3J81W

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j81W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j81W02
2UUBH 4B3TH 4DR4H 3T1HH 4LF6H 4LFBH 4JI7H 4YY3H 4DV1H 3J81W 4JI4H 4OX9H 2VQEH 1XNQH 2VQFH 3T1YH 4KHPH 2UXCH 4DUYH 4JI5H 4JI3H 4X65H 3JAMW 1AN7A 2UXBH 4NXMH 4B3MH 3OTOH 4DR6H 4LF8H 1I6UA 4X66H 1N34H 4LF5H 4K0KH 4DR2H 2E5LH 4DR5H 2F4VH 1J5EH 4GKKH 4X62H 1HNWH 4NXNH 4JV5H 1N33H 3RF2A 2UU9H 4DUZH 4DV2H 4DV3H 4LF4H 4GKJH 4JI8H 1HR0H 4PDBA 4LF7H 1IBKH 4LF9H 4DV5H 5LMUH 1FKAH 2UUCH 3J80W 1XMQH 1N32H 1IBMH 1XMOH 4B3SH 4LFCH 1HNXH 4JI0H 4DV6H 1N36H 4JYAH 5IT9W 4DR3H 4JI2H 1IBLH 4DR7H 4DV0H 4JI1H 1I94H 5A2QW 4B3RH 2ZM6H 4AQYH 4DR1H 4X64H 2HHHH 4YHHH 3J7AK 5FLXW 2UUAH 1XNRH 4LFAH 4DV4H 5BR8H 1HNZH 1SEIA 5IWAH 5LL6b 4JI6H 5LMNH 4DV7H 1FJGH 2UXDH 1S03G
chains in the Genus database with same CATH superfamily
4B3TH 2PBZA 2YU9A 5L1JA 5LP6F 5KX5F 4J9PA 2C2EA 4AYBA 3VKEA 2YZGA 1RJPA 1EZ1A 4HR7A 3BG5A 3I12A 1KJQA 5C1OA 2CPQA 4AIMA 3HOVG 4BXXG 4Q8FA 4DLKA 2VUMA 3PVXA 2VKCA 3C0FB 1EHIA 3H40A 2FK3A 4IZOA 3J81W 5FPRA 5LOVF 2ATLA 1ZZKA 1S0NA 2M6QA 2W7OA 5DLFA 1WR2A 2VQEH 3GKUA 1A9XA 2G8YA 5DG7A 1E4EB 5KFGA 4IRDA 4BY7G 1K83A 4DUYH 1ODHA 1EC6A 3VPCA 5KKNB 5IYBG 3H0GG 5IYCG 5KT3A 2W57A 3H4DA 3H4BA 2R8JA 3JAMW 4MTDA 2UVUA 1XDNA 5F9LA 1AN7A 2UXBH 3R5HA 2YL2A 4IRKA 3TQ1A 4O3QA 4F4WA 4B8TA 4B3MH 2CQYA 2M8WA 5KT6A 5EDWA 1TWGA 4FS1A 1NXUA 1S68A 2ZDGA 2OH2A 4O3OA 4TV9F 4JV1A 3G6VA 1S9FA 1N34H 4QWDA 5D1OB 2FLPA 1KC7A 3PN1A 2PQUA 1ZQ7A 3KAJA 4C2MA 4ECTA 2R82A 2CTKA 4YR3A 1GYFA 1I50A 3GILA 4GKKH 5K36G 2ZQEA 4ED7A 1TAEA 4X62H 3Q8PB 4JV5H 4NXNH 3JRWA 2WAQE 1N33H 3N42B 5DG9A 2V4RA 3RF2A 1Z2NX 2I80A 4MAMA 4MV7A 1TWHA 5KFWA 4UCSA 3GV7B 5HBRB 4EC5A 1ZTGA 3K5HA 4HYKA 4RB2C 4BBRG 2JZXA 1HR0H 3MWEA 1IOVA 2WTFA 4NZTM 1TWFA 3MR3A 2AGQA 2ANNA 4A3BG 2LTMA 5KG5A 1CE8A 1VAJA 2A1SA 1Y1WG 4G3IA 2W6QA 4BA1I 4DV5H 2CW7A 2CZGA 3K3VA 4Y8VB 2V4QA 2O4CA 3MWMA 3GTQA 3GTPA 3SE7A 3KHRA 4A3GG 2YQRA 1XMQH 2R7NA 5KG6A 3HOUG 3OSPA 1V9NA 1BGWA 1SFOA 2JEBI 1VIHA 1GLVA 5C0XG 1JXLA 5KFPA 5CA0F 2P2RA 3GTJA 2MJHA 4DL5A 3V4ZA 4DL6A 2B63A 1J4WA 2R87A 4A3EG 2C2DA 5JUMA 4XYMB 4MV3A 4MV4A 5IT9W 3E5NA 4C5AA 2NUAB 1DT4A 5JVLA 5KFKA 2ASJA 2OLSA 4DV0H 3H3VH 5LXTF 1M7JA 1KJ8A 2ZM6H 4UCOA 4QWBA 1CQIB 4I4TF 4ZHQF 4DR1H 2FK1A 2WAQA 5KG7A 3GTLA 2R8IA 4WANA 4O3NA 4AYBE 4RUCA 5FLXW 4EG0A 1XNRH 4APMA 1X9ZA 3BAAA 1S0OA 4LFAH 1JLLB 2X0SA 4DV4H 4LSXA 5KFXA 5EWGA 4A3CG 2QYZA 4FBUA 3Q8SB 2IBKA 4ECVA 4J9MA 2CW8A 4JI6H 3BA8A 4DV7H 4LSAA 5DQHA 4IR9A 3T5HA 2R7ZG 1Y1VA 2NVYA 2R86A 5DQIA 1RYSA 2UUBH 2JEFA 2ANRA 2DWCA 4MA0A 3UOEA 1JDEA 1CS0A 4H8AA 3EPGA 1UNNC 2VOBA 3GIIA 2W71A 4A3KG 3RJ0A 4YJ3F 4ED2A 1Z2OX 2R8GA 4G08A 2NU7B 1O75A 1S10A 2CWFA 2WYOA 4DV1H 4RZRA 4J9NA 5EWEA 3MR6A 4NLGA 1FVIA 5KT5A 1TUAA 5KFCA 2DLNA 3BABA 4MA5A 5EZYF 5DLGA 5BMVF 2FPIB 3T5LA 4F50A 1ULZA 1WTJA 3TIGA 3G6XA 4RB1A 2AU0A 1B6RA 4OO1G 4KHPH 2GLTA 3U1KA 1SYXB 5IYDG 1J5KA 3R23A 3FDSA 1WCMG 2AXYA 4JI3H 2ASDA 1Z2IA 4X65H 1EYZA 4QW8A 