C 1YI2V 4BWAA 3OMNB 3N2KA 2AXTZ 2PUSA 5L3DA 2X6BA 3ABLB 5FNVA 1EFRG 5ITZA 3CCSV 3EFFK 1N0JA 1JMKC 4PDMA 2WLIB 3VOUA 4IHJB 2HLDG 4RO2A 1P7GA 1K4DC 3WU2Z 2QWPB 4LH7A 3WFVA 1VF5B 5LA6B 2EULA 4LFBO 4DUZO 4I5SA 1WB7A 4DV6O 5DM6V 2ADQB 4OPHA 1N32O 1QCEA 4FK5C 1NZ6A 2AGAA 3ZN0A 5BY1A 4JTDB 3BY6A 2MK3A 2MW2B 2QGNA 4QGPA 5A9GA 4I9WA 1HW7A 1HNXO 3MHHC 1S0VA 2Q5ZA 4QE9A 4WBNB 4O4LB 2X6CA 2ZKOA 1NTKH 1ZUQA 1BCCH 3ETGA 1IBLO 3E22A 1XI1A 1ZL8B 4FM2A 3OUFA 4RWUA 3E8HA 1VQLV 5KAFZ 2UU9B 4FJCC 5IWAO 2RCVA 1AROP 1FXKA 1FD9A 3SPIA 1B06A 5LYJA 1BZKA 5JJNB 3CCEV 2E74B 1D2DA 2YXHA 4HYOA 4EKWA 4FFBB 1YHQV 1JJ2U 2JGUA 2KG7B 2P7TC 1AR5A 3LUTB 4MS2A 5J2TB 4PD4F 1WN7A 3SYPA 1AVMA
chains in the Genus database with same CATH topology
1XMOO 1R1BA 1I94O 4LF4O 4OX9O 1NS1A 3O65A 4JI5O 4DV2O 4JYAO 2DOSA 4LFCO 1N34O 2F4VO 4B3SO 4DV0O 4NXNO 4X66O 4LFAO 4YY3O 5BR8O 4DV7O 4B3RO 4JI1O 4DR5O 4JI3O 3SDLA 4JI6O 2VQEO 1XNRO 1R6TA 3J81N 3T1YO 3J80N 1FYJA 2UXDO 3J7AU 2UXBO 2N74A 1HNZO 3RT3C 4LF5O 4DR4O 1HR0O 1F7YA 4JI2O 1IBMO 4KHPO 2UU9O 1J5EO 4LFBO 2ZM6O 2JRIA 4DUZO 3JAMN 4LF8O 1YZBA 4LF6O 3M8AA 4DV3O 2Z0AA 4GKKO 4A5UB 4JI7O 4X62O 4DUYO 5BXZA 4DV6O 4JI0O 2E5LO 4OPHA 4DR1O 1KUQA 1N32O 2UUAO 4K0KO 4JV5O 1G1XB 4DV5O 2UUBO 2AGAA 5BY1A 4DR7O 5FLXN 4X65O 1IBKO 3F5TA 1N36O 1N33O 4JI4O 4DR3O 1HNXO 2LW7A 3R66A 5LMNO 1A32A 5LMUO 4B3TO 5A2QN 5IT9N 2ZKOA 1FKAO 4AQYO 4GKJO 1IBLO 1DK1A 4DR6O 5LL6Y 2UXCO 4OPAA 4YHHO 2FKXA 3OTOO 1XNQO 4LF9O 5IWAO 1X59A 4DV1O 2VQFO 2HHHO 1D2DA 1HNWO 4X64O 1XEQA 4LF7O 4B3MO 5H5NA 3T1HO 1XMQO 2UUCO 1AILA 4DV4O 1AB3A 1FJGO 4NXMO 2DJVA 4DR2O 4JI8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO O;  1R1B A;  1I94 O;  4LF4 O;  4OX9 O;  1NS1 A;  3O65 A;  4JI5 O;  4DV2 O;  4JYA O;  2DOS A;  4LFC O;  1N34 O;  2F4V O;  4B3S O;  4DV0 O;  4NXN O;  4X66 O;  4LFA O;  4YY3 O;  5BR8 O;  4DV7 O;  4B3R O;  4JI1 O;  4DR5 O;  4JI3 O;  3SDL A;  4JI6 O;  2VQE O;  1XNR O;  1R6T A;  3J81 N;  3T1Y O;  3J80 N;  1FYJ A;  2UXD O;  3J7A U;  2UXB O;  2N74 A;  1HNZ O;  3RT3 C;  4LF5 O;  4DR4 O;  1HR0 O;  1F7Y A;  4JI2 O;  1IBM O;  4KHP O;  2UU9 O;  1J5E O;  4LFB O;  2ZM6 O;  2JRI A;  4DUZ O;  3JAM N;  4LF8 O;  1YZB A;  4LF6 O;  3M8A A;  4DV3 O;  2Z0A A;  4GKK O;  4A5U B;  4JI7 O;  4X62 O;  4DUY O;  5BXZ A;  4DV6 O;  4JI0 O;  2E5L O;  4OPH A;  4DR1 O;  1KUQ A;  1N32 O;  2UUA O;  4K0K O;  4JV5 O;  1G1X B;  4DV5 O;  2UUB O;  2AGA A;  5BY1 A;  4DR7 O;  5FLX N;  4X65 O;  1IBK O;  3F5T A;  1N36 O;  1N33 O;  4JI4 O;  4DR3 O;  1HNX O;  2LW7 A;  3R66 A;  5LMN O;  1A32 A;  5LMU O;  4B3T O;  5A2Q N;  5IT9 N;  2ZKO A;  1FKA O;  4AQY O;  4GKJ O;  1IBL O;  1DK1 A;  4DR6 O;  5LL6 Y;  2UXC O;  4OPA A;  4YHH O;  2FKX A;  3OTO O;  1XNQ O;  4LF9 O;  5IWA O;  1X59 A;  4DV1 O;  2VQF O;  2HHH O;  1D2D A;  1HNW O;  4X64 O;  1XEQ A;  4LF7 O;  4B3M O;  5H5N A;  3T1H O;  1XMQ O;  2UUC O;  1AIL A;  4DV4 O;  1AB3 A;  1FJG O;  4NXM O;  2DJV A;  4DR2 O;  4JI8 O; 
