3J81W

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
b'TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j81W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j81W02
2UXCH 1I94H 1FKAH 4YHHH 1IBLH 2VQFH 5A2QW 4JI3H 2ZM6H 3T1HH 2UU9H 2UXBH 1HR0H 4PDBA 4X64H 1IBMH 5LMUH 1IBKH 4JI2H 4B3TH 5LL6b 5IWAH 1FJGH 4DV1H 2UUCH 3J80W 4K0KH 3JAMW 4DV2H 2VQEH 4DUZH 4B3MH 4LF4H 4DR3H 4JI5H 1N36H 4NXMH 5IT9W 2UUBH 4B3SH 1XNRH 4LF5H 1SEIA 4LFAH 4LFBH 1N33H 2UUAH 1AN7A 4DV5H 4DV7H 3J81W 4DV3H 1S03G 4AQYH 4X66H 5BR8H 1XNQH 4JI0H 4YY3H 5FLXW 4JI7H 1XMQH 1I6UA 3J7AK 4DR6H 5LMNH 4LF9H 2HHHH 1N32H 4DV6H 4X65H 4LF6H 4OX9H 4DR7H 4DR5H 1HNWH 4LF7H 2E5LH 1J5EH 2F4VH 4DV0H 2UXDH 1HNXH 4B3RH 4DR2H 4X62H 3T1YH 3OTOH 4DV4H 4GKJH 4DR1H 4GKKH 4NXNH 4DUYH 4JV5H 4DR4H 1XMOH 1N34H 4JI6H 4JYAH 4KHPH 4LF8H 1HNZH 4JI1H 4LFCH 4JI8H 3RF2A 4JI4H
chains in the Genus database with same CATH superfamily
2V4RA 4RZQA 2FLNA 3L4KA 2FLPA 3MR5A 3BQ1A 1FVIA 2YU9A 1V51A 1KEEA 4I4TF 4O3PA 3OHAA 1CE8A 3EPIA 2V9WA 5FJ8G 2W57A 5KFEA 3T1HH 1EZ1A 4G3IA 2R92A 2W70A 4ZI7F 3H40A 4IHJF 3N6XA 4EEQA 5LP6F 4ECQA 1CQIB 2NU9B 2HJWA 2OPUA 5KG7A 2FJZA 5H80A 4U7CA 1EHIA 3GV7B 3KALA 4O4IF 3RGZA 2WTFA 3V6JA 4MV6A 5DQGA 2ASDA 2DWCA 4R8UB 1KJQA 5DG9A 4EBDA 5LMUH 2CWHA 4O2AF 4A2BA 5C3EG 1W93A 1IBKH 4YR3A 2R8KA 5C0XG 1TAEA 4IWYA 1Y1WG 2W9AA 4YAJB 2JA6G 5D1OB 5IWAH 2J6UA 3VPDA 2UUCH 3QZ8A 1JKJB 5DQHA 1WSCA 2YZMA 4PWQA 4K0KH 4AYBA 3FAUA 1T36A 4UFZA 4ECWA 3N43B 2C35B 5KFZA 5KFXA 2ZDQA 5KKNB 4QW9A 2NVXA 3H3VH 5C5JA 1WE8A 1E4EA 5IT9W 3H4DA 1JDEA 2FB9A 1RYSA 2QNDA 2DZDA 2K1HA 2P0AA 2W6NA 4R7RA 2C2EA 2CTLA 1KC7A 3HOVG 1AN7A 1A0IA 3NCVA 4O3SA 4A3MG 1S9FA 2E3UA 3J81W 5DT9A 1S03G 4AQYH 2WB1E 2ZQEA 3KDKA 2FK1A 3BG5A 4MV9A 5KT6A 2AU0A 2FFMA 1XNQH 4J9OA 3MWMA 5KG1A 4DL6A 2AGQA 2R82A 1IOVA 2YW2A 3CQZA 1N48A 2YS6A 2XGPA 4O3RA 2CTEA 5CAEB 4XX0B 4O3QA 1GO3E 4BWSC 3LWBA 1EUDB 1VS0A 1RJPA 3GABA 4M9UA 2NUAB 4EFEA 1DGSA 3J7AK 5KT5A 5KT7A 1JX4A 1K1GA 3GTOA 4A3IG 4WALA 5KG6A 3VMMA 1N32H 4RNMA 4I55F 4LF6H 4OX9H 3BABA 2RF4A 1UC8A 3JRWA 3MWEA 2IBKA 4A3LG 4BXXG 4HR7A 4QIWA 1EUCB 4UCVA 3OUUA 4J9LA 3HOXG 3JZIA 2E2IA 1SCUB 2QYZA 3R5HA 2BQUA 4EBCA 3QFFA 1KBLA 2QK4A 2W9BA 1GLVA 2R8JA 4DR2H 5FPOA 1S20A 2D9IA 2PY9A 4APMA 5T14A 2UVUA 2BL5A 2J6TA 5F9LA 2ZDHA 3PO3G 2JVZA 5KFTA 3C0FB 3OTOH 4DV4H 3H0GA 2W6MA 1VBHA 3MJFA 2CTFA 4GKJH 2PN1A 2UVVA 5DLFA 3M9OB 3GIIA 1V4YA 4RNOA 2JA5A 3PW5A 2GLTA 4Q0YA 4E4TA 2V4QA 3MFIA 4JV5H 4C5BA 4DR4H 1XMOH 1E4EB 1N34H 3MWDA 4JYAH 4LF8H 3VKEA 4RZRA 4IFDG 4TUYF 4JI1H 1XDNA 2VUGA 3VPBA 2CTJA 5FLMG 1ZZJA 4MV8A 1ULZA 4EYHB 1WR2A 5DLGA 3WO1A 5EWEA 4QWCA 2JEGA 4IRKA 2JA9A 3Q8PB 5IP9G 2PMZE 5KFUA 4JVYA 3GR5A 2VQFH 4ZQIA 5KFBA 4J9NA 4ED7A 2ZM6H 2YRXA 1BXRA 4MA0A 4ECVA 4H8AA 2YZGA 4FM9A 5DG8A 3MR6A 1KHMA 2FPIB 2JEAI 2BR0A 1ZHQA 2NU8B 3TQTA 3PR5B 3GIKA 2VUMG 2R93A 1GSOA 2PT7G 3QD7X 1B33N 3M9NB 4PDBA 4ED1A 4A3EG 2FE3A 1V8CA 2ASJA 5D1PA 5CA0F 4C2MA 4HQ6A 4J9QA 4O3NA 2M6QA 2CPMA 5KFYA 1S0NA 5I47A 1WCMA 4DLKA 2R7NA 