3J81W

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j81W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j81W02
4B3SH 4DR4H 1N36H 1N32H 2VQFH 4JI3H 4DV1H 4LF6H 4LFBH 3T1HH 4DUZH 3T1YH 2F4VH 3JAMW 4JI2H 4JYAH 4GKKH 4DR5H 1IBMH 2UUAH 4DV0H 1IBLH 4K0KH 5A2QW 4DR7H 4DV4H 4LFCH 4LF9H 5LL6b 1N34H 2UXBH 4DR6H 4YY3H 1XNRH 2E5LH 4X65H 2VQEH 5LMNH 2UXCH 4LF5H 4JI0H 1XMOH 1HNXH 1AN7A 3J7AK 4KHPH 4YHHH 5IWAH 1SEIA 4DV2H 3J80W 2ZM6H 4LFAH 4JI1H 4DUYH 4AQYH 1HNZH 5IT9W 1J5EH 4DV3H 4X62H 4DV7H 1FKAH 4JV5H 2HHHH 2UUBH 4DV6H 4DR2H 2UU9H 4DR3H 5LMUH 4JI4H 4B3RH 1N33H 1S03G 4PDBA 1FJGH 4GKJH 4LF8H 4DR1H 4JI6H 4DV5H 1I94H 1XMQH 3RF2A 1I6UA 4NXNH 1IBKH 5BR8H 1HNWH 4B3TH 4NXMH 4X66H 3J81W 4JI5H 1HR0H 3OTOH 4JI8H 2UXDH 4JI7H 1XNQH 4X64H 2UUCH 4B3MH 5FLXW 4LF4H 4LF7H 4OX9H
chains in the Genus database with same CATH superfamily
4B3SH 1R9TA 5IP9G 5KFBA 3MR5A 1DT4A 1N36H 5KFHA 4MA5A 3GILA 2VR1A 4O4LF 4ECUA 5KG0A 2ATLA 4JI3H 4YBZB 2JA6A 3MFIA 2MCTA 4AIMA 4EYHB 3PW4A 2W6QA 4YAJB 4DUZH 4XYLB 4A3EG 5BPFA 5DG7A 2HVRA 2ANNA 2FB9A 4MV3A 4O3SA 2FMAA 2X0SA 3HXLA 2JZXA 2R92A 1WSCA 2Q2TA 4B8CD 3FKIG 1GSOA 4DR5H 4WALA 5J2UF 4EEYA 2AGOA 3LMLA 1N56A 1L2ZA 5KG1A 1XDNA 4ZOLF 4O3PA 4OO1G 4A3DG 4FS1A 4FJUA 1IBLH 4XZ3B 1Z2IA 1VS0A 2W9BA 2JA7A 2XGPA 4I7HA 3L7ZC 1GSHA 2WAQE 4Q8FA 2J9GA 3K5IA 4Q44A 4DV4H 4LFCH 2VA3A 3GIIA 5GONF 4DR6H 4J9LA 4Q8EA 1XNRH 3M9OB 2JA9A 1ZZIA 2NVYA 2R8KA 3GV7B 3PO3G 2VQEH 5LMNH 2C28A 4BA2I 4O3RA 1BGWA 2JEGA 3JSNA 1UC9A 3H4DA 5KT7A 5JUMA 3MR2A 1XMOH 2C2EA 4YP3A 1O75A 5D8DA 5KKNB 4RB1A 2JEJA 2AGQA 1E4FT 4QWAA 4DL3A 3M9NB 1SEIA 2JVZA 2M8WA 3KHHA 1IOVA 1TA8A 5KFAA 5FD6A 5D1OA 4TUYF 4NZTM 5KFPA 4ECWA 3T5LA 3C0FB 3GIPA 3R5HA 1S10A 1EZ1A 1JLLB 1KJQA 5C8YF 4GLXA 3ORQA 4GC7A 1V51A 1MZBA 4R8UA 4AQYH 5IP7G 4LH7A 4FJSA 2OH2A 1HNZH 3N6XA 1TWGA 1ZZJA 3AYHB 3V6KA 1IOWA 4RU9A 3VMMA 4ECQA 4QIWA 3KALA 2FLPA 1FKAH 1JDBB 3I4MG 2WYOA 1E4GT 4UFZA 2UUBH 4DV6H 4DR2H 3LWBA 2FJZA 4DL4A 5HBRB 4RAZA 3RV4A 3RAQA 3BG5A 1KJ8A 4Q43A 1GYFA 4RZQA 5H80A 2FLNA 4A3LG 4OCHA 3GLKA 2FFMA 1N33H 1S03G 4RB0A 4ZI7F 2XCAA 3GIJA 4FS2A 4J9SA 1F0XA 3TIIA 1JKJB 3N8DA 3HB9A 2V58A 1TWCA 2RGVA 3RBEA 2R6FA 4QW8A 3H4BA 5KFOA 4BBSG 4J9QA 4NBQA 4J9MA 3SB1A 1J5KA 1V4YA 5DGAA 2HJWA 2OWOA 5BR8H 1RK5A 2HVQA 3N40P 4O3NA 4HNVA 1B6SA 1PX2A 2ZDHA 2PN1A 4X66H 2FE3A 1KJ9A 3J81W 2FPIB 2R7MA 1PQXA 1HR0H 4UCRA 2W9CA 3H40A 3KTMA 3OTOH 1S0NA 2ASLA 3JSLA 1C30A 2YCHA 1OWTA 2DLNA 4TV9F 1XNQH 3QZ8A 4BY7G 3QFFA 1I3QA 1VAJA 3T5HA 3RV3A 1KHMA 3MWMA 4LF4H 3T1YH 3OSNA 2R82A 2C2RA 4DR4H 4M7EA 4NLGA 3F8NA 5L1LA 1EC6A 1B04A 1WVNA 2XCPA 5LOVF 3G6XA 4OD6A 3PR5B 4DV1H 3N43B 1EUDB 4BWSC 1ZZKA 2R7LA 4YR2A 3T1HH 3RB4A 2I8CA 3EYYA 3JAMW 5CB4F 4JI2H 2BR0A 4R7RA 4QW9A 4GKKH 1WE8A 2FP4B 4HR7A 3LP8A 4ME6A 4MV6A 4IWYA 2X06A 2FKLA 2YZNA 3KXYT 3HOZG 3TQ1A 4DV0H 4YQWA 3HOUG 1JIHA 4RB3C 2ZDQA 5DT9A 3QZ7A 3Q8RB 3V6HA 4QWBA 2W9CB 2OPUA 2VUMG 3L4JA 2CTJA 2YQRA 4WBNF 2UXBH 2ZJTA 3RIZA 5C1PA 1RJQA 5DLFA 1Y1WG 1WH2A 4EFBA 1Z2OX 1S0OA 