3J81W

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3j81W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3j81W02
1N36H 4PDBA 4YY3H 4LF8H 4JI8H 4DR6H 2F4VH 1FKAH 1AN7A 3J81W 4X64H 2E5LH 4LFBH 4JYAH 4DR5H 4X62H 3J80W 2UXDH 5BR8H 2UUCH 4DUYH 1I6UA 1HNWH 4LFAH 5A2QW 1XNRH 4LF4H 4B3RH 4JI4H 5LMNH 4JI1H 4NXNH 2UUBH 1FJGH 4DV6H 4LF9H 1J5EH 4B3SH 4DR7H 4LF7H 4JI7H 4YHHH 1N34H 4DV5H 1I94H 5IT9W 1IBLH 3T1YH 4KHPH 5LMUH 1XNQH 1IBMH 1N33H 2ZM6H 1XMOH 2UXBH 4GKKH 4OX9H 4GKJH 4DR2H 1HR0H 3OTOH 5IWAH 5FLXW 4JI0H 4B3TH 4DV7H 2HHHH 2VQEH 2VQFH 3T1HH 4DV4H 4X66H 4DV2H 4DV3H 2UXCH 4AQYH 3RF2A 5LL6b 4JI2H 1S03G 4X65H 4LFCH 4DV1H 1HNXH 4JI5H 4B3MH 4K0KH 1N32H 3J7AK 2UU9H 4DR4H 4JI6H 1XMQH 4DR1H 4DR3H 2UUAH 4DV0H 4DUZH 4JI3H 1IBKH 1HNZH 3JAMW 4NXMH 4LF6H 1SEIA 4LF5H 4JV5H
chains in the Genus database with same CATH superfamily
4PDBA 1RK6A 2BQUA 3M4IA 3G6VA 2VOBA 2OPUA 2Q2TA 1UG8A 3GV5B 2D9IA 4QW9A 2UVRA 4HQ6A 2R7ZG 2YS7A 2CW7A 3JRXA 5C5JA 3GTJA 4BA2I 2BL5A 5C44G 3U1KA 2QK4A 1PQXA 3RB3A 1MSZA 4LFBH 4MTEA 5L9XA 3H0GG 4JYAH 4BWSC 4IFDG 3TQ1A 2JA7A 4X62H 4EC5A 3GIIA 3NCVA 2YYAA 4MV9A 4AYBE 2HVSA 3VKEA 2YS6A 1RYSA 1HNWH 2FKLA 1BNCA 3OSSD 4O4IF 2FE3A 1JXLA 1EUDB 1TA8A 3PN1A 1I7NA 1V4YA 4B3RH 3GIDA 1DV1A 3TIIA 2CWHA 4UCTA 2NU8B 4HNUA 3N42B 5KFMA 4ECSA 5LMNH 4JI1H 3BQ1A 3HXLA 5KT3A 4EGQA 2BQRA 3JSLA 1JDBB 1RJPA 2Y3MA 4DL6A 1J5EH 2FJZA 4YJ3F 1WH2A 5KFYA 4HNVA 2FK3A 4LF7H 4LSAA 4YHHH 2VUGA 2VUMG 1V8CA 4DV5H 1S10A 2JA7G 5K2MA 5C3EG 4AM3A 2M8WA 5IT9W 1IBLH 1S20A 4DL5A 3Q2OA 3TQTA 2ANNA 4MV8A 5KG2A 3G6XA 4RUCA 3HOZG 3UFXB 1IBMH 4EYIB 2NUAB 1K1GA 2LTMA 1E4GT 4UFZA 4Q8FA 2JA9A 2GPSA 1X0AA 2HH3A 4OX9H 4GKJH 4A3LG 2QYZA 1HR0H 2V58A 2NU6B 4HNTA 2DZDA 4B3TH 2HHHH 2PMZA 3KAKA 2VQEH 3MR3A 2R93G 2OPVA 2BR0A 1L2ZA 3RV3A 3HKZA 5LOVF 4YQWA 3PR4A 2DGRA 4I50F 2M6QA 4X66H 3MWMA 1EYZA 4A2AA 1XRHA 4DV3H 2UXCH 1Y1WG 1KJ8A 2RGVA 4IZOA 2OWOA 4M9UA 1W93A 3IG0A 1DV2A 4IWXA 4Q0YA 1S03G 2FPIB 3VPBA 3RB6A 4UCOA 1AUVA 4XX0B 5T14A 4QIWE 3GV7B 4F4WA 4EG0A 1ZZKA 4X65H 4O4LF 4MA5A 3KHGA 3H40A 4F4ZA 4AYBA 4ECUA 4DV1H 4TQRA 1HNXH 5F9NA 2R84A 4JI5H 1JIHA 4RNMA 3GTPA 2JA5A 3GABA 5KFLA 4NZTM 2AGPA 4C5BA 4CC6A 5KFUA 4K0KH 1E4EA 2SCUB 5DQGA 3L4JA 1S97A 2R92G 5CA1F 1EHIA 2C00A 1VBIA 3KXYT 4ZI7F 2FLLA 2UU9H 2R6FA 1KJQA 4H8AA 3Q1KA 4I4TF 3I0PA 3Q8QB 3N8DA 1CQIB 2DWCA 4DLKA 4DR1H 4DR3H 1RJQA 1SCUB 4MV6A 1GLVA 2YZMA 4EBCA 2RGRA 4UCSA 2R7KA 4MAMA 3FDSA 4ED1A 1Y1VG 2FP4B 3QZ7A 2ALZA 4LH6A 4LH7A 4RNNA 4OO1G 2CTFA 3JAMW 5HBRB 5EOYA 4MV3A 3AEVB 4J9KA 4Q44A 3MWDA 1S68A 2ZJTA 5FPRA 3T5KA 5DG7A 3WO1A 4NXMH 3H4BA 2W9BA 5KFHA 2DIKA 4JV0A 3PW7A 2DPJA 3ORRA 2BQ3A 2DPIA 4TV9F 3KHLA 3KHRA 3QZ8A 5KFJA 5I47A 5JVLA 2BA0A 2FPGB 4RB0A 1N48A 4MA0A 2LTLA 1E4EB 1VIGA 2O03A 3OHBA 4XZ3B 5BPFA 2F4VH 3MWEA 1FKAH 1TWFA 3GTGA 1ZZIA 3U9TA 5D1OA 4DL2A 2VA3A 2C2EA 2NU7B 5KFCA 2E2HA 3JRWA 5EZYF 4PWQA 5KFWA 3G6YA 4J9PA 4IRKA 1JKJB 4WANA 1UC8A 4JV2A 3I12A 5IP9G 3GKUA 2P2RA 1ULZA 5EDWA 3EPIA 3J80W 2R85A 3KAJA 4EEYA 3SB1A 