4RAZA 1UC9A 3F8NA 4MV1A 1A9XA 1Y1VA 2AXYA 2WB1A 5KFMA 2AQ4A 1FJGH 2R7MA 3U9SA 3L2PA 1X4MA 1O75A 2LTLA 1DV1A 4RAYA 4OCHA 3J80W 4FJSA 3N40P 4I7HA 1X9NA 4UCRA 4ED8A 1E4FT 4RU9A 3I4MG 4XYLB 4DV2H 3KXYT 2VQEH 3G6XA 4Q8EA 2W6PA 2CW7A 2R92G 3U1KA 4LF4H 4QWEA 4ED6A 3I12A 4NXMH 3LP8A 1EYZA 4TV9F 5J2TF 4ETSA 4B3SH 1XNRH 4RUCA 3Q8SB 3HKZE 1SEIA 3NGDA 4EYIB 4ED2A 3RBDA 3RB4A 2UVWA 5L1KA 3GTJA 4LFBH 5KFIA 2W8KA 2R8IA 4UCUA 2BQRA 3T5HA 1P8LA 4YAKB 2R8GA 3JSNA 1GSHA 5BR8H 2V5AA 1JIHA 4A3JG 4FBTA 1B04A 1KJIA 4NLGA 1J5KA 2YCHA 1RJQA 2FKLA 3IG0A 3KAJA 4G08A 3KTMA 3OSPA 4YY3H 4Q45A 3N41B 5CA1F 1K83A 2PVPA 5C44G 1PK8A 1M0TA 3GV5B 4JV1A 2C22A 4F4XA 2M05A 1NXUA 4A3KG 4IR9A 4LH7A 3R5XA 4DR6H 3GIJA 2RGVA 5KG3A 5KT3A 4A93G 2PBZA 3WNZA 4F50A 1SFOA 5CB4F 4QJFA 3H20A 3RJ0A 1VKZA 4IRCA 4DR7H 2FPPB 5GONF 2Z0SA 5EDWA 3I0PA 1ODHA 1HNWH 2OLSA 4LF7H 2WAQA 1DIKA 2YRWA 2LRRA 3ETHA 1WH2A 2YS7A 2E5LH 5C1PA 4EGJA 5IYCG 3CVZA 3RIZA 1BGWA 2VPSA 2F4VH 2ZDGA 4FBUA 5EWGA 3K5HA 2LTMA 3RB0A 2UXDH 4AIMA 1HNXH 1TWGA 3GTQA 2JEJA 4BBRG 3V69A 4U6PA 3OSSD 3T5JA 4B8CD 3RUPA 4O3OA 2WDTA 2XIGA 4DL5A 1CS0A 1MSZA 2CW8A 3HOYG 1B6RA 1RJRA 4IRDA 1S0MA 2VPQA 4ECTA 3GTKA 3LMLA 2R85A 4DR1H 4MV4A 2OH2A 1WHRA 5KT2A 2HGSA 4YB8B 3RB6A 2RDIA 2YL2A 5KT4A 5KFJA 5D8DA 1AUVA 2XD4A 4TQSA 2ANRA 4OO1G 4BA2I 1Z2IA 5C1OA 4KHPH 3KHRA 1X4NA 2XCLA 4ME6A 5KFNA 2XGQA 1I7LA 2O03A 2W9CA 3RTXA 2CWFA 4OD6A 2HVSA 2R7ZA 5L1IA 2MJHA 2C00A 1JXLA 2UXCH 2YZNA 3BJYA 3BA8A 1I94H 1FKAH 1ZQ7A 3K5IA 5HBRB 4QMFB 2RGRA 3R23A 4A3BG 2HVQA 4MTDA 2XC9A 2Y3MA 4O4LF 5JEAG 1W96A 1E4GT 1IBLH 1ZTGA 3H0GG 3M4IA 3TIIA 3U9TA 4YP3A 5A2QW 3G6VA 3G6YA 3PW0A 3HOZG 4EFBA 2JA5G 1M0WA 5J2UF 2HH3A 3V6KA 2UU9H 2UXBH 4A3FG 5KFOA 3MR2A 1XRHA 3EYYA 4LH6A 4ECRA 2J6SA 1R9TA 3FKIA 4DL2A 4FJUA 1S10A 3GILA 2JEIA 2WYOA 5IYDG 4XYMB 1I50A 5EWFA 1WVNA 2LF0A 2O4CA 1L2ZA 5KG0A 5C8YF 2SCUB 5DGBA 2DLNA 1I7NA 4J9PA 3OHBA 5KFAA 2C2RA 2FP4B 4A3DG 3L7ZC 4JI2H 4B3TH 2XCPA 2ZJTA 3TIGA 4J9KA 2B63G 1C30A 3PR4A 1Z2NX 2XCAA 2R8HA 1PQXA 1F0XA 3FDSA 4O2BF 1X9ZA 4IR1A 3GQCA 1CQJB 1M7JA 1TA8A 3KHHA 4FS1A 2BA0A 1B6SA 4DUZH 3GIDA 2VA3A 4B3MH 3GTGA 2R93G 5LOVF 2WE6A 4RB2C 3GIMA 2UVRA 3ETJA 1JLLB 1C3OA 2MCTA 4R8UA 2DGRA 4LF5H 1X0AA 1ZETA 4LFAH 5IYBG 1N33H 2R86A 3BA9A 4DV7H 2IA6A 2W71A 3HBLA 1TWFA 5F9NA 1WCMG 3V4SA 2PQUA 2G8YA 4X66H 3VPCA 3QZ7A 1MZBA 1Y1VG 2CKZB 3Q1KA 5BPHA 2W9CB 5EOYA 5FLXW 3T5KA 2FPHX 1DT4A 2CZGA 4FU0A 4QWAA 4MV3A 5KG5A 2DPJA 3KDGA 1J4WA 2W9BB 2W8LA 3AYHB 2W6OA 4ED3A 4Y8VB 5LMNH 2VOBA 2HHHH 1KJ9A 4X65H 1VIHA 5KFPA 4YQWA 3Q8QB 4DR5H 2FK2A 2I80A 4HNUA 4IWXA 4L1KA 4RUAA 1V9PA 3GV8B 1T3NA 1RYRA 2JA7A 4IZOA 5LA6F 2M8WA 3HXLA 5KFGA 3K3VA 4ECXA 4IAJA 5EZYF 2ASLA 3RV4A 4JUZA 4DV0H 3RAQA 4C5CA 1TWHA 2Q2TA 2DIKA 4Q43A 3JSLA 1Y14B 2NU6B 4JV2A 3GTLA 5K36G 3TQ1A 4GC6A 2JEFA 2R7KA 4LMYA 2RDJA 1Z2PX 2Y0SE 5K2MA 4JV0A 5KX5F 3IN5A 3GTMA 5KFFA 4A3CG 5LXTF 1TWCA 4YJ3F 4F4ZA 1N56A 2HH2A 4LSXA 1GYFA 5DQIA 4GKKH 1V9NA 2C2DA 2FLLA 2ATLA 4WD3A 3BQ0A 3GLKA 5KFVA 1K1SA 4DUYH 4MV7A 5LYJF 