1DTJA 4ECRA 3V6JA 4I7HA 3PZPA 1X9NA 3HOZG 4FJSA 3AEVB 1IOWA 3PW0A 5EOYA 4NXMH 4WD3A 2HJWA 4RAZA 4ZOLF 5KFTA 4QWCA 3OSNA 1K1SA 3RBDA 3GV8B 2XGPA 2W9CA 3H0GA 2JA5G 1WVNA 4LF8H 1I6UA 3RFCA 1ZHQA 3GV5B 4X66H 4NBQA 4K0KH 3KTMA 2O03A 2E5LH 2BA0A 2JEIA 2NVXA 2F4VH 2JE6I 1GSAA 2FB9A 4O4LF 4R8UA 2YZMA 4R7RA 3K3PA 4EFEA 4EEQA 1GGOA 5KFQA 2CKZB 5C5JA 4YR2A 3EZJA 1HNWH 1RYRA 4BBSG 2J6TA 5KFAA 3N6XA 3MJFA 3FAUA 4GKJH 3GIMA 1SCUB 3GQCA 4ZI7F 3PW4A 2CTMA 3N8DA 3RTXA 2GPWA 4GC6A 1Z2PX 5J2TF 2PN1A 2XCLA 4O2AF 2IP4A 5HV6A 2R7MA 2DZDA 3L4JA 4EEYA 5KFYA 1R9TA 3JSLA 2CTFA 4O4IF 1IBKH 1DIKA 3JZIA 2VUGA 4JVYA 2ZJTA 5KFOA 4YP3A 3NCVA 5IYZF 1UC9A 5KFBA 5LMUH 2JVZA 2ZDHA 1FKAH 4B8CD 4CC5A 4BA2I 2C35B 3OUZA 4A3JG 2BR0A 1N32H 1T94A 5F9NA 2I87A 2R85A 2YCHA 1ZZJA 4TQRA 1Y1WA 4YQWA 3OHAA 1XMOH 5KFEA 4EGQA 4ECWA 4A93G 3SB1A 3OSSD 4MV1A 2PVPA 3PR5B 4JI0H 5LA6F 3TINA 5JEAG 2VPSA 3RB4A 2ASLA 2BQRA 3FKIG 2FE3A 2MCTA 1V51A 3N43B 5C8YF 2X06A 1B04A 3M9OB 5CB4F 3U9TA 4GLXA 4O3PA 4EBCA 3RGXA 1OWTA 2W9BA 4U6PA 2IA6A 1X4NA 4TV8F 2DIKA 4IFDG 1W93A 5KFRA 3KHLA 1VBHA 4RUAA 1DV2A 4AM3A 1WHRA 3U9SA 1KJJA 4J0MA 3RB3A 4QWEA 3GIKA 4RB3C 4J9KA 4A2AA 2V9WA 4XX0B 2YRWA 1C30A 5IWAH 5LL6b 1FJGH 5KFFA 2C28A 3OETA 2W8KA 2FMRA 3VPDA 5D8DA 4ZQIA 4JV0A 3GTKA 5KFUA 3RV4A 3RUPA 4YJ2F 3GIJA 4QW9A 2SCUB 4ECUA 4E9JA 2PMZE 3GTOA 4QIWE 5KFSA 1X4MA 3HOXG 4A3LG 5C3EG 3T5JA 2FLNA 5BPFA 4Q44A 1K1GA 2YS7A 4TUYF 5C44G 4ED3A 4ECZA 1RJQA 2DPJA 5I47A 4OCHA 3RGZA 5J2UF 3HBLA 3V6HA 5FD6A 2J6UA 4EBDA 5T14A 2LF0A 3IG0A 2VA3A 4HQ6A 2RGRA 2XCPA 5L1IA 1XNQH 2VQFH 3Q8QB 4IRCA 2E2IA 4MTEA 4EBEA 1VS0A 1MZBA 4JI5H 3PO3G 5FLMG 4RZQA 3LMLA 4DL4A 3UFXB 5KG2A 3L4KA 1DV1A 4M7EA 3GR5A 3GLKA 4F4YA 3RB6A 3WO1A 5FD5A 1T36A 2NU8B 4JUZA 3TQTA 2R8HA 3N44B 1AUVA 4I55F 3OTOH 2CPMA 1I7NA 1WCMA 5KT4A 4HNTA 3QZ8A 4UCVA 2CTJA 3KHGA 2R92A 1WSCA 3Q1KA 5KG0A 5KFMA 1WH2A 2W6PA 3MR5A 3KXYT 2JA7A 1F0XA 1VBIA 5CAEB 2V58A 4HNUA 3WO0A 5KFDA 1J5EH 2GPSA 4UCTA 5JVDF 4U7CA 4EYHB 2JA5A 2C22A 2HVSA 3I4NG 3DF7A 1KBLA 5KFJA 2PMZA 1KJ9A 4QIWA 3M9MB 4DL7A 2HH2A 4YAJB 1E4GT 4ETSA 4ECXA 1B6SA 1ZHSA 4Q0YA 5CA1F 3MFIA 2JA9A 2VR1A 4JVHA 4DUZH 4DV2H 3PO2G 4LF4H 5C1PA 1KJIA 2R92G 3I4MG 4FBTA 3HXLA 3L2PA 2W9CB 3GIQA 5KG1A 4BWSC 1M0WA 4O3SA 1L2ZA 2K1HA 5KFIA 2JA7G 3KDKA 4A3FG 1M0TA 4WALA 1JIHA 4PDBA 3KALA 1CQJB 5IP9G 5KFNA 2HVQA 2HGSA 4IR1A 3HOYG 4IWXA 4XZ3B 1RK6A 5L1LA 2OWOA 2UUCH 2NU9B 3J80W 5DGAA 2DPIA 3HB9A 2RDIA 2XC9A 4A2BA 1N56A 1RJRA 4DL3A 2FJZA 4B3SH 4J9OA 4J9LA 2YW2A 3LP8A 3MWDA 2FP4B 1S20A 4LFCH 1HNXH 2NN6G 2NU6B 2WE6A 4DV6H 1N36H 4C5CA 2HVRA 3ETJA 4LH6A 2FPPB 4UFZA 1VKZA 2HH3A 1IBLH 5KFHA 5FJ8G 2QNDA 4F4ZA 4JI1H 1P8LA 3Q2OA 4LH7A 1S0MA 4NZRM 3K5IA 2XCAA 1I94H 4B3RH 3PW5A 5DQGA 2XGQA 5DGBA 4J9QA 4ECYA 3AYHB 1EUDB 3KAKA 4AQYH 2R93G 1BXRA 2LRRA 4ED6A 4X64H 5C4XG 4Q45A 1C3OA 4YHHH 5KFZA 1I7LA 3HKZA 3FKIA 3V4SA 4J9SA 1V8CA 2VA2A 2WDTA 2FLLA 1GO3E 5JQWA 1GSOA 2JEGA 5BR8H 2BQUA 4DL2A 2R84A 2OPUA 1SEIA 1HNZH 1VBGA 2FPGB 1M6VA 2W6OA 2C2RA 3GTMA 2JA8G 