5BR8H 2IP4A 1I6UA 5KFAA 5KFIA 3V6KA 4BA1I 3PW2A 1EZ1A 4ECXA 1XNRH 3GIMA 2YCHA 4NLGA 4QWBA 4UCUA 2W8KA 3RGZA 4BY1G 5JVDF 1S0NA 4JVHA 2C22A 4MTDA 4RAZA 1ODHA 3OHAA 2W9CA 4ED8A 5KFEA 3N43B 3RBDA 3FAUA 5FPOA 2UUBH 1RYRA 3BABA 2R86A 5KFOA 4RAYA 4NBQA 4MV4A 5KFBA 1DT4A 4Q8EA 1VIHA 4LF9H 2NVYA 3PO3G 5D1PA 5KFPA 2DLNA 1RJRA 4JI7H 3U9SA 5IYZF 4J9MA 5JUMA 3HBLA 4XYMB 3H20A 5C1OA 2ZQEA 2W9AA 1FVIA 3IN5A 1CE8A 5LMUH 4OD6A 1XNQH 1N33H 1UC9A 3GQCA 2B63G 2ZM6H 3T5LA 4A3DG 5KG3A 4A3CG 2JA6G 1GGOA 4J9NA 2E2IA 4YBZB 3OTOH 5IWAH 5FLXW 1T94A 3VMMA 5KFFA 4ED6A 4EFBA 4YR0A 5BPHA 1VKZA 1WCMA 3GILA 1UNNC 1T36A 4ECZA 4DV4H 4J9RA 4J9OA 3V6JA 4DL3A 2RDJA 1DGSA 3JZIA 5KFGA 1VBGA 4RU9A 5LYJF 3RUPA 2CKZB 5KFSA 3M9NB 1JX4A 4IR9A 5KFNA 4I7HA 5LL6b 4A93G 2LRRA 4JI2H 1EUCB 3H3VH 2WB1A 2YZGA 5KG7A 4YP3A 2W9BB 2AGOA 4QW8A 1TWCA 3R5HA 5KT4A 2AXYA 3KDGA 2R7NA 2PN1A 3RJ0A 2UVWA 1JLLB 2W7OA 3QD7X 1M7JA 2CTKA 4O2BF 4A3EG 1R9TA 3K3PA 4JUZA 4LFCH 4ED0A 5KT6A 2IMWP 3N41B 2ANRA 4BBSG 5L1IA 3I4NG 3HOUG 4YR3A 3MR5A 4O3RA 4Q43A 5L1JA 2V9WA 5D1OB 2CZGA 4ECWA 1PK8A 3GV8B 1V9NA 2JEJA 4HR7A 4EBEA 3J7AK 1JDEA 1IOWA 2W6MA 2WAQA 4ZOLF 3V4ZA 2XD4A 2JA8G 2FFMA 1CS0A 3FKIG 2CWFA 3MFIA 2J9GA 3M9OB 3TIGA 2IBKA 3Q8PB 2WYOA 2WTFA 4C2MA 5C0XG 2FB9A 4DV0H 4DUZH 1GYFA 5KG6A 2J6UA 5GONF 5DG8A 5JQWA 4EFEA 5LP6F 4EBDA 1WHRA 1Z2OX 4IAJA 5LXTF 5BMVF 4EYHB 4YAJB 5KFXA 1X9ZA 2UVUA 4IRDA 1KHMA 4J9LA 2ATLA 2FMRA 1X4MA 4FM9A 4WBNF 5H80A 1SEIA 5DLGA 4JV5H 4FS2A 3OSPA 3EZJA 3F8NA 4HYKA 3HOWG 4YY3H 4LF8H 1GO3E 3RV4A 4JI8H 4DR6H 3MJFA 2ASDA 4LIJA 3OUZA 5FLMG 1Y14B 3M9MB 1VAJA 1MZBA 2Y0SA 1AN7A 4RZQA 5LA6F 3GIKA 2CTMA 3J81W 3LWBA 2W8LA 1A0IA 4X64H 5FD5A 3WO0A 1VS0A 4IRCA 1VBHA 1K1SA 2CTEA 3CVZA 2E5LH 2Q2UA 4XYLB 2HH2A 4O2AF 4DR5H 2VPQA 3ORQA 4YAKB 1Z2NX 1GSAA 5EWGA 2YU9A 2UXDH 2UUCH 2AU0A 2CPQA 2JE6I 3L4KA 3K5IA 5KFDA 4LFAH 5A2QW 1Y1WA 2RF4A 1B04A 2PVPA 5DGBA 5D8DA 2AQ4A 3CQZA 3VPDA 4FS1A 4ECRA 2R8JA 3L7ZC 4JI4H 2YQRA 2FMAA 4WD3A 1F0XA 2G8YA 1I3QA 3NGDA 4F50A 2W6PA 4NXNH 4I55F 4GLXA 2JEFA 1FJGH 4F4XA 4G08A 5CA0F 4LF5H 4DV6H 2R7MA 2W6NA 3T5HA 4BY7G 1AUXA 3ETHA 5KX5F 2W6QA 1B6RA 2R8GA 4DR7H 2VKCA 3K5HA 5KT7A 4A3IG 4G3IA 2UVVA 2JA5G 4ME6A 1BXRA 1BJTA 1I94H 3G8CA 2V5AA 2NU9B 2HVQA 2E3UA 2WE6A 3BA9A 5KFTA 5EWFA 4A3JG 1T3NA 2I80A 1C3OA 1KJ9A 2HGSA 2GPWA 4DR2H 1K83A 4FBUA 2W6OA 4DV7H 2VQFH 1M6VA 2Y0SE 3ETJA 1TAEA 3RIZA 5JEAG 2MCTA 3QFFA 3KALA 4AQYH 3BQ0A 3RF2A 2ZDQA 4MV7A 3V4SA 4ECYA 4O3QA 3BA8A 1CQJB 2X06A 1S0OA 3DF7A 3KHHA 3T5JA 5KG4A 3UOEA 3PZPA 1PX2A 4ED2A 3GIPA 1KEEA 4GC6A 5FD6A 1XDNA 4E9JA 2IA6A 3EPGA 2VUMA 3GTQA 3H0GA 5IYDG 4WALA 3BAAA 4ECQA 4FBTA 2C2DA 1V9PA 1ZHQA 1TWHA 2YW2A 5DT9A 1GSHA 3RB0A 2R7LA 3VPCA 1S9FA 4JV1A 3GR5A 1E4FT 2KSWA 4R7RA 5HV6A 5F9LA 3GTOA 4RB3C 3HOXG 3GTLA 4YR2A 2C2RA 5C1PA 2R93A 1KC7A 2W57A 1TWAA 4O3OA 5JH7F 2WB1E 2W6ZA 2HJWA 1GSOA 4R8UB 3H4DA 2JA6A 1I7LA 3PR5B 4JI3H 1IBKH 5FJ8G 2PQUA 2YRXA 2YRWA 1HNZH 2VA2A 1Y1VA 4RB1A 2PY9A 1K1QA 4EGJA 2R8KA 2ZDHA 1B6SA 5DQHA 5CB4F 5KFKA 4B8CD 