2DPIA 1X9NA 2IP4A 5EOYA 3PR4A 3BAAA 2R7NA 1HNXH 3TIGA 1Y14B 2M6QA 4RZRA 4IZOA 4DL7A 2W6PA 2HH3A 3AEVB 4YHHH 2YRXA 5CAEB 4QWDA 1GGOA 1TWHA 4ECVA 2BL5A 2E2HA 5F9NA 2DGRA 3J80W 2PY9A 1KJIA 3BA9A 4QIWE 4U7CA 4JI1H 4JUZA 4ED1A 2CQYA 3GTQA 4MV8A 3JZIA 2NUAB 1JX4A 2R8JA 4FBUA 1CQIB 4LIJA 2FPHX 3V4SA 3Q8PB 1AUXA 4Q0YA 5IT9W 4I4TF 1T94A 2HH2A 2WTFA 1UNNC 5K36G 4JV0A 5KFEA 1ZTGA 1B33N 3FMAA 5KFWA 4IR9A 2Z0SA 1J4WA 5KFLA 1A9XA 1GSAA 2VPQA 4R8UB 1ULZA 1XRHA 2W70A 1KC7A 3V69A 1Z2NX 5KX5F 1AUVA 5KFXA 2MJHA 5EDWA 3Q8QB 3GIQA 4A3GG 3G6YA 4DR3H 1C3OA 2PMZE 2UVWA 2R93A 4WD3A 2B63A 4ECYA 3HOVG 4A3FG 2AXYA 2PBZA 4UCSA 4ECTA 2P0AA 5KFSA 1DTJA 4JVHA 5FJ8G 3EPIA 3KDKA 2R86A 3GABA 4CC6A 2R8HA 4MV1A 3ETHA 2K1HA 3M4IA 3GTLA 2A1SA 5DG9A 4GC6A 5KT4A 1TUAA 5CA1F 2YW2A 1XMQH 3KHLA 3OHBA 4MV9A 4O3QA 2WAQA 1I6UA 4U6PA 2YS7A 4A2BA 1IBKH 5C3EG 1M6VA 2VUGA 5JQWA 3WNZA 2LTMA 4O3OA 2XC9A 3G8CA 3Q1KA 4ED8A 5BPHA 3FAUA 3N44B 2R87A 5KFRA 2JA5A 2LF0A 1W93A 2YS6A 3WO1A 3R23A 1T36A 2ZQEA 1ZHQA 4TQSA 4JI8H 2UXDH 1ZHSA 1ZETA 4XX0B 4JI7H 4DL5A 2I80A 4RUAA 4O2AF 4LH6A 4BBRG 4EBDA 2UUCH 3U9TA 4EFEA 2SCUB 2V4QA 2JA5G 4ED0A 4J9KA 4LF7H 2C22A 4NZRM 4OX9H 3HKZA 1PK8A 3T5KA 4RB2C 2UVRA 4IFDG 3PN1A 1N32H 5KFYA 4J9RA 3UQ8A 4CC5A 1Y1VG 4IRCA 3PZPA 5IYZF 3U1KA 2YL2A 4MTEA 4RNNA 2F4VH 3MFHA 2XGQA 4RAYA 3BQ2A 5L1JA 2VA2A 4APMA 1ZQ7A 4FM9A 2RGRA 4JYAH 1RK6A 3KAKA 4O4HF 1JDEA 2YYAA 1IBMH 1EHIA 3MR6A 2R7ZG 2UUAH 3OUUA 5K2MA 4MV4A 3TINA 3U9SA 2R85A 3BABA 4C2MA 3KDGA 5KFVA 2GPSA 4J0MA 2VKCA 4K0KH 4IHJF 1I7LA 4YR0A 1WCMG 5EWEA 4ED7A 2V59A 4F4YA 3RB0A 2CZGA 2WE6A 4JV1A 4MAMA 4O4IF 3Q2OA 4UCTA 4DLKA 4LF9H 2HGSA 2OPVA 2NU9B 3RJ0A 1WHRA 1N34H 2XD4A 3DF7A 1X9ZA 2CTFA 2PQUA 1VKZA 2WB1E 4YY3H 2Y3MA 5EZYF 2E5LH 1NXUA 1V8CA 2FPGB 1UC8A 3N41B 2IA6A 2VPSA 1TWAA 4YR3A 3UFXB 3SE7A 2FLLA 5DQIA 2G8YA 1WCMA 5KFNA 2Y0SE 4LF5H 4BY1G 1E4EB 5C1OA 4J9PA 1B6RA 3PW7A 2HVSA 2RDIA 3Q8SB 4QWCA 1TAEA 4A93G 2LRRA 1CE8A 3V4ZA 5KG2A 3G6VA 4EBEA 2BQUA 1KEEA 5KG7A 1FVIA 2B63G 1K1GA 2FK1A 5KT6A 1W96A 4DV2H 2CTLA 2YZMA 1BXRA 2DPJA 2NN6G 2O4CA 2ZM6H 3I12A 5KFTA 5DLGA 4MTDA 5LP6F 3RGZA 5KFCA 5C44G 2IBKA 3TQTA 2UVUA 4EYIB 4EG0A 4A3MG 2ASDA 3HKZE 1VBHA 2O03A 1SFOA 2E3UA 2XCLA 3H3VH 2QNDA 4EGJA 4E9JA 1J5EH 3HOWG 2M05A 2XIGA 4C5CA 3GQCA 4LSXA 3ETJA 4DV3H 5JVLA 2AGPA 4X62H 4TV8F 4ZHQF 3BQ0A 4FBTA 1S20A 4JV5H 2DWCA 1SYXB 4HQ6A 3GIMA 4TQRA 5IYCG 4LMYA 5JEAG 2JA6G 1RJPA 2BA0A 3GIKA 3RFCA 4JI4H 5DGBA 1SCUB 1GO3E 1KJJA 4E4TA 4PDBA 1WTJA 1M0TA 2NU6B 5JVDF 2R7KA 3HBLA 4L1KA 4GKJH 2VQDA 3FKIA 5DQHA 2LTLA 4WANA 2NU8B 4LF8H 4FU0A 5F9LA 5KFFA 2NVXA 1E4EA 2ALZA 1Y1WA 3BJYA 5FLMG 1N48A 3GTOA 4BXXG 4RNOA 4M9UA 1MSZA 3T5JA 3RF2A 3L4KA 5EWGA 3RAXA 3EPGA 4NXNH 1DIKA 4XYMB 4A2AA 4HNTA 4IRKA 4A3BG 3K3VA 5KG3A 2FK3A 1HNWH 3GR5A 1DGSA 2YU9A 4ECRA 5L9XA 2Q2UA 2C00A 4JI5H 4YJ3F 3RGXA 5KFGA 2V5AA 4C5AA 4HNUA 1X4MA 2W8KA 2W9BB 3H0GA 4YB8B 3OETA 5KFKA 2DIKA 1K83A 3MJFA 1GLVA 3PW0A 1DV1A 3I0PA 3KHRA 4X64H 2CTMA 4RNMA 4EEQA 1ODHA 4B3MH 5FLXW 1CQJB 4IWXA 