3J81Y

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
134
structure length
134
Chain Sequence
SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 25
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j81Y00
3J80Y 3JAMY 3J81Y 5IT9Y 5A2QY 5FLXY 3J7A1 5LL6d
chains in the Genus database with same CATH superfamily
1B99A 4Y2MA 2AW0A 3C16B 2V68A 3PEJA 5GVQA 4AFFA 1RAOA 1MMDA 1RA6A 3RZAA 4UQGA 2WOMA 4B17A 2CG8A 5DDQC 1UP1A 1VQYA 3CJ5A 4ANEA 4RUHA 4IKAA 1V6HA 4NX9A 2XBPA 1XWLA 1VQMS 3EGWB 2EI5A 4KHRA 2R7UA 2YPYA 3BS9A 3NCPA 2X1AA 4Q44A 1U48A 4LVOP 3BBCA 1GXLA 2JEFA 3CC4S 3J7A1 2UUAF 2IJFA 4RLEA 1IBKJ 2BW7A 1ZM3A 1HA1A 3KHGA 1SUQB 1BQXA 4ZIVA 4GC6A 1SL1A 1YG0A 1WC0A 2QLFB 4DPYA 3K57A 1ZETA 3D3BJ 2VJUA 4J9PA 2XMAA 3DKDA 3NMAA 3LP0B 1HNIB 2AF6A 3D0IE 3G82B 4QQBA 1E6YA 4A47A 4A8OA 4B3SF 1KHWA 1R6YA 1Z2LA 3LF0A 2J9EA 2FJDB 4IRKA 4JI7F 4CLUA 4JI0F 5DG9A 1HWJA 2GMHA 2B7BB 2DY1A 4P72A 3J80U 3IS9B 1NKCA 4I6WA 2DHSA 2Q43A 3AXMA 3BR9A 1Q4RA 4RU2A 4LFCJ 1PAUB 2DITA 5KT5A 1MWZA 1BHNA 3P5TL 3W8PA 3NCQA 4FP9A 2CQBA 3PFOA 2YQ3A 2ZH7A 1IN0A 1T03A 3CE8A 3AODA 2QE5A 5I3PA 3I5BA 1EHWA 4JI8J 4NLRA 4O3OA 4F4YA 3UR0A 2YNFA 1VQ4S 1SVDA 2LA4A 4PR6A 3K8WA 3HHLB 4GKKF 1VHFA 1HWLA 2JLEA 4OYWA 3BGLA 3HO1A 4DJBA 2R7VA 2WVEA 3M6WA 2HW3A 2UVVA 3EGNA 4YP3A 4DUYF 4EUVA 3TUZC 1KTVA 2DHGA 2RF2B 2OI2A 2CJ9A 4EO8A 4NLTA 5ETLA 2HIQA 4FYWB 4J9RA 3M2UB 1ZM2A 5AT1B 1Q79A 5T41A 2V4QA 1OYEA 3PW7A 1Y0HA 5IT9Y 2NS1B 2WCXA 1MWQA 3MTKA 1FHTA 4NLOA 1XIQA 4WXWA 4R5PB 1RHJB 1KDNA 4XO0A 4EZ6A 3QRRA 1YJ7A 4HHUA 4WTYA 1FE4A 4X66J 1U0HA 3FBFA 4WFAQ 2KM8C 3G71S 4RW9A 1XMOJ 3I32A 1URNA 3G6XA 4DV7J 4WF9Q 1IM6A 3QNWB 4JI1F 2HBYB 5HJYA 4WTOB 1CLFA 4CWBA 1WACA 3OV7A 2W7AA 1HNWF 1FD2A 3W1YC 1JJHA 4LSNA 2BE2A 5GAHI 4YB7A 3D54A 1M5VC 3DRRA 2C1EB 3D1HA 4KO0B 4N8OA 4BLGA 4LF6J 2CQHA 3DYAA 2YBVA 3K2YA 1VCTA 2DH7A 4PXEA 4DS5A 3T5KA 1RT1B 4LF8F 3T19A 2E7WA 1NJYA 1UVJA 4B3OA 5L39A 1RWXB 1V3SA 4M5IA 3SDEA 4URGA 1KBRA 1U1MA 3IM8A 2XY5A 2Y9HA 1D09B 5D4LA 4RNHA 2ATLA 2LP4A 3WQPA 4IOCQ 3FZBA 3G82A 3CCZA 4IOBA 4HDGA 3MM7B 3QRPA 1IWAA 2D9PA 3MR3A 4JI6F 2DHXA 4QOTA 2YTCA 5F8IA 4Q0BA 2ZJPQ 2PT0A 3AH6A 1JLFA 3OFEA 4GVLA 4NLYA 1RAEB 5C42A 1CJUB 4M5DB 1TUGB 2B4OA 4NL5A 3AJ2A 5G4DA 1S0NA 4NXNF 3RAQA 2ROPA 1NRKA 4FPRA 4CLYA 3CMES 1VIOA 3Q8QB 2FY1A 2HFVA 4OMFG 5LT5A 3K7RA 2E29A 1TTHB 3T3FA 1UKUA 5JVGQ 4DR3F 3B8HA 1XNRF 5EX0A 4J9VA 3T1YJ 1EB0A 2CVEA 1WEZA 4ZS6A 5KFUA 4D3GA 7FD1A 1YTYA 4W92B 3KNAA 4USJC 4JI6J 1S1VA 4ALZA 3PCOB 1VQ5S 1T05B 1HBNB 2IHR1 5IT0A 1HBMB 1U45A 2ACMA 4M95A 2QIFA 3U7JA 5K20B 1U1OA 2WVCA 1HBUA 4I4BA 2XNQA 2LXFA 4ZPVR 2B4UA 5J2MA 1QLNA 3RW6A 2AJQA 4NCAA 2KXHA 4PG7A 2PFFB 3KWMA 4KKOB 2Y1IA 2BE9B 2UZAA 3PG9A 3ZZPA 3V81A 1S59A 3DLJA 3R7NB 1R8PA 3OW2R 3SIPB 1BWVA 2DVIA 4LF6F 3FNNA 4P74A 4DHVA 1JLQA 1PYTA 2J76E 1T9WA 2CADA 5HI7A 4ED0A 4N76A 4V19J 2WRMA 2YNHA 5DZ6A 3J81j 2CJBA 2IRYA 1OY9A 3KJQB 8ATCB 3BSNA 3UO0A 2CAJA 3AAWB 2ZDPA 1F0XA 2JZ5A 2VG7B 3L7OA 1OY6A 4QIGA 3KMSA 5D15A 2AQ4A 2CPXA 3IR5B 4H4OA 4OX6A 3CPWR 5DRKA 2V2VA 4KO0A 4LF7J 2CPHA 4DL7A 1S10A 3CEDA 5ETRA 1RT1A 3DRPA 1CS4B 4DR7F 1RP5A 1HPZA 1SI9A 1QTMA 1RWMB 3NG8A 4NLVA 5DJBA 2XM3A 2E7XA 2ZBCA 2V8GA 3TA2A 4M63A 2W01A 2XC9A 5CHCB 3VALA 3K59A 4DUYJ 4FF2A 2WVBA 2ASLA 1RCXB 3MM7A 1TMMA 1CULA 3OFGA 3IXQA 2R8KA 3VGVA 1L3TA 1UVNA 2B8PA 1HIYA 2ZNYA 3MZIA 2GA7A 5HANA 2VODA 3LGMA 1UFLA 2Z56B 2PMWA 3CO0P 3MM5B 4K5RA 4PAAA 2Z2YB 4RX6A 2RQMA 2DNMA 4RWWA 5KG4A 1FKOA 4DL4A 2CPZA 2WVFA 2HNZA 2ZBPA 3PRBA 4USHA 2FHJD 4MJKA 4WK1A 3BH7B 2HSEB 4R8UA 3G9CA 3UDVA 2XG8A 3RAMA 1FNOA 1FRIA 2BUNA 2CUYA 1PJ7A 2HIYA 2VF3A 5FDLB 3CJKA 3BQ2A 3FBEA 4U8YA 3M2VB 4OI6A 3KLGB 4ECSA 1K0VA 2MKKA 3MPYA 2D3ZA 1HBNA 1U26A 2AKWB 3ILOA 1AFIA 2WB4A 2B8QA 2BEFA 1HBUB 3W5XA 5J2MB 2ZH1A 1FO1A 4C8YA 1LWCB 1G4CA 1TKXB 1ZA2B 4RUBA 5CZXA 3T5JA 1X7VA 2FJVA 3DU6A 1FE0A 3X1LB 3B78A 2AZ3A 2ZFHA 2XLIA 3IP0A 3V81B 3AOBA 4DL2A 2HFNA 2Y8WA 2XI2A 5KFQA 1HL6A 4N41A 3DOKB 1OSDA 1S0VA 2B0GA 1R31A 1MLAA 4I0WA 1EZZB 3EDRB 4MYTA 4NZ0A 3FC9A 4ZCIA 4DL3A 3C46A 4FXDA 4QYZJ 1URRA 1KVJA 1KONA 3RU0A 4DFMA 3I4HX 3S7RA 1IKVB 4NPOA 3QFWA 3M2RA 2ILZA 2HVEA 2ZE2B 2VG7A 1K8AT 3HKWA 5B09A 2DHAA 1S6UA 4CH7A 2G9OA 2RJZA 1YBAA 3MEEA 