4FU0A 2MJHA 1EC6A 4QMFB 5KKNB 1N36H 3RTXA 2R8HA 3N40P 4O3SA 2R7ZA 4JVYA 4TQSA 3SI8A 4U6PA 5DLFA 2JEIA 1C30A 1P8LA 2XGQA 1ZTGA 2B63A 5KFRA 4GC7A 1Z2PX 2W9CB 2LF0A 4RZRA 1TUAA 2C35B 3KDKA 3PW4A 3RAXA 3BJYA 2AGQA 4U7CA 4LMYA 2Z0SA 2VQDA 4ECTA 2V4RA 3I4MG 4B8TA 1DIKA 5CAEB 4A3FG 5C4XG 4Q45A 4R8UA 3N6XA 4YJ2F 3R5XA 2JVZA 4F4YA 2WAQE 3GLKA 2CPMA 3RB4A 2QNDA 3L2PA 4LF4H 2XCPA 3BG5A 2XC9A 4DL4A 2ZDGA 2J6SA 2NN6G 3K3VA 4AIMA 3Q8RB 3OSNA 4IR1A 3PW5A 5EWEA 4O3NA 4EEQA 3LMLA 1W96A 3OUUA 3SE7A 1N56A 4IHJF 4E4TA 2P0AA 4B3SH 3OETA 2R92A 3RBEA 3PVXA 5KFQA 2FPHX 1N34H 1BGWA 5DGAA 4C5CA 2XCLA 2ASJA 3T1YH 1WE8A 3KTMA 2FK2A 2C28A 4KHPH 2RDIA 2FLPA 3GTMA 1S0MA 4RUAA 5IP7G 4FJUA 1XMOH 4BXXG 2CTJA 2UXBH 4GKKH 1SYXB 2X0SA 3N44B 4IWYA 5J2TF 1O75A 4A2BA 4UCRA 4JI0H 2GLTA 5IYBG 3WNZA 2R8IA 5L1KA 2JEBI 1SFOA 2YL2A 1M0TA 3T1HH 3GTKA 2JZXA 2XGPA 4A3MG 2CW8A 1RK5A 4DV2H 1J4WA 1IOVA 2V4QA 1WCMG 2YZNA 1WR2A 1M0WA 4QWDA 4J9SA 3HB9A 4A3BG 3R5FA 3V6HA 1ZZJA 1X4NA 3MR2A 5KFVA 2PBZA 5KG5A 2JEAI 2VPSA 2VR1A 2W70A 4TV8F 1KJJA 1OWTA 3MR6A 3HOVG 3JSNA 3GIJA 2CTLA 4ZHQF 4ECVA 2I87A 3RGXA 2PT7G 5K36G 4RB2C 5KT2A 2K1HA 2HVRA 4Y8VB 1WSCA 2ASLA 1KJIA 4A3GG 2FLNA 3HKZE 4CC5A 4J9QA 1I50A 4OCHA 2PMZE 4C5AA 1TWGA 4YB8B 3Q8SB 2W7PA 1ZQ7A 2M05A 4DL7A 4B3MH 4L1KA 4LSXA 3UQ8A 2CQYA 5J2UF 5IYCG 5C8YF 1N32H 1ZETA 2JEGA 4QWAA 3LP8A 3HOYG 3V69A 2FPPB 2XCAA 3TINA 2R87A 4M7EA 4RNOA 2I8CA 2V59A 1X9NA 2J6TA 5KG1A 4DR4H 3EYYA 4ZQIA 5KFZA 4BBRG 2O4CA 2A1SA 4JI6H 3RFCA 1XMQH 4QIWA 4TUYF 5DG9A 3FKIA 2OLSA 5DQIA 4O3PA 4UCVA 4QJFA 1DTJA 5L1LA 3R23A 4O4HF 3PO2G 2UUAH 3MFHA 1NXUA 2FK1A 4FJSA 3GIQA 1V51A 2W71A 1Z2IA 2R82A 3BQ2A 4J0MA 3C0FB 1A9XA 1WVNA 3FMAA 3PW0A 3E5NA 1ZHSA 4ED3A 4NZRM 4APMA 4ED7A 2OH2A 4QWCA 1B33N 3AYHB 5KG0A 4LF6H 5KT5A 4QWEA 2WDTA 4A3KG 4ETSA 3RAQA 1J5KA 4DUYH 1WTJA 1KBLA 2NVXA 4MV1A 2XIGA
chains in the Genus database with same CATH topology
3EZJA 1N36H 4PDBA 3F8NA 3N40P 3M4IA 4RB0A 3RTXA 4YY3H 4LF8H 2VOBA 2O03A 2Q2TA 4JI8H 4DR6H 2D9IA 4GLXA 2F4VH 1FKAH 1MZBA 4RZQA 1AN7A 5D1OA 1P8LA 3J81W 2CW7A 1A0IA 4X64H 1Z2PX 5FD5A 2LF0A 1VS0A 3CVZA 3KDKA 2E5LH 2Q2UA 4LFBH 4MTEA 4LMYA 4BWSC 4JYAH 4DR5H 4X62H 4EC5A 1Z2NX 3NCVA 3J80W 3KAJA 3N6XA 2UXDH 3SB1A 5BR8H 2UUCH 4DUYH 1I6UA 4MV9A 1HNWH 3L4KA 3OSSD 5A2QW 4LFAH 3L2PA 2FE3A 1XNRH 4LF4H 1B04A 1TA8A 2YCHA 3PN1A 4UCUA 4B3RH 3RGZA 4UCTA 3N42B 4MTDA 4RAZA 1ODHA 5LMNH 4JI1H 4JI4H 1F0XA 3K3VA 3HXLA 3N43B 3FAUA 4NXNH 2UUBH 5FPOA 3BABA 1FJGH 4G08A 3JSLA 4LF5H 4DV6H 3LMLA 4RAYA 2Y3MA 4EEQA 4LF9H 1J5EH 5D1PA 4B3SH 3OETA 4DR7H 1WH2A 2VKCA 4LF7H 4JI7H 4LSAA 2FPHX 4YHHH 1N34H 1BGWA 2VUGA 4DV5H 1BJTA 3H20A 1I94H 5IT9W 1IBLH 2ZQEA 3T1YH 2HVQA 1FVIA 4KHPH 2WE6A 3BA9A 5LMUH 4OD6A 1IBMH 1XNQH 1N33H 1E4GT 2ZM6H 1XMOH 4UFZA 2UXBH 3N44B 4GKKH 1SYXB 4OX9H 4GKJH 2HGSA 4A2BA 1O75A 4DR2H 1HR0H 3OTOH 5IWAH 5FLXW 4UCRA 4JI0H 4B3TH 4EFBA 4DV7H 2HHHH 3KAKA 2VQEH 2VQFH 1L2ZA 1M0TA 3T1HH 4DV4H 1TAEA 2CW8A 4X66H 3MWMA 4DV2H 1DGSA 4A2AA 3RIZA 2MCTA 4DV3H 3KALA 2UXCH 