2CTEA 4FM9A 1S03G 3VPBA 2YRXA 1E4EA 3G8CA 4DR4H 3T1HH 2J9GA 4FS2A 3LWBA 4LF6H 1ZETA 4LFBH 4O3RA 1W96A 2W9BB 4RNOA 4JI7H 4RU9A 2WB1A 4F4XA 4EYIB 3BQ1A 4YY3H 3KDGA 2FMAA 3BQ2A 4ECQA 5D1PA 4JV2A 1JKJB 2YS6A 5IP7G 1AUXA 1UG8A 2V59A 1V4YA 2XD4A 3BQ0A 1B33N 4BY1G 3PR4A 3M4IA 4QJFA 3T5KA 1GSHA 1I3QA 2UVWA 5LYJF 3RIZA 3N41B 1BNCA 4A3IG 3MFHA 5D1OA 3VMMA 2CTLA 4JI4H 3EYYA 4RNNA 4OX9H 2Y3MA 2W6NA 3QZ7A 1T3NA 2FKLA 2BL5A 4RAYA 4CC6A 5KFVA 3T1YH 2UXCH 2VPQA 5JH7F 3R5XA 1E4FT 5H80A 2W8LA 4IAJA 1A0IA 3BA9A 5KFLA 4IWYA 1TA8A 2FFMA 4Q43A 3GTGA 3GIPA 4FJUA 4O2BF 4J9RA 5KG4A 2R7KA 3QD7X 4ED8A 2XIGA 1K1QA 4QWAA 4DR6H 3PW2A 3RBEA 2I8CA 4MV6A 3TIIA 5DG8A 5BPHA 1N48A 3UQ8A 2E2HA 4IHJF 4LF5H 3JRXA 1MSZA 1PK8A 4ED1A 4DR2H 4DR5H 4RB0A 2P0AA 3NGDA 4YB8B 4ECSA 2IMWP 4ME6A 1KHMA 2JEAI 5GONF 3G6YA 2OPVA 3HOWG 2W6ZA 4TQSA 2AGPA 3QFFA 3RV3A 3CQZA 3CVZA 2Q2TA 1UC8A 1BJTA 1PX2A 2D9IA 1Y14B 3OHBA 1WE8A 1JX4A 3WNZA 5K2MA 4PWQA 2C00A 2UU9H 4RNMA 2QK4A 4DV3H 4LMYA 2PT7G 2RDJA 2R7ZA 2KSWA 2VUMG 4GC7A 4MV8A 1EUCB 2JA6A 4LIJA 3IN5A 1ZZIA 2DGRA 4JI8H 2Y0SE 4L1KA 2YYAA 4MV9A 4EFBA 2W7PA 3FMAA 5EWFA 1V9PA 1TWCA 2V5AA 4OD6A 2Z0SA 2FPHX 1KEEA 4LF7H 4LF9H 2PY9A 3ORRA 3OUUA 2W9AA 4O4HF 5KT2A 3KHHA 2UVVA 5DT9A 2Q2UA 2W6MA 3N40P 5L9XA 3Q8RB 3SI8A 2VQDA 1S97A 2B63G 4A3DG 1X0AA 1XRHA 1VIGA 3V6KA 4WBNF 3GIDA 1IBMH 2JA6G 3R5FA 4E4TA 3ORQA 3RAXA 5KT7A 3BJYA 2YZNA 2RF4A 2RGVA 2ZDQA 3F8NA 2R7LA 3HKZE 3MR2A 2AGOA 4YBZB 3I0PA 2W70A 4EGJA 4JYAH 1DGSA 4DR3H 4JI2H 4DR7H 1JDBB 2M05A 2FK2A 3H20A 4FU0A 5KG3A 2AQ4A 4M9UA 5FPOA 4ED0A 2ALZA 5A2QW 2LTLA 2BQ3A 3ETHA 2JEJA 1RK5A 4C5BA 2CWHA 4R8UB 2R8KA 1Y1VG 3PW7A 2HHHH 3RB0A 2J6SA 3J7AK 4UCRA 4XYLB 3GABA 4QMFB 2UUAH 4YR0A 4Q8EA 2WB1E 4HNVA 1TWAA 3JSNA 2UVRA 3EPIA 4YAKB 2R6FA 4I50F 2R93A 4UCUA 1PQXA 3L7ZC 3M9NB 3RAQA 5LMNH 3V69A 2Y0SA 4A3MG 2E3UA 5L1KA 2UXDH
chains in the Genus database with same CATH topology
2UUBH 4B3TH 4DR4H 3T1HH 2VOBA 4LF6H 4LFBH 3RJ0A 4E9JA 1Z2OX 4JI7H 4FM9A 4G08A 4YY3H 3KDGA 1O75A 5D1PA 2WYOA 4DV1H 2VKCA 1FVIA 3C0FB 3M4IA 3RIZA 4OCHA 3J81W 3BABA 3N41B 5FPRA 3RGZA 5D1OA 5FD6A 4JI4H 3EYYA 4OX9H 2Y3MA 2LF0A 2VQEH 3IG0A 4RB1A 4CC6A 4RAYA 2RGRA 1XNQH 2VQFH 3T1YH 4KHPH 2UXCH 1SYXB 4MTEA 1VS0A 1MZBA 4DUYH 4JI5H 1E4FT 4IAJA 1ODHA 1A0IA 4RZQA 3LMLA 3BA9A 4JI3H 2W57A 4X65H 1TA8A 3JAMW 4MTDA 4I7HA 1XDNA 3L4KA 1X9NA 1AN7A 2UXBH 4M7EA 3GR5A 5EOYA 5FD5A 3QD7X 2XIGA 4NXMH 4B3MH 3N44B 4RAZA 3OTOH 4DR6H 1S68A 4LF8H 1I6UA 3UQ8A 1ZHQA 4UCVA 4X66H 1N34H 4LF5H 4K0KH 5D1OB 2O03A 4DR2H 2E5LH 4DR5H 4RB0A 2F4VH 3PN1A 1WH2A 3KXYT 3KAJA 1F0XA 1J5EH 4UCTA 1GYFA 4R7RA 4EFEA 4GKKH 3CVZA 4EEQA 2HVSA 2ZQEA 1TAEA 4X62H 2Q2TA 3EZJA 1BJTA 1HNWH 4NXNH 4JV5H 3DF7A 2D9IA 1N33H 1E4GT 3N42B 4ETSA 1ZHSA 4Q0YA 3RF2A 1Z2NX 3N6XA 2UU9H 4MV7A 3FAUA 4DUZH 4DV2H 4DV3H 4LF4H 2PT7G 4GKJH 4LMYA 4UCSA 3HXLA 3L2PA 4EC5A 2KSWA 4BWSC 1L2ZA 1M0WA 4RB2C 4JI8H 3RTXA 4MV9A 1Z2PX 3KDKA 4EFBA 1M0TA 1HR0H 3FMAA 1V9PA 4NZTM 4OD6A 3L4JA 2FPHX 4PDBA 3JSLA 3KALA 4LF7H 1IBKH 4LF9H 2VUGA 