#chains in the Genus database with same CATH topology
 4FLY A;  5JCO C;  1E1Q G;  1S5H C;  4TV8 A;  5C93 A;  2N05 A;  4K35 A;  2CK3 G;  3QTC A;  2HVK C;  4NTX A;  2ZE6 A;  4DR5 O;  1R3I C;  4LF7 B;  3B8N A;  3W7W A;  4DYL A;  4DO2 A;  3K0G A;  2LJ2 A;  4X1I A;  3SPJ A;  3CXC U;  3N2K B;  3CX5 F;  3E35 A;  4JI2 O;  2CTR A;  5IY5 B;  4YJ2 A;  3ZHT A;  3B77 A;  4UVA A;  1I0H A;  3CJH B;  2P90 A;  4DV7 B;  2EIN C;  2P6J A;  4EB6 B;  1NKD A;  3JAM N;  1YZB A;  2BSK A;  4A5U B;  5BXZ A;  4U7N A;  4N23 A;  1OCZ B;  2UUA O;  1F23 A;  3JD1 A;  4X1Y A;  2P06 A;  4LF5 B;  4IL6 Z;  1BL8 A;  2F66 C;  4LWS A;  1RP3 B;  1YJW V;  1V54 B;  5J2U B;  4EFB A;  4LC1 A;  1SQP H;  4F6R A;  4B3T O;  5IT9 N;  2QWQ B;  1PNK A;  3RYH A;  2XAQ A;  2W6J G;  5EIB C;  3OD4 A;  4JI1 B;  1H2K A;  1H2N A;  2WLI A;  3I5D A;  2PF4 E;  4GCZ A;  5E1A C;  3A0H Z;  2AZ2 A;  3IJ4 A;  4Z1V A;  1JFF B;  1XL6 A;  1ENV A;  2QM7 A;  1DTO A;  3BVO A;  5LMU B;  5BR8 B;  3VQW A;  5L3E A;  3FB8 C;  1ZL8 A;  3G67 A;  4G28 B;  3P3P A;  1LR1 A;  2Y69 C;  4DR2 O;  5LGT A;  5EZY A;  3E8G A;  1R3L C;  2Q67 A;  1IX9 A;  2LGQ A;  3OUS A;  3QO8 A;  1H38 A;  4WBN A;  2YSU B;  1AI4 A;  1SQG A;  2IH1 C;  1SA0 B;  3CE2 A;  3OE7 G;  4TV8 B;  1Y4M A;  1FPO A;  4PA3 A;  3J7A U;  4PA6 A;  1IXM A;  1W59 A;  1Z5V A;  3CCQ V;  4X1K B;  2Q7H A;  5CB4 A;  1V9P A;  1M57 C;  3T1C A;  3X2Q C;  1XUQ A;  4FPP A;  5CA1 A;  4F4L A;  3FB5 C;  3FYI B;  1RSO A;  2RQ6 A;  1QQC A;  5EBM C;  1FXK B;  2GDS A;  5LP6 C;  2Y4T A;  3M8A A;  2F43 G;  4BIZ A;  1CP9 A;  5B1B B;  4UB8 Z;  5F2V O;  4EFE A;  3CJH A;  3K5M A;  3JYC A;  5CA3 A;  4O2A A;  2IW5 A;  4CH6 A;  2BSK B;  1Q7Y W;  5JVD B;  3RYF A;  1V55 C;  1QR8 A;  3UO2 A;  2BTO A;  3GWO A;  4Q20 A;  3CC7 V;  1VQ4 V;  1M9N A;  1FKA O;  2Y48 A;  2EIL B;  3B4S A;  3AG4 C;  2CGN A;  4ZHQ A;  3JAK B;  1NTZ H;  1R3J C;  1QU7 A;  4I4T B;  3AK2 A;  2WLK A;  2BE3 A;  4I50 A;  2EJR A;  4X1I B;  3S3W A;  4ABM A;  3H1L H;  2DWE C;  4DV4 B;  2YUA A;  1YCI A;  1VQP V;  1XMO B;  3CC4 V;  2IJI A;  3F5W C;  4WFE A;  3JAS B;  2LP7 A;  5LA6 A;  3MAQ A;  2PYL A;  1Y6X A;  1NI8 A;  1GTO A;  5K1X A;  2LFR A;  1Q6U A;  2GUZ B;  1FXV A;  2GSM B;  1SER A;  1Z5W A;  1H2L A;  3T1H O;  3ETD A;  1AIL A;  3ABM B;  3L9D A;  4TV9 A;  4X1Y B;  2XAF A;  3ZHQ A;  4QE7 A;  3AG3 B;  4RUF A;  1YF2 A;  1GMG A;  3ZX6 A;  1AJN A;  2Q6A A;  4JI5 O;  3H1J H;  3IGA C;  4GX1 A;  5DED A;  4DV7 O;  