4AQYH 2RGVA 3RF2A 1M0WA 4MV7A 4I7HA 5LL6b 2OWOA 4JI2H 3IG0A 3BA8A 4Q0YA 1S03G 3DF7A 4UCOA 2VPSA 3KDGA 3RJ0A 3QD7X 4X65H 3JSNA 4LFCH 3RGXA 2PT7G 4RB2C 4DV1H 1HNXH 5FD6A 1XDNA 2HVRA 4E9JA 3N41B 4JI5H 3GABA 4CC5A 3BAAA 4OCHA 4NZTM 4B3MH 1V9PA 1ZHQA 5D1OB 4CC6A 4LSXA 5DT9A 4K0KH 1N32H 3UQ8A 3J7AK 3L4JA 3GR5A 3KXYT 1E4FT 2KSWA 4R7RA 4M7EA 2UU9H 1X9NA 4RB3C 4DR4H 3EYYA 2O4CA 4JI6H 1XMQH 4DR1H 4DR3H 2W57A 2WYOA 4UCVA 4UCSA 2UUAH 4DV0H 4DUZH 4JI3H 1IBKH 2HVSA 1GYFA 4LH6A 4LH7A 4EFEA 3C0FB 1HNZH 4J0MA 5EOYA 3FMAA 1Z2OX 4IAJA 1ZHSA 4RB1A 4NZRM 4APMA 1X9ZA 1S68A 2ZJTA 5FPRA 2RGRA 4NXMH 4LF6H 4FM9A 2WDTA 4ETSA 4B8CD 1SEIA 3JAMW 4JV5H 2XIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 H;  4PDB A;  4YY3 H;  4LF8 H;  4JI8 H;  4DR6 H;  2F4V H;  1FKA H;  1AN7 A;  3J81 W;  4X64 H;  2E5L H;  4LFB H;  4JYA H;  4DR5 H;  4X62 H;  3J80 W;  2UXD H;  5BR8 H;  2UUC H;  4DUY H;  1I6U A;  1HNW H;  4LFA H;  5A2Q W;  1XNR H;  4LF4 H;  4B3R H;  4JI4 H;  5LMN H;  4JI1 H;  4NXN H;  2UUB H;  1FJG H;  4DV6 H;  4LF9 H;  1J5E H;  4B3S H;  4DR7 H;  4LF7 H;  4JI7 H;  4YHH H;  1N34 H;  4DV5 H;  1I94 H;  5IT9 W;  1IBL H;  3T1Y H;  4KHP H;  5LMU H;  1XNQ H;  1IBM H;  1N33 H;  2ZM6 H;  1XMO H;  2UXB H;  4GKK H;  4OX9 H;  4GKJ H;  4DR2 H;  1HR0 H;  3OTO H;  5IWA H;  5FLX W;  4JI0 H;  4B3T H;  4DV7 H;  2HHH H;  2VQE H;  2VQF H;  3T1H H;  4DV4 H;  4X66 H;  4DV2 H;  4DV3 H;  2UXC H;  4AQY H;  3RF2 A;  5LL6 b;  4JI2 H;  1S03 G;  4X65 H;  4LFC H;  4DV1 H;  1HNX H;  4JI5 H;  4B3M H;  4K0K H;  1N32 H;  3J7A K;  2UU9 H;  4DR4 H;  4JI6 H;  1XMQ H;  4DR1 H;  4DR3 H;  2UUA H;  4DV0 H;  4DUZ H;  4JI3 H;  1IBK H;  1HNZ H;  3JAM W;  4NXM H;  4LF6 H;  1SEI A;  4LF5 H;  4JV5 H; 
#chains in the Genus database with same CATH topology
 4PDB A;  1RK6 A;  2BQU A;  3M4I A;  3G6V A;  2VOB A;  2OPU A;  2Q2T A;  1UG8 A;  3GV5 B;  2D9I A;  4QW9 A;  2UVR A;  4HQ6 A;  2R7Z G;  2YS7 A;  2CW7 A;  3JRX A;  5C5J A;  3GTJ A;  4BA2 I;  2BL5 A;  5C44 G;  3U1K A;  2QK4 A;  1PQX A;  3RB3 A;  1MSZ A;  4LFB H;  4MTE A;  5L9X A;  3H0G G;  4JYA H;  4BWS C;  4IFD G;  3TQ1 A;  2JA7 A;  4X62 H;  4EC5 A;  3GII A;  3NCV A;  2YYA A;  4MV9 A;  4AYB E;  2HVS A;  3VKE A;  2YS6 A;  1RYS A;  1HNW H;  2FKL A;  1BNC A;  3OSS D;  4O4I F;  2FE3 A;  1JXL A;  1EUD B;  1TA8 A;  3PN1 A;  1I7N A;  1V4Y A;  4B3R H;  3GID A;  1DV1 A;  3TII A;  2CWH A;  4UCT A;  2NU8 B;  4HNU A;  3N42 B;  5KFM A;  4ECS A;  5LMN H;  4JI1 H;  3BQ1 A;  3HXL A;  5KT3 A;  4EGQ A;  2BQR A;  3JSL A;  1JDB B;  1RJP A;  2Y3M A;  4DL6 A;  1J5E H;  2FJZ A;  4YJ3 F;  1WH2 A;  5KFY A;  4HNV A;  2FK3 A;  4LF7 H;  4LSA A;  4YHH H;  2VUG A;  2VUM G;  1V8C A;  4DV5 H;  1S10 A;  2JA7 G;  5K2M A;  5C3E G;  4AM3 A;  2M8W A;  5IT9 W;  1IBL H;  1S20 A;  4DL5 A;  3Q2O A;  3TQT A;  2ANN A;  4MV8 A;  5KG2 A;  3G6X A;  4RUC A;  3HOZ G;  3UFX B;  1IBM H;  4EYI B;  2NUA B;  1K1G A;  2LTM A;  1E4G T;  4UFZ A;  4Q8F A;  2JA9 A;  2GPS A;  1X0A A;  2HH3 A;  4OX9 H;  4GKJ H;  