3EPGA 4GLXA 3DF7A 4DL3A 4F4WA 1IOWA 1BNCA 1TWAA 5KG4A 5KFCA 4JI6H 4EC5A 2IP4A 5KFRA 5JQWA 4J9RA 4LIJA 3N8DA 4RB0A 5JVDF 4J9MA 4EGQA 1AUXA 4JI8H 4EG0A 3HOUG 2OPVA 3RF2A 4B8TA 2CTMA 4HNTA 1Y1WA 4F4YA 4BBSG 2JA6A 3UOEA 3T5LA 3N42B 4YHHH 3TINA 5IP7G 5BMVF 3GKUA 1KJJA 3UQ8A 4NZRM 3GTPA 3H4BA 2E2HA 3RB3A 4JI3H 4EEYA 4BY7G 2GPWA 2JA8G 3OSNA 3RGXA 5KFKA 2PMZA 4BA1I 3FMAA 4RNNA 2NN6G 3I4NG 2KSWA 2JEBI 1HR0H 4O4HF 1BJTA 1S68A 3HB9A 4X64H 4QWDA 1Z2OX 5FD5A 3V4ZA 5HV6A 2VQDA 1JDBB 1IBMH 2VR1A 2DPIA 2R7ZG 4UCTA 5KFHA 1UNNC 2YYAA 4E9JA 3JRXA 3KHGA 3PW7A 2V58A 4ZOLF 4RB1A 5LL6b 4FS2A 5DGAA 1EC6A 4NZTM 2FK3A 3SB1A 1M6VA 4DV1H 1GGOA 1VBGA 4CC5A 4ECYA 4DL7A 3GIPA 3RAXA 1K1QA 2VKCA 5KFQA 1KJ8A 1DTJA 3RBEA 3JAMW 2AGPA 2GPSA 2NU7B 4GC7A 4MTEA 3PVXA 4DR3H 2X0SA 4YR0A 3L4JA 2BQ3A 1S0OA 4JI5H 3PO2G 1N36H 3FKIG 4XZ3B 5KFSA 2UUBH 1OWTA 4WANA 5FPRA 4LSAA 3MR3A 4ED0A 5KFLA 4MA5A 4NBQA 4JVHA 2UUAH 2J9GA 4DV5H 4WBNF 5BPFA 5L1LA 3KAKA 4TV8F 4ZHQF 3OETA 1I3QA 2W7OA 4DV3H 2R7LA 3HKZA 1S97A 4YJ2F 4ECUA 3EZJA 5C4XG 4J0MA 3Q8RB 4JI0H 2C28A 2R87A 3V6HA 3M9MB 4EBEA 4A3GG 2VA2A 3AEVB 1VIGA 5IYZF 2I8CA 4HNVA 4AYBE 2FMAA 5DG7A 1ZZKA 4JI7H 2R84A 2CTKA 4YBZB 1XMQH 3RFCA 5JH7F 3MFHA 3PW4A 2X06A 1I6UA 2ANNA 4HYKA 3PZPA 2NVYA 4LF9H 1VBIA 2YQRA 2B63A 1VAJA 1RK6A 2WAQE 2FMRA 3K3PA 3N44B 2Y0SA 3R5FA 4DV6H 4BY1G 3WO0A 2AGOA 1WTJA 1T94A 4YR2A 3BQ2A 4ECSA 5L9XA 1J5EH 2W6QA 1TUAA 4QWBA 2OWOA 1RK5A 4MAMA 5D1OA 2Q2UA 1ZHSA 2ALZA 3SE7A 4A2AA 4DL4A 3OUZA 4RB3C 3E5NA 1SYXB 4B3RH 2FPGB 4J9SA 4C5AA 2CQYA 3BAAA 4X62H 3ORRA 3PN1A 2HVRA 5KFWA 2A1SA 3T1YH 1PX2A 5JVLA 5JUMA 3G8CA 3ORQA 2W6ZA 3GIQA 3Q2OA 5KG2A 4UCSA 4Q44A 3UFXB 2IMWP 5FD6A 5L1JA 2CPQA 2JZXA 2W7PA 4UCOA 4QW8A 1ZZIA 4NXNH 2JA7G 4QIWE 1UG8A 1DV2A 3KHLA 2VUMA 4TQRA 3HOWG 3SI8A 4ECZA 2P2RA 1HNZH 4AM3A 3PW2A 4M7EA 2JE6I 4LFCH 4Q8FA 1GSAA 4CC6A 4I50F 2R6FA 2V59A 3RV3A 5KFDA 2I87A 4JI4H
chains in the Genus database with same CATH topology
2UXCH 4RZQA 3BA8A 1I94H 1FKAH 2RGRA 3L4KA 3N42B 2HVQA 4MTDA 4YHHH 1FVIA 2Y3MA 3UQ8A 4NZRM 1E4GT 3GR5A 2VQFH 1IBLH 3M4IA 5A2QW 4JI3H 2ZM6H 2W57A 3T1HH 4EFBA 3RGXA 4FM9A 1M0WA 3FMAA 2UU9H 2UXBH 1ZHQA 3N6XA 4EEQA 2KSWA 1HR0H 2PT7G 3QD7X 1BJTA 1S68A 3EYYA 4PDBA 4X64H 4LH6A 1Z2OX 2FE3A 3KALA 5FD5A 3RGZA 5D1PA 2WYOA 1IBMH 2LF0A 2O4CA 5LMUH 4A2BA 1L2ZA 1IBKH 4UCTA 4RAZA 1TAEA 3F8NA 4E9JA 4JI2H 4B3TH 2ZJTA 5D1OB 4RB1A 5LL6b 5IWAH 1FJGH 4NZTM 1Z2NX 3SB1A 3L2PA 4DV1H 2UUCH 1O75A 4RAYA 4OCHA 1F0XA 4CC5A 3J80W 4I7HA 1X9ZA 3N40P 4UCRA 2VKCA 1E4FT 1TA8A 4K0KH 3JAMW 3FAUA 4DV2H 2VQEH 3KXYT 4DUZH 2CW7A 3N43B 4B3MH 4UFZA 4MTEA 4LF4H 4DR3H 3L4JA 2WE6A 4JI5H 1N36H 4NXMH 4RB2C 5IT9W 2MCTA 4ETSA 2UUBH 4B3SH 1XNRH 4LF5H 1SEIA 5FPRA 4LSAA 4R7RA 4LFAH 4LFBH 1N33H 1X9NA 3BA9A 2UUAH 1AN7A 4DV5H 3NCVA 4DV7H 1A0IA 1P8LA 3KAKA 4UCUA 3OETA 3J81W 5DT9A 4DV3H 4AQYH 1S03G 2ZQEA 3KDKA 4X66H 5BR8H 3JSNA 4MV9A 3EZJA 1MZBA 1XNQH 1B04A 4J0MA 4JI0H 2YCHA 3IG0A 3KAJA 3MWMA 4G08A 5EOYA 4YY3H 3N41B 5FLXW 2FPHX 1M0TA 3KDGA 4JI7H 4BWSC 1VS0A 1XMQH 