4DV5H 2CW7A 2HVQA 2ZJTA 2HGSA 3K3VA 2O4CA 3NCVA 3MWMA 5LMUH 1FKAH 5DT9A 4B8CD 2UUCH 4CC5A 3J80W 1XMQH 3N40P 1N32H 2Q2UA 2OWOA 1BGWA 4A2BA 2YCHA 1IBMH 1XMOH 4B3SH 3SB1A 2RGVA 3F8NA 3OSSD 4LFCH 1HNXH 4JI0H 2WE6A 4DV6H 1N36H 4JYAH 2VPSA 4LH6A 2HVRA 5IT9W 1DGSA 4DR3H 4JI2H 1IBLH 4DR7H 2FE3A 3H20A 4UFZA 4DV0H 4JI1H 1P8LA 2MCTA 3N43B 1B04A 4NZRM 4LH7A 5FPOA 4GLXA 1I94H 5A2QW 4B3RH 3RGXA 2ZM6H 4UCOA 3KAKA 4AQYH 4DR1H 4X64H 2HHHH 4YHHH 3J7AK 5FLXW 4UCRA 3GABA 2UUAH 1XNRH 4APMA 1X9ZA 3BAAA 4J0MA 4RB3C 2WDTA 3JSNA 4A2AA 4LFAH 4DV4H 4LSXA 5BR8H 4UCUA 1HNZH 1SEIA 5IWAH 5LL6b 4JI6H 5LMNH 4DV7H 1FJGH 2CW8A 3BA8A 4LSAA 3OETA 2UXDH 1S03G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB H;  4B3T H;  4DR4 H;  3T1H H;  4LF6 H;  4LFB H;  4JI7 H;  4YY3 H;  4DV1 H;  3J81 W;  4JI4 H;  4OX9 H;  2VQE H;  1XNQ H;  2VQF H;  3T1Y H;  4KHP H;  2UXC H;  4DUY H;  4JI5 H;  4JI3 H;  4X65 H;  3JAM W;  1AN7 A;  2UXB H;  4NXM H;  4B3M H;  3OTO H;  4DR6 H;  4LF8 H;  1I6U A;  4X66 H;  1N34 H;  4LF5 H;  4K0K H;  4DR2 H;  2E5L H;  4DR5 H;  2F4V H;  1J5E H;  4GKK H;  4X62 H;  1HNW H;  4NXN H;  4JV5 H;  1N33 H;  3RF2 A;  2UU9 H;  4DUZ H;  4DV2 H;  4DV3 H;  4LF4 H;  4GKJ H;  4JI8 H;  1HR0 H;  4PDB A;  4LF7 H;  1IBK H;  4LF9 H;  4DV5 H;  5LMU H;  1FKA H;  2UUC H;  3J80 W;  1XMQ H;  1N32 H;  1IBM H;  1XMO H;  4B3S H;  4LFC H;  1HNX H;  4JI0 H;  4DV6 H;  1N36 H;  4JYA H;  5IT9 W;  4DR3 H;  4JI2 H;  1IBL H;  4DR7 H;  4DV0 H;  4JI1 H;  1I94 H;  5A2Q W;  4B3R H;  2ZM6 H;  4AQY H;  4DR1 H;  4X64 H;  2HHH H;  4YHH H;  3J7A K;  5FLX W;  2UUA H;  1XNR H;  4LFA H;  4DV4 H;  5BR8 H;  1HNZ H;  1SEI A;  5IWA H;  5LL6 b;  4JI6 H;  5LMN H;  4DV7 H;  1FJG H;  2UXD H;  1S03 G; 
#chains in the Genus database with same CATH topology
 4B3T H;  2PBZ A;  2YU9 A;  5L1J A;  5LP6 F;  5KX5 F;  4J9P A;  2C2E A;  4AYB A;  3VKE A;  2YZG A;  1RJP A;  1EZ1 A;  4HR7 A;  3BG5 A;  3I12 A;  1KJQ A;  5C1O A;  2CPQ A;  4AIM A;  3HOV G;  4BXX G;  4Q8F A;  4DLK A;  2VUM A;  3PVX A;  2VKC A;  3C0F B;  1EHI A;  3H40 A;  2FK3 A;  4IZO A;  3J81 W;  5FPR A;  5LOV F;  2ATL A;  1ZZK A;  1S0N A;  2M6Q A;  2W7O A;  5DLF A;  1WR2 A;  2VQE H;  3GKU A;  1A9X A;  2G8Y A;  5DG7 A;  1E4E B;  5KFG A;  4IRD A;  4BY7 G;  1K83 A;  4DUY H;  1ODH A;  1EC6 A;  3VPC A;  5KKN B;  5IYB G;  3H0G G;  5IYC G;  5KT3 A;  2W57 A;  3H4D A;  3H4B A;  2R8J A;  3JAM W;  4MTD A;  2UVU A;  1XDN A;  5F9L A;  1AN7 A;  2UXB H;  3R5H A;  2YL2 A;  4IRK A;  3TQ1 A;  4O3Q A;  4F4W A;  4B8T A;  4B3M H;  2CQY A;  2M8W A;  5KT6 A;  5EDW A;  1TWG A;  4FS1 A;  1NXU A;  1S68 A;  2ZDG A;  2OH2 A;  4O3O A;  4TV9 F;  4JV1 A;  3G6V A;  1S9F A;  1N34 H;  4QWD A;  5D1O B;  2FLP A;  1KC7 A;  3PN1 A;  2PQU A;  1ZQ7 A;  3KAJ A;  4C2M A;  4ECT A;  2R82 A;  2CTK A;  4YR3 A;  1GYF A;  1I50 A;  3GIL A;  4GKK H;  5K36 G;  2ZQE A;  4ED7 A;  1TAE A;  4X62 H;  3Q8P B;  4JV5 H;  4NXN H;  3JRW A;  2WAQ E;  1N33 H;  3N42 B;  5DG9 A;  2V4R A;  3RF2 A;  1Z2N X;  2I80 A;  