1YTF D;  4BAY A;  1YIJ V;  4J7Z A;  4PA4 A;  2VQE O;  4CH3 A;  3I55 V;  3N2G A;  1FYJ A;  2UXB O;  1IBL B;  1YVW A;  1GK9 A;  3A2F A;  4FLX A;  2WLL A;  1SA0 A;  2JS5 A;  1B04 A;  2EZO A;  2NLJ C;  4O2B B;  2IJH A;  2UU9 O;  4LF6 B;  5IWA B;  3Q4H A;  4NR1 A;  4JYB A;  4DW0 A;  2P22 C;  2OWO A;  1PL4 A;  2JEX A;  3EHB B;  4JI6 B;  1KUQ A;  4CZZ A;  3T1Y B;  4UB6 Z;  3OTO B;  1NR1 A;  5EZY B;  4GX2 A;  2OTL V;  4LF9 B;  4GZR B;  2QTO A;  1TUB B;  1Q6I A;  3TXQ A;  3ZN1 A;  5A2Q N;  4AQY O;  1Y76 B;  2Q0O C;  3E8B A;  4LWS B;  1YDX A;  4JTA B;  3ABU A;  1WLE A;  5CB4 B;  1OV9 A;  3QVN A;  4OPA A;  5J9P C;  1XNQ B;  4UV8 A;  1WPB A;  1MZF A;  4KHP B;  1RSO B;  1S5J A;  3LDC A;  1XOU A;  1RPO A;  2XOK G;  3DGE A;  3E83 A;  3SYC A;  1X59 A;  1AI6 A;  4K0K B;  3OEH G;  1XEQ A;  3ETE A;  2DYR C;  5L3F A;  4UVC A;  2E5L B;  2UXX A;  2QM4 A;  3HKE B;  4U3F H;  1SF9 A;  2L6L A;  3UO3 A;  1Q90 D;  4O2A B;  2R9I A;  4DRX A;  2X0L A;  2M6Y A;  4LF4 B;  1U97 A;  2Q8V A;  4FVM A;  5LXT A;  2G38 A;  5IJ9 B;  4MVR A;  4U7O A;  1URF A;  4LFA O;  2UXN A;  4UUJ C;  2DYS B;  3H01 A;  3ZRX A;  3B8M A;  4BIO A;  2RNB A;  3J81 N;  4DV5 B;  1NR7 A;  4ZKI A;  1QR9 A;  4I55 A;  4F6E A;  3STZ C;  1WP7 A;  3TXS A;  4BIU A;  3LNM B;  2F23 A;  1K33 A;  4FM1 A;  3CRQ A;  2L35 A;  4JYA B;  3L72 H;  4FLW A;  4G27 B;  1J5E B;  4YY3 B;  2ZM6 O;  1OCC C;  3M99 B;  2BTQ B;  4GKK O;  5CA1 B;  1OCO C;  4LBE C;  2JJ1 G;  1M1K W;  3ZCC A;  4N21 A;  5B1O A;  1CEZ A;  5KMG B;  4MT8 A;  4IYH A;  2IBZ H;  4X8A A;  3W7S A;  1S5L Z;  2GTA A;  5KX5 A;  1ROP A;  3HKD B;  1VQM V;  2A79 B;  2QDO A;  2QKA A;  2ZQM A;  5KLV H;  3ZRW A;  2UXC O;  3ASN B;  3ZRS A;  4UVB A;  5IJ0 B;  5JH7 B;  3H1I H;  2FB5 A;  4X20 A;  4FLZ A;  5FPO A;  4I4T A;  2H3O A;  2EIJ B;  4NB5 A;  5DEC A;  3WG7 C;  3B40 A;  4DV1 O;  4DUZ B;  4O4J B;  1OCO B;  2GV9 A;  3OFN G;  3JAT A;  1IDS A;  3JCZ A;  5LP6 B;  2WA3 A;  1VQ9 V;  3E2E A;  4XBF A;  1L0L H;  1AI5 A;  2VWK A;  1XMO O;  3RYF B;  5JVD A;  2A06 H;  2R9R B;  3JAL A;  4JAU A;  3W7T A;  1VF6 A;  5AG2 A;  4AI8 A;  4JI3 O;  4B3R B;  4L87 A;  4ZOL A;  4X62 B;  3WB0 A;  3JAK A;  1J95 A;  1HR0 B;  3C3S A;  2KKW A;  4FZ0 A;  2DYS C;  2QJ1 A;  4TQF A;  1KP3 A;  5LOV A;  3MDS A;  4J41 A;  3BPZ A;  3QNE A;  5FNV B;  4E4E A;  2HG5 C;  1VP7 A;  1R73 A;  4EEQ A;  2PI5 A;  2AZ0 A;  5L3G A;  3ZHR A;  4JAA A;  1QLN A;  2ZE5 A;  2H8P C;  2K1E A;  1WA8 B;  1GN6 A;  3G4S V;  5KHJ A;  1NVP B;  3QO5 A;  1PM9 A;  4J80 A;  4X65 O;  1SQB H;  2ZIO A;  5FL7 G;  1MAB G;  2F1M A;  4X66 B;  2WLH A;  4WFF A;  3R66 A;  3RFR A;  4J10 A;  3K9A A;  5KHH A;  3FB7 C;  3H1H H;  2NN4 A;  4PJ0 Z;  3D36 C;  4JV5 B;  