4A3L G;  2QYZ A;  1HR0 H;  2V58 A;  2NU6 B;  4HNT A;  2DZD A;  4B3T H;  2HHH H;  2PMZ A;  3KAK A;  2VQE H;  3MR3 A;  2R93 G;  2OPV A;  2BR0 A;  1L2Z A;  3RV3 A;  3HKZ A;  5LOV F;  4YQW A;  3PR4 A;  2DGR A;  4I50 F;  2M6Q A;  4X66 H;  3MWM A;  1EYZ A;  4A2A A;  1XRH A;  4DV3 H;  2UXC H;  1Y1W G;  1KJ8 A;  2RGV A;  4IZO A;  2OWO A;  4M9U A;  1W93 A;  3IG0 A;  1DV2 A;  4IWX A;  4Q0Y A;  1S03 G;  2FPI B;  3VPB A;  3RB6 A;  4UCO A;  1AUV A;  4XX0 B;  5T14 A;  4QIW E;  3GV7 B;  4F4W A;  4EG0 A;  1ZZK A;  4X65 H;  4O4L F;  4MA5 A;  3KHG A;  3H40 A;  4F4Z A;  4AYB A;  4ECU A;  4DV1 H;  4TQR A;  1HNX H;  5F9N A;  2R84 A;  4JI5 H;  1JIH A;  4RNM A;  3GTP A;  2JA5 A;  3GAB A;  5KFL A;  4NZT M;  2AGP A;  4C5B A;  4CC6 A;  5KFU A;  4K0K H;  1E4E A;  2SCU B;  5DQG A;  3L4J A;  1S97 A;  2R92 G;  5CA1 F;  1EHI A;  2C00 A;  1VBI A;  3KXY T;  4ZI7 F;  2FLL A;  2UU9 H;  2R6F A;  1KJQ A;  4H8A A;  3Q1K A;  4I4T F;  3I0P A;  3Q8Q B;  3N8D A;  1CQI B;  2DWC A;  4DLK A;  4DR1 H;  4DR3 H;  1RJQ A;  1SCU B;  4MV6 A;  1GLV A;  2YZM A;  4EBC A;  2RGR A;  4UCS A;  2R7K A;  4MAM A;  3FDS A;  4ED1 A;  1Y1V G;  2FP4 B;  3QZ7 A;  2ALZ A;  4LH6 A;  4LH7 A;  4RNN A;  4OO1 G;  2CTF A;  3JAM W;  5HBR B;  5EOY A;  4MV3 A;  3AEV B;  4J9K A;  4Q44 A;  3MWD A;  1S68 A;  2ZJT A;  5FPR A;  3T5K A;  5DG7 A;  3WO1 A;  4NXM H;  3H4B A;  2W9B A;  5KFH A;  2DIK A;  4JV0 A;  3PW7 A;  2DPJ A;  3ORR A;  2BQ3 A;  2DPI A;  4TV9 F;  3KHL A;  3KHR A;  3QZ8 A;  5KFJ A;  5I47 A;  5JVL A;  2BA0 A;  2FPG B;  4RB0 A;  1N48 A;  4MA0 A;  2LTL A;  1E4E B;  1VIG A;  2O03 A;  3OHB A;  4XZ3 B;  5BPF A;  2F4V H;  3MWE A;  1FKA H;  1TWF A;  3GTG A;  1ZZI A;  3U9T A;  5D1O A;  4DL2 A;  2VA3 A;  2C2E A;  2NU7 B;  5KFC A;  2E2H A;  3JRW A;  5EZY F;  4PWQ A;  5KFW A;  3G6Y A;  4J9P A;  4IRK A;  1JKJ B;  4WAN A;  1UC8 A;  4JV2 A;  3I12 A;  5IP9 G;  3GKU A;  2P2R A;  1ULZ A;  5EDW A;  3EPI A;  3J80 W;  2R85 A;  3KAJ A;  4EEY A;  3SB1 A;  5BR8 H;  2IP4 A;  1I6U A;  5KFA A;  5KFI A;  3V6K A;  4BA1 I;  3PW2 A;  1EZ1 A;  4ECX A;  1XNR H;  3GIM A;  2YCH A;  4NLG A;  4QWB A;  4UCU A;  2W8K A;  3RGZ A;  4BY1 G;  5JVD F;  1S0N A;  4JVH A;  2C22 A;  4MTD A;  4RAZ A;  1ODH A;  3OHA A;  2W9C A;  4ED8 A;  5KFE A;  3N43 B;  3RBD A;  3FAU A;  5FPO A;  2UUB H;  1RYR A;  3BAB A;  2R86 A;  5KFO A;  4RAY A;  4NBQ A;  4MV4 A;  5KFB A;  1DT4 A;  4Q8E A;  1VIH A;  4LF9 H;  2NVY A;  3PO3 G;  5D1P A;  5KFP A;  2DLN A;  1RJR A;  4JI7 H;  3U9S A;  5IYZ F;  4J9M A;  5JUM A;  3HBL A;  4XYM B;  3H20 A;  5C1O A;  2ZQE A;  2W9A A;  1FVI A;  3IN5 A;  1CE8 A;  5LMU H;  4OD6 A;  1XNQ H;  1N33 H;  1UC9 A;  3GQC A;  2B63 G;  2ZM6 H;  3T5L A;  4A3D G;  5KG3 A;  4A3C G;  2JA6 G;  1GGO A;  4J9N A;  2E2I A;  4YBZ B;  3OTO H;  5IWA H;  5FLX W;  1T94 A;  3VMM A;  5KFF A;  4ED6 A;  4EFB A;  4YR0 A;  5BPH A;  1VKZ A;  1WCM A;  3GIL A;  1UNN C;  1T36 A;  4ECZ A;  4DV4 H;  4J9R A;  4J9O A;  3V6J A;  4DL3 A;  2RDJ A;  1DGS A;  3JZI A;  5KFG