3GABA 4EFEA 1I6UA 3J7AK 1DGSA 4LH7A 4DR6H 2RGVA 5LMNH 4LF9H 2VOBA 2HHHH 1N32H 3N44B 3H20A 3RJ0A 4DV6H 4X65H 4LF6H 4OX9H 4DR7H 3BABA 4DR5H 1ODHA 1HNWH 4LF7H 1V9PA 3HXLA 1WH2A 3K3VA 2E5LH 1J5EH 4IAJA 4UCVA 3CVZA 2OWOA 3RIZA 2Q2UA 5D1OA 1BGWA 1ZHSA 2VPSA 2F4VH 4DV0H 4A2AA 4RB3C 2UXDH 1HNXH 2Q2TA 1SYXB 4B3RH 3JSLA 4DR2H 5FPOA 3OSSD 2D9IA 4B8CD 3BAAA 4X62H 4APMA 3PN1A 2WDTA 2HVRA 2XIGA 3T1YH 4LMYA 1Z2PX 2CW8A 3C0FB 3OTOH 4DV4H 4GKJH 3LMLA 4UCSA 5FD6A 4DR1H 4LSXA 1GYFA 4GKKH 2HGSA 4UCOA 4NXNH 4Q0YA 4DUYH 4MV7A 4GLXA 4JV5H 4DR4H 1XMOH 3DF7A 1N34H 4JI6H 4JYAH 4EC5A 4KHPH 4LF8H 1HNZH 4RB0A 4JI1H 4M7EA 1XDNA 2VUGA 2O03A 4LFCH 4CC6A 4JI8H 4OD6A 3RTXA 3RF2A 2HVSA 4JI4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC H;  1I94 H;  1FKA H;  4YHH H;  1IBL H;  2VQF H;  5A2Q W;  4JI3 H;  2ZM6 H;  3T1H H;  2UU9 H;  2UXB H;  1HR0 H;  4PDB A;  4X64 H;  1IBM H;  5LMU H;  1IBK H;  4JI2 H;  4B3T H;  5LL6 b;  5IWA H;  1FJG H;  4DV1 H;  2UUC H;  3J80 W;  4K0K H;  3JAM W;  4DV2 H;  2VQE H;  4DUZ H;  4B3M H;  4LF4 H;  4DR3 H;  4JI5 H;  1N36 H;  4NXM H;  5IT9 W;  2UUB H;  4B3S H;  1XNR H;  4LF5 H;  1SEI A;  4LFA H;  4LFB H;  1N33 H;  2UUA H;  1AN7 A;  4DV5 H;  4DV7 H;  3J81 W;  4DV3 H;  1S03 G;  4AQY H;  4X66 H;  5BR8 H;  1XNQ H;  4JI0 H;  4YY3 H;  5FLX W;  4JI7 H;  1XMQ H;  1I6U A;  3J7A K;  4DR6 H;  5LMN H;  4LF9 H;  2HHH H;  1N32 H;  4DV6 H;  4X65 H;  4LF6 H;  4OX9 H;  4DR7 H;  4DR5 H;  1HNW H;  4LF7 H;  2E5L H;  1J5E H;  2F4V H;  4DV0 H;  2UXD H;  1HNX H;  4B3R H;  4DR2 H;  4X62 H;  3T1Y H;  3OTO H;  4DV4 H;  4GKJ H;  4DR1 H;  4GKK H;  4NXN H;  4DUY H;  4JV5 H;  4DR4 H;  1XMO H;  1N34 H;  4JI6 H;  4JYA H;  4KHP H;  4LF8 H;  1HNZ H;  4JI1 H;  4LFC H;  4JI8 H;  3RF2 A;  4JI4 H; 
#chains in the Genus database with same CATH topology
 2V4R A;  4RZQ A;  2FLN A;  3L4K A;  2FLP A;  3MR5 A;  3BQ1 A;  1FVI A;  2YU9 A;  1V51 A;  1KEE A;  4I4T F;  4O3P A;  3OHA A;  1CE8 A;  3EPI A;  2V9W A;  5FJ8 G;  2W57 A;  5KFE A;  3T1H H;  1EZ1 A;  4G3I A;  2R92 A;  2W70 A;  4ZI7 F;  3H40 A;  4IHJ F;  3N6X A;  4EEQ A;  5LP6 F;  4ECQ A;  1CQI B;  2NU9 B;  2HJW A;  2OPU A;  5KG7 A;  2FJZ A;  5H80 A;  4U7C A;  1EHI A;  3GV7 B;  3KAL A;  4O4I F;  3RGZ A;  2WTF A;  3V6J A;  4MV6 A;  5DQG A;  2ASD A;  2DWC A;  4R8U B;  1KJQ A;  5DG9 A;  4EBD A;  5LMU H;  2CWH A;  4O2A F;  4A2B A;  5C3E G;  1W93 A;  1IBK H;  4YR3 A;  2R8K A;  5C0X G;  1TAE A;  4IWY A;  1Y1W G;  2W9A A;  4YAJ B;  2JA6 G;  5D1O B;  5IWA H;  2J6U A;  3VPD A;  2UUC H;  3QZ8 A;  1JKJ B;  5DQH A;  1WSC A;  2YZM A;  4PWQ A;  4K0K H;  4AYB A;  3FAU A;  1T36 A;  4UFZ A;  4ECW A;  3N43 B;  2C35 B;  5KFZ A;  5KFX A;  2ZDQ A;  5KKN B;  4QW9 A;  2NVX A;  3H3V H;  5C5J A;  1WE8 A;  1E4E A;  5IT9 W;  3H4D A;  1JDE A;  2FB9 A;  1RYS A;  2QND A;  2DZD A;  2K1H A;  2P0A A;  2W6N A;  4R7R A;  2C2E A;  2CTL A;  1KC7 A;  3HOV G;  1AN7 A;  1A0I A;  3NCV A;  4O3S A;  4A3M G;  1S9F A;  2E3U A;  3J81 W;  5DT9 A;  1S03 G;  4AQY H;  2WB1 