2JIZ G;  5BZB A;  1LUW A;  1RM1 B;  4YHH O;  3HR0 A;  5KX5 B;  2ZDI C;  1Q81 W;  4P9O A;  2XND G;  3ZHU A;  1SRY A;  5CA0 A;  1W2B U;  5CN0 A;  1SQQ H;  1EZV H;  4UCU A;  1OCR C;  2EBO A;  4X20 B;  4DV1 B;  1SQX H;  4C7U A;  4PHZ A;  3AG1 C;  3AG3 C;  5H5N A;  2QR4 A;  3WB1 A;  2QEX V;  4DR6 B;  2K9P A;  4IIJ B;  4RQE A;  3GVM A;  1T5E A;  3WG7 B;  5KMG A;  4NVP A;  4O4H A;  4HAM A;  3K3W A;  1I5X A;  4ZI7 A;  1S77 D;  4JAS A;  2XAG A;  3K79 A;  1WB8 A;  1IVS A;  5BR8 O;  3T4D A;  1PD3 A;  2W0X A;  5B5E Z;  4P30 A;  3CMA V;  4FZ1 A;  1Q43 A;  2M7W A;  3CCJ V;  3U0Z A;  3CB2 A;  3LSS A;  3W7U A;  1HR0 O;  4H33 A;  2YIC A;  2WWW A;  2VRZ A;  1UPG A;  4WFG A;  2CTW A;  3K06 A;  4GUN A;  2HJD A;  2LW1 A;  3CD6 V;  4DV3 O;  4GT1 A;  1GM8 A;  1H8H G;  4JI7 O;  4GX0 A;  3AG1 B;  4NKG B;  4YJ2 B;  1F51 A;  4JZG A;  2UXD B;  1O9G A;  4K0K O;  4AIL C;  4FLT A;  1FXK C;  3D8C A;  4DRX B;  3U11 A;  3A0B Z;  3UT5 B;  5B1B C;  2QTS A;  1AP5 A;  2BOB C;  4WF9 V;  1N33 O;  1YXB A;  4R6Z A;  2X7R B;  2P4K A;  4LR3 A;  1A32 A;  3BAA A;  1QLE B;  2YIA A;  1FS0 G;  2JVD A;  1FXH A;  1XMQ B;  3K03 A;  1RPR A;  3FKS G;  3FD9 A;  4DR7 B;  1JR9 A;  2FKX A;  5LGN A;  1KKC A;  1XQ8 A;  2DYR B;  4IYI A;  4LF9 O;  3DC5 A;  4MVO A;  4YJ3 B;  4O4L A;  2Z5U A;  2D3O W;  2DN9 A;  3ZMU A;  1KYO F;  4WFA V;  4UXN A;  3ZMZ A;  1WA8 A;  2JJ2 G;  4J7K A;  1Q86 W;  1ZAU A;  3A8T A;  4JI2 B;  4UCT A;  3F7Y C;  3H9V A;  1L8D A;  4O4J A;  3ZMT A;  3JAT B;  2ZNJ A;  4NXN B;  1BHB A;  1Y74 A;  3NR7 A;  5L3C A;  5FPR A;  1XRE A;  4JI1 O;  3K0D A;  2Q69 A;  3JSL A;  4TOI A;  1O9H A;  2Y4U A;  2EIM C;  1XNR O;  4FFB A;  2YC0 A;  3CEI A;  2B1G A;  2N74 A;  1YTF B;  5J2T A;  4LF5 O;  3G80 A;  3CP1 A;  1OCC B;  5J2U A;  4KHP O;  1P4R A;  2OIE A;  4F6R B;  5CBF A;  3T2M A;  4DV6 B;  2EIK B;  4R8C A;  1G6U A;  4X62 O;  2E5L O;  2UXB B;  3UCS C;  2PYJ A;  4DV5 O;  1BQZ A;  1M90 W;  1AJP A;  3ABT A;  3R65 A;  2QWN B;  4DR3 B;  2Q4P A;  1JQ0 A;  1MSW D;  5JJE B;  4JYY A;  4BW5 A;  5BMV B;  3UT5 A;  3AK1 A;  4ICG A;  4GLX A;  4GKK B;  3BA8 A;  5LL6 Y;  4Q6G A;  5HFM A;  4QPJ A;  5DN6 G;  4LNU B;  4K8Z A;  5LGU A;  5KAI Z;  4MVZ A;  4HZ3 A;  4KP4 A;  3DXR B;  3DC6 A;  2H94 A;  1EN5 A;  3UM7 A;  1H2M A;  2EIN B;  3FAV A;  4RQF A;  2RJZ A;  4Z1M G;  3SJQ C;  3I56 V;  2UUC O;  1AB3 A;  1XBL A;  4JI8 O;  2UXC B;  4QIW F;  1G8M A;  3L74 H;  1D5A A;  4JYA O;  4JTC B;  4DV0 O;  3AG4 B;  4X66 O;  4TV9 B;  1NTM H;  3JAR A;  1E79 G;  1SZT A;  1NH2 D;  4MTX A;  1I7F A;  2QA4 V;  3T1Y O;  1XNR B;  5GON A;  4DR4 O;  1IUR A;  1W0K G;  3VQY A;  1QBZ A;  3CME V;  1JX9 A;  1IBM O;  3K04 A;  4R50 A;  2ZDI A;  1IXB A;  2YID