A;  1VBG A;  4RU9 A;  5LYJ F;  3RUP A;  2CKZ B;  5KFS A;  3M9N B;  1JX4 A;  4IR9 A;  5KFN A;  4I7H A;  5LL6 b;  4A93 G;  2LRR A;  4JI2 H;  1EUC B;  3H3V H;  2WB1 A;  2YZG A;  5KG7 A;  4YP3 A;  2W9B B;  2AGO A;  4QW8 A;  1TWC A;  3R5H A;  5KT4 A;  2AXY A;  3KDG A;  2R7N A;  2PN1 A;  3RJ0 A;  2UVW A;  1JLL B;  2W7O A;  3QD7 X;  1M7J A;  2CTK A;  4O2B F;  4A3E G;  1R9T A;  3K3P A;  4JUZ A;  4LFC H;  4ED0 A;  5KT6 A;  2IMW P;  3N41 B;  2ANR A;  4BBS G;  5L1I A;  3I4N G;  3HOU G;  4YR3 A;  3MR5 A;  4O3R A;  4Q43 A;  5L1J A;  2V9W A;  5D1O B;  2CZG A;  4ECW A;  1PK8 A;  3GV8 B;  1V9N A;  2JEJ A;  4HR7 A;  4EBE A;  3J7A K;  1JDE A;  1IOW A;  2W6M A;  2WAQ A;  4ZOL F;  3V4Z A;  2XD4 A;  2JA8 G;  2FFM A;  1CS0 A;  3FKI G;  2CWF A;  3MFI A;  2J9G A;  3M9O B;  3TIG A;  2IBK A;  3Q8P B;  2WYO A;  2WTF A;  4C2M A;  5C0X G;  2FB9 A;  4DV0 H;  4DUZ H;  1GYF A;  5KG6 A;  2J6U A;  5GON F;  5DG8 A;  5JQW A;  4EFE A;  5LP6 F;  4EBD A;  1WHR A;  1Z2O X;  4IAJ A;  5LXT F;  5BMV F;  4EYH B;  4YAJ B;  5KFX A;  1X9Z A;  2UVU A;  4IRD A;  1KHM A;  4J9L A;  2ATL A;  2FMR A;  1X4M A;  4FM9 A;  4WBN F;  5H80 A;  1SEI A;  5DLG A;  4JV5 H;  4FS2 A;  3OSP A;  3EZJ A;  3F8N A;  4HYK A;  3HOW G;  4YY3 H;  4LF8 H;  1GO3 E;  3RV4 A;  4JI8 H;  4DR6 H;  3MJF A;  2ASD A;  4LIJ A;  3OUZ A;  5FLM G;  1Y14 B;  3M9M B;  1VAJ A;  1MZB A;  2Y0S A;  1AN7 A;  4RZQ A;  5LA6 F;  3GIK A;  2CTM A;  3J81 W;  3LWB A;  2W8L A;  1A0I A;  4X64 H;  5FD5 A;  3WO0 A;  1VS0 A;  4IRC A;  1VBH A;  1K1S A;  2CTE A;  3CVZ A;  2E5L H;  2Q2U A;  4XYL B;  2HH2 A;  4O2A F;  4DR5 H;  2VPQ A;  3ORQ A;  4YAK B;  1Z2N X;  1GSA A;  5EWG A;  2YU9 A;  2UXD H;  2UUC H;  2AU0 A;  2CPQ A;  2JE6 I;  3L4K A;  3K5I A;  5KFD A;  4LFA H;  5A2Q W;  1Y1W A;  2RF4 A;  1B04 A;  2PVP A;  5DGB A;  5D8D A;  2AQ4 A;  3CQZ A;  3VPD A;  4FS1 A;  4ECR A;  2R8J A;  3L7Z C;  4JI4 H;  2YQR A;  2FMA A;  4WD3 A;  1F0X A;  2G8Y A;  1I3Q A;  3NGD A;  4F50 A;  2W6P A;  4NXN H;  4I55 F;  4GLX A;  2JEF A;  1FJG H;  4F4X A;  4G08 A;  5CA0 F;  4LF5 H;  4DV6 H;  2R7M A;  2W6N A;  3T5H A;  4BY7 G;  1AUX A;  3ETH A;  5KX5 F;  2W6Q A;  1B6R A;  2R8G A;  4DR7 H;  2VKC A;  3K5H A;  5KT7 A;  4A3I G;  4G3I A;  2UVV A;  2JA5 G;  4ME6 A;  1BXR A;  1BJT A;  1I94 H;  3G8C A;  2V5A A;  2NU9 B;  2HVQ A;  2E3U A;  2WE6 A;  3BA9 A;  5KFT A;  5EWF A;  4A3J G;  1T3N A;  2I80 A;  1C3O A;  1KJ9 A;  2HGS A;  2GPW A;  4DR2 H;  1K83 A;  4FBU A;  2W6O A;  4DV7 H;  2VQF H;  1M6V A;  2Y0S E;  3ETJ A;  1TAE A;  3RIZ A;  5JEA G;  2MCT A;  3QFF A;  3KAL A;  4AQY H;  3BQ0 A;  3RF2 A;  2ZDQ A;  4MV7 A;  3V4S A;  4ECY A;  4O3Q A;  3BA8 A;  1CQJ B;  2X06 A;  1S0O A;  3DF7 A;  3KHH A;  3T5J A;  5KG4 A;  3UOE A;  3PZP A;  1PX2 A;  4ED2 A;  3GIP A;  1KEE A;  4GC6 A;  5FD6 A;  1XDN A;  4E9J A;  2IA6 A;  3EPG A;  2VUM A;  3GTQ A;  3H0G A;  5IYD G;  4WAL A;  3BAA A;  4ECQ A;  4FBT A;  2C2D A;  1V9P A;  1ZHQ A;  1TWH A;  2YW2 A;  5DT9 A;  1GSH A;  3RB0 A;  2R7L