4MAM A;  4MV7 A;  1TWH A;  5KFW A;  4UCS A;  3GV7 B;  5HBR B;  4EC5 A;  1ZTG A;  3K5H A;  4HYK A;  4RB2 C;  4BBR G;  2JZX A;  1HR0 H;  3MWE A;  1IOV A;  2WTF A;  4NZT M;  1TWF A;  3MR3 A;  2AGQ A;  2ANN A;  4A3B G;  2LTM A;  5KG5 A;  1CE8 A;  1VAJ A;  2A1S A;  1Y1W G;  4G3I A;  2W6Q A;  4BA1 I;  4DV5 H;  2CW7 A;  2CZG A;  3K3V A;  4Y8V B;  2V4Q A;  2O4C A;  3MWM A;  3GTQ A;  3GTP A;  3SE7 A;  3KHR A;  4A3G G;  2YQR A;  1XMQ H;  2R7N A;  5KG6 A;  3HOU G;  3OSP A;  1V9N A;  1BGW A;  1SFO A;  2JEB I;  1VIH A;  1GLV A;  5C0X G;  1JXL A;  5KFP A;  5CA0 F;  2P2R A;  3GTJ A;  2MJH A;  4DL5 A;  3V4Z A;  4DL6 A;  2B63 A;  1J4W A;  2R87 A;  4A3E G;  2C2D A;  5JUM A;  4XYM B;  4MV3 A;  4MV4 A;  5IT9 W;  3E5N A;  4C5A A;  2NUA B;  1DT4 A;  5JVL A;  5KFK A;  2ASJ A;  2OLS A;  4DV0 H;  3H3V H;  5LXT F;  1M7J A;  1KJ8 A;  2ZM6 H;  4UCO A;  4QWB A;  1CQI B;  4I4T F;  4ZHQ F;  4DR1 H;  2FK1 A;  2WAQ A;  5KG7 A;  3GTL A;  2R8I A;  4WAN A;  4O3N A;  4AYB E;  4RUC A;  5FLX W;  4EG0 A;  1XNR H;  4APM A;  1X9Z A;  3BAA A;  1S0O A;  4LFA H;  1JLL B;  2X0S A;  4DV4 H;  4LSX A;  5KFX A;  5EWG A;  4A3C G;  2QYZ A;  4FBU A;  3Q8S B;  2IBK A;  4ECV A;  4J9M A;  2CW8 A;  4JI6 H;  3BA8 A;  4DV7 H;  4LSA A;  5DQH A;  4IR9 A;  3T5H A;  2R7Z G;  1Y1V A;  2NVY A;  2R86 A;  5DQI A;  1RYS A;  2UUB H;  2JEF A;  2ANR A;  2DWC A;  4MA0 A;  3UOE A;  1JDE A;  1CS0 A;  4H8A A;  3EPG A;  1UNN C;  2VOB A;  3GII A;  2W71 A;  4A3K G;  3RJ0 A;  4YJ3 F;  4ED2 A;  1Z2O X;  2R8G A;  4G08 A;  2NU7 B;  1O75 A;  1S10 A;  2CWF A;  2WYO A;  4DV1 H;  4RZR A;  4J9N A;  5EWE A;  3MR6 A;  4NLG A;  1FVI A;  5KT5 A;  1TUA A;  5KFC A;  2DLN A;  3BAB A;  4MA5 A;  5EZY F;  5DLG A;  5BMV F;  2FPI B;  3T5L A;  4F50 A;  1ULZ A;  1WTJ A;  3TIG A;  3G6X A;  4RB1 A;  2AU0 A;  1B6R A;  4OO1 G;  4KHP H;  2GLT A;  3U1K A;  1SYX B;  5IYD G;  1J5K A;  3R23 A;  3FDS A;  1WCM G;  2AXY A;  4JI3 H;  2ASD A;  1Z2I A;  4X65 H;  1EYZ A;  4QW8 A;  1DTJ A;  4ECR A;  3V6J A;  4I7H A;  3PZP A;  1X9N A;  3HOZ G;  4FJS A;  3AEV B;  1IOW A;  3PW0 A;  5EOY A;  4NXM H;  4WD3 A;  2HJW A;  4RAZ A;  4ZOL F;  5KFT A;  4QWC A;  3OSN A;  1K1S A;  3RBD A;  3GV8 B;  2XGP A;  2W9C A;  3H0G A;  2JA5 G;  1WVN A;  4LF8 H;  1I6U A;  3RFC A;  1ZHQ A;  3GV5 B;  4X66 H;  4NBQ A;  4K0K H;  3KTM A;  2O03 A;  2E5L H;  2BA0 A;  2JEI A;  2NVX A;  2F4V H;  2JE6 I;  1GSA A;  2FB9 A;  4O4L F;  4R8U A;  2YZM A;  4R7R A;  3K3P A;  4EFE A;  4EEQ A;  1GGO A;  5KFQ A;  2CKZ B;  5C5J A;  4YR2 A;  3EZJ A;  1HNW H;  1RYR A;  4BBS G;  2J6T A;  5KFA A;  3N6X A;  3MJF A;  3FAU A;  4GKJ H;  3GIM A;  1SCU B;  3GQC A;  4ZI7 F;  3PW4 A;  2CTM A;  3N8D A;  3RTX A;  2GPW A;  4GC6 A;  1Z2P X;  5J2T F;  2PN1 A;  2XCL A;  4O2A F;  2IP4 A;  5HV6 A;  2R7M A;  2DZD A;  3L4J A;  4EEY A;  5KFY A;  1R9T A;  3JSL A;  2CTF A;  4O4I F;  1IBK H;  1DIK A;  3JZI A;  2VUG A;  4JVY A;  2ZJT A;  5KFO A;  4YP3 A;  3NCV A;  5IYZ F;  1UC9 A;  5KFB A;  5LMU H;  2JVZ A;  2ZDH