A;  2Q0A A;  3TK1 A;  3PN1 A;  3F7V C;  4ZHQ B;  5H2F Z;  2YIB D;  3A0R A;  2A7W A;  1ZWI C;  4X1K A;  3KKY A;  3ZMV A;  2YI8 A;  5L3B A;  2DE0 X;  3GWK C;  4FLU A;  1I94 B;  1P49 A;  3ZIA G;  4HNA A;  5K1P A;  1B6Q A;  3D3I A;  1RM1 C;  4MVU A;  2IM9 A;  4GKJ O;  2PI4 A;  3ZHS A;  3CCU V;  3LSU A;  4Z2W A;  2A0L A;  2Q7E A;  4X9Q A;  2HJF C;  1OCR B;  1BSM A;  4JI4 B;  4I50 B;  3CRR A;  2Y69 B;  4FFK A;  2GTS A;  3RGB A;  2DWD C;  3UQ8 A;  2R72 A;  3BCC H;  1Q82 W;  4DV4 O;  5JJJ B;  1UJW B;  1FJG O;  2UUC B;  2GUZ A;  3SR2 C;  2F93 B;  2WLL B;  2ZR2 A;  5D5Q A;  4H0L B;  1FFX B;  3JD0 A;  2F4V O;  2OTJ V;  4AQY B;  1H8E G;  1HDJ A;  3FYE B;  1SES A;  4JI6 O;  2LQT A;  1N0N A;  1M56 B;  2XAS A;  3OT7 A;  3SPC A;  1SQV H;  2XUM A;  1HNZ O;  3FB6 C;  4FMT A;  3CC2 V;  3AG2 C;  4WFB V;  5H9C A;  1YEW A;  1N34 B;  4JAV A;  5H6Q A;  3N2G B;  2EIL C;  2Y0P A;  1XIL A;  2YEV A;  3SYA A;  2CH7 B;  1R3K C;  2JGD A;  4P2Z A;  1K97 A;  4YXW G;  1KBH A;  1NQT A;  3DXR A;  2JRI A;  1K7D A;  3HB3 B;  1Y76 A;  2PZS A;  2Z0A A;  3FAV B;  3SJA C;  1MSD A;  1GM9 A;  4NXM B;  2UUB O;  5GTI Z;  5FLX N;  3CRA A;  1K4C C;  1L0N H;  1KKD A;  4LFA B;  3ZBH A;  4J42 A;  5LMN O;  3H1K H;  1YJ9 V;  3Q4H B;  1VQN V;  1OHH G;  1HNW B;  1XHX A;  1ZLZ A;  1R6K A;  1M93 A;  1OZ0 A;  2BOC C;  3IFX A;  4FIP C;  1PP9 H;  1ZX3 A;  1HP8 A;  4PEL A;  1COW G;  4D6T H;  2AHZ A;  3ABK C;  4BR6 A;  1P84 F;  3MHS C;  2EZP A;  4JPR A;  4MSW C;  1W0J G;  4B3M O;  2EIK C;  1XMQ O;  1VIB A;  2X6A A;  4YHH B;  3E86 A;  2LGW A;  3RYC A;  2YI9 A;  4DR4 B;  3CWB H;  1BE3 H;  1F4N A;  1TGO A;  2ARH A;  4LFC O;  3CCV V;  4NXN O;  4HNA B;  4CC5 A;  4YY3 O;  3UKM A;  5LBQ A;  2F4V B;  5KUM A;  4JI3 B;  4B3R O;  4D7T A;  4DV3 B;  4U3J A;  3JAW A;  5LXT B;  2DQ0 A;  2GBO A;  3CCM V;  1K3E A;  2UXD O;  5JWP A;  3QG5 A;  4IT5 A;  3HKE A;  2XTA A;  4BW9 A;  5GW7 A;  1F7Y A;  2CAZ C;  3CYO A;  4XDL A;  2Q7G A;  2W0F C;  3CXH F;  1DLB A;  3JCU Z;  4XDK A;  5B3S C;  2HKO A;  2QKS A;  3M7M X;  1GH6 A;  1VAR A;  1Q8I A;  5GON B;  2CTQ A;  5B3S B;  2ILM A;  4DUY O;  2EIM B;  2EJ7 A;  1MA1 A;  1KD1 W;  5IYZ B;  4I55 B;  3K5O A;  1MMM A;  3SJC C;  4IHJ A;  2KB1 A;  1K34 A;  1H2G A;  1CXZ B;  1P7B A;  3LNN A;  2FYU H;  3AEI A;  1EZJ A;  4DR3 O;  1GRJ A;  1OCZ C;  2LW7 A;  5JQG B;  4HBN A;  1VMG A;  4X88 A;  1K5Q A;  4LFB B;  3IC9 A;  3BA9 A;  1KEC A;  4LCU C;  1VF7 A;  4PDR A;  5IY5 C;  1VF6 C;  4H37 A;  1M5I A;  2ZE7 A;  5B1A C;  3OAA G;  5B66 Z;  3JAL B;  4I0X B;  2QM8 A;  4TQD A;  2JDI G;  4PA7 A;  5D5P A;  4PV1 B;  3VQV A;  3KG2 A;  4QJF B;  5EC1 C;  4LH6 A;  4PDV A;  3G71 V;  4X64 O;  4LF7 O;  3B09 A;  1BS3 A;  