3J81R

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
120
Chain Sequence
GRVRTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPDVSHSNDVLNVDTQTAELVNSLGLKLPLSVSSVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 24
structure length 120
sequence length 125
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00833 Ribosomal_S17e Ribosomal S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.20 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Ribosomal protein S17e-like 3j81R01
5IT9R 3JAMR 3J80R 5FLXR 5A2QR 1RQ6A 3J7AW 3J81R
chains in the Genus database with same CATH superfamily
1BI2A 3JAMR 3R61A 1B1BA 1U8RA 4HV5A 2EV0A 1ON2A 2F5CA 3GLXA 1ON1A 3R60A 5A2QR 2F5DA 3J81R 1DPRA 2HYGD 3A52A 2MZ4A 5FLXR 2H09A 1BI1A 1FX7A 4O6JA 2QQAA 5IT9R 1G3WA 1FWZA 2X98A 4O5VA 2QQ9A 2DTRA 2EV6A 2M35A 4HX4A 2P0TA 2QQBA 4HX7A 1XCVA 1DDNA 2ISZA 1P92A 3J7AW 1BI0A 3J80R 1BI3A 4HX8A 1G3SA 1F5TA 2EV5A 2F5EA 1G3YA 2HYFA 2F5FA 1G3TA 2MUNA 1RQ6A 2MVTA 2TDXA 4HV6A 1C0WA
chains in the Genus database with same CATH topology
5IT9R 3JAMR 3J80R 5FLXR 5A2QR 1RQ6A 3J7AW 3J81R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 R;  3JAM R;  3J80 R;  5FLX R;  5A2Q R;  1RQ6 A;  3J7A W;  3J81 R; 
#chains in the Genus database with same CATH topology
 1BI2 A;  3JAM R;  3R61 A;  1B1B A;  1U8R A;  4HV5 A;  2EV0 A;  1ON2 A;  2F5C A;  3GLX A;  1ON1 A;  3R60 A;  5A2Q R;  2F5D A;  3J81 R;  1DPR A;  2HYG D;  3A52 A;  2MZ4 A;  5FLX R;  2H09 A;  1BI1 A;  1FX7 A;  4O6J A;  2QQA A;  5IT9 R;  1G3W A;  1FWZ A;  2X98 A;  4O5V A;  2QQ9 A;  2DTR A;  2EV6 A;  2M35 A;  4HX4 A;  2P0T A;  2QQB A;  4HX7 A;  1XCV A;  1DDN A;  2ISZ A;  1P92 A;  3J7A W;  1BI0 A;  3J80 R;  1BI3 A;  4HX8 A;  1G3S A;  1F5T A;  2EV5 A;  2F5E A;  1G3Y A;  2HYF A;  2F5F A;  1G3T A;  2MUN A;  1RQ6 A;  2MVT A;  2TDX A;  4HV6 A;  1C0W A; 
#chains in the Genus database with same CATH homology
 5IT9 R;  3JAM R;  3J80 R;  5FLX R;  5A2Q R;  1RQ6 A;  3J7A W;  3J81 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...