A;  1FKA H;  4B8C D;  4CC5 A;  4BA2 I;  2C35 B;  3OUZ A;  4A3J G;  2BR0 A;  1N32 H;  1T94 A;  5F9N A;  2I87 A;  2R85 A;  2YCH A;  1ZZJ A;  4TQR A;  1Y1W A;  4YQW A;  3OHA A;  1XMO H;  5KFE A;  4EGQ A;  4ECW A;  4A93 G;  3SB1 A;  3OSS D;  4MV1 A;  2PVP A;  3PR5 B;  4JI0 H;  5LA6 F;  3TIN A;  5JEA G;  2VPS A;  3RB4 A;  2ASL A;  2BQR A;  3FKI G;  2FE3 A;  2MCT A;  1V51 A;  3N43 B;  5C8Y F;  2X06 A;  1B04 A;  3M9O B;  5CB4 F;  3U9T A;  4GLX A;  4O3P A;  4EBC A;  3RGX A;  1OWT A;  2W9B A;  4U6P A;  2IA6 A;  1X4N A;  4TV8 F;  2DIK A;  4IFD G;  1W93 A;  5KFR A;  3KHL A;  1VBH A;  4RUA A;  1DV2 A;  4AM3 A;  1WHR A;  3U9S A;  1KJJ A;  4J0M A;  3RB3 A;  4QWE A;  3GIK A;  4RB3 C;  4J9K A;  4A2A A;  2V9W A;  4XX0 B;  2YRW A;  1C30 A;  5IWA H;  5LL6 b;  1FJG H;  5KFF A;  2C28 A;  3OET A;  2W8K A;  2FMR A;  3VPD A;  5D8D A;  4ZQI A;  4JV0 A;  3GTK A;  5KFU A;  3RV4 A;  3RUP A;  4YJ2 F;  3GIJ A;  4QW9 A;  2SCU B;  4ECU A;  4E9J A;  2PMZ E;  3GTO A;  4QIW E;  5KFS A;  1X4M A;  3HOX G;  4A3L G;  5C3E G;  3T5J A;  2FLN A;  5BPF A;  4Q44 A;  1K1G A;  2YS7 A;  4TUY F;  5C44 G;  4ED3 A;  4ECZ A;  1RJQ A;  2DPJ A;  5I47 A;  4OCH A;  3RGZ A;  5J2U F;  3HBL A;  3V6H A;  5FD6 A;  2J6U A;  4EBD A;  5T14 A;  2LF0 A;  3IG0 A;  2VA3 A;  4HQ6 A;  2RGR A;  2XCP A;  5L1I A;  1XNQ H;  2VQF H;  3Q8Q B;  4IRC A;  2E2I A;  4MTE A;  4EBE A;  1VS0 A;  1MZB A;  4JI5 H;  3PO3 G;  5FLM G;  4RZQ A;  3LML A;  4DL4 A;  3UFX B;  5KG2 A;  3L4K A;  1DV1 A;  4M7E A;  3GR5 A;  3GLK A;  4F4Y A;  3RB6 A;  3WO1 A;  5FD5 A;  1T36 A;  2NU8 B;  4JUZ A;  3TQT A;  2R8H A;  3N44 B;  1AUV A;  4I55 F;  3OTO H;  2CPM A;  1I7N A;  1WCM A;  5KT4 A;  4HNT A;  3QZ8 A;  4UCV A;  2CTJ A;  3KHG A;  2R92 A;  1WSC A;  3Q1K A;  5KG0 A;  5KFM A;  1WH2 A;  2W6P A;  3MR5 A;  3KXY T;  2JA7 A;  1F0X A;  1VBI A;  5CAE B;  2V58 A;  4HNU A;  3WO0 A;  5KFD A;  1J5E H;  2GPS A;  4UCT A;  5JVD F;  4U7C A;  4EYH B;  2JA5 A;  2C22 A;  2HVS A;  3I4N G;  3DF7 A;  1KBL A;  5KFJ A;  2PMZ A;  1KJ9 A;  4QIW A;  3M9M B;  4DL7 A;  2HH2 A;  4YAJ B;  1E4G T;  4ETS A;  4ECX A;  1B6S A;  1ZHS A;  4Q0Y A;  5CA1 F;  3MFI A;  2JA9 A;  2VR1 A;  4JVH A;  4DUZ H;  4DV2 H;  3PO2 G;  4LF4 H;  5C1P A;  1KJI A;  2R92 G;  3I4M G;  4FBT A;  3HXL A;  3L2P A;  2W9C B;  3GIQ A;  5KG1 A;  4BWS C;  1M0W A;  4O3S A;  1L2Z A;  2K1H A;  5KFI A;  2JA7 G;  3KDK A;  4A3F G;  1M0T A;  4WAL A;  1JIH A;  4PDB A;  3KAL A;  1CQJ B;  5IP9 G;  5KFN A;  2HVQ A;  2HGS A;  4IR1 A;  3HOY G;  4IWX A;  4XZ3 B;  1RK6 A;  5L1L A;  2OWO A;  2UUC H;  2NU9 B;  3J80 W;  5DGA A;  2DPI A;  3HB9 A;  2RDI A;  2XC9 A;  4A2B A;  1N56 A;  1RJR A;  4DL3 A;  2FJZ A;  4B3S H;  4J9O A;  4J9L A;  2YW2 A;  3LP8 A;  3MWD A;  2FP4 B;  1S20 A;  4LFC H;  1HNX H;  2NN6 G;  2NU6 B;  2WE6 A;  4DV6 H;  1N36 H;  4C5C A;  2HVR A;  3ETJ A;  4LH6 A;  2FPP B;  4UFZ A;  1VKZ A;  2HH3 A;  1IBL H;  5KFH A;  5FJ8 G;  2QND A;  4F4Z A;  4JI1 H;  1P8L A;  3Q2O A;  4LH7 A;  1S0M A;  4NZR M;  