4TUY B;  3ZS8 C;  2A3Q A;  2QE7 G;  1GAX A;  4L8J A;  1AJQ A;  1Q3E A;  2E75 B;  1SKV A;  1NS1 A;  2WPD G;  4CS4 A;  4B7K A;  1N34 O;  4TSF G;  1WNS A;  3VQX A;  1QLE C;  4DV0 B;  4LFC B;  1JA8 A;  2LO1 A;  2OCH A;  4JI0 B;  3SDL A;  1EBO A;  4I7Z B;  3ABK B;  2QWR B;  4O4H B;  2ZXW C;  4D7S A;  5LHI A;  2CUG A;  4JZ2 A;  3SYO A;  1GO3 F;  3KCY A;  1N33 B;  4DK1 A;  1IBK B;  3BRC A;  3PJS K;  3ZRV A;  2ZM6 B;  4RUE A;  3MD0 A;  3CCL V;  4X89 A;  1YIT V;  4UCR A;  2NNU A;  2HVJ C;  5LHH A;  1PKX A;  2CH7 A;  2P67 A;  3TET A;  3KZI Z;  4JV5 O;  3N27 A;  2WLN A;  1KQS U;  5E79 Z;  3F5T A;  4G2K A;  2IU0 A;  1FFX A;  2B5U A;  4PA9 A;  2RN9 A;  1M57 B;  3X2Q B;  4GX5 A;  1TAE A;  1TVK A;  5EBL C;  4DXW A;  1VQ8 V;  3L70 H;  1JPX A;  2LFS A;  4I9Q A;  3O9O A;  4DR6 O;  4CC6 A;  3ABM C;  1N36 B;  2ZD9 A;  1UFI A;  1XHZ A;  1KU9 A;  1QHT A;  2HR3 A;  1NT2 B;  4DR2 B;  1K9M W;  2N04 A;  2YEV B;  2KG7 A;  4PI0 A;  1AR1 B;  1M56 C;  2CDY A;  2V4D A;  3C3T A;  1VQO V;  4JI7 B;  1V54 C;  1KB9 F;  1BHA A;  2HHH O;  1JVM A;  1KMI Z;  1HNW O;  2PY5 A;  3OR7 C;  1EN4 A;  4X64 B;  1TA8 A;  2E3C A;  4NXM O;  2F95 B;  1SQF A;  4DV2 B;  2KSD A;  5IE9 A;  4OX9 O;  2A9H A;  1IBM B;  5JQG A;  1SZX A;  3L73 H;  1L1F A;  4TUY A;  1M4U A;  1XL4 A;  1Q6H A;  2JEU A;  1PPJ H;  1K92 A;  3P32 A;  5LHG A;  3E89 A;  1I5Y A;  4UFZ A;  3J80 N;  1E1R G;  2DQ3 A;  3IC7 A;  2CE4 A;  2JK5 C;  4FLV A;  2OYQ A;  1NH2 B;  3RVZ A;  2WLM A;  4P9P A;  2Y0I A;  3AG7 A;  2ADP A;  5B1N A;  1FJG B;  1GN3 A;  3JAW B;  3JD4 A;  2ZIN A;  3E8F A;  4UCO A;  4ZI7 B;  4MVQ A;  3G6B A;  3EXA A;  1I08 A;  4PDL A;  5EK0 A;  1KC8 W;  4DW1 A;  4LF6 O;  3OEE G;  3P3N A;  2OT5 A;  1G1X B;  5IYB O;  2OIG A;  3STL C;  1BQ0 A;  2PTM A;  4DR7 O;  4MVM A;  1GKF A;  2ODM A;  3AK3 A;  1G4Y B;  4MW8 A;  3DSQ A;  1OJH A;  2YIB A;  1R6N A;  3IAY A;  4YIO A;  4MTF A;  2XHB A;  2KQX A;  4OGQ B;  4DR1 B;  3ML0 A;  1WAZ A;  3JSN A;  3NXS A;  3JAS A;  1Y67 A;  4PI2 A;  3C90 A;  3T1H B;  1TVK B;  2HEP A;  2ZR3 A;  5BMV A;  4TWK A;  1ORQ C;  1FFT B;  4YIP A;  4NTY A;  1ZSP A;  4O4I A;  3ASN C;  5CBH A;  2ITD C;  3ZJZ A;  4B08 A;  4GKJ B;  3D36 A;  4J9Y B;  2V7Q G;  1LNQ A;  4DUY B;  4DK0 A;  5IYZ A;  5HFL A;  3CHX A;  3L71 H;  4YJ3 A;  5EYP B;  3RYI A;  5IDJ A;  5IYC O;  3GB7 C;  5EIB D;  2DJV A;  3CS5 A;  3G6E V;  1I94 O;  5EBW C;  3ICX A;  4DV2 O;  3OMA B;  4TT3 G;  4B3S O;  1H2S B;  1GN2 A;  5GTH Z;  3CPW U;  2XAJ A;  2IJK A;  4JYC A;  1R6T A;  3ZMS A;  5H6R A;  5C8Y A;  2Q73 A;  4O2B A;  1Y74 B;  3RT3 C;  2UUB B;  2DMX A;  2QWO B;  4FM0 A;  4H44 B;  3SPG A;  1TUB A;  5B1A B;  2AHY A;  3CCR V;  3BEH A;  4B3T B;  2DW4 A;  4LF8 