4QMFB 3K5HA 1K1QA 4I55F 1I7NA 2RF4A 2KSWA 2Y0SA 2VOBA 3UOEA 2CPMA 3H0GG 5LXTF 4F4ZA 2VQFH 3QD7X 2R93G 4AYBE 3FDSA 2YZGA 4C5BA 4ECZA 4LF6H 1RJRA 1BJTA 5IYBG 4LFBH 2ASJA 3EZJA 1Z2PX 3JRWA 4YJ2F 5C5JA 3R5FA 2JEIA 2CPQA 4LSAA 3RUPA 4ED6A 5KG5A 4EGQA 4Q45A 4HYKA 3H20A 2W9AA 3M9MB 1VIHA 2JEBI 4F4WA 2W6NA 3IG0A 4B8TA 3CVZA 1VBGA 3E5NA 5A2QW 4DR7H 1M0WA 3K3PA 4AM3A 3KAJA 4UCUA 2JA8G 4QWEA 1A0IA 2JEAI 5LL6b 4H8AA 5KFZA 1P8LA 5IYDG 3OSSD 4QJFA 2W7OA 3HOXG 2R92G 4X65H 3VKEA 2ZDGA 3OSPA 2WB1A 3GV8B 2V4RA 2UXCH 5KG6A 2AU0A 4G3IA 2E2IA 5FD5A 4JI0H 2RDJA 2C2DA 3L2PA 1EYZA 5C4XG 4A3CG 1AN7A 3J7AK 2ANRA 4KHPH 5IWAH 1Y1VA 2CWHA 2J6SA 1X4NA 5KFQA 4DL6A 2UVVA 4ECXA 2BQ3A 4ED2A 4LFAH 1M7JA 4F4XA 4DL2A 4EC5A 3JRXA 5LA6F 4DUYH 2R8GA 2JA7G 5KFMA 4PWQA 2JE6I 5LYJF 1RYSA 2CW7A 2PT7G 5KFJA 4MV7A 3BQ1A 2IMWP 5HV6A 3GTGA 3R5XA 3VPCA 3GV5B 3ORRA 2R7ZA 4ED3A 3V6JA 3GTKA 5T14A 2W6OA 2DZDA 2W6ZA 1V9NA 4I50F 4UCVA 5DG8A 2OLSA 2VUMA 3GKUA 4RUCA 4DV7H 1VBIA 3VPBA 2W8LA 2GLTA 4BA1I 1T3NA 2J6UA 3RB6A 3RTXA 4ETSA 2HHHH 4F50A 1S0MA 2UU9H 5CA0F 4A3JG 4IR1A 4IAJA 3KHGA 4A3KG 5D1OB 2NU7B 4MA0A 3GTMA 5LMUH 2W71A 3WO0A 5BMVF 3MR3A 5FPRA 3PW2A 3RB3A 4B3RH 3IN5A 5KFIA 2BQRA 4ZQIA 5EWFA 3OHAA 1S97A 1FJGH 2W7PA 1DV2A 4EBCA 3GTPA 5KFDA 1JXLA 4DR1H 2R8IA 4YAKB 2FK2A 3I4NG 3NCVA 2CTEA 1VIGA 4A3IG 3RBDA 4JI6H 4DV5H 3GTJA 3HOYG 1I94H 5L1KA 4Y8VB 2CW8A 2C35B 2QK4A 3OUZA 5KT5A 5KFUA 2JEFA 1KBLA 4J9NA 2V9WA 4IRDA 3NGDA 3SI8A 1S68A 4G08A 4UCOA 2R84A 2CKZB 4AYBA 1I50A 4JV2A 1UG8A 1S9FA 2FPPB 4B3TH 5KT3A 5J2TF 4NXMH 5DQGA 3MWDA 2WDTA 1WR2A 4JVYA 3N42B 3CQZA 3PO2G 2CWFA 2I87A 2P2RA 5FPOA 5JH7F 2PVPA 2YRWA 2W57A 4J9OA 2D9IA 2CTKA 1EUCB 3VPDA 3BA8A 3PW5A 3PVXA 2FMRA 1TWFA 2AQ4A 1K1SA 1X0AA 3GIDA 2QYZA 5KG4A 5C0XG 3MWEA 1BNCA 5L1IA 5KT2A 1CS0A 4ECSA 1V9PA 2W6MA 2PMZA 5D1PA 2J6TA 2GPWA 4O2BF 5I47A 1RYRA
chains in the Genus database with same CATH topology
2KSWA 4B3SH 4DR4H 2VOBA 4M7EA 4RB2C 3F8NA 3PN1A 1N36H 1N32H 2VQFH 1B04A 3QD7X 3UQ8A 4CC5A 4OD6A 4JI3H 4DV1H 3N43B 4BWSC 4LF6H 1BJTA 2MCTA 4LFBH 4MTEA 3T1HH 4DUZH 2F4VH 3EZJA 3JAMW 1Z2PX 4JI2H 3EYYA 4RAYA 2HVRA 4APMA 4LSAA 4FM9A 3HXLA 2RGRA 4JYAH 3KAKA 4R7RA 4B8CD 2Q2TA 4GKKH 4DR5H 1IBMH 3H20A 1L2ZA 3LMLA 2UUAH 1XDNA 3KXYT 3BABA 3IG0A 3KDGA 4DV0H 3CVZA 4J0MA 2VKCA 1IBLH 4K0KH 1VS0A 4RB3C 5A2QW 4DR7H 1M0WA 4I7HA 5DT9A 3KAJA 4UCUA 1A0IA 2WE6A 3L4JA 4UCTA 4DV4H 4LFCH 4LF9H 2HGSA 5LL6b 3RJ0A 1N34H 2UXBH 3DF7A 1P8LA 1X9ZA 2ZJTA 4DR6H 3RIZA 4YY3H 2Y3MA 1XNRH 2E5LH 3N41B 3OSSD 2VPSA 4X65H 2VQEH 5LMNH 1WH2A 4EFBA 1Z2OX 1BGWA 3JSNA 1X9NA 2UXCH 4LF5H 5EOYA 3BAAA 5FD5A 4JI0H 1XMOH 1HNXH 3L2PA 1O75A 1TAEA 1AN7A 4RB1A 3J7AK 4KHPH 4YHHH 1E4FT 5IWAH 1FVIA 1SEIA 4DV2H 1TA8A 3J80W 5FD6A 2O4CA 2ZM6H 4LFAH 4NZTM 4JI1H 4EC5A 3BA9A 5D1OA 4DUYH 3RGZA 4MTDA 3C0FB 4LF7H 2PT7G 2CW7A 4MV7A 4GLXA 1MZBA 4AQYH 2FPHX 4LH7A 2O03A 1HNZH 5IT9W 3N6XA 4Q0YA 4E9JA 1J5EH 2XIGA 4UCVA 3FMAA 4LSXA 4DV3H 3KALA 4X62H 4DV7H 1FKAH 2WYOA 4JV5H 1E4GT 3RTXA 1SYXB 1Z2NX 2HHHH 2UUBH 4UFZA 