E;  2ZQE A;  3KDK A;  2FK1 A;  3BG5 A;  4MV9 A;  5KT6 A;  2AU0 A;  2FFM A;  1XNQ H;  4J9O A;  3MWM A;  5KG1 A;  4DL6 A;  2AGQ A;  2R82 A;  1IOV A;  2YW2 A;  3CQZ A;  1N48 A;  2YS6 A;  2XGP A;  4O3R A;  2CTE A;  5CAE B;  4XX0 B;  4O3Q A;  1GO3 E;  4BWS C;  3LWB A;  1EUD B;  1VS0 A;  1RJP A;  3GAB A;  4M9U A;  2NUA B;  4EFE A;  1DGS A;  3J7A K;  5KT5 A;  5KT7 A;  1JX4 A;  1K1G A;  3GTO A;  4A3I G;  4WAL A;  5KG6 A;  3VMM A;  1N32 H;  4RNM A;  4I55 F;  4LF6 H;  4OX9 H;  3BAB A;  2RF4 A;  1UC8 A;  3JRW A;  3MWE A;  2IBK A;  4A3L G;  4BXX G;  4HR7 A;  4QIW A;  1EUC B;  4UCV A;  3OUU A;  4J9L A;  3HOX G;  3JZI A;  2E2I A;  1SCU B;  2QYZ A;  3R5H A;  2BQU A;  4EBC A;  3QFF A;  1KBL A;  2QK4 A;  2W9B A;  1GLV A;  2R8J A;  4DR2 H;  5FPO A;  1S20 A;  2D9I A;  2PY9 A;  4APM A;  5T14 A;  2UVU A;  2BL5 A;  2J6T A;  5F9L A;  2ZDH A;  3PO3 G;  2JVZ A;  5KFT A;  3C0F B;  3OTO H;  4DV4 H;  3H0G A;  2W6M A;  1VBH A;  3MJF A;  2CTF A;  4GKJ H;  2PN1 A;  2UVV A;  5DLF A;  3M9O B;  3GII A;  1V4Y A;  4RNO A;  2JA5 A;  3PW5 A;  2GLT A;  4Q0Y A;  4E4T A;  2V4Q A;  3MFI A;  4JV5 H;  4C5B A;  4DR4 H;  1XMO H;  1E4E B;  1N34 H;  3MWD A;  4JYA H;  4LF8 H;  3VKE A;  4RZR A;  4IFD G;  4TUY F;  4JI1 H;  1XDN A;  2VUG A;  3VPB A;  2CTJ A;  5FLM G;  1ZZJ A;  4MV8 A;  1ULZ A;  4EYH B;  1WR2 A;  5DLG A;  3WO1 A;  5EWE A;  4QWC A;  2JEG A;  4IRK A;  2JA9 A;  3Q8P B;  5IP9 G;  2PMZ E;  5KFU A;  4JVY A;  3GR5 A;  2VQF H;  4ZQI A;  5KFB A;  4J9N A;  4ED7 A;  2ZM6 H;  2YRX A;  1BXR A;  4MA0 A;  4ECV A;  4H8A A;  2YZG A;  4FM9 A;  5DG8 A;  3MR6 A;  1KHM A;  2FPI B;  2JEA I;  2BR0 A;  1ZHQ A;  2NU8 B;  3TQT A;  3PR5 B;  3GIK A;  2VUM G;  2R93 A;  1GSO A;  2PT7 G;  3QD7 X;  1B33 N;  3M9N B;  4PDB A;  4ED1 A;  4A3E G;  2FE3 A;  1V8C A;  2ASJ A;  5D1P A;  5CA0 F;  4C2M A;  4HQ6 A;  4J9Q A;  4O3N A;  2M6Q A;  2CPM A;  5KFY A;  1S0N A;  5I47 A;  1WCM A;  4DLK A;  2R7N A;  4RAZ A;  1UC9 A;  3F8N A;  4MV1 A;  1A9X A;  1Y1V A;  2AXY A;  2WB1 A;  5KFM A;  2AQ4 A;  1FJG H;  2R7M A;  3U9S A;  3L2P A;  1X4M A;  1O75 A;  2LTL A;  1DV1 A;  4RAY A;  4OCH A;  3J80 W;  4FJS A;  3N40 P;  4I7H A;  1X9N A;  4UCR A;  4ED8 A;  1E4F T;  4RU9 A;  3I4M G;  4XYL B;  4DV2 H;  3KXY T;  2VQE H;  3G6X A;  4Q8E A;  2W6P A;  2CW7 A;  2R92 G;  3U1K A;  4LF4 H;  4QWE A;  4ED6 A;  3I12 A;  4NXM H;  3LP8 A;  1EYZ A;  4TV9 F;  5J2T F;  4ETS A;  4B3S H;  1XNR H;  4RUC A;  3Q8S B;  3HKZ E;  1SEI A;  3NGD A;  4EYI B;  4ED2 A;  3RBD A;  3RB4 A;  2UVW A;  5L1K A;  3GTJ A;  4LFB H;  5KFI A;  2W8K A;  2R8I A;  4UCU A;  2BQR A;  3T5H A;  1P8L A;  4YAK B;  2R8G A;  3JSN A;  1GSH A;  5BR8 H;  2V5A A;  1JIH A;  4A3J G;  4FBT A;  1B04 A;  1KJI A;  4NLG A;  1J5K A;  2YCH A;  1RJQ A;  2FKL A;  3IG0 A;  3KAJ A;  4G08 A;  3KTM A;  3OSP A;  4YY3 H;  4Q45 A;  3N41 B;  5CA1 F;  1K83 A;  2PVP A;  5C44 G;  1PK8 A;  1M0T A;  3GV5 B;  4JV1 A;  2C22 A;  4F4X A;  2M05 A;  1NXU A;  4A3K G;  4IR9 A;  4LH7 A;  3R5X A;  4DR6 H;  3GIJ A;  