O;  3TGU H;  3TJT A;  2EX3 A;  1GM7 A;  4B3M B;  2B1I A;  1JJO A;  3JD3 A;  4OXS A;  2OCC C;  3K08 A;  1N36 O;  3HKB B;  1HNX B;  4JI4 O;  2FML A;  3FX7 A;  4UV9 A;  3P30 A;  4JI5 B;  1NVP D;  2OCC B;  1NJI W;  4K8X A;  1QVF U;  4J7J A;  1JCH A;  3L75 H;  1YSC A;  2RDC A;  1BT8 A;  2HHH B;  4ZBM A;  4CBC A;  1S72 V;  1QVG U;  4JI8 B;  5EC2 C;  1NU1 H;  3OGI B;  4ASU G;  4KL1 A;  2HFE C;  1K73 W;  1WPX A;  4H13 B;  2YXY A;  4OX9 B;  4DR5 B;  1BGY H;  4W4L A;  1PV0 A;  2FTK A;  3ASO C;  4B7E A;  3OM3 B;  1MG1 A;  1N4C A;  3THO A;  1EN6 A;  1CPY A;  5IJ9 A;  2W6I G;  3RBZ A;  3BFR A;  1S76 D;  2WSS G;  1PNM A;  1FAF A;  2B9Z A;  2Z3Y A;  2JS3 A;  2WLJ A;  4LNU A;  3OW2 U;  2GHY A;  4J11 A;  1F4M A;  2DOS A;  5KHK A;  2VQF B;  5EYP A;  3SGI A;  2P4V A;  1BMF G;  2D2C B;  5KHI A;  2ZT9 B;  1HWY A;  1NBM G;  5JCO A;  4J9Z B;  1QNM A;  1Z2G A;  2IJJ A;  1VQ6 V;  3JAR B;  2HP8 A;  4WCE V;  2BTQ A;  1VEW A;  2VS0 A;  2ZNI A;  3K5L A;  1N8R W;  5TIS Z;  2XAH A;  5KA5 A;  2VWJ A;  3LDE A;  4LF8 B;  4JI0 O;  2ZXW B;  3HKC B;  4QPK A;  1AI7 A;  4DR1 O;  2UUA B;  3ZED A;  1VQ7 V;  1RFY A;  1TUE B;  1B3Q A;  3OR6 C;  5IJ0 A;  5JH7 A;  2C2A A;  3JD2 A;  1THZ A;  3HKD A;  3KCX A;  3S3X A;  5LMN B;  3RWR D;  3AG2 B;  2NR5 A;  3LSQ A;  1YJN V;  1K8A W;  1N32 B;  4JGS A;  1D5N A;  4MVS A;  4XDJ A;  1ZTE A;  3SPH A;  5ITZ B;  3APO A;  4KUM A;  1Q5O A;  1DK1 A;  1U96 A;  5C8Y B;  4CH5 A;  2YDE A;  3K9S A;  4CS3 A;  3RW0 A;  1SC5 B;  3QO7 A;  3D3Q A;  4K3A A;  3QF7 A;  3OTO O;  1XNQ O;  2WAM A;  3OTF A;  4UCV A;  3SYQ A;  3VBB A;  3K59 A;  4W4K A;  1AP6 A;  2ETN A;  4EB6 A;  2AW9 A;  1PL0 A;  4ZOL B;  1MZE A;  5CBG A;  3APQ A;  1LUV A;  2PGG A;  2VQE B;  2YS8 A;  1HNZ B;  2P5O A;  1WP8 A;  2ZE8 A;  4JF3 A;  4CH4 A;  2ZIM A;  2QKC A;  4CS2 A;  2Q9L A;  3U10 A;  1R1B A;  1S3J A;  1V55 B;  4LF4 O;  3O65 A;  3DTU B;  1X4T A;  2IU3 A;  4MTG A;  3RYH B;  5LOV B;  4LP8 A;  3TCU A;  4E2L A;  3OMI B;  1KP2 A;  2R9A A;  2CGO A;  3ASO B;  3K57 A;  2E76 B;  1MOF A;  4NTW A;  4MW3 A;  3CRC A;  1SS3 A;  2YXL A;  2V1D A;  5KHG A;  1XDC A;  4U3J B;  3K5N A;  1DGS A;  2QSA A;  2RMK B;  5KUK A;  4O4I B;  1VQ5 V;  1J5E O;  3WB2 A;  5LYJ B;  4RAI A;  1US6 A;  5IYD O;  3EVK A;  3RVY A;  2XT9 A;  3RYI B;  3OGC C;  1SET A;  2EIJ C;  3FFQ A;  3T4Z A;  1IBK O;  1DF5 A;  1MNG A;  2R70 A;  3HKC A;  5CA0 B;  2JGD B;  2O57 A;  4KXR A;  1WJZ A;  3ZRW B;  5LMU O;  1Y66 A;  3ETQ A;  3E22 B;  4B3S B;  3K58 A;  3CSX A;  3HKB A;  3HPL C;  1K5S A;  2CTP A;  3SJB C;  1JFF A;  3W7X A;  4IIJ A;  4MTO A;  1PNL A;  4QNH B;  4UCS A;  3RYC B;  4AHC A;  2Q68 A;  2ATK C;  2ZCE A;  5LP6 A;  4NYK A;  1JOY A;  4IGG A;  