4DV6H 4DR2H 2UU9H 4ETSA 4LMYA 4RAZA 4IAJA 5D1OB 1GYFA 4RZQA 4DR3H 5LMUH 4OCHA 4JI4H 5FPRA 4B3RH 1N33H 4RB0A 1S03G 2OWOA 4PDBA 4UCSA 1M0TA 1F0XA 1FJGH 4GKJH 3KDKA 3GABA 4CC6A 4LF8H 2RGVA 4DR1H 3M4IA 3NCVA 4JI6H 4DV5H 1I94H 2CW8A 1XMQH 4MV9A 3RF2A 3L4KA 1I6UA 3SB1A 4NXNH 1IBKH 4A2BA 1S68A 4A2AA 4G08A 5BR8H 2HVQA 3K3VA 3N40P 2VUGA 4UCOA 1HNWH 3GR5A 1DGSA 2Q2UA 4B3TH 2HVSA 4NXMH 4X66H 3FAUA 2FE3A 3J81W 4JI5H 2WDTA 1HR0H 2LF0A 3N42B 3N44B 4UCRA 3RGXA 5FPOA 3OTOH 2ZQEA 1ZHQA 3OETA 2W57A 4JI8H 2UXDH 1ZHSA 2D9IA 3JSLA 3BA8A 4JI7H 2YCHA 1XNQH 4LH6A 4X64H 2UUCH 1V9PA 4EEQA 1ODHA 4B3MH 5FLXW 5D1PA 3MWMA 4EFEA 4LF4H 3T1YH 4NZRM 4OX9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S H;  4DR4 H;  1N36 H;  1N32 H;  2VQF H;  4JI3 H;  4DV1 H;  4LF6 H;  4LFB H;  3T1H H;  4DUZ H;  3T1Y H;  2F4V H;  3JAM W;  4JI2 H;  4JYA H;  4GKK H;  4DR5 H;  1IBM H;  2UUA H;  4DV0 H;  1IBL H;  4K0K H;  5A2Q W;  4DR7 H;  4DV4 H;  4LFC H;  4LF9 H;  5LL6 b;  1N34 H;  2UXB H;  4DR6 H;  4YY3 H;  1XNR H;  2E5L H;  4X65 H;  2VQE H;  5LMN H;  2UXC H;  4LF5 H;  4JI0 H;  1XMO H;  1HNX H;  1AN7 A;  3J7A K;  4KHP H;  4YHH H;  5IWA H;  1SEI A;  4DV2 H;  3J80 W;  2ZM6 H;  4LFA H;  4JI1 H;  4DUY H;  4AQY H;  1HNZ H;  5IT9 W;  1J5E H;  4DV3 H;  4X62 H;  4DV7 H;  1FKA H;  4JV5 H;  2HHH H;  2UUB H;  4DV6 H;  4DR2 H;  2UU9 H;  4DR3 H;  5LMU H;  4JI4 H;  4B3R H;  1N33 H;  1S03 G;  4PDB A;  1FJG H;  4GKJ H;  4LF8 H;  4DR1 H;  4JI6 H;  4DV5 H;  1I94 H;  1XMQ H;  3RF2 A;  1I6U A;  4NXN H;  1IBK H;  5BR8 H;  1HNW H;  4B3T H;  4NXM H;  4X66 H;  3J81 W;  4JI5 H;  1HR0 H;  3OTO H;  4JI8 H;  2UXD H;  4JI7 H;  1XNQ H;  4X64 H;  2UUC H;  4B3M H;  5FLX W;  4LF4 H;  4LF7 H;  4OX9 H; 
#chains in the Genus database with same CATH topology
 4B3S H;  1R9T A;  5IP9 G;  5KFB A;  3MR5 A;  1DT4 A;  1N36 H;  5KFH A;  4MA5 A;  3GIL A;  2VR1 A;  4O4L F;  4ECU A;  5KG0 A;  2ATL A;  4JI3 H;  4YBZ B;  2JA6 A;  3MFI A;  2MCT A;  4AIM A;  4EYH B;  3PW4 A;  2W6Q A;  4YAJ B;  4DUZ H;  4XYL B;  4A3E G;  5BPF A;  5DG7 A;  2HVR A;  2ANN A;  2FB9 A;  4MV3 A;  4O3S A;  2FMA A;  2X0S A;  3HXL A;  2JZX A;  2R92 A;  1WSC A;  2Q2T A;  4B8C D;  3FKI G;  1GSO A;  4DR5 H;  4WAL A;  5J2U F;  4EEY A;  2AGO A;  3LML A;  1N56 A;  1L2Z A;  5KG1 A;  1XDN A;  4ZOL F;  4O3P A;  4OO1 G;  4A3D G;  4FS1 A;  4FJU A;  1IBL H;  4XZ3 B;  1Z2I A;  1VS0 A;  2W9B A;  2JA7 A;  2XGP A;  4I7H A;  3L7Z C;  1GSH A;  2WAQ E;  4Q8F A;  2J9G A;  3K5I A;  4Q44 A;  4DV4 H;  4LFC H;  2VA3 A;  3GII A;  5GON F;  4DR6 H;  4J9L A;  4Q8E A;  1XNR H;  3M9O B;  2JA9 A;  1ZZI A;  2NVY A;  2R8K A;  3GV7 B;  3PO3 G;  2VQE H;  5LMN H;  2C28 A;  4BA2 I;  4O3R A;  1BGW A;  2JEG A;  3JSN A;  1UC9 A;  3H4D A;  5KT7 A;  5JUM A;  3MR2 A;  1XMO H;  2C2E A;  4YP3 A;  1O75 A;  5D8D A;  5KKN B;  4RB1 A;  2JEJ A;  2AGQ A;  1E4F T;  4QWA A;  4DL3 A;  3M9N B;  1SEI A;  2JVZ A;  2M8W A;  3KHH A;  1IOV A;  1TA8 A;  5KFA A;  5FD6 A;  5D1O A;  4TUY F;  4NZT M;  5KFP A;  