3K5I A;  2XCA A;  1I94 H;  4B3R H;  3PW5 A;  5DQG A;  2XGQ A;  5DGB A;  4J9Q A;  4ECY A;  3AYH B;  1EUD B;  3KAK A;  4AQY H;  2R93 G;  1BXR A;  2LRR A;  4ED6 A;  4X64 H;  5C4X G;  4Q45 A;  1C3O A;  4YHH H;  5KFZ A;  1I7L A;  3HKZ A;  3FKI A;  3V4S A;  4J9S A;  1V8C A;  2VA2 A;  2WDT A;  2FLL A;  1GO3 E;  5JQW A;  1GSO A;  2JEG A;  5BR8 H;  2BQU A;  4DL2 A;  2R84 A;  2OPU A;  1SEI A;  1HNZ H;  1VBG A;  2FPG B;  1M6V A;  2W6O A;  2C2R A;  3GTM A;  2JA8 G;  2CTE A;  4FM9 A;  1S03 G;  3VPB A;  2YRX A;  1E4E A;  3G8C A;  4DR4 H;  3T1H H;  2J9G A;  4FS2 A;  3LWB A;  4LF6 H;  1ZET A;  4LFB H;  4O3R A;  1W96 A;  2W9B B;  4RNO A;  4JI7 H;  4RU9 A;  2WB1 A;  4F4X A;  4EYI B;  3BQ1 A;  4YY3 H;  3KDG A;  2FMA A;  3BQ2 A;  4ECQ A;  5D1P A;  4JV2 A;  1JKJ B;  2YS6 A;  5IP7 G;  1AUX A;  1UG8 A;  2V59 A;  1V4Y A;  2XD4 A;  3BQ0 A;  1B33 N;  4BY1 G;  3PR4 A;  3M4I A;  4QJF A;  3T5K A;  1GSH A;  1I3Q A;  2UVW A;  5LYJ F;  3RIZ A;  3N41 B;  1BNC A;  4A3I G;  3MFH A;  5D1O A;  3VMM A;  2CTL A;  4JI4 H;  3EYY A;  4RNN A;  4OX9 H;  2Y3M A;  2W6N A;  3QZ7 A;  1T3N A;  2FKL A;  2BL5 A;  4RAY A;  4CC6 A;  5KFV A;  3T1Y H;  2UXC H;  2VPQ A;  5JH7 F;  3R5X A;  1E4F T;  5H80 A;  2W8L A;  4IAJ A;  1A0I A;  3BA9 A;  5KFL A;  4IWY A;  1TA8 A;  2FFM A;  4Q43 A;  3GTG A;  3GIP A;  4FJU A;  4O2B F;  4J9R A;  5KG4 A;  2R7K A;  3QD7 X;  4ED8 A;  2XIG A;  1K1Q A;  4QWA A;  4DR6 H;  3PW2 A;  3RBE A;  2I8C A;  4MV6 A;  3TII A;  5DG8 A;  5BPH A;  1N48 A;  3UQ8 A;  2E2H A;  4IHJ F;  4LF5 H;  3JRX A;  1MSZ A;  1PK8 A;  4ED1 A;  4DR2 H;  4DR5 H;  4RB0 A;  2P0A A;  3NGD A;  4YB8 B;  4ECS A;  2IMW P;  4ME6 A;  1KHM A;  2JEA I;  5GON F;  3G6Y A;  2OPV A;  3HOW G;  2W6Z A;  4TQS A;  2AGP A;  3QFF A;  3RV3 A;  3CQZ A;  3CVZ A;  2Q2T A;  1UC8 A;  1BJT A;  1PX2 A;  2D9I A;  1Y14 B;  3OHB A;  1WE8 A;  1JX4 A;  3WNZ A;  5K2M A;  4PWQ A;  2C00 A;  2UU9 H;  4RNM A;  2QK4 A;  4DV3 H;  4LMY A;  2PT7 G;  2RDJ A;  2R7Z A;  2KSW A;  2VUM G;  4GC7 A;  4MV8 A;  1EUC B;  2JA6 A;  4LIJ A;  3IN5 A;  1ZZI A;  2DGR A;  4JI8 H;  2Y0S E;  4L1K A;  2YYA A;  4MV9 A;  4EFB A;  2W7P A;  3FMA A;  5EWF A;  1V9P A;  1TWC A;  2V5A A;  4OD6 A;  2Z0S A;  2FPH X;  1KEE A;  4LF7 H;  4LF9 H;  2PY9 A;  3ORR A;  3OUU A;  2W9A A;  4O4H F;  5KT2 A;  3KHH A;  2UVV A;  5DT9 A;  2Q2U A;  2W6M A;  3N40 P;  5L9X A;  3Q8R B;  3SI8 A;  2VQD A;  1S97 A;  2B63 G;  4A3D G;  1X0A A;  1XRH A;  1VIG A;  3V6K A;  4WBN F;  3GID A;  1IBM H;  2JA6 G;  3R5F A;  4E4T A;  3ORQ A;  3RAX A;  5KT7 A;  3BJY A;  2YZN A;  2RF4 A;  2RGV A;  2ZDQ A;  3F8N A;  2R7L A;  3HKZ E;  3MR2 A;  2AGO A;  4YBZ B;  3I0P A;  2W70 A;  4EGJ A;  4JYA H;  1DGS A;  4DR3 H;  4JI2 H;  4DR7 H;  1JDB B;  2M05 A;  2FK2 A;  3H20 A;  4FU0 A;  5KG3 A;  2AQ4 A;  4M9U A;  5FPO A;  4ED0 A;  2ALZ A;  5A2Q W;  2LTL A;  2BQ3 A;  3ETH A;  2JEJ A;  1RK5 A;  4C5B A;  2CWH A;  4R8U B;  2R8K A;  1Y1V G;  3PW7 A;  2HHH H;  3RB0 A;  2J6S A;  3J7A K;  4UCR A;  4XYL B;  3GAB A;  4QMF B;  2UUA H;  4YR0 A;  4Q8E A;  2WB1 E;  4HNV A;  1TWA A;  3JSN A;  2UVR A;  3EPI A;  4YAK B;  2R6F A;  4I50 F;  2R93 A;  4UCU A;  1PQX A;  3L7Z C;  3M9N B;  3RAQ A;  5LMN H;  3V69 A;  2Y0S A;  4A3M G;  2E3U A;  5L1K A;  2UXD H; 