2RGV A;  5KG3 A;  5KT3 A;  4A93 G;  2PBZ A;  3WNZ A;  4F50 A;  1SFO A;  5CB4 F;  4QJF A;  3H20 A;  3RJ0 A;  1VKZ A;  4IRC A;  4DR7 H;  2FPP B;  5GON F;  2Z0S A;  5EDW A;  3I0P A;  1ODH A;  1HNW H;  2OLS A;  4LF7 H;  2WAQ A;  1DIK A;  2YRW A;  2LRR A;  3ETH A;  1WH2 A;  2YS7 A;  2E5L H;  5C1P A;  4EGJ A;  5IYC G;  3CVZ A;  3RIZ A;  1BGW A;  2VPS A;  2F4V H;  2ZDG A;  4FBU A;  5EWG A;  3K5H A;  2LTM A;  3RB0 A;  2UXD H;  4AIM A;  1HNX H;  1TWG A;  3GTQ A;  2JEJ A;  4BBR G;  3V69 A;  4U6P A;  3OSS D;  3T5J A;  4B8C D;  3RUP A;  4O3O A;  2WDT A;  2XIG A;  4DL5 A;  1CS0 A;  1MSZ A;  2CW8 A;  3HOY G;  1B6R A;  1RJR A;  4IRD A;  1S0M A;  2VPQ A;  4ECT A;  3GTK A;  3LML A;  2R85 A;  4DR1 H;  4MV4 A;  2OH2 A;  1WHR A;  5KT2 A;  2HGS A;  4YB8 B;  3RB6 A;  2RDI A;  2YL2 A;  5KT4 A;  5KFJ A;  5D8D A;  1AUV A;  2XD4 A;  4TQS A;  2ANR A;  4OO1 G;  4BA2 I;  1Z2I A;  5C1O A;  4KHP H;  3KHR A;  1X4N A;  2XCL A;  4ME6 A;  5KFN A;  2XGQ A;  1I7L A;  2O03 A;  2W9C A;  3RTX A;  2CWF A;  4OD6 A;  2HVS A;  2R7Z A;  5L1I A;  2MJH A;  2C00 A;  1JXL A;  2UXC H;  2YZN A;  3BJY A;  3BA8 A;  1I94 H;  1FKA H;  1ZQ7 A;  3K5I A;  5HBR B;  4QMF B;  2RGR A;  3R23 A;  4A3B G;  2HVQ A;  4MTD A;  2XC9 A;  2Y3M A;  4O4L F;  5JEA G;  1W96 A;  1E4G T;  1IBL H;  1ZTG A;  3H0G G;  3M4I A;  3TII A;  3U9T A;  4YP3 A;  5A2Q W;  3G6V A;  3G6Y A;  3PW0 A;  3HOZ G;  4EFB A;  2JA5 G;  1M0W A;  5J2U F;  2HH3 A;  3V6K A;  2UU9 H;  2UXB H;  4A3F G;  5KFO A;  3MR2 A;  1XRH A;  3EYY A;  4LH6 A;  4ECR A;  2J6S A;  1R9T A;  3FKI A;  4DL2 A;  4FJU A;  1S10 A;  3GIL A;  2JEI A;  2WYO A;  5IYD G;  4XYM B;  1I50 A;  5EWF A;  1WVN A;  2LF0 A;  2O4C A;  1L2Z A;  5KG0 A;  5C8Y F;  2SCU B;  5DGB A;  2DLN A;  1I7N A;  4J9P A;  3OHB A;  5KFA A;  2C2R A;  2FP4 B;  4A3D G;  3L7Z C;  4JI2 H;  4B3T H;  2XCP A;  2ZJT A;  3TIG A;  4J9K A;  2B63 G;  1C30 A;  3PR4 A;  1Z2N X;  2XCA A;  2R8H A;  1PQX A;  1F0X A;  3FDS A;  4O2B F;  1X9Z A;  4IR1 A;  3GQC A;  1CQJ B;  1M7J A;  1TA8 A;  3KHH A;  4FS1 A;  2BA0 A;  1B6S A;  4DUZ H;  3GID A;  2VA3 A;  4B3M H;  3GTG A;  2R93 G;  5LOV F;  2WE6 A;  4RB2 C;  3GIM A;  2UVR A;  3ETJ A;  1JLL B;  1C3O A;  2MCT A;  4R8U A;  2DGR A;  4LF5 H;  1X0A A;  1ZET A;  4LFA H;  5IYB G;  1N33 H;  2R86 A;  3BA9 A;  4DV7 H;  2IA6 A;  2W71 A;  3HBL A;  1TWF A;  5F9N A;  1WCM G;  3V4S A;  2PQU A;  2G8Y A;  4X66 H;  3VPC A;  3QZ7 A;  1MZB A;  1Y1V G;  2CKZ B;  3Q1K A;  5BPH A;  2W9C B;  5EOY A;  5FLX W;  3T5K A;  2FPH X;  1DT4 A;  2CZG A;  4FU0 A;  4QWA A;  4MV3 A;  5KG5 A;  2DPJ A;  3KDG A;  1J4W A;  2W9B B;  2W8L A;  3AYH B;  2W6O A;  4ED3 A;  4Y8V B;  5LMN H;  2VOB A;  2HHH H;  1KJ9 A;  4X65 H;  1VIH A;  5KFP A;  4YQW A;  3Q8Q B;  4DR5 H;  2FK2 A;  2I80 A;  4HNU A;  4IWX A;  4L1K A;  4RUA A;  1V9P A;  3GV8 B;  1T3N A;  1RYR A;  2JA7 A;  4IZO A;  5LA6 F;  2M8W A;  3HXL A;  5KFG A;  3K3V A;  4ECX A;  4IAJ A;  5EZY F;  2ASL A;  3RV4 A;  4JUZ A;  4DV0 H;  3RAQ A;  4C5C A;  1TWH A;  