4KFM A;  3BHP A;  3ZHV A;  4ZIB A;  4WFH A;  3BAB A;  1EM1 A;  2VQF O;  3LDD A;  3RN4 A;  5KA6 A;  2ITC C;  4I0X A;  1DF4 A;  2WA4 A;  3B2E E;  1IZ3 A;  4R7C A;  1GN4 A;  5CMU A;  1VQK V;  2BCC H;  3ABL C;  4GYC B;  4X65 B;  2FL4 A;  3CRM A;  1AR4 A;  2IH3 C;  1YI2 V;  4BWA A;  3OMN B;  3N2K A;  2AXT Z;  2PUS A;  5L3D A;  2X6B A;  3ABL B;  5FNV A;  1EFR G;  5ITZ A;  3CCS V;  3EFF K;  1N0J A;  1JMK C;  4PDM A;  2WLI B;  3VOU A;  4IHJ B;  2HLD G;  4RO2 A;  1P7G A;  1K4D C;  3WU2 Z;  2QWP B;  4LH7 A;  3WFV A;  1VF5 B;  5LA6 B;  2EUL A;  4LFB O;  4DUZ O;  4I5S A;  1WB7 A;  4DV6 O;  5DM6 V;  2ADQ B;  4OPH A;  1N32 O;  1QCE A;  4FK5 C;  1NZ6 A;  2AGA A;  3ZN0 A;  5BY1 A;  4JTD B;  3BY6 A;  2MK3 A;  2MW2 B;  2QGN A;  4QGP A;  5A9G A;  4I9W A;  1HW7 A;  1HNX O;  3MHH C;  1S0V A;  2Q5Z A;  4QE9 A;  4WBN B;  4O4L B;  2X6C A;  2ZKO A;  1NTK H;  1ZUQ A;  1BCC H;  3ETG A;  1IBL O;  3E22 A;  1XI1 A;  1ZL8 B;  4FM2 A;  3OUF A;  4RWU A;  3E8H A;  1VQL V;  5KAF Z;  2UU9 B;  4FJC C;  5IWA O;  2RCV A;  1ARO P;  1FXK A;  1FD9 A;  3SPI A;  1B06 A;  5LYJ A;  1BZK A;  5JJN B;  3CCE V;  2E74 B;  1D2D A;  2YXH A;  4HYO A;  4EKW A;  4FFB B;  1YHQ V;  1JJ2 U;  2JGU A;  2KG7 B;  2P7T C;  1AR5 A;  3LUT B;  4MS2 A;  5J2T B;  4PD4 F;  1WN7 A;  3SYP A;  1AVM A; 
#chains in the Genus database with same CATH homology
 1XMO O;  1R1B A;  1I94 O;  4LF4 O;  4OX9 O;  1NS1 A;  3O65 A;  4JI5 O;  4DV2 O;  4JYA O;  2DOS A;  4LFC O;  1N34 O;  2F4V O;  4B3S O;  4DV0 O;  4NXN O;  4X66 O;  4LFA O;  4YY3 O;  5BR8 O;  4DV7 O;  4B3R O;  4JI1 O;  4DR5 O;  4JI3 O;  3SDL A;  4JI6 O;  2VQE O;  1XNR O;  1R6T A;  3J81 N;  3T1Y O;  3J80 N;  1FYJ A;  2UXD O;  3J7A U;  2UXB O;  2N74 A;  1HNZ O;  3RT3 C;  4LF5 O;  4DR4 O;  1HR0 O;  1F7Y A;  4JI2 O;  1IBM O;  4KHP O;  2UU9 O;  1J5E O;  4LFB O;  2ZM6 O;  2JRI A;  4DUZ O;  3JAM N;  4LF8 O;  1YZB A;  4LF6 O;  3M8A A;  4DV3 O;  2Z0A A;  4GKK O;  4A5U B;  4JI7 O;  4X62 O;  4DUY O;  5BXZ A;  4DV6 O;  4JI0 O;  2E5L O;  4OPH A;  4DR1 O;  1KUQ A;  1N32 O;  2UUA O;  4K0K O;  4JV5 O;  1G1X B;  4DV5 O;  2UUB O;  2AGA A;  5BY1 A;  4DR7 O;  5FLX N;  4X65 O;  1IBK O;  3F5T A;  1N36 O;  1N33 O;  4JI4 O;  4DR3 O;  1HNX O;  2LW7 A;  3R66 A;  5LMN O;  1A32 A;  5LMU O;  4B3T O;  5A2Q N;  5IT9 N;  2ZKO A;  1FKA O;  4AQY O;  4GKJ O;  1IBL O;  1DK1 A;  4DR6 O;  5LL6 Y;  2UXC O;  4OPA A;  4YHH O;  2FKX A;  3OTO O;  1XNQ O;  4LF9 O;  5IWA O;  1X59 A;  4DV1 O;  2VQF O;  2HHH O;  1D2D A;  1HNW O;  4X64 O;  1XEQ A;  4LF7 O;  4B3M O;  5H5N A;  3T1H O;  1XMQ O;  2UUC O;  1AIL A;  4DV4 O;  1AB3 A;  1FJG O;  4NXM O;  2DJV A;  4DR2 O;  4JI8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...