4O44A 2DH8A 3X3UA 1KWMA 3Q86A 3ULHA 1RZMA 5HMWA 1YBUA 5DM7Q 1RWWB 1T11A 3EM1A 3DM2A 3NAIA 3NXZA 2QTWA 3THTA 1S1XA 3M8ZA 3M8PB 2E66A 4DQRA 4ILMA 4DQQA 3J7Z5 3OPKA 2R7SA 1AA1B 4WU3A 2Z2ZA 5FJ4A 5KFMA 3LWMA 5KFHA 3GYXB 2N3OA 2HLTA 2OIHA 3TA1A 1YITS 3M8YA 5DQGA 3NOCA 1A0OB 4OZLA 5FIIA 3MR5A 4NA3A 2LCWA 4U8VA 3M30A 4AL6A 3R5BA 3GCWP 3C6TA 1JNZB 1EP4B 2BJ7A 2FHKA 4LFBJ 2CWKA 3RR8A 2DO4A 2ZOGA 4DWIA 2XS2A 3F0NA 2VQEF 3HT3A 2KVIA 2CQ0A 4UY85 2H1YA 3US5A 1DLOB 3EXCX 1X31C 3TAQA 4LF7F 2CPIA 1OSCA 1H6KX 2B56A 2A1BA 5GAGU 1VBXA 4OFZA 2Z0GA 1DQ8A 2Q3PA 2BKOA 1QTNB 3Q8PB 4WK3A 5JVHQ 5H9EJ 2QL5B 1JLCB 4ZOSA 2XMMA 1UPMB 1ROFA 1HBOB 2YH0A 5C2GA 1KOHA 5HBMA 4DSEA 4XPCA 3KLFB 1N36J 4F2SA 4KGXB 3CW2C 1IKWA 1RADB 1CJKA 3QIPB 4J90A 3TEHB 2EPIA 3Q24A 4F0MA 4IFYB 1GMUA 3NMRA 2F63A 3C6UA 2HHHJ 3NP5A 3EZUA 4DSJA 5KG1A 5GAEU 4F36A 2HBZB 5CAAA 2AEFA 1BQMB 3NS6A 5DLFA 2HMIA 1M5SA 4LRAA 2C28A 1IKVA 2AYGA 1EX8A 4OYZA 4X4SA 1RWOB 4ID5A 3GFXA 2JVOA 3P45B 4L3NA 2B4PA 1UZHA 1LFWA 1YKWA 2CNOB 3UVJA 4DR3J 2H48B 2ZBQA 4L75A 2DR6A 3SCKE 2W7OA 2VFTA 3MEEB 3PFEA 1RISA 2FGOA 4QWCA 3MUMP 2CQ1A 1TAQA 2P9CA 3MMAA 4NA2A 3GR1A 3C66A 5KFXA 3HVWA 2OD4A 2AGOA 4O3PA 3F41A 5AXMA 3BO3A 4PCQA 8RUCA 1WTFA 1W7WA 3EXYA 2DY9A 3MECA 5GAEI 5J1EA 1ZTWA 2HHQA 3D28A 3UW1A 1U1NA 4GO7X 2G2ZA 2HNDB 1FNMA 1RT6B 2DK2A 2DYAA 2GGPA 4CIOA 3ZZ0A 3Q23A 3KK3A 1HI0P 2KG1A 4K4SA 3JQJA 3MOZA 2VH7A 4KJIA 6FDRA 3RGIA 3QRQA 2QZ8A 3FBBA 1O5JA 4EO6A 4IRCA 1FF2A 4MAKA 4LF8J 1S49A 3UWTA 4OI2A 5A8RA 2ZZMA 1Q8IA 1T0TV 4A8QA 2F3JA 3A3PB 3IC1A 3Q22A 2BA9A 2HQGA 2OEJA 3BBFA 2N7YA 4ZLJA 2A10A 3VAHA 1IR2A 2ZOFA 1NK8A 1UAWA 2AEMA 5ITHA 1KTQA 1S7HA 4DCPB 1PJ6A 3DLHA 4F4WA 1YJRA 2IFXA 1NJWA 2UVWA 4JI1J 5GAGI 4URSA 1NDPA 1C1BB 5HN0A 2NQPA 1MROB 2RHSB 3LO3A 2YWEA 3D66A 3ZZYA 7AT1B 3J7YU 2E1AA 5EWEA 4ZP8A 2WTFA 4DSFA 2C2ZB 2MQLA 2VKRA 3QZ8A 1X60A 4B9VA 1FJCA 1AUDA 1VIXA 3CD5A 4J5OA 1QUPA 4H4MB 4DLEA 3QJLA 3JSYA 2DT9A 3KUGA 3E3XA 2HQIA 2V9WA 3JYTB 1RXOB 1R7IA 1BQMA 3PX4A 1NKEA 4YN3B 1RWUA 5IXUA 2N4DA 4B02A 5KFVA 3BSOA 4JI4J 4ID5B 4FVCA 3GG0A 4IO1A 5IT4A 3PIPQ 1NK4A 5E3AA 1NLKL 3GCXP 4USTA 2VQFJ 5J2PB 5I42B 3OVAA 1V3RA 1S9GA 2OPSB 4A48A 3HJVA 2BQRA 1KFSA 5HAOA 4OV6A 4TY9A 5HJXA 3TJ9A 4DR4F 4OI0A 1CJVA 1S7IA 1TL1A 3ZTRA 3GU0A 1C2PA 2IA0A 1VBKA 4H4KC 2B9YA 5AXNA 3AD7C 4ECYA 1Y3KA 1LW2A 1TK8A 4YOEA 1TFWA 1SJ3P 1M90T 5HP1A 3W2WB 2GGPB 1T9YA 4YR2A 4CP5A 1ZBTA 3KK3B 1IUJA 1H0HB 3MWBA 3HXMA 1S5ZA 1GQEA 2I38A 3GJSB 5A6PA 3G6YA 4OZNA 4NXMF 2GX8A 4PXBA 1EARA 1FRHA 2M0GB 2W8KA 1HYSB 4LQ3A 4XIUA 1YDLA 4J9QA 4ID8A 1HHSA 2UUAJ 2F65A 3TX8A 1FNXH 3RRGA 3PHEA 2RMLA 4F0HA 2DPJA 3ZXWA 4M5MA 1P9QC 3I0RB 4AXJA 1XMQJ 4FF1A 1RU1A 2Y1LB 4NEZA 4KC5A 1YZ6A 4FBTA 2R7XA 5HO4A 1MN7A 3ZTQA 1OYDA 4U95A 4NWBA 4O4GB 1Q16B 1F9EB 2MLZA 5K8OA 4P73A 3KJVB 2WSEC 4JI5J 3EICA 1N54B 4RO0A 3WC0A 2CQIA 1FJGJ 2VASA 3QYYA 4A8SA 2H54B 2YQ0A 4Y2AA 3NWGA 3R6LB 4DPWA 2CG4A 4LRFA 2FLLA 4TXSA 4DV3F 1RGVA 3W9IA 2ZEJA 1JK9B 3BH6B 2V6AA 3C14B 3E8OA 4PQUA 3HSDA 4JB8B 1NK0A 4ED4A 2R9LA 1I94F 4F04B 2E5IA 2QL9B 4ECTA 1VQNS 2V34A 1PSDA 1YWXA 4YEAA 1OPZA 4QWDA 3H0PA 2XO6A 2XSJB 4IG3B 3HHKA 4K7QA 1WG1A 5HL7Q 3CD7A 3KFWX 3KJNB 3GJQB 1VHIA 4J91A 2G13A 2ZOMA 1YZ7A 2ZKUA 1TKDA 2BANB 3NBPA 3HZEA 3PNIA 3POTA 5E3RA 3VVUA 3CCRS 3JXOA 4FXWA 4ZN3A 4I2PB 2XHCA 4RBUA 3BPDA 2FIUA 4FNIA 1JJ2R 2H51B 3CJ8A 5IS2A 2O67A 5J1PA 1NSAA 5AJ3J 2LVWA 2XB2D 3WX4A 1ZAXA 2Y3YA 4NRUA 2O5DA 1LXJA 1WF2A 1X5OA 2OPSA 3SSQA 3DMJB 5AE2A 2GO8A 3HULA 3MEDB 1NUEA 3K5PA 3MMCA 3GIIA 3K89A 1U24A 1CJVB 2YX4A 3MCOA 3UCGA 1QAIA 3BGRA 2IYGA 1H7XA 3BM7A 4Z7YA 3VAMA 4NXMJ 2DEIA 3MCSA 2A6MA 3HHDA 3MXHP 1HNVB 3R7SB 2ZM6F 5DG8A 2BABA 2BJ3A 3BYRA 3UD3P 2OJ3A 4LRCA 3CJTA 2UXDF 3CJ4A 3OJSA 3QSIA 5B7WA 1JKHA 5RUBA 3W3SA 1SBRA 3CF5Q 1NZ8A 1T02A 1ELOA 4NASA 4NLWA 9ATCB 2HLUA 2OH2A 5KG3A 2HK2A 5EX3A 1RBAA 5G0RA 1BD6A 4G1IA 3CXCR 2EFPA 4QIWD 3DOLB 2CWXA 2F1FA 2OUGA 3I0RA 3CCMS 1UVIA 1U2CA 4XDDA 3CCSS 2UUCF 4WFBQ 3EZOA 3GMGA 3NGDA 1LW0B 1FCAA 1GTEA 4OZJA 2W9AA 3HVTA 1RHUB 2C2NA 1RTJB 1IKXA 3B4MA 4QW8A 2HBQB 5I3UB 5DDRC 2MKIA 1ZYQA 4JI4F 3MOJB 3VF0B 2B9WA 2V8HA 4TNOA 4HL9A 4MH8A 4ZJOA 1TL3A 2BRLA 4LFAF 1O51A 2IBOA 1P27B 1RAFB 2H5JB 1QVGR 2QN6B 4HKQA 1RT3A 2DNPA 