4ECW A;  3T5L A;  3C0F B;  3GIP A;  3R5H A;  1S10 A;  1EZ1 A;  1JLL B;  1KJQ A;  5C8Y F;  4GLX A;  3ORQ A;  4GC7 A;  1V51 A;  1MZB A;  4R8U A;  4AQY H;  5IP7 G;  4LH7 A;  4FJS A;  2OH2 A;  1HNZ H;  3N6X A;  1TWG A;  1ZZJ A;  3AYH B;  3V6K A;  1IOW A;  4RU9 A;  3VMM A;  4ECQ A;  4QIW A;  3KAL A;  2FLP A;  1FKA H;  1JDB B;  3I4M G;  2WYO A;  1E4G T;  4UFZ A;  2UUB H;  4DV6 H;  4DR2 H;  3LWB A;  2FJZ A;  4DL4 A;  5HBR B;  4RAZ A;  3RV4 A;  3RAQ A;  3BG5 A;  1KJ8 A;  4Q43 A;  1GYF A;  4RZQ A;  5H80 A;  2FLN A;  4A3L G;  4OCH A;  3GLK A;  2FFM A;  1N33 H;  1S03 G;  4RB0 A;  4ZI7 F;  2XCA A;  3GIJ A;  4FS2 A;  4J9S A;  1F0X A;  3TII A;  1JKJ B;  3N8D A;  3HB9 A;  2V58 A;  1TWC A;  2RGV A;  3RBE A;  2R6F A;  4QW8 A;  3H4B A;  5KFO A;  4BBS G;  4J9Q A;  4NBQ A;  4J9M A;  3SB1 A;  1J5K A;  1V4Y A;  5DGA A;  2HJW A;  2OWO A;  5BR8 H;  1RK5 A;  2HVQ A;  3N40 P;  4O3N A;  4HNV A;  1B6S A;  1PX2 A;  2ZDH A;  2PN1 A;  4X66 H;  2FE3 A;  1KJ9 A;  3J81 W;  2FPI B;  2R7M A;  1PQX A;  1HR0 H;  4UCR A;  2W9C A;  3H40 A;  3KTM A;  3OTO H;  1S0N A;  2ASL A;  3JSL A;  1C30 A;  2YCH A;  1OWT A;  2DLN A;  4TV9 F;  1XNQ H;  3QZ8 A;  4BY7 G;  3QFF A;  1I3Q A;  1VAJ A;  3T5H A;  3RV3 A;  1KHM A;  3MWM A;  4LF4 H;  3T1Y H;  3OSN A;  2R82 A;  2C2R A;  4DR4 H;  4M7E A;  4NLG A;  3F8N A;  5L1L A;  1EC6 A;  1B04 A;  1WVN A;  2XCP A;  5LOV F;  3G6X A;  4OD6 A;  3PR5 B;  4DV1 H;  3N43 B;  1EUD B;  4BWS C;  1ZZK A;  2R7L A;  4YR2 A;  3T1H H;  3RB4 A;  2I8C A;  3EYY A;  3JAM W;  5CB4 F;  4JI2 H;  2BR0 A;  4R7R A;  4QW9 A;  4GKK H;  1WE8 A;  2FP4 B;  4HR7 A;  3LP8 A;  4ME6 A;  4MV6 A;  4IWY A;  2X06 A;  2FKL A;  2YZN A;  3KXY T;  3HOZ G;  3TQ1 A;  4DV0 H;  4YQW A;  3HOU G;  1JIH A;  4RB3 C;  2ZDQ A;  5DT9 A;  3QZ7 A;  3Q8R B;  3V6H A;  4QWB A;  2W9C B;  2OPU A;  2VUM G;  3L4J A;  2CTJ A;  2YQR A;  4WBN F;  2UXB H;  2ZJT A;  3RIZ A;  5C1P A;  1RJQ A;  5DLF A;  1Y1W G;  1WH2 A;  4EFB A;  1Z2O X;  1S0O A;  2DPI A;  1X9N A;  2IP4 A;  5EOY A;  3PR4 A;  3BAA A;  2R7N A;  1HNX H;  3TIG A;  1Y14 B;  2M6Q A;  4RZR A;  4IZO A;  4DL7 A;  2W6P A;  2HH3 A;  3AEV B;  4YHH H;  2YRX A;  5CAE B;  4QWD A;  1GGO A;  1TWH A;  4ECV A;  2BL5 A;  2E2H A;  5F9N A;  2DGR A;  3J80 W;  2PY9 A;  1KJI A;  3BA9 A;  4QIW E;  4U7C A;  4JI1 H;  4JUZ A;  4ED1 A;  2CQY A;  3GTQ A;  4MV8 A;  3JZI A;  2NUA B;  1JX4 A;  2R8J A;  4FBU A;  1CQI B;  4LIJ A;  2FPH X;  3V4S A;  3Q8P B;  1AUX A;  4Q0Y A;  5IT9 W;  4I4T F;  1T94 A;  2HH2 A;  2WTF A;  1UNN C;  5K36 G;  4JV0 A;  5KFE A;  1ZTG A;  1B33 N;  3FMA A;  5KFW A;  4IR9 A;  2Z0S A;  1J4W A;  5KFL A;  1A9X A;  1GSA A;  2VPQ A;  4R8U B;  1ULZ A;  1XRH A;  2W70 A;  1KC7 A;  3V69 A;  1Z2N X;  5KX5 F;  1AUV A;  5KFX A;  2MJH A;  5EDW A;  3Q8Q B;  3GIQ A;  4A3G G;  3G6Y A;  4DR3 H;  1C3O A;  2PMZ E;  2UVW A;  2R93 A;  4WD3 A;  2B63 A;  4ECY A;  3HOV G;  4A3F G;  2AXY A;  2PBZ A;  4UCS A;  4ECT A;  2P0A A;  5KFS A;  1DTJ A;  4JVH A;  5FJ8 G;  3EPI A;  3KDK