A;  3VPC A;  1S9F A;  4JV1 A;  3GR5 A;  1E4F T;  2KSW A;  4R7R A;  5HV6 A;  5F9L A;  3GTO A;  4RB3 C;  3HOX G;  3GTL A;  4YR2 A;  2C2R A;  5C1P A;  2R93 A;  1KC7 A;  2W57 A;  1TWA A;  4O3O A;  5JH7 F;  2WB1 E;  2W6Z A;  2HJW A;  1GSO A;  4R8U B;  3H4D A;  2JA6 A;  1I7L A;  3PR5 B;  4JI3 H;  1IBK H;  5FJ8 G;  2PQU A;  2YRX A;  2YRW A;  1HNZ H;  2VA2 A;  1Y1V A;  4RB1 A;  2PY9 A;  1K1Q A;  4EGJ A;  2R8K A;  2ZDH A;  1B6S A;  5DQH A;  5CB4 F;  5KFK A;  4B8C D;  4FU0 A;  2MJH A;  1EC6 A;  4QMF B;  5KKN B;  1N36 H;  3RTX A;  2R8H A;  3N40 P;  4O3S A;  2R7Z A;  4JVY A;  4TQS A;  3SI8 A;  4U6P A;  5DLF A;  2JEI A;  1C30 A;  1P8L A;  2XGQ A;  1ZTG A;  2B63 A;  5KFR A;  4GC7 A;  1Z2P X;  2W9C B;  2LF0 A;  4RZR A;  1TUA A;  2C35 B;  3KDK A;  3PW4 A;  3RAX A;  3BJY A;  2AGQ A;  4U7C A;  4LMY A;  2Z0S A;  2VQD A;  4ECT A;  2V4R A;  3I4M G;  4B8T A;  1DIK A;  5CAE B;  4A3F G;  5C4X G;  4Q45 A;  4R8U A;  3N6X A;  4YJ2 F;  3R5X A;  2JVZ A;  4F4Y A;  2WAQ E;  3GLK A;  2CPM A;  3RB4 A;  2QND A;  3L2P A;  4LF4 H;  2XCP A;  3BG5 A;  2XC9 A;  4DL4 A;  2ZDG A;  2J6S A;  2NN6 G;  3K3V A;  4AIM A;  3Q8R B;  3OSN A;  4IR1 A;  3PW5 A;  5EWE A;  4O3N A;  4EEQ A;  3LML A;  1W96 A;  3OUU A;  3SE7 A;  1N56 A;  4IHJ F;  4E4T A;  2P0A A;  4B3S H;  3OET A;  2R92 A;  3RBE A;  3PVX A;  5KFQ A;  2FPH X;  1N34 H;  1BGW A;  5DGA A;  4C5C A;  2XCL A;  2ASJ A;  3T1Y H;  1WE8 A;  3KTM A;  2FK2 A;  2C28 A;  4KHP H;  2RDI A;  2FLP A;  3GTM A;  1S0M A;  4RUA A;  5IP7 G;  4FJU A;  1XMO H;  4BXX G;  2CTJ A;  2UXB H;  4GKK H;  1SYX B;  2X0S A;  3N44 B;  4IWY A;  5J2T F;  1O75 A;  4A2B A;  4UCR A;  4JI0 H;  2GLT A;  5IYB G;  3WNZ A;  2R8I A;  5L1K A;  2JEB I;  1SFO A;  2YL2 A;  1M0T A;  3T1H H;  3GTK A;  2JZX A;  2XGP A;  4A3M G;  2CW8 A;  1RK5 A;  4DV2 H;  1J4W A;  1IOV A;  2V4Q A;  1WCM G;  2YZN A;  1WR2 A;  1M0W A;  4QWD A;  4J9S A;  3HB9 A;  4A3B G;  3R5F A;  3V6H A;  1ZZJ A;  1X4N A;  3MR2 A;  5KFV A;  2PBZ A;  5KG5 A;  2JEA I;  2VPS A;  2VR1 A;  2W70 A;  4TV8 F;  1KJJ A;  1OWT A;  3MR6 A;  3HOV G;  3JSN A;  3GIJ A;  2CTL A;  4ZHQ F;  4ECV A;  2I87 A;  3RGX A;  2PT7 G;  5K36 G;  4RB2 C;  5KT2 A;  2K1H A;  2HVR A;  4Y8V B;  1WSC A;  2ASL A;  1KJI A;  4A3G G;  2FLN A;  3HKZ E;  4CC5 A;  4J9Q A;  1I50 A;  4OCH A;  2PMZ E;  4C5A A;  1TWG A;  4YB8 B;  3Q8S B;  2W7P A;  1ZQ7 A;  2M05 A;  4DL7 A;  4B3M H;  4L1K A;  4LSX A;  3UQ8 A;  2CQY A;  5J2U F;  5IYC G;  5C8Y F;  1N32 H;  1ZET A;  2JEG A;  4QWA A;  3LP8 A;  3HOY G;  3V69 A;  2FPP B;  2XCA A;  3TIN A;  2R87 A;  4M7E A;  4RNO A;  2I8C A;  2V59 A;  1X9N A;  2J6T A;  5KG1 A;  4DR4 H;  3EYY A;  4ZQI A;  5KFZ A;  4BBR G;  2O4C A;  2A1S A;  4JI6 H;  3RFC A;  1XMQ H;  4QIW A;  4TUY F;  5DG9 A;  3FKI A;  2OLS A;  5DQI A;  4O3P A;  4UCV A;  4QJF A;  1DTJ A;  5L1L A;  3R23 A;  4O4H F;  3PO2 G;  2UUA H;  3MFH A;  1NXU A;  2FK1 A;  4FJS A;  3GIQ A;  1V51 A;  2W71 A;  1Z2I A;  2R82 A;  3BQ2 A;  4J0M A;  3C0F B;  1A9X A;  1WVN A;  3FMA A;  3PW0 A;  3E5N A;  1ZHS A;  4ED3 A;  4NZR M;  4APM A;  4ED7 A;  2OH2 A;  4QWC A;  1B33 N;  3AYH B;  5KG0 A;  4LF6 H;  5KT5 A;  4QWE A;  2WDT A;  4A3K G;  4ETS A;  3RAQ A;  1J5K A;  4DUY H;  1WTJ A;  1KBL A;  2NVX A;  4MV1 A;  2XIG A; 