2Q2T A;  2DIK A;  4Q43 A;  3JSL A;  1Y14 B;  2NU6 B;  4JV2 A;  3GTL A;  5K36 G;  3TQ1 A;  4GC6 A;  2JEF A;  2R7K A;  4LMY A;  2RDJ A;  1Z2P X;  2Y0S E;  5K2M A;  4JV0 A;  5KX5 F;  3IN5 A;  3GTM A;  5KFF A;  4A3C G;  5LXT F;  1TWC A;  4YJ3 F;  4F4Z A;  1N56 A;  2HH2 A;  4LSX A;  1GYF A;  5DQI A;  4GKK H;  1V9N A;  2C2D A;  2FLL A;  2ATL A;  4WD3 A;  3BQ0 A;  3GLK A;  5KFV A;  1K1S A;  4DUY H;  4MV7 A;  5LYJ F;  3EPG A;  4GLX A;  3DF7 A;  4DL3 A;  4F4W A;  1IOW A;  1BNC A;  1TWA A;  5KG4 A;  5KFC A;  4JI6 H;  4EC5 A;  2IP4 A;  5KFR A;  5JQW A;  4J9R A;  4LIJ A;  3N8D A;  4RB0 A;  5JVD F;  4J9M A;  4EGQ A;  1AUX A;  4JI8 H;  4EG0 A;  3HOU G;  2OPV A;  3RF2 A;  4B8T A;  2CTM A;  4HNT A;  1Y1W A;  4F4Y A;  4BBS G;  2JA6 A;  3UOE A;  3T5L A;  3N42 B;  4YHH H;  3TIN A;  5IP7 G;  5BMV F;  3GKU A;  1KJJ A;  3UQ8 A;  4NZR M;  3GTP A;  3H4B A;  2E2H A;  3RB3 A;  4JI3 H;  4EEY A;  4BY7 G;  2GPW A;  2JA8 G;  3OSN A;  3RGX A;  5KFK A;  2PMZ A;  4BA1 I;  3FMA A;  4RNN A;  2NN6 G;  3I4N G;  2KSW A;  2JEB I;  1HR0 H;  4O4H F;  1BJT A;  1S68 A;  3HB9 A;  4X64 H;  4QWD A;  1Z2O X;  5FD5 A;  3V4Z A;  5HV6 A;  2VQD A;  1JDB B;  1IBM H;  2VR1 A;  2DPI A;  2R7Z G;  4UCT A;  5KFH A;  1UNN C;  2YYA A;  4E9J A;  3JRX A;  3KHG A;  3PW7 A;  2V58 A;  4ZOL F;  4RB1 A;  5LL6 b;  4FS2 A;  5DGA A;  1EC6 A;  4NZT M;  2FK3 A;  3SB1 A;  1M6V A;  4DV1 H;  1GGO A;  1VBG A;  4CC5 A;  4ECY A;  4DL7 A;  3GIP A;  3RAX A;  1K1Q A;  2VKC A;  5KFQ A;  1KJ8 A;  1DTJ A;  3RBE A;  3JAM W;  2AGP A;  2GPS A;  2NU7 B;  4GC7 A;  4MTE A;  3PVX A;  4DR3 H;  2X0S A;  4YR0 A;  3L4J A;  2BQ3 A;  1S0O A;  4JI5 H;  3PO2 G;  1N36 H;  3FKI G;  4XZ3 B;  5KFS A;  2UUB H;  1OWT A;  4WAN A;  5FPR A;  4LSA A;  3MR3 A;  4ED0 A;  5KFL A;  4MA5 A;  4NBQ A;  4JVH A;  2UUA H;  2J9G A;  4DV5 H;  4WBN F;  5BPF A;  5L1L A;  3KAK A;  4TV8 F;  4ZHQ F;  3OET A;  1I3Q A;  2W7O A;  4DV3 H;  2R7L A;  3HKZ A;  1S97 A;  4YJ2 F;  4ECU A;  3EZJ A;  5C4X G;  4J0M A;  3Q8R B;  4JI0 H;  2C28 A;  2R87 A;  3V6H A;  3M9M B;  4EBE A;  4A3G G;  2VA2 A;  3AEV B;  1VIG A;  5IYZ F;  2I8C A;  4HNV A;  4AYB E;  2FMA A;  5DG7 A;  1ZZK A;  4JI7 H;  2R84 A;  2CTK A;  4YBZ B;  1XMQ H;  3RFC A;  5JH7 F;  3MFH A;  3PW4 A;  2X06 A;  1I6U A;  2ANN A;  4HYK A;  3PZP A;  2NVY A;  4LF9 H;  1VBI A;  2YQR A;  2B63 A;  1VAJ A;  1RK6 A;  2WAQ E;  2FMR A;  3K3P A;  3N44 B;  2Y0S A;  3R5F A;  4DV6 H;  4BY1 G;  3WO0 A;  2AGO A;  1WTJ A;  1T94 A;  4YR2 A;  3BQ2 A;  4ECS A;  5L9X A;  1J5E H;  2W6Q A;  1TUA A;  4QWB A;  2OWO A;  1RK5 A;  4MAM A;  5D1O A;  2Q2U A;  1ZHS A;  2ALZ A;  3SE7 A;  4A2A A;  4DL4 A;  3OUZ A;  4RB3 C;  3E5N A;  1SYX B;  4B3R H;  2FPG B;  4J9S A;  4C5A A;  2CQY A;  3BAA A;  4X62 H;  3ORR A;  3PN1 A;  2HVR A;  5KFW A;  2A1S A;  3T1Y H;  1PX2 A;  5JVL A;  5JUM A;  3G8C A;  3ORQ A;  2W6Z A;  3GIQ A;  3Q2O A;  5KG2 A;  4UCS A;  4Q44 A;  3UFX B;  2IMW P;  5FD6 A;  5L1J A;  2CPQ A;  2JZX A;  2W7P A;  4UCO A;  4QW8 A;  1ZZI A;  4NXN H;  2JA7 G;  4QIW E;  1UG8 A;  1DV2 A;  3KHL A;  2VUM A;  4TQR A;  3HOW G;  3SI8 A;  4ECZ A;  2P2R A;  1HNZ H;  4AM3 A;  3PW2 A;  4M7E A;  2JE6 I;  4LFC H;  4Q8F A;  1GSA A;  4CC6 A;  4I50 F;  2R6F A;  2V59 A;  3RV3 A;  5KFD A;  2I87 A;  4JI4 H; 