A;  2R86 A;  3GAB A;  4CC6 A;  2R8H A;  4MV1 A;  3ETH A;  2K1H A;  3M4I A;  3GTL A;  2A1S A;  5DG9 A;  4GC6 A;  5KT4 A;  1TUA A;  5CA1 F;  2YW2 A;  1XMQ H;  3KHL A;  3OHB A;  4MV9 A;  4O3Q A;  2WAQ A;  1I6U A;  4U6P A;  2YS7 A;  4A2B A;  1IBK H;  5C3E G;  1M6V A;  2VUG A;  5JQW A;  3WNZ A;  2LTM A;  4O3O A;  2XC9 A;  3G8C A;  3Q1K A;  4ED8 A;  5BPH A;  3FAU A;  3N44 B;  2R87 A;  5KFR A;  2JA5 A;  2LF0 A;  1W93 A;  2YS6 A;  3WO1 A;  3R23 A;  1T36 A;  2ZQE A;  1ZHQ A;  4TQS A;  4JI8 H;  2UXD H;  1ZHS A;  1ZET A;  4XX0 B;  4JI7 H;  4DL5 A;  2I80 A;  4RUA A;  4O2A F;  4LH6 A;  4BBR G;  4EBD A;  2UUC H;  3U9T A;  4EFE A;  2SCU B;  2V4Q A;  2JA5 G;  4ED0 A;  4J9K A;  4LF7 H;  2C22 A;  4NZR M;  4OX9 H;  3HKZ A;  1PK8 A;  3T5K A;  4RB2 C;  2UVR A;  4IFD G;  3PN1 A;  1N32 H;  5KFY A;  4J9R A;  3UQ8 A;  4CC5 A;  1Y1V G;  4IRC A;  3PZP A;  5IYZ F;  3U1K A;  2YL2 A;  4MTE A;  4RNN A;  2F4V H;  3MFH A;  2XGQ A;  4RAY A;  3BQ2 A;  5L1J A;  2VA2 A;  4APM A;  1ZQ7 A;  4FM9 A;  2RGR A;  4JYA H;  1RK6 A;  3KAK A;  4O4H F;  1JDE A;  2YYA A;  1IBM H;  1EHI A;  3MR6 A;  2R7Z G;  2UUA H;  3OUU A;  5K2M A;  4MV4 A;  3TIN A;  3U9S A;  2R85 A;  3BAB A;  4C2M A;  3KDG A;  5KFV A;  2GPS A;  4J0M A;  2VKC A;  4K0K H;  4IHJ F;  1I7L A;  4YR0 A;  1WCM G;  5EWE A;  4ED7 A;  2V59 A;  4F4Y A;  3RB0 A;  2CZG A;  2WE6 A;  4JV1 A;  4MAM A;  4O4I F;  3Q2O A;  4UCT A;  4DLK A;  4LF9 H;  2HGS A;  2OPV A;  2NU9 B;  3RJ0 A;  1WHR A;  1N34 H;  2XD4 A;  3DF7 A;  1X9Z A;  2CTF A;  2PQU A;  1VKZ A;  2WB1 E;  4YY3 H;  2Y3M A;  5EZY F;  2E5L H;  1NXU A;  1V8C A;  2FPG B;  1UC8 A;  3N41 B;  2IA6 A;  2VPS A;  1TWA A;  4YR3 A;  3UFX B;  3SE7 A;  2FLL A;  5DQI A;  2G8Y A;  1WCM A;  5KFN A;  2Y0S E;  4LF5 H;  4BY1 G;  1E4E B;  5C1O A;  4J9P A;  1B6R A;  3PW7 A;  2HVS A;  2RDI A;  3Q8S B;  4QWC A;  1TAE A;  4A93 G;  2LRR A;  1CE8 A;  3V4Z A;  5KG2 A;  3G6V A;  4EBE A;  2BQU A;  1KEE A;  5KG7 A;  1FVI A;  2B63 G;  1K1G A;  2FK1 A;  5KT6 A;  1W96 A;  4DV2 H;  2CTL A;  2YZM A;  1BXR A;  2DPJ A;  2NN6 G;  2O4C A;  2ZM6 H;  3I12 A;  5KFT A;  5DLG A;  4MTD A;  5LP6 F;  3RGZ A;  5KFC A;  5C44 G;  2IBK A;  3TQT A;  2UVU A;  4EYI B;  4EG0 A;  4A3M G;  2ASD A;  3HKZ E;  1VBH A;  2O03 A;  1SFO A;  2E3U A;  2XCL A;  3H3V H;  2QND A;  4EGJ A;  4E9J A;  1J5E H;  3HOW G;  2M05 A;  2XIG A;  4C5C A;  3GQC A;  4LSX A;  3ETJ A;  4DV3 H;  5JVL A;  2AGP A;  4X62 H;  4TV8 F;  4ZHQ F;  3BQ0 A;  4FBT A;  1S20 A;  4JV5 H;  2DWC A;  1SYX B;  4HQ6 A;  3GIM A;  4TQR A;  5IYC G;  4LMY A;  5JEA G;  2JA6 G;  1RJP A;  2BA0 A;  3GIK A;  3RFC A;  4JI4 H;  5DGB A;  1SCU B;  1GO3 E;  1KJJ A;  4E4T A;  4PDB A;  1WTJ A;  1M0T A;  2NU6 B;  5JVD F;  2R7K A;  3HBL A;  4L1K A;  4GKJ H;  2VQD A;  3FKI A;  5DQH A;  2LTL A;  4WAN A;  2NU8 B;  4LF8 H;  4FU0 A;  5F9L A;  5KFF A;  2NVX A;  1E4E A;  2ALZ A;  1Y1W A;  3BJY A;  5FLM G;  1N48 A;  3GTO A;  4BXX G;  4RNO A;  4M9U A;  1MSZ A;  3T5J A;  3RF2 A;  3L4K A;  5EWG A;  