#chains in the Genus database with same CATH homology
 3EZJ A;  1N36 H;  4PDB A;  3F8N A;  3N40 P;  3M4I A;  4RB0 A;  3RTX A;  4YY3 H;  4LF8 H;  2VOB A;  2O03 A;  2Q2T A;  4JI8 H;  4DR6 H;  2D9I A;  4GLX A;  2F4V H;  1FKA H;  1MZB A;  4RZQ A;  1AN7 A;  5D1O A;  1P8L A;  3J81 W;  2CW7 A;  1A0I A;  4X64 H;  1Z2P X;  5FD5 A;  2LF0 A;  1VS0 A;  3CVZ A;  3KDK A;  2E5L H;  2Q2U A;  4LFB H;  4MTE A;  4LMY A;  4BWS C;  4JYA H;  4DR5 H;  4X62 H;  4EC5 A;  1Z2N X;  3NCV A;  3J80 W;  3KAJ A;  3N6X A;  2UXD H;  3SB1 A;  5BR8 H;  2UUC H;  4DUY H;  1I6U A;  4MV9 A;  1HNW H;  3L4K A;  3OSS D;  5A2Q W;  4LFA H;  3L2P A;  2FE3 A;  1XNR H;  4LF4 H;  1B04 A;  1TA8 A;  2YCH A;  3PN1 A;  4UCU A;  4B3R H;  3RGZ A;  4UCT A;  3N42 B;  4MTD A;  4RAZ A;  1ODH A;  5LMN H;  4JI1 H;  4JI4 H;  1F0X A;  3K3V A;  3HXL A;  3N43 B;  3FAU A;  4NXN H;  2UUB H;  5FPO A;  3BAB A;  1FJG H;  4G08 A;  3JSL A;  4LF5 H;  4DV6 H;  3LML A;  4RAY A;  2Y3M A;  4EEQ A;  4LF9 H;  1J5E H;  5D1P A;  4B3S H;  3OET A;  4DR7 H;  1WH2 A;  2VKC A;  4LF7 H;  4JI7 H;  4LSA A;  2FPH X;  4YHH H;  1N34 H;  1BGW A;  2VUG A;  4DV5 H;  1BJT A;  3H20 A;  1I94 H;  5IT9 W;  1IBL H;  2ZQE A;  3T1Y H;  2HVQ A;  1FVI A;  4KHP H;  2WE6 A;  3BA9 A;  5LMU H;  4OD6 A;  1IBM H;  1XNQ H;  1N33 H;  1E4G T;  2ZM6 H;  1XMO H;  4UFZ A;  2UXB H;  3N44 B;  4GKK H;  1SYX B;  4OX9 H;  4GKJ H;  2HGS A;  4A2B A;  1O75 A;  4DR2 H;  1HR0 H;  3OTO H;  5IWA H;  5FLX W;  4UCR A;  4JI0 H;  4B3T H;  4EFB A;  4DV7 H;  2HHH H;  3KAK A;  2VQE H;  2VQF H;  1L2Z A;  1M0T A;  3T1H H;  4DV4 H;  1TAE A;  2CW8 A;  4X66 H;  3MWM A;  4DV2 H;  1DGS A;  4A2A A;  3RIZ A;  2MCT A;  4DV3 H;  3KAL A;  2UXC H;  4AQY H;  2RGV A;  3RF2 A;  1M0W A;  4MV7 A;  4I7H A;  5LL6 b;  2OWO A;  4JI2 H;  3IG0 A;  3BA8 A;  4Q0Y A;  1S03 G;  3DF7 A;  4UCO A;  2VPS A;  3KDG A;  3RJ0 A;  3QD7 X;  4X65 H;  3JSN A;  4LFC H;  3RGX A;  2PT7 G;  4RB2 C;  4DV1 H;  1HNX H;  5FD6 A;  1XDN A;  2HVR A;  4E9J A;  3N41 B;  4JI5 H;  3GAB A;  4CC5 A;  3BAA A;  4OCH A;  4NZT M;  4B3M H;  1V9P A;  1ZHQ A;  5D1O B;  4CC6 A;  4LSX A;  5DT9 A;  4K0K H;  1N32 H;  3UQ8 A;  3J7A K;  3L4J A;  3GR5 A;  3KXY T;  1E4F T;  2KSW A;  4R7R A;  4M7E A;  2UU9 H;  1X9N A;  4RB3 C;  4DR4 H;  3EYY A;  2O4C A;  4JI6 H;  1XMQ H;  4DR1 H;  4DR3 H;  2W57 A;  2WYO A;  4UCV A;  4UCS A;  2UUA H;  4DV0 H;  4DUZ H;  4JI3 H;  1IBK H;  2HVS A;  1GYF A;  4LH6 A;  4LH7 A;  4EFE A;  3C0F B;  1HNZ H;  4J0M A;  5EOY A;  3FMA A;  1Z2O X;  4IAJ A;  1ZHS A;  4RB1 A;  4NZR M;  4APM A;  1X9Z A;  1S68 A;  2ZJT A;  5FPR A;  2RGR A;  4NXM H;  4LF6 H;  4FM9 A;  2WDT A;  4ETS A;  4B8C D;  1SEI A;  3JAM W;  4JV5 H;  2XIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...