2MJUA 4J9OA 3C14A 4PQUB 1IR0A 4ECRA 2CVIA 4JYAF 1K73T 1GEHA 2EK6A 4I2QA 5F0WA 3RBDA 2XO7A 3NL0A 1VC5A 3EJMA 2EFOA 3G86A 4HTJA 4ATNA 5A2QU 3HVRA 1NK5A 1F9FA 2XSJA 4IG3A 2E5GA 3FFIB 4O3QA 3J7ZT 3OTDA 2HEKA 3UI3A 1R27B 3POTB 4OZ1A 2UV8A 1HW9A 4Z2XA 5DGAA 4RPFA 3OLAA 2K8GA 1QVFR 5KG2A 3G8QA 1KC8T 3HT0A 2FHMA 2LQ9A 1HQUA 4NA1A 1VFJA 2XI3A 5IM0B 3I31A 2W9BB 4Z37A 1UA0A 1DTTA 4RW4A 4DL5A 2J0QD 4KHPF 5J2NA 4Y6IA 3TVZA 1CG2A 4MIAA 1RT2B 3Q2SC 3GB0A 4C3MA 2VOPA 2DNHA 2MLYA 3L95X 1GT8A 3MEDA 2UXBF 2V63A 2E5JA 1NMEB 2HGMA 2OO4A 2HZAA 3A3OB 3VQSA 4DR5J 1OQ6A 2QL7B 2Y1RI 5BXIA 2IC3A 4HYKA 5DS7A 2RB7A 4JOUA 4WWSA 4BC7A 3TQ1A 2YNGA 2N3LA 1KEKA 1YHQS 2V0NA 2HRYA 3C19A 2CJYB 2L3MA 2WONA 3IBWA 1C4CA 2R7RA 2DD8S 6FD1A 2HWTA 2PDAA 3I0SB 3D4JA 3OT9A 4K0KF 4X4PA 1G3OA 3FSXA 2GVZB 2E5HA 1DFDA 2WSFC 3GV5B 2Z2MA 5F3ZA 1R0BG 2PI4A 3KK2B 1D3WA 5LJ3Y 2UUTA 1MW7A 3I9V9 2HS3A 3N6NA 3SV3A 1T9XA 1U0SA 3PIOQ 5DG7A 3EVMA 3P3DA 3PW0A 1TV6A 1P1TA 2VIHA 4ZIWA 4F3MA 3T9ZA 5C25A 2JL9A 3CIMA 5I4MA 1FRJA 4WZMA 1S1TB 4E2FB 3GR0A 3HVTB 4F67A 4CYUB 5I3UA 1NSPA 2HVZA 2O01C 4I64A 3ISZA 3LPYA 4CLPA 1VBZA 1UVLA 4YQWA 4IQMA 1WDTA 2NXUA 5F9LA 3VAFA 4ZP6A 1JB0C 3IBCB 1WOPA 1K1QA 2VBZA 5IZHA 2RUSA 3DC2A 5K8MA 4DS4A 2B9EA 2OPRB 4RW8B 3TW0A 3RB3A 2UXCF 2KU7A 1AROP 5KG7A 4HLBA 1TVRB 1XEZA 4P2XA 1T03B 1FXRA 4X65J 4I1TA 5IC4B 5LL6d 1ZS6A 4I2QB 3MR2A 3HLUA 4OHZA 3OSNA 4LSLB 4B08A 1WOOA 3JTOA 1M5KC 1VDHA 3KOAA 1RBOB 3U1MA 1XNQJ 3AA9A 4KT0C 2BBEA 4TQSA 1M1GA 2DGTA 2F5GA 5J2QA 2QLJB 3ILIA 1Q7LB 1H3DA 1G2EA 2M3DA 2BMBA 1GK8A 4ED1A 3IS9A 1DRZA 1S99A 3I87A 4CLLA 4ZVUB 4A8FA 4G3IA 1LNQA 4X65F 4EU0A 5CYQA 3P5BP 4ZHRA 5AE3A 1HI8A 4TLQA 2JRSA 1KNZA 2WHOA 3GYNA 2CPYA 3FCVA 3OSPA 1GMVA 3M6UA 5LSRA 2ZC4A 2COLA 3ET6B 2XS7A 3IA0A 4L74A 3LP1B 5CQGA 4CT9A 5KT3A 4G1QA 4LBPA 4M5GA 1LWFA 1RT4A 1NU4A 4M5HA 1JWWA 4F2RA 3RG6A 3OTOJ 3IMQJ 2YXLA 1TU0B 4CLTA 5T7LB 1REVB 2C3MA 1LV5A 1TL4A 2VU5A 4L73A 4O0IA 1HARA 1PYOB 1VRTA 3BN7A 4U7CA 2KH9A 2FPHX 1SH3A 2EFQA 2HBRB 2AWZA 1FKPA 1RA7A 2I0XA 2XSFA 1H2TZ 3MM6B 3OXGA 4OLOA 4EMDA 2MSSA 4ANCA 5HMYA 4Q8FA 3UQSA 4B9NA 4AUKA 1TL5A 3DI6A 3A12A 3WIUA 4R5PA 2VBWA 3EYZA 3PZPA 3GPAA 1SKRA 3IN5A 3KDOA 4LREA 4C8KA 3TI0A 2YH1A 3JS9A 1S4EA 4RW6B 3H59A 3MGJA 1LWXA 4HDHA 4NLUA 5LSLA 4NLXA 2RRBA 2UP1A 3GFZA 2ZJRQ 3NCRA 4I7FA 1DAXA 3CMAS 2DR7A 4JI3J 2FZKB 4OX8A 1APSA 1SQGA 5D3GA 2PFDA 3SSRA 2Z30B 1RHRB 1Q95G 3TA0A 1UJ6A 5D0HA 2KM8B 1TUVA 4RW8A 4ZN1A 2VICA 2M52A 1X9SA 3N4WA 2AJ2A 3RRHA 2ASJA 1NXIA 4CM0A 3TWZA 4ZJLA 2DNGA 4CNZA 1NJIT 2XLJA 2VD3A 2X1GA 2RQCA 3ETMA 1RI7A 1H72C 3TJ8A 4DV4J 1E6VA 1XR5A 4X4RA 3CB4A 1E6YB 1HW8A 1TK0A 2ZH4A 3CDWA 2DNOA 3BDEA 3HFVA 2YKQA 4P6QA 3MFHA 3FQKA 1WC6A 1WI6A 4I68A 1F5CA 2J0SD 4KRWA 4DFJA 1VMBA 4DQIA 4PKDB 3D1OA 2UV8G 3W5YA 2XY7A 4NCGA 3NAHA 4FDFA 5SZTA 3FJ2A 3LAMA 4G1QB 4NEYA 3PW2A 2CKWA 3QPIA 3ZTPA 5CA5A 1V3ZA 5KFRA 4O0NA 4RUAA 4M8LA 2K7KA 5T7LA 2RKIA 2IMOA 1JLAA 1M0SA 1FRXA 2BOAA 2F9JA 4RJVA 3UN5A 4EGLA 5IOLA 1HWIA 4YHHJ 2HHHF 2RF2A 4DR6F 3MM8A 2D9OA 1SB6A 2YWHA 2ZC3A 3MM6A 5FLXU 1AUSL 3HFKA 8AT1B 2PA8D 4OIXA 2ZZTA 1YJVA 3GYGA 4ZVGA 4OYXA 2LLZA 3DN9A 4K59A 1N5VA 4X64F 3M9OB 1H38A 1PIEA 2MKSA 4JV0A 4PQAA 4C98A 2C2DA 1R3NA 2KTQA 5KFSA 1XJWB 2VFUA 3OR1B 5KFCA 2YNHB 2ZWPA 4DOZA 3NGSA 2JX2A 4NYPA 2JEGA 4LIRA 3OJUA 4CZCA 1K0TA 3W2VB 2IVYA 3M6VA 4BWMA 3VGTA 2R7WA 4BHQA 4ELTA 4KH0B 2R42A 1XBWA 3GSDA 3N6LA 4IO9Q 4GVBB 4YR3A 3KNGA 3MDFA 4KFBA 4F25A 1Y00A 3HP6A 4C97A 3DRRB 1UL3A 1U1RA 2VDHA 1Q53A 3DYAB 4HT7A 3DRPB 5DQIA 3H4DA 3H7HB 2VQEJ 1JLEB 5HVFA 3CDEA 1S1UA 1BLUA 1TKZA 4J37A 4GC7A 2FVRA 4O3SA 4NYZA 2P6TA 3SDEB 3T5LA 1PC5A 5B0AA 1PGZA 1DZ5A 1S6PB 5KOWA 2KO1A 3W7BA 3KHRA 1VK3A 4DMZA 4ER8A 4OLPA 1UVMA 1S1WB 2IDEA 4MIWA 1B0TA 4LF2A 3OVBA 3IWXA 2DBBA 1FJ7A 4A46A 4PZVA 2RQKA 2I2YA 4Q0BB 4Q2LA 4DF4A 5CD4A 2IM2A 5KFZA 2RDIA 5LMNJ 4WFNQ 4K4VA 3SFGA 2V2ZA 1FDAA 3QGIA 1NPPA 4DFKA 3MCNA 1NDKA 1WC4A 2BXJA 5K14B 2VUGA 5MLCV 2E9RX 4M5LA 4HACB 1BQNB 3D1QA 3PYEA 4NCGB 3THVA 2KZZA 3DLGA 3D5MA 1I1GA 3UDEA 4KB7A 4Y00A 1ZH5A 3EWGA 4DV0F 5CCMA 2GQQA 4CO5A 2IM0A 5IV3A 5KT2A 2DGWA 4F4ZA 3PY8A 1N6QB 1X4EA 2FLNA 1LQ9A 2BV3A 1NB7A 2D69A 4F3OA 4IR9A 1JLAB 4P52A 4PXDA 5HLFB 2WAQD 4W90B 1YRXA 4KV8B 