3RAX A;  3EPG A;  4NXN H;  1DIK A;  4XYM B;  4A2A A;  4HNT A;  4IRK A;  4A3B G;  3K3V A;  5KG3 A;  2FK3 A;  1HNW H;  3GR5 A;  1DGS A;  2YU9 A;  4ECR A;  5L9X A;  2Q2U A;  2C00 A;  4JI5 H;  4YJ3 F;  3RGX A;  5KFG A;  2V5A A;  4C5A A;  4HNU A;  1X4M A;  2W8K A;  2W9B B;  3H0G A;  4YB8 B;  3OET A;  5KFK A;  2DIK A;  1K83 A;  3MJF A;  1GLV A;  3PW0 A;  1DV1 A;  3I0P A;  3KHR A;  4X64 H;  2CTM A;  4RNM A;  4EEQ A;  1ODH A;  4B3M H;  5FLX W;  1CQJ B;  4IWX A;  4QMF B;  3K5H A;  1K1Q A;  4I55 F;  1I7N A;  2RF4 A;  2KSW A;  2Y0S A;  2VOB A;  3UOE A;  2CPM A;  3H0G G;  5LXT F;  4F4Z A;  2VQF H;  3QD7 X;  2R93 G;  4AYB E;  3FDS A;  2YZG A;  4C5B A;  4ECZ A;  4LF6 H;  1RJR A;  1BJT A;  5IYB G;  4LFB H;  2ASJ A;  3EZJ A;  1Z2P X;  3JRW A;  4YJ2 F;  5C5J A;  3R5F A;  2JEI A;  2CPQ A;  4LSA A;  3RUP A;  4ED6 A;  5KG5 A;  4EGQ A;  4Q45 A;  4HYK A;  3H20 A;  2W9A A;  3M9M B;  1VIH A;  2JEB I;  4F4W A;  2W6N A;  3IG0 A;  4B8T A;  3CVZ A;  1VBG A;  3E5N A;  5A2Q W;  4DR7 H;  1M0W A;  3K3P A;  4AM3 A;  3KAJ A;  4UCU A;  2JA8 G;  4QWE A;  1A0I A;  2JEA I;  5LL6 b;  4H8A A;  5KFZ A;  1P8L A;  5IYD G;  3OSS D;  4QJF A;  2W7O A;  3HOX G;  2R92 G;  4X65 H;  3VKE A;  2ZDG A;  3OSP A;  2WB1 A;  3GV8 B;  2V4R A;  2UXC H;  5KG6 A;  2AU0 A;  4G3I A;  2E2I A;  5FD5 A;  4JI0 H;  2RDJ A;  2C2D A;  3L2P A;  1EYZ A;  5C4X G;  4A3C G;  1AN7 A;  3J7A K;  2ANR A;  4KHP H;  5IWA H;  1Y1V A;  2CWH A;  2J6S A;  1X4N A;  5KFQ A;  4DL6 A;  2UVV A;  4ECX A;  2BQ3 A;  4ED2 A;  4LFA H;  1M7J A;  4F4X A;  4DL2 A;  4EC5 A;  3JRX A;  5LA6 F;  4DUY H;  2R8G A;  2JA7 G;  5KFM A;  4PWQ A;  2JE6 I;  5LYJ F;  1RYS A;  2CW7 A;  2PT7 G;  5KFJ A;  4MV7 A;  3BQ1 A;  2IMW P;  5HV6 A;  3GTG A;  3R5X A;  3VPC A;  3GV5 B;  3ORR A;  2R7Z A;  4ED3 A;  3V6J A;  3GTK A;  5T14 A;  2W6O A;  2DZD A;  2W6Z A;  1V9N A;  4I50 F;  4UCV A;  5DG8 A;  2OLS A;  2VUM A;  3GKU A;  4RUC A;  4DV7 H;  1VBI A;  3VPB A;  2W8L A;  2GLT A;  4BA1 I;  1T3N A;  2J6U A;  3RB6 A;  3RTX A;  4ETS A;  2HHH H;  4F50 A;  1S0M A;  2UU9 H;  5CA0 F;  4A3J G;  4IR1 A;  4IAJ A;  3KHG A;  4A3K G;  5D1O B;  2NU7 B;  4MA0 A;  3GTM A;  5LMU H;  2W71 A;  3WO0 A;  5BMV F;  3MR3 A;  5FPR A;  3PW2 A;  3RB3 A;  4B3R H;  3IN5 A;  5KFI A;  2BQR A;  4ZQI A;  5EWF A;  3OHA A;  1S97 A;  1FJG H;  2W7P A;  1DV2 A;  4EBC A;  3GTP A;  5KFD A;  1JXL A;  4DR1 H;  2R8I A;  4YAK B;  2FK2 A;  3I4N G;  3NCV A;  2CTE A;  1VIG A;  4A3I G;  3RBD A;  4JI6 H;  4DV5 H;  3GTJ A;  3HOY G;  1I94 H;  5L1K A;  4Y8V B;  2CW8 A;  2C35 B;  2QK4 A;  3OUZ A;  5KT5 A;  5KFU A;  2JEF A;  1KBL A;  4J9N A;  2V9W A;  4IRD A;  3NGD A;  3SI8 A;  1S68 A;  4G08 A;  4UCO A;  2R84 A;  2CKZ B;  4AYB A;  1I50 A;  4JV2 A;  1UG8 A;  1S9F A;  2FPP B;  4B3T H;  5KT3 A;  5J2T F;  4NXM H;  5DQG A;  3MWD A;  2WDT A;  1WR2 A;  4JVY A;  3N42 B;  3CQZ A;  3PO2 G;  2CWF A;  2I87 A;  2P2R A;  5FPO A;  5JH7 F;  2PVP A;  2YRW A;  2W57 A;  4J9O A;  2D9I A;  2CTK A;  1EUC B;  3VPD A;  3BA8 A;  3PW5 A;  3PVX A;  2FMR A;  1TWF A;  2AQ4 A;  1K1S A;  1X0A A;  3GID A;  2QYZ A;  5KG4 A;  5C0X G;  3MWE A;  1BNC A;  5L1I A;  5KT2 A;  1CS0 A;  4ECS A;  1V9P A;  2W6M A;  2PMZ A;  5D1P A;  2J6T A;  2GPW A;  4O2B F;  5I47 A;  1RYR A; 