#chains in the Genus database with same CATH homology
 2UUB H;  4B3T H;  4DR4 H;  3T1H H;  2VOB A;  4LF6 H;  4LFB H;  3RJ0 A;  4E9J A;  1Z2O X;  4JI7 H;  4FM9 A;  4G08 A;  4YY3 H;  3KDG A;  1O75 A;  5D1P A;  2WYO A;  4DV1 H;  2VKC A;  1FVI A;  3C0F B;  3M4I A;  3RIZ A;  4OCH A;  3J81 W;  3BAB A;  3N41 B;  5FPR A;  3RGZ A;  5D1O A;  5FD6 A;  4JI4 H;  3EYY A;  4OX9 H;  2Y3M A;  2LF0 A;  2VQE H;  3IG0 A;  4RB1 A;  4CC6 A;  4RAY A;  2RGR A;  1XNQ H;  2VQF H;  3T1Y H;  4KHP H;  2UXC H;  1SYX B;  4MTE A;  1VS0 A;  1MZB A;  4DUY H;  4JI5 H;  1E4F T;  4IAJ A;  1ODH A;  1A0I A;  4RZQ A;  3LML A;  3BA9 A;  4JI3 H;  2W57 A;  4X65 H;  1TA8 A;  3JAM W;  4MTD A;  4I7H A;  1XDN A;  3L4K A;  1X9N A;  1AN7 A;  2UXB H;  4M7E A;  3GR5 A;  5EOY A;  5FD5 A;  3QD7 X;  2XIG A;  4NXM H;  4B3M H;  3N44 B;  4RAZ A;  3OTO H;  4DR6 H;  1S68 A;  4LF8 H;  1I6U A;  3UQ8 A;  1ZHQ A;  4UCV A;  4X66 H;  1N34 H;  4LF5 H;  4K0K H;  5D1O B;  2O03 A;  4DR2 H;  2E5L H;  4DR5 H;  4RB0 A;  2F4V H;  3PN1 A;  1WH2 A;  3KXY T;  3KAJ A;  1F0X A;  1J5E H;  4UCT A;  1GYF A;  4R7R A;  4EFE A;  4GKK H;  3CVZ A;  4EEQ A;  2HVS A;  2ZQE A;  1TAE A;  4X62 H;  2Q2T A;  3EZJ A;  1BJT A;  1HNW H;  4NXN H;  4JV5 H;  3DF7 A;  2D9I A;  1N33 H;  1E4G T;  3N42 B;  4ETS A;  1ZHS A;  4Q0Y A;  3RF2 A;  1Z2N X;  3N6X A;  2UU9 H;  4MV7 A;  3FAU A;  4DUZ H;  4DV2 H;  4DV3 H;  4LF4 H;  2PT7 G;  4GKJ H;  4LMY A;  4UCS A;  3HXL A;  3L2P A;  4EC5 A;  2KSW A;  4BWS C;  1L2Z A;  1M0W A;  4RB2 C;  4JI8 H;  3RTX A;  4MV9 A;  1Z2P X;  3KDK A;  4EFB A;  1M0T A;  1HR0 H;  3FMA A;  1V9P A;  4NZT M;  4OD6 A;  3L4J A;  2FPH X;  4PDB A;  3JSL A;  3KAL A;  4LF7 H;  1IBK H;  4LF9 H;  2VUG A;  4DV5 H;  2CW7 A;  2HVQ A;  2ZJT A;  2HGS A;  3K3V A;  2O4C A;  3NCV A;  3MWM A;  5LMU H;  1FKA H;  5DT9 A;  4B8C D;  2UUC H;  4CC5 A;  3J80 W;  1XMQ H;  3N40 P;  1N32 H;  2Q2U A;  2OWO A;  1BGW A;  4A2B A;  2YCH A;  1IBM H;  1XMO H;  4B3S H;  3SB1 A;  2RGV A;  3F8N A;  3OSS D;  4LFC H;  1HNX H;  4JI0 H;  2WE6 A;  4DV6 H;  1N36 H;  4JYA H;  2VPS A;  4LH6 A;  2HVR A;  5IT9 W;  1DGS A;  4DR3 H;  4JI2 H;  1IBL H;  4DR7 H;  2FE3 A;  3H20 A;  4UFZ A;  4DV0 H;  4JI1 H;  1P8L A;  2MCT A;  3N43 B;  1B04 A;  4NZR M;  4LH7 A;  5FPO A;  4GLX A;  1I94 H;  5A2Q W;  4B3R H;  3RGX A;  2ZM6 H;  4UCO A;  3KAK A;  4AQY H;  4DR1 H;  4X64 H;  2HHH H;  4YHH H;  3J7A K;  5FLX W;  4UCR A;  3GAB A;  2UUA H;  1XNR H;  4APM A;  1X9Z A;  3BAA A;  4J0M A;  4RB3 C;  2WDT A;  3JSN A;  4A2A A;  4LFA H;  4DV4 H;  4LSX A;  5BR8 H;  4UCU A;  1HNZ H;  1SEI A;  5IWA H;  5LL6 b;  4JI6 H;  5LMN H;  4DV7 H;  1FJG H;  2CW8 A;  3BA8 A;  4LSA A;  3OET A;  2UXD H;  1S03 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...