3MM8B 3NY0A 3R5AA 2HK3A 4ECXA 5CCLA 3FGVA 4C8ZA 4U96A 1B64A 4XDCA 4ZLNA 1UPPA 1X4GA 1ZOTA 2JHEA 5CZVA 3AJ1A 3CTRA 1TFYA 1HR0J 2MY8A 2VB6A 5K8PA 3LQVA 3OTBA 4X2BA 1NPKA 3TZWA 4ERDA 3TAPA 2CQPA 2NYHA 3VQTA 1D9AA 3OR1A 1A7GE 2QA4G 1VLYA 2DTJA 3MM9A 3ZZTA 2B6AA 1UEVA 5H9EK 1HNXF 3PKMA 2VFVA 1HNWJ 2ILYA 3TEGA 1FJEB 2UU9F 4EK2A 2FVCA 4CO1A 4ZPAA 1RUSA 2HURA 1S4FA 3NNAA 2CRLA 2UUBF 4HEA9 1WELA 4DR4J 3CMQA 4QJVA 2OHDA 2OLWA 3D0HE 3T6JA 4KFBB 2IA6A 4UOFA 1R8AA 1T9VA 3BB5A 4R0JA 1JLGA 2LXIA 3V4MA 1RAJA 3DLEA 2VPYB 2C22A 3D3CJ 5D8HB 3NOGA 2G0JA 3P6YC 1LWEA 3FMWA 2DGVA 4ETXA 1CS4A 4C0HA 1TKZB 1HPZB 2AMCB 1YJWS 5BYQA 3TUPA 3GV7B 4PG6A 2XLKA 4BDPA 5KFDA 1HQEA 1RTHA 2QYCA 4X62F 2EG2A 3B4DA 3BZQA 5KT7A 4QWAA 3LAKA 4DF8A 2DNLA 3GFYA 4TY8A 5E3PA 2PA3A 4B9SA 2E1CA 3ZNUA 1NJZA 1NB2A 2A2CA 2F40A 3Q89A 4UY8T 1U47A 4DPXA 3PXGa 1KQFB 2IY5B 2MTLA 4ZCKA 2QA2A 4RNOA 2NXCA 3C15B 5A6WA 4C2MA 1NK9A 1NAQA 1U2RA 2AYMA 1I5OB 2CFXA 3JSMA 3AOAA 2H4YB 3V6DA 2J6TA 1BQNA 2VFRA 3S6EA 2V69A 4LFCF 3J7AN 1KHVA 4OJ1A 3QO9A 4WYWA 3C16A 3R1LA 1S9EA 1X4CA 2O3DA 1U1QA 1P1LA 1ZAVA 3O5TB 3CJKB 4BC9A 3TOQA 2UU9J 1AYEA 4DL6A 4ZKAA 1FVQA 1WKJA 3LH2S 2HNYB 1F5BA 5ETSA 3M6XA 5DGBA 4KV8A 3JAMU 1NPRA 2RS8A 2ZNZA 4S0MA 3CD6S 3V4IA 4YDXA 3R3TA 2E1MC 2P2CB 2VA2A 1SJRA 3UN2A 3K5MA 1TK5A 2D7SA 4HT5A 4QZVB 3OTEA 4WP3A 3C6UB 3TZZA 3IBFB 4DQPA 2UXCJ 4EFAC 2EFNA 2J8AA 1S97A 1Y10A 1HNIA 2LQBA 1I94J 2OD6A 5KFFA 2VZ9A 1DJ0A 1O8BA 2B6AB 1A6LA 1WG5A 3O6QA 2YPZA 2YWFA 3R5GA 4NMLA 2KG0A 1BWEA 1IJFB 4DX6A 2ABYA 1DY3A 1H7WA 3DHXA 4C4WA 1FXLA 3TUJC 2ZE2A 1UWBA 4Y0FA 1UEUA 2IJRA 4OZ3A 1XTZA 5EUHA 4C11B 1ZA1B 3ISNC 3AOCA 5LM7E 2FLPA 4ZPDA 4KR0B 1JLGB 5GMEA 4ZJQA 4DV6F 1WHWA 2F4VJ 2DRDA 9RUBA 3KDNA 4CQ1A 1IBLF 2LEAA 2W4CA 5EN1A 1DBDA 4BCAA 2HGLA 2O66A 4OZ0A 5IWAF 3QT7A 3R5JB 2GIQA 2Y1JA 2CQDA 1AW0A 1SQFA 4K0KJ 1GTHA 1RT6A 2RDDA 3DFEA 4FKYA 2HQ3A 3GP9A 4DUTA 2V8DA 2CZ4A 4P7VA 2BR0A 1Z1ZA 4AE5A 1XQIA 4CLZA 1O6XA 2XGPA 4FS1A 4CTAB 3D6HB 4YMEA 4A8WA 4IG0A 2Q6BA 1G7CB 1N5TA 2PMZD 3UN3A 3KMQA 3SCIE 2J9CA 4EEYA 3HD1A 1G6BA 2V5HG 2IVMA 1X9MA 1D9DA 1TMJA 3RAXA 4NZ7A 3TX0A 2ZH8A 4MKYA 2F8EX 3QO9B 3SCJE 1HFEL 2FGCA 2HS0A 2KJVA 2KYXA 4P9SA 4UOHA 4LF1A 4CT8A 3QWUA 3LP2A 3R7BB 1IBCB 2ZH3A 3IR6B 2ZVIA 3VVTA 2M8DB 4Q45A 4ZVTB 4DXLA 4HHJA 2RHQB 4FPIA 1C1BA 2VKZG 5DQHA 4LSNB 3GILA 2MZ1A 3BDPA 3KLFA 4X64J 1N0VC 3SBMA 3ONQA 4V19X 2OPPB 3IRXB 4B3OB 4LFBF 4JYAJ 2KL8A 3GIKA 2NXNA 1M1HA 4K4UA 2DO0A 4C3KA 3HHLC 1IR1A 3H2VE 2J7WA 3ISND 1B3TA 4DV1J 5IT9U 2JWNA 3DLKB 1W2BR 2HMIB 4GKKJ 3FDSA 1YK9A 3FRZA 5GAHU 4RWXA 3BQ0A 1S0MA 3MCMA 1RYRA 3PYDA 1FWPA 1UWBB 2FC9A 1DTQA 1CJUA 2QV6A 2YX7A 4M5DA 3QZ7A 2QFJA 5LSOA 4LF4J 5B0BA 4DV5F 3FCHA 4JV1A 2HHSA 4KIAA 5DDOC 2VG5B 2ZHAA 4QU7A 1UTAA 2N4CA 4ZVOB 4CLSA 4WE1B 3V2UC 2VV5A 2BACA 1C4AA 1KFDA 4Y28C 1U09A 4ZPBA 1EETA 2R2UA 4ED6A 2H9ZA 1NH8A 5ETTA 3B82A 4FF4A 4B3MF 2R8JA 1S1VB 2CQ2A 3PDNA 5D4OA 1LW2B 2FTRA 5KFIA 1DURA 1N34F 1TL7A 3W2WA 2C2MB 2CQGA 3L7UA 1DARA 3R9LA 3GIMA 4AQYF 1VQ7S 1TAUA 4CI0B 2ZH9A 1LKZA 3VWSA 1UEKA 2CQCA 4CTAA 1RAAB 2PI5A 4OZ5A 4IG0B 1NEEA 2F4FA 4KAIA 2ZBIA 2MDAA 2CYYA 2F7VA 3HKZD 2K3IA 2PSZA 2EWHA 3KTQA 5A8WA 4AXIA 5KFOA 2VONA 3FZ2A 2OKQA 2PN6A 5AXLA 1FXDA 2J0WA 5D77A 4J9SA 1HD1A 5LOQA 4ZLPA 3EZ5A 2U2FA 4B9TA 2B7CB 3TYTA 2FZGB 1Q8LA 2W9CA 5HROA 4JI3F 2GV1A 2IM1A 2MZRA 3KJVA 3FSYA 1VRQC 2C2RA 3OXLA 5CABA 1NHVA 1R8CA 3RRKA 3CVKA 4OYOA 2GHWA 1MROA 4ZCLA 2YNIA 1RSCA 1UCNA 2KFNA 2ZD1A 4YB6A 2KVQE 4CLFA 3A8JA 4Y2IA 5L1IA 1NBEB 3CIZA 2ALZA 1QSYA 1SC3B 2PIIA 2XZTB 2POKA 5EWFA 3Q0AA 4NOHA 3EPGA 2XWXA 3BF4A 2IAJA 3L3CA 3V6JA 3ETOA 2OAUA 3EGVA 3OL6A 3H2LA 1U8WA 4DV3J 1YI2S 3KLHA 4PPDA 1KQSR 1CULB 1Y5LB 3FUYA 3UDCA 1VR6A 2YY3A 2JEJA 1FJGF 1X4DA 3UDLA 3NNCA 1NH7A 4A8XA 1NHUA 3FEXB 1X5TA 1NM2A 3SCLE 4JI5F 1S76D 1M5PC 2YKAA 3H2UB 2CNKB 4USMA 1FKOB 2MKHA 2ZITA 2A2DA 2M88A 4TKTA 4RNMA 1L3UA 2AYBA 4UTGA 4XPEA 4WFXA 3TRGA 1NDCA 4LJMA 5J2PA 4U6PA 3QT8A 1JJ4A 4NI2A 3OHBA 3DRSA 3CJQA 4R8UB 4IQXA 1UETA 4ES3A 3MHYA 5JXSA 1GFWB 1EETB 1SXLA 5FDLA 3W61A 3BO2A 1HNVA 1CC7A 2VPWB 2YKPA 3GONA 5E0OA 2LMIA 3ZNJ1 5F8MA 4IDKB 4ZVSB 2GAHC 5K9FA 3VGUA 2VPXB 1KQGB 2LU2A 4BBYA 3CCES 4ED2A 4MT1A 2V50A 4FN5A 3BKUA 3VAKA 1FTCA 4D3HA 