#chains in the Genus database with same CATH homology
 2UXC H;  4RZQ A;  3BA8 A;  1I94 H;  1FKA H;  2RGR A;  3L4K A;  3N42 B;  2HVQ A;  4MTD A;  4YHH H;  1FVI A;  2Y3M A;  3UQ8 A;  4NZR M;  1E4G T;  3GR5 A;  2VQF H;  1IBL H;  3M4I A;  5A2Q W;  4JI3 H;  2ZM6 H;  2W57 A;  3T1H H;  4EFB A;  3RGX A;  4FM9 A;  1M0W A;  3FMA A;  2UU9 H;  2UXB H;  1ZHQ A;  3N6X A;  4EEQ A;  2KSW A;  1HR0 H;  2PT7 G;  3QD7 X;  1BJT A;  1S68 A;  3EYY A;  4PDB A;  4X64 H;  4LH6 A;  1Z2O X;  2FE3 A;  3KAL A;  5FD5 A;  3RGZ A;  5D1P A;  2WYO A;  1IBM H;  2LF0 A;  2O4C A;  5LMU H;  4A2B A;  1L2Z A;  1IBK H;  4UCT A;  4RAZ A;  1TAE A;  3F8N A;  4E9J A;  4JI2 H;  4B3T H;  2ZJT A;  5D1O B;  4RB1 A;  5LL6 b;  5IWA H;  1FJG H;  4NZT M;  1Z2N X;  3SB1 A;  3L2P A;  4DV1 H;  2UUC H;  1O75 A;  4RAY A;  4OCH A;  1F0X A;  4CC5 A;  3J80 W;  4I7H A;  1X9Z A;  3N40 P;  4UCR A;  2VKC A;  1E4F T;  1TA8 A;  4K0K H;  3JAM W;  3FAU A;  4DV2 H;  2VQE H;  3KXY T;  4DUZ H;  2CW7 A;  3N43 B;  4B3M H;  4UFZ A;  4MTE A;  4LF4 H;  4DR3 H;  3L4J A;  2WE6 A;  4JI5 H;  1N36 H;  4NXM H;  4RB2 C;  5IT9 W;  2MCT A;  4ETS A;  2UUB H;  4B3S H;  1XNR H;  4LF5 H;  1SEI A;  5FPR A;  4LSA A;  4R7R A;  4LFA H;  4LFB H;  1N33 H;  1X9N A;  3BA9 A;  2UUA H;  1AN7 A;  4DV5 H;  3NCV A;  4DV7 H;  1A0I A;  1P8L A;  3KAK A;  4UCU A;  3OET A;  3J81 W;  5DT9 A;  4DV3 H;  4AQY H;  1S03 G;  2ZQE A;  3KDK A;  4X66 H;  5BR8 H;  3JSN A;  4MV9 A;  3EZJ A;  1MZB A;  1XNQ H;  1B04 A;  4J0M A;  4JI0 H;  2YCH A;  3IG0 A;  3KAJ A;  3MWM A;  4G08 A;  5EOY A;  4YY3 H;  3N41 B;  5FLX W;  2FPH X;  1M0T A;  3KDG A;  4JI7 H;  4BWS C;  1VS0 A;  1XMQ H;  3GAB A;  4EFE A;  1I6U A;  3J7A K;  1DGS A;  4LH7 A;  4DR6 H;  2RGV A;  5LMN H;  4LF9 H;  2VOB A;  2HHH H;  1N32 H;  3N44 B;  3H20 A;  3RJ0 A;  4DV6 H;  4X65 H;  4LF6 H;  4OX9 H;  4DR7 H;  3BAB A;  4DR5 H;  1ODH A;  1HNW H;  4LF7 H;  1V9P A;  3HXL A;  1WH2 A;  3K3V A;  2E5L H;  1J5E H;  4IAJ A;  4UCV A;  3CVZ A;  2OWO A;  3RIZ A;  2Q2U A;  5D1O A;  1BGW A;  1ZHS A;  2VPS A;  2F4V H;  4DV0 H;  4A2A A;  4RB3 C;  2UXD H;  1HNX H;  2Q2T A;  1SYX B;  4B3R H;  3JSL A;  4DR2 H;  5FPO A;  3OSS D;  2D9I A;  4B8C D;  3BAA A;  4X62 H;  4APM A;  3PN1 A;  2WDT A;  2HVR A;  2XIG A;  3T1Y H;  4LMY A;  1Z2P X;  2CW8 A;  3C0F B;  3OTO H;  4DV4 H;  4GKJ H;  3LML A;  4UCS A;  5FD6 A;  4DR1 H;  4LSX A;  1GYF A;  4GKK H;  2HGS A;  4UCO A;  4NXN H;  4Q0Y A;  4DUY H;  4MV7 A;  4GLX A;  4JV5 H;  4DR4 H;  1XMO H;  3DF7 A;  1N34 H;  4JI6 H;  4JYA H;  4EC5 A;  4KHP H;  4LF8 H;  1HNZ H;  4RB0 A;  4JI1 H;  4M7E A;  1XDN A;  2VUG A;  2O03 A;  4LFC H;  4CC6 A;  4JI8 H;  4OD6 A;  3RTX A;  3RF2 A;  2HVS A;  4JI4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...