#chains in the Genus database with same CATH homology
 2KSW A;  4B3S H;  4DR4 H;  2VOB A;  4M7E A;  4RB2 C;  3F8N A;  3PN1 A;  1N36 H;  1N32 H;  2VQF H;  1B04 A;  3QD7 X;  3UQ8 A;  4CC5 A;  4OD6 A;  4JI3 H;  4DV1 H;  3N43 B;  4BWS C;  4LF6 H;  1BJT A;  2MCT A;  4LFB H;  4MTE A;  3T1H H;  4DUZ H;  2F4V H;  3EZJ A;  3JAM W;  1Z2P X;  4JI2 H;  3EYY A;  4RAY A;  2HVR A;  4APM A;  4LSA A;  4FM9 A;  3HXL A;  2RGR A;  4JYA H;  3KAK A;  4R7R A;  4B8C D;  2Q2T A;  4GKK H;  4DR5 H;  1IBM H;  3H20 A;  1L2Z A;  3LML A;  2UUA H;  1XDN A;  3KXY T;  3BAB A;  3IG0 A;  3KDG A;  4DV0 H;  3CVZ A;  4J0M A;  2VKC A;  1IBL H;  4K0K H;  1VS0 A;  4RB3 C;  5A2Q W;  4DR7 H;  1M0W A;  4I7H A;  5DT9 A;  3KAJ A;  4UCU A;  1A0I A;  2WE6 A;  3L4J A;  4UCT A;  4DV4 H;  4LFC H;  4LF9 H;  2HGS A;  5LL6 b;  3RJ0 A;  1N34 H;  2UXB H;  3DF7 A;  1P8L A;  1X9Z A;  2ZJT A;  4DR6 H;  3RIZ A;  4YY3 H;  2Y3M A;  1XNR H;  2E5L H;  3N41 B;  3OSS D;  2VPS A;  4X65 H;  2VQE H;  5LMN H;  1WH2 A;  4EFB A;  1Z2O X;  1BGW A;  3JSN A;  1X9N A;  2UXC H;  4LF5 H;  5EOY A;  3BAA A;  5FD5 A;  4JI0 H;  1XMO H;  1HNX H;  3L2P A;  1O75 A;  1TAE A;  1AN7 A;  4RB1 A;  3J7A K;  4KHP H;  4YHH H;  1E4F T;  5IWA H;  1FVI A;  1SEI A;  4DV2 H;  1TA8 A;  3J80 W;  5FD6 A;  2O4C A;  2ZM6 H;  4LFA H;  4NZT M;  4JI1 H;  4EC5 A;  3BA9 A;  5D1O A;  4DUY H;  3RGZ A;  4MTD A;  3C0F B;  4LF7 H;  2PT7 G;  2CW7 A;  4MV7 A;  4GLX A;  1MZB A;  4AQY H;  2FPH X;  4LH7 A;  2O03 A;  1HNZ H;  5IT9 W;  3N6X A;  4Q0Y A;  4E9J A;  1J5E H;  2XIG A;  4UCV A;  3FMA A;  4LSX A;  4DV3 H;  3KAL A;  4X62 H;  4DV7 H;  1FKA H;  2WYO A;  4JV5 H;  1E4G T;  3RTX A;  1SYX B;  1Z2N X;  2HHH H;  2UUB H;  4UFZ A;  4DV6 H;  4DR2 H;  2UU9 H;  4ETS A;  4LMY A;  4RAZ A;  4IAJ A;  5D1O B;  1GYF A;  4RZQ A;  4DR3 H;  5LMU H;  4OCH A;  4JI4 H;  5FPR A;  4B3R H;  1N33 H;  4RB0 A;  1S03 G;  2OWO A;  4PDB A;  4UCS A;  1M0T A;  1F0X A;  1FJG H;  4GKJ H;  3KDK A;  3GAB A;  4CC6 A;  4LF8 H;  2RGV A;  4DR1 H;  3M4I A;  3NCV A;  4JI6 H;  4DV5 H;  1I94 H;  2CW8 A;  1XMQ H;  4MV9 A;  3RF2 A;  3L4K A;  1I6U A;  3SB1 A;  4NXN H;  1IBK H;  4A2B A;  1S68 A;  4A2A A;  4G08 A;  5BR8 H;  2HVQ A;  3K3V A;  3N40 P;  2VUG A;  4UCO A;  1HNW H;  3GR5 A;  1DGS A;  2Q2U A;  4B3T H;  2HVS A;  4NXM H;  4X66 H;  3FAU A;  2FE3 A;  3J81 W;  4JI5 H;  2WDT A;  1HR0 H;  2LF0 A;  3N42 B;  3N44 B;  4UCR A;  3RGX A;  5FPO A;  3OTO H;  2ZQE A;  1ZHQ A;  3OET A;  2W57 A;  4JI8 H;  2UXD H;  1ZHS A;  2D9I A;  3JSL A;  3BA8 A;  4JI7 H;  2YCH A;  1XNQ H;  4LH6 A;  4X64 H;  2UUC H;  1V9P A;  4EEQ A;  1ODH A;  4B3M H;  5FLX W;  5D1P A;  3MWM A;  4EFE A;  4LF4 H;  3T1Y H;  4NZR M;  4OX9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...