2Z8QA 2BZ2A 2RU9A 3R8YA 4CO0A 3ZFVA 1ZZNA 1U1KA 3NKYA 3M8QB 1DHMA 2JFDA 5HVGA 3KLVA 4GKJJ 2MEWA 4A8KA 1L3SA 4CDIA 2FB0A 2YX1A 3AFGA 3DOKA 4MK9A 1FT8A 1N5SA 4DL0C 1Y4ZB 2QO3A 3SEOA 1F5AA 3MAHA 4FYXB 1U49A 5DO2A 5KFJA 3S8SA 2B43A 2HZVA 1D0EA 5HMZA 2QFIA 4O4GA 5L46A 4C3LA 2F9DA 2WW8A 4DCOB 3CCJS 4G6VB 3O3LA 3SQGB 3A3NB 2OSQA 3A8KA 5FD1A 3S1TA 2EBGA 1Z2ZA 1SKWA 1S6QA 2EFGA 1FFSB 3SFUA 1SC1B 2MLXA 2X7IA 1RT3B 2MPUA 2PD1A 2VL1A 1KLMB 3BPSP 4NXNJ 3AD8C 4WIIA 3CD0A 3DOMA 1TUWA 1FVSA 4K4YA 2G1HA 2ZUAA 3VGSA 4PG8A 3M8RA 2HGNA 4J7CA 1KVKA 3BGOP 2GQCA 4QR1A 3PW4A 3DRXA 2BQ3A 2QJ3A 3MUTP 1R0AB 1W25A 2NPIA 4WJBA 3HI9A 1U6ZA 1B70B 5LJ5Y 2A3JA 4ED8A 4RUCA 3WZ0A 2OPQB 3PM9A 3M30B 1H2VZ 4PWDB 1GXTA 3UCZP 2VDIA 3NNHA 1F2GA 2BJ1A 3P96A 4DV4F 4PUOB 4ZK7M 4DR2F 3CJ2A 4F3QA 4FYYB 3D0GE 1MU2B 1N5YB 4UZCA 1Q5YA 2UXBJ 4RW4B 3R6GB 3SMZA 3PHTA 1DLOA 4IH5A 4YY3F 2G4BA 1NSQA 1RT2A 4NI2B 3HMJG 2MGZB 2WBRA 1C0UB 2QSWA 5L9NA 4KHPJ 3MMCB 1I51B 1RHQB 2RE1A 1CSJA 3CC7S 4YDDB 3P4UB 3QFHA 5CYJA 5D4NA 2YNGB 4ZLLA 1RYSA 1HBOA 5E41A 3H20A 4C48A 4DV7F 3T1HF 2YKMB 1VQKS 1X8DA 5D0EA 1VGYA 1M1KT 3CCTA 4OV1A 1IQZA 2XMUA 2JC0A 2HHWA 3MR7A 1JKHB 3TNVA 4K50A 2V94A 3QT6A 4L72B 3IGVA 3N5BA 1SPBP 2XMVA 4M5JA 4MTPA 1FFGB 5B0EA 5KFGA 1U7LA 2QX0A 2MMYA 2X51A 3H90A 1WOSA 2ATCB 3M8QA 3N79A 5L1LA 4K4TA 1WC5A 2K2PA 3KJFB 4J9LA 3U27A 4RZRA 1FWLA 2YKNA 1U2FA 1FESA 2HAIA 4NLPA 5IQQA 5A0YB 4TN2A 1RBLA 1J2VA 1FFWB 4P10A 1X4FA 4JV2A 3DRYA 4XK8C 3KG4A 4WKRA 2AP6A 3OTOF 3SYZA 1IKXB 1IWGA 1N32J 5IC6B 2DGUA 2Z58B 2YKOA 2FJEB 3BKFA 4USKA 3UVJB 1KLNA 4TYAA 3CC2S 3MUVP 2JFKA 5CYMA 1D1UA 4Q43A 2HHXA 4KQZA 2DGQA 4K2XA 2EBEA 3MMAB 1FDDA 3DOMB 1JXVA 3ITHA 4G65A 5ETVA 2OTLS 3ENVA 2J7KA 3D7SB 1SUQA 4ZVFA 2NR0A 4B3TJ 2HFUA 2OELA 3TJAA 3ICLA 3IGNA 2HVIA 1FRKA 2RUGA 4WFZA 3A1YG 3MPVA 1CJTA 3QLHA 3MFIA 1AXQA 3LP0A 2QGFB 4JI7J 2DRAA 2HNDA 4X84A 4B3SJ 1OS5A 2NSCA 1LFPA 2RRAA 2VA3A 3BGFA 3EMTA 1MMLA 1WDDA 2CZVC 4ITSA 3UPFA 2IBKA 1XNQF 3O44A 4W98A 4JV5F 2KDOA 1RWPB 2NZCA 3ILJA 3OD2A 4ZPWR 5F8HA 1MU2A 1K1SA 2MZJA 2IJNA 2PEBA 3RUBL 3PJWA 3G8SA 1AT1B 1Z4UA 2U1AA 2FJBB 4ZP9A 2C2EA 1GX6A 4JI2J 4DV2J 5A8RB 4Y65A 3I6PA 3FSIA 2GJIA 1C0TA 2MGZA 2LU1A 1VQ9S 2H3EB 1R6VA 4OYPA 1SL2A 1RHKB 2FHOB 3GWCA 3GSIA 1LWFB 2MSTA 1ITPA 2B4VA 3KHHA 2EKYA 1X4HA 2HYIB 4FS2A 2XYGB 3HHLA 5C7PA 1RTZA 5BYRA 1N4LA 2MHEA 4TLRA 4GMKA 5KG0A 4J9MA 5ETQA 1RDRA 3NGTA 2GS8A 3AD9C 3VTIA 3KK1A 2I9SA 4CCHA 4OX9J 3Q8SB 1FKPB 3RBEA 2G0CA 4TU8A 3K0JA 3Q8YA 2JNJA 4LR9A 2I8EA 1T3NA 1WF0A 5JUMA 1WSVA 1YJ9S 2E9ZA 5A0YA 2FVQA 1RLDA 3IWLA 5A2QY 2JH3A 2Z57B 4HVZA 2FQQB 3O1LA 1U0HB 2FUG9 4GRSA 3PX0A 2ADBA 2OTJS 1KN6A 3GE9A 4ENOA 4Z7CA 3FBCA 1Q86T 5L9XA 4OI3A 3ZZZA 1QUVA 1YRTA 3ADAC 1C1CA 2AJ1A 3AQOA 4OI4A 4PXCA 2I1RA 1U25A 5CYMB 1YJTA 2J8SA 4WP8A 5BR8F 5I42A 3PYGA 4O3NA 3WC2A 3DDKA 1FD8A 3H40A 1Y5NB 3CUNA 1TVRA 1IXKA 5C24B 2HHUA 1NO8A 2PE8A 2DNQA 2BJ8A 4JV5J 5D4PA 4C7QA 3JSRA 1J5OA 1Q1KA 2QMUB 1TZ0A 2YWGA 5KTQA 2XY6A 4FNHA 2D3O1 1S77D 2LYVA 3ZO7A 4F50A 5GADI 4Y2KA 5HP1B 2GVDA 4F0KA 1U1LA 4IYQA 5J2QB 4DU8A 1TP7A 4QWBA 3Q8UA 2XNRA 2HHTA 3A4TA 1HI1A 2VPZB 5HQMA 1Q8KA 4B3MJ 2DNYA 2XZWA 2GMJA 1S79A 3PYFA 2EXUA 2RQ4A 4K2JA 3NS7B 4KSEB 5ETPA 3W63A 5C42B 2RS2A 1KSPA 4EZ9A 4DSLA 4PRFA 4QU6A 2QLWA 1HYSA 1RABB 2KT2A 1KKHA 4ZA1A 3CCUS 2FVPA 2GIFA 3FVYA 5JJBA 1M5OC 2A0FB 3RB0A 2HVHA 1C0TB 1OQ3A 3DXBA 4CH1A 4LF5J 4Y2CA 3WBZA 1WKLA 4DQSA 1UMJA 2R7OA 3EE3A 3ET6A 1R43A 1XR7A 4TQRA 2XHWA 4DV6J 3TR5A 3MEKA 4DI6A 4X4TA 1RT5B 1WHYA 1AZSB 2Q79A 3PV8A 4CLKA 3EGZA 2R7TA 1Q8BA 5KT6A 4QIFA 3O8WA 4KTQA 2L08A 2P5VA 1UWAA 1X0PA 5F3TA 3AB2B 1REVA 2W24A 1HBMA 2DNRA 2RAQA 2D41A 3B54A 3GG1A 3JTPA 3L09A 4O23A 2UUCJ 4FBUA 4DPOA 1VRTB 2DIUA 4HH1A 1VRUB 1R0CB 3R2DJ 1U02A 1RT7A 2RDJA 3GLJA 3H5UA 2H5IB 1QJHA 1FWKA 5HATA 3HM9A 3MMJA 5KFNA 1CEZA 5CH7B 4UW2A 2KI2A 2NXJA 1SKUB 1QE1A 3OFHA 3KXDA 1PC4A 3L7PA 4ILRA 2LFVA 3OUYA 1NKBA 1JLBB 1JLQB 2ALYB 3NGRA 4LF9F 1FX2A 4RW6A 5KOXA 5IQ6A 1SC6A 3EUNA 1HQ2A 5J1NA 4B9LA 2C3YA 3D6MB 5BYSA 5F8GA 2WB1D 3VAIA 4DFPA 2R2TA 3B6BA 3OTCA 4I2PA 4MKVA 5F41A 4F4AA 1MSWD 3E01A 4HTIA 1IKYA 1R8BA 3QGPA 2ZWOA 4ICLA 4AL5A 1N8RT 2CPFA 4USIA 4M5NA 2GNKA 3W62A 3AA8A 2J6SA 1VISA 2C2OB 1F3FA 5B0FA 4OHYA 3KLEB 4EI2A 3M8WA 3S01A 3TZXA 5C24A 3TAMA 4JI0J 3NEKA 3A8EA 2ZH6A 2JLFA 5DDPC 4KE5A 3H5SA 3QAUA 4LRBA 4P2FA 5U47A 2HRTA 4YFUA 2MJNA 3I5AA 1TKTB 3NGUA 3QBCA 1NNDA 1TELA 1TR0A 2AJ0A 4BS2A 2VG6A 1JIHA 3LTOA 3OFFA 4OL8A 2AX1A 2BM0A 2J9DA 3UCUP 1QAJA 3BQ1A 3G4SS 1UW9A 3MPDA 3PTWA 4YS2A 2GHPA 4F02A 4ECZA 2IYIA 4A8MP 5IWAJ 3D67A 2CNNB 1S0OA 4QIVA 4J9NA 1MG7A 2WZ1A 2BX6A 3MM5A 2DNZA 3GJRB 1ULRA 3T1YF 2DR9A 2OMLA 4CO3A 4CNYA 2GAGC 5KT4A 5G0RB 2DB1A 2F8HA 1Q78A 2DXDA 2M2BA 4ZPCA 5K5MA 1VC6A 3DOLA 2HVDA 1FTRA 3HD2A 3HX9A 5K8NA 3DLGB 3L4BC 4XTTA 1EIYB 1S1UB 1ZPWX 2EFVA 1LW0A 1SH2A 3QAEA 4RU9A 2HHVA 1FEHA 1LK5A 2P9GA 5F0UA 4E98A 3W66A 1RT5A 4WZQA 4TU9A 1HMVA 1N6QA 2E1PA 3LA0A 3M2VA 1ICEB 2P9EA 3KLGA 3KYLA 2KXNB 2AU0A 1TL3B 1U1PA 4DSIA 5HLFA 2XULA 4CRJA 3WX8A 2PGCA 1XMQF 4ECQA 4DX7A 3HPOA 4DLGA 4QIEA 2YWKA 5HSPA 2D74B 3TO8A 5LMUJ 3OBIA 4GO5X 4PYAA 1U6FA 1WHVA 1FDBA 1ZM9A 2BKPA 4USWA 4UUWA 4ZP7A 4X4OA 3OL8A 2KXFA 3IFEA 4P2SA 3OVSA 4EYIB 3RB4A 1QE1B 2J5AA 3OUYB 4EWTA 4DPTA 1N36F 2FVSA 1F9HA 3CCVS 2IMWP 4DUZF 4ZITA 3R2CJ 3IR7B 3PRVA 3CULA 1GH8A 2DXEA 3D68A 3ENQA 2KYZA 4J9KA 3M2RB 1IKYB 3TUIC 1HQUB 1UZDA 2LA6A 2CDQA 2MKYA 5HVHA 4X66F 5J2NB 1XMOF 3LW5C 5E3QA 2X1FA 1S6OA 5C5JA 1D8YA 1XK8A 2W2OP 4IRDA 3D9BA 4Y3CA 5GMDA 1LWEB 1RLCL 2VQFF 2CIMA 2E5LF 3VAJA 1JLEA 1T95A 1XN9A 2HS4A 1S1XB 3Q8VA 4MK8A 1BC6A 1S6PA 2L9NA 1HQEB 1UVKA 2RVJA 2GFFA 2R8HA 1Y9OA 2VG6B 3EDQB 1GAOA 4LRDA 4N8NA 3WIVA 4NLGA 4N7TA 4TY8B 2LDIA 3LOUA 3GQCA 4K8RA 2BJDA 1N48A 3HVAA 3EVOA 4ZMMA 2QSFA 3C6TB 4AYBD 4E8UA 3SI8A 1EP4A 1OWXA 3GJTB 3CJSA 3CGIA 2W2MP 5BJRA 3F56A 1NK6A 1SJ4P 1N88A 1LK7A 1L5UA 4PG4A 4HACA 3VHQA 4B3RJ 2JC1A 3CJRA 1YGYA 1PBUA 4RW9B 1X4AA 1WEXA 4WYLA 1PAEX 2MKJA 4CYUA 2UUBJ 4P2MA 5AXKA 1N0UA 1BMQB 1HMVB 2K3KA 3MR6A 3ZZRA 2K06A 1D8ZA 4LQ9A 4WCEQ 2DEJA 5F8LA 1XC9A 1N56A 1HNXJ 4FYDA 4F4XA 3FEZA 2KHDA 4X4VA 2CPDA 1YLXA 4ELVA 1RACB 3CWJA 3MD1A 2BKNA 1FKAF 3AQPA 1HR0F 2XTJP 1KQKA 5B0DA 2B5JA 3DGPA 4KBIA 4LSLA 4MFBA 3Q2TC 2CZ9A 3I82A 1IBKF 2V8VA 3DDIA 4AQYJ 4NE9C 1WUUA 1JXLA 3CCWA 3NGKA 3IAM9 1X0FA 2VBXA 1Q82T 1N34J 1F2HA 4K4XA 1VQOS 2OSRA 5ETMA 1V5IB 3DGVA 2C3PA 4I56A 2WW4A 3PX6A 2BYCA 1JLFB 2DNNA 3O2IA 3SSSA 2VC1A 2XYHB 1UFWA 4DV0J 4CO4A 4DZ6A 3QT5A 1F60B 2KRBA 5SUHA 4EYHB 1P6TA 4B3RF 4O4RA 1AFJA 3C8YA 4KGKA 3MURP 3M9NB 3V5RA 1P8GA 4OI1A 1KD1T 2NLWA 4R25A 4X4UA 5EDWA 1FK9A 1FRMA 5D0GA 1YQHA 2EK1A 4H4KA 3HFZB 1RE1B 3AXKA 4HH0A 5EHHA 1JQGA 3GIJA 3KLIB 1YRUA 5LMNF 2GW8A 4I6AA 4I69A 1S72S 3K5LA 7FDRA 2YNFB 2ZZNA 3MECB 5J1EB 4AT1B 1RTHB 3G2XA 4DV1F 1SIWB 2N82B 1PG5B 3HF5A 3RBXA 3QMQA 1GMWA 4P7TA 4ES1A 3W64A 3ENWA 3ZTSA 2FYXA 2L9DA 3BYPA 1B7YB 3M05A 4KHMA 2RT3A 2ERRA 3M2UA 4JUZA 2YQ1A 1Q7YT 2XMWA 3CO9A 1RK8A 1VQ8S 4DR7J 2V4RA 1NHKL 3NLCA 4LVNP 4IOAQ 2DR5A 3M7VA 2ZJQQ 2DGSA 2SXLA 3JSMB 4ELUA 1RWVB 3DU5A 5C2CA 3K58A 4IFVB 2DCLA 1KR4A 4F7VA 1KRPA 1Y3JA 2RILA 3WHIA 5A76A 3HDSA 4PEOA 5F8NA 1YSJA 3LP2B 4O3RA 3M32A 1RB0A 2KT5A 3P8BB 1YIJS 4JP8A 2FJXA 4ZVPB 1HWKA 4DUZJ 4MKAA 2NYIA 2BE2B 2EG1A 3AY0A 2R8IA 2NREA 1FA0A 3BR8A 2DCUB 4I67A 1KP6A 2ACYA 2AD9A 4YUDA 2H4WB 3JQKA 3ELHA 4OJ3A 2NUUG 3OXFA 4YR0A 2B5JB 3DGPB 4MFBB 1RJJA 5LMUF 4OHVA 1FEEA 1FDNA 1PYSB 2XMKA 2G0IA 2LXUA 3BEGB 5M2PA 3HK2A 2C3UA 3AHPA 3ENAA 4KYZA 4YHHF 3QJJA 1CQMA 3QSYB 4L6V3 1PBAA 1YJNS 1QAXA 3MPWA 4WU2A 1VK8A 4OX7A 3MF5A 4ECUA 1Y11A 3R97A 3OL7A 2QRRA 3QQCD 3BJYA 1RKJA 2HWIA 2UVUA 4OYIA 2ZH2A 4YB5A 1T9TA 1YX2A 2FJAB 3CDBA 2N7CA 1XNRJ 3JSBA 2XMJA 2JVRA 4DR1J 1VQLS 6AT1B 1K9MT 2HNZB 2ZHBA 2DGXA 2F4VF 5KFYA 3CCQS 1HKAA 2RSQA 1SQEA 1FK9B 1RAGB 2X1BA 4WE1A 2L9WA 2HWHA 3TVYA 3K5NA 3KLIA 3UE2A 1VS3A 2ZDOA 4OHWA 3PR5B 2ROEA 4A8YA 5E3CA 3T5HA 2IM3A 2GHVC 2AV5A 2K1RB 1TL7B 3LGHA 2RKIB 1T05A 3KUEA 1QM9A 2MQOA 3VCDA 4L3KA 4ZVRB 3PW5A 2AX0A 1KVIA 1SJQA 1F3VA 4DEZA 2OEKA 5GADU 3IWNC 1VQ6S 2W25A 3U02A 2WBMA 4KKOA 4QR2A 3PO4A 4URQU 1LXNA 3C2PA 3GIRA 3N28A 5EWGA 3WDOA 4IFVA 2KZMA 4M5KA 3Q83A 1ACMB 2FLOA 2I5JB 2F8MA 3K5OA 4DN0A 4AL7A 2R2SA 4OZ2A 2BM1A 1NJXA 4M94A 3HZGA 2OFGX 3M32B 4QR0A 2CJXB 2FDNA 2ZHOA 5ETOA 3W2VA 2JOQA 1B0PA 2IPOB 2QG9B 2HAFA 2DXFA 4I6YA 1ZAWA 1REGX 3T1AA 4LF9J 4GVBA 2R7QA 3QGHA 2YNIB 4H4OB 3BO4A 1VC0A 3W60A 2ZD1B 2E44A 2D3OR 3DXSX 2BOPA 2C2KB 1UA1A 4U7UD 1HHTP 2IIHA 3IRXA 4UT4A 3MAQA 2H65B 4Y34A 2IAJB 4K5SA 4LR8A 4DR1F 1VOMA 5KAKA 3M8SA 5DM6Q 4C0BA 5E5NA 2XEXA 1U6BA 3Q8RB 3VAGA 3QATA 3SQOP 2EW9A 4X62J 3I55S 4F4KA 1WD6A 5HQLA 2HFOA 1L3VA 2CXEA 3THPA 3TARA 4HI1A 4ZVQB 1CBKA 2P6SA 4DCJB 1K47A 3M4XA 3GV8B 2DKOB 2IDLA 2WVDA 3LPEA 2E5LJ 1RTDB 4LF5F 2HFSA 5K14A 4Q7AA 3ZZUA 1L3KA 3RYLA 3NWRA 5L1JA 1ZPVA 2NSBA 2VG5A 3BREA 2R3VA 1M5HA 4FF3A 3RB6A 4WP9A 2NUHA 1HD0A 1BY9A 5KFPA 1SC4B 2V2KA 3L9ZA 1KOOA 2W2QP 1QAYA 2AGPA 2K1RA 4DN9A 5HBMB 4ECWA 4LBHA 1OJ4A 3ZTOA 4ILLA 4MIBA 3SZ2A 3PVXA 2AGQA 1MNEA 1FERA 1AB8A 1GXUA 1MN9A 4NCBA 2V4JB 3MMBA 1IKWB 1VYAA 3H42A 4TYBA 1DQAA 5DLGA 1LWCA 1TKXA 2E7VA 1SH0A 3QIPA 2QA1A 5L38A 5CD4H 3HHNB 1SKSA 3H5XA 4USUA 2ROGA 1CVJA 2IRXA 1I3OB 1RQ0A 2DH9A 2GJ2A 2W4DA 3HCXA 4NLSA 2FD2A 3UFCX 5KFWA 4K4WA 2YWWA 4WPAA 2EKNA 2CPEA 2AT1B 3MM9B 2FC8A 2I5JA 1N52B 1OY8A 1OMSA 2QMWA 1HHQA 2DISA 5LXYA 2JSXA 3D6TB 3FQLA 3W65A 2W9CB 3V6HA 1DQ9A 4MMOA 1UW4A 2KFZA 1YVFA 3R5DA 3G87A 3DCAA 2MQPA 5T14A 4TU7A 3CCLS 4PYDA 2Q1LA 5ETNA 1ZM4A 1S6QB 1X9WA 3F73A 4ED7A 4EBCA 2C3OA 4O44B 3K17A 1H73A 1PILA 4KY3A 4BWJA 2RH3A 4V1Ak 2LEPA 1N33F 5ADZA 2XQCA 3TP2A 1CC8A 5HQ8A 2VBYA 3DM2B 5DETA 1FX4A 2MYFA 2V2QA 4DX5A 2JLGA 2AIRB 3BGUA 5L1KA 3M8PA 3MI7X 5F9NA 2VHGA 4XAKA 4DSKA 1WORA 2M9KA 2ZBRA 3IO1A 3MAAB 2MQ8A 2O1PA 4QPTA 4NMXA 4RBTA 2GC8A 4ZCMA 5A8KB 4CH0S 4Q8EA 4FZVA 5H9FK 1JMTA 2GCFA 3RTVA 3JAMY 1RCOB 3JTNA 5AE1A 1EQ0A 1VJWA 1RU2A 3CJ0A 5ETKA 1BGXT 4ZDNA 2BVZA 4QYZK 2EC2A 2QLXA 5IM0A 1RTDA 1MMNA 1RTIA 1V5VA 3BKTA 4OYBA 1SV5A 1W2IA 2BE7D 3HHLD 4PG5A 3TVKA 3V6DB 2L41A 4DV2F 3A8IA 3G96A 1QSSA 3DLLQ 4JI2F 2H5EA 2XMTA 3IG1A 4KGZB 2Q66A 3TQEA 3DRSB 4PABA 1N5QA 2LDYA 2KHCA 4DU7A 3W9HA 1S9EB 3PJ9A 1Y5IB 1JLCA 4NLDA 3N0VA 2GZOA 2WSCC 4E0DA 1ZTTA 1QD1A 1VQPS 2ASDA 2L48A 1T94A 3VZHA 5FLXY 2HNYA 3W5ZA 1X5SA 1OO0B 2BRKA 2V4JA 3KG1A 2AJ4A 3MMBB 2HQDA 5B0GA 5HMXA 3J80Y 4DPUA 3V4IB 3CJ3A 4B3TF 3P49B 2AZ1A 4KGMA 1CJKB 1H2UX 2LEBA 4H4MA 3KK2A 1VBYA 4IR1A 1VJQA 3LGNA 4MK7A 2DR8A 2APOA 5B08A 4IFYA 2YKNB 1GX5A 4DR6J 1TV6B 2J6UA 5C25B 2MHNA 4FKXA 2M70A 2GIRA 4RR5A 1P9YA 1RWNB 2DPIA 1N32F 3BBBA 5IFMA 4UZBA 2ZH5A 4G1PA 1OIAA 3GZ7A 4JI8F 2BJEA 4PPZA 2UVRA 4C11A 1RWKB 3SQGA 1BUXA 3VR1A 4IUFA 4J9UE 1T7PA 1UJ4A 2HG4A 3FCWA 3R5CA 5D0RA 3KHLA 1PO6A 1IBMJ 1S9GB 1KLMA 1RKIA 3M1VB 3ITHB 3TZYA 4C8LA 1YJUA 1X5PA 1R89A 1TL1B 1LOUA 5D78A 3PEHA 4RNNA 2HHPA 4WIQA 4QWEA 3MAAA 3N6MA 5KFLA 1CJTB 3OR2B 3QLHB 4IH7A 3W8GA 5GMKa 3AJDA 3H4BA 5A8KA 2VC0A 1R0AA 1J27A 1Y7PA 2W1BA 4JBCA 1G1XA 2OPQA 4PWDA 4N77A 2M7SA 3BV8A 2ZM6J 4NYOA 5D6GA 3PACA 3EPIA 4U67Q 2MQMA 2G1DA 2KFYA 4OYMA 1S9FA 3PKYA 3FEYB 2XCAA 5KFBA 1N5YA 2DRBA 4KPCA 2JDJA 1RTIB 3HSJA 1SV5B 1NSKL 5B0CA 5M2UA 2HFZA 1MWYA 2FZCB 2HQCA 3A13A 2CNLB 1SJ1A 3IG1B 4YY3J 2CJAA 1QY7A 3G6ES 1C0UA 4PWUA 3QWPA 2HPUA 4CLWA 4LMZA 4DR2J 3SXLA 5KFAA 2JJ4D 2RNEA 3D6FB 3HHEA 4W4MA 5H9FJ 3PJXA 2GQ2A 4ED3A 2MZTA 1HNZF 3R1HA 3K8VA 1B7FA 3EX7B 1K44A 2HZCA 3H98A 4Q2MA 5M2RA 1T8EA 3DDNA 5KFTA 1NK7A 2AJFE 4L76A 1JXEA 1IQTA 2DGOA 2OPPA 2J7UA 2PMHA 3OL9A 2LECA 1HWUA 2G2YA 5KG6A 1RHMB 4A4JA 2CDRB 5LXRA 2V67A 3V6KA 3H8YA 4LIWA 1WWHA 2D3UA 1O0PA 3DI6B 2PO4A 1SL0A 2NPFA 3I5CA 4C8NA 3DLBA 2HRUA 4X4QA 3EVWA 2V9KA 2RIJA 1UFKA 3JYTA 2CPJA 3T41A 3DLKA 3ZZOA 1ZZFA 2BANA 3NBPB 3DNCA 2Y0SD 4NZ6A 3J81Y 2EVZA 3PRDA 4WBFA 5E2QA 1CQNA 1VQSA 1DTQB 1PKUA 4I7FB 5IV4A 3NS5A 1BE4A 5D3GB 2P8IA 3N9UC 2XGQA 4B9MA 2E9TA 1HLWA 1JNRB 4UUXA 3GFHA 3M1VA 3DMJA 2CQ3A 1J5EF 3BSAA 2QT7A 2QLBB 4QYRA 5THWA 3HJFA 3D2WA 2QEXS 4C9DA 2HQFA 5L8RC 4UOGA 4N47A 3OR2A 1E6VB 3I96A 4OYAA 1IJEB 2ZVSA 3N5FA 2M8HA 1WHXA 2GVDB 3CT9A 3I9ZA 4M1KA 1F6TA 2MQNA 5HK4A 3UNGC 5I3QA 1QSLA 1WKKA 2IRUA 2LQJA 1N33J 1EAYC 4UF4A 2GJFA 4P75A 1EQMA 5A8WB 1NDLA 4WFYA 3RJMB 2XCPA 4NRTA 2PC6A 3KUHA 2KRRA 2Y8YA 1R8HA 1XMBA 4CM2A 4MKBA 4R0EA 2Y0BB 2EEYA 3G6VA 3MD3A 4FVMA 2BDPA 5HROB 2MB0B 1VI7A 3OHAA 2M5YA 1RTJA 1AZSA 2DHHA 4RNFA 1B0VA 4F26A 4WXOA 1Q5VA 3R27A 1FRLA 1S57A 2KN4A 1SCJB 4LT6A 2Z2LA 2MXYA 4ZVEA 3LANA 5H1SV 2OGUA 4PWWA 4DG1A 3KK1B 2LQ5A 3FK4A 3KG0A 2XZDB 4ANDA 2VJVA 4ECVA 2ASYA 2W2NP 2X3GA 3UD5A 2FJWA 3FMBA 2DIVA 3IAS9 3QGGA 3AT1B 3LALA 4K4ZA 2UUWA 1SIZA 3CNQP 4B9UA 3E51A 4WKYA 2CJQA 2XYPB 4RW7B 1V9OA 2KB2A 1W26A 2Z4PA 3FFIA 1QDUB 3KLHB 3C3LA 2G2OA 3FRYA 4QW9A 2J0XA 4QPXA 3UD4P 2MZSA 2A6OA 5MAOA 5JMNA 1HNZJ 3T1HJ 1WF1A 4NLQA 3RW7A 3J7YI 2W7PA 1WNEA 3I4PA 4OQJA 1S48A 3JQMA 1H74A 1EJ7L 2OMOA 3E01B 1C1CB 4TVAB 2VFSA 1WC1A 4ICLB 4ZVHA 4DR5F 1GNKA 2OEMA 1VLOA 3U1NA 4RKUC 4C8MA 1WI8A 5KFKA 2PEHA 3H25A 1U8SA 2BQUA 4KGVB 1RAHB 2GMLA 2KKHA 4H54A 2GO9A 2W8LA 4PUOA 1YBTA 4UOCA 3OLBA 3IRWP 4F8RA 3MEGA 3BGRB 2I6WA 1J5OB 1I6JA 3IM9A 4IDKA 2CA9A 2OP5A 1OPIA 2WONB 3NRBA 2K7JA 3I0SA 3F44A 1S1WA 2V8PA 3ILLA 3LWLA 2AEJA 2NXEA 4DX8H 3JB9k 3N01A 4FYVB 2HKEA 3HSGA 2LKZA 2MQQA 3G8TA 1EKSA 2GVZA 2J9DE 4UQTA 1NCLA 1X4BA 5KFEA 4P71A 4LF4F 2ADCA 3MTJA 3TANA 3HSZA 3ZC4A 4C6AA 3VZIA 3RBZA 2OFHX 4C0OC 3J81U 2RU3A 4LR7A 1WEYA 2KT3A 4N56A 4DDFA 1Q81T 1IBMF 2ZUGA 4RL1A 5F8JA 2CQ4A 1CPZA 1WJ9A 4Q5VA 4LFAJ 3T6BA 4DV5J 4EBDA 1LEOA 1F1BB 1S1TA 1A9NB 2Q6CA 1WSRA 4N5SA 3CDAA 1TQLA 2QYGA 3UNYA 4CO2A 4LSZB 1KS2A 2WOMB 2ZKTA 2B3TB 2CJKA 2W4PA 4DZDA 3UR3C 5DZ7A 4HHHA 3FKBA 4HR2A 2DJWA 2OPRA 4DG1B 1T3OA 1VRUA 4LBIA 3GTYX 2W2PP 3U1LA 4GKJF 3I56S 3MPUB 1RT7B 4EBEA 2R8GA 4QCLA 3M9MB 3E2EA 1S12A 2AYEA 2MZQA 2RD5C 4MYUA 2XWYA 2R4FA 3CSKA 1D9FA 1NZAA 2C42A 3VV2B 4RW7A 1JX4A 4ED5A 3KKFA 4OJGA 2B51A 4ZPTR 5KG5A 2UXDJ 3QJPA 1JLBA 3W9JA 2LQ8A 1PCAA 4ETZA 4FXVA 2IVFB 1XERA 2M4MA 3SV4A 4KPYA 2EC0A 4OHXA 2FHJA 1JJCB 3PO5A 1WTBA 2AHOB 2X3DA 2XS5A 3BN4A 5EGYA 2W9BA 1IM4A 5CYQB 4ZHRB 4HI2A 1DTTB 5CXTA 1J5EJ 2MY7A 4RBVA 4C8OA 2KJWA 2NZ4A 3T9NA 5BR8J 3DLEB 2JEIA 3KLEA 2VOOA 2WK4A 4IH6A 5AJ3F 4U9RA 4X4NA 3TAMB 3LP1A 3DHWC 1IVZA 3MEGB 1B4SA 3AB4B 5E33A 4DBQA 1RT4B 3BSCA 2IC3B 1WG4A 2E1RA 1TKTA 2MKCA 1Q0NA 2FY8A 2QC3A 3QIDA 2YKMA 3RR7A 1UJ5A 1WC3A 3CDUA 1SJFA 3LUYA 2D1CA 2A18A 2RRNA 4KH1B 4LUBA 4YB1P 1BXNA 2NCKL 4U7UK 3PR4A 4OJHA 2B9XA 2BJ9A 2DNKA 1EKRA 1PJ5A 3OQ2A 3C15A 1IBLJ 1H98A 1XR6A 4OX9F 1RAIB 4USVA 2QA4S 1U4BA 4AD6A 2QMXA 5E7OB 2R2RA 1GMWD 1FI4A 2BW2A 4ES2A 4QBUA 3H5YA 1T9UA 2YVSA
chains in the Genus database with same CATH topology
4Y2MA 2AW0A 3PEJA 5GVQA 4AFFA 1MMDA 1RA6A 3RZAA 4UQGA 2WOMA 4B17A 5DDQC 1UP1A 1VQYA 3CJ5A 4RUHA 4IKAA 1V6HA 4NX9A 2XBPA 1XWLA 1VQMS 3EGWB 2EI5A 4KHRA 2R7UA 3NCPA 3BS9A 2JEFA 2X1AA 4Q44A 1U48A 4LVOP 4ELVA 1GXLA 3J7A1 2UUAF 2IJFA 4RLEA 1ZM3A 1HA1A 3KHGA 1SUQB 1BQXA 4GC6A 1SL1A 1YG0A 3K57A 1ZETA 4J9PA 3NMAA 3LP0B 1HNIB 2AF6A 3D0IE 4QQBA 4A47A 1E6YA 4A8OA 4B3SF 1KHWA 1R6YA 1Z2LA 3LF0A 2J9EA 2FJDB 4IRKA 4JI7F 5DG9A 4JI0F 3QJPA 1HWJA 2GMHA 2B7BB 3IS9B 1NKCA 4I6WA 2DHSA 2Q43A 3BR9A 4RU2A 1Q4RA 2DITA 5KT5A 1MWZA 3P5TL 3NCQA 4FP9A 2CQBA 3PFOA 2YQ3A 2ZH7A 1IN0A 1T03A 3CE8A 2QE5A 5I3PA 3I5BA 4NLRA 4O3OA 4F4YA 3UR0A 2YNFA 1VQ4S 2LA4A 4PR6A 3K8WA 3HHLB 4GKKF 1VHFA 1HWLA 2JLEA 3HO1A 3BGLA 2R7VA 4DJBA 3M6WA 2HW3A 2UVVA 3EGNA 4YP3A 4DUYF 4EUVA 3TUZC 1KTVA 2DHGA 2RF2B 4EO8A 2CJ9A 3WC2A 4NLTA 2HIQA 4J9RA 3M2UB 1ZM2A 5T41A 1Q79A 2V4QA 3PW7A 1Y0HA 5IT9Y 2NS1B 2WCXA 3MTKA 1FHTA 4NLOA 4WXWA 4R5PB 4XO0A 4EZ6A 4WTYA 1FE4A 3G71S 4WFAQ 2KM8C 4WF9Q 4RW9A 1URNA 3I32A 3G6XA 4JI1F 1CLFA 1WACA 3OV7A 2W7AA 1HNWF 1FD2A 1JJHA 4LSNA 2BE2A 5GAHI 4YB7A 3D54A 1M5VC 3DRRA 3D1HA 4KO0B 4N8OA 2CQHA 3DYAA 3K2YA 4PXEA 4LF8F 2DH7A 4DS5A 3T5KA 1RT1B 3T19A 2E7WA 1NJYA 1UVJA 4B3OA 5L39A 1V3SA 3SDEA 4URGA 1U1MA 2XY5A 5D4LA 4RNHA 4IOCQ 3FZBA 3CCZA 4IOBA 4HDGA 3MM7B 2D9PA 3MR3A 4JI6F 2DHXA 4QOTA 2YTCA 5F8IA 4Q0BA 2ZJPQ 2PT0A 3AH6A 1JLFA 3OFEA 4NLYA 5C42A 4M5DB 2B4OA 4NL5A 3AJ2A 5G4DA 1S0NA 4NXNF 3RAQA 2ROPA 1NRKA 4FPRA 3CMES 1VIOA 3Q8QB 2FY1A 5LT5A 4OMFG 3K7RA 2E29A 3T3FA 1UKUA 5JVGQ 4DR3F 3B8HA 1XNRF 5EX0A 2CVEA 4ZS6A 1WEZA 5KFUA 4D3GA 4W92B 7FD1A 1YTYA 3KNAA 4USJC 1S1VA 4ALZA 1VQ5S 1T05B 1HBNB 2IHR1 5IT0A 1HBMB 1U45A 4M95A 2QIFA 3U7JA 1U1OA 1HBUA 4I4BA 2XNQA 2LXFA 4ZPVR 2B4UA 5J2MA 1QLNA 3RW6A 2AJQA 4NCAA 2KXHA 4PG7A 2PFFB 3KWMA 4KKOB 2Y1IA 3ZZPA 2UZAA 3V81A 3DLJA 3OW2R 1R8PA 4LF6F 2DVIA 3FNNA 4DHVA 1JLQA 2J76E 4N76A 5HI7A 4ED0A 2WRMA 2YNHA 3BSNA 2CJBA 2IRYA 3AAWB 2ZDPA 1F0XA 2JZ5A 2VG7B 3L7OA 4QIGA 3KMSA 2AQ4A 2CPXA 3IR5B 4H4OA 4OX6A 3CPWR 5DRKA 4KO0A 2CPHA 4DL7A 1S10A 3CEDA 1RT1A 3DRPA 4DR7F 1RP5A 1HPZA 1SI9A 1QTMA 3NG8A 4NLVA 5DJBA 2E7XA 2ZBCA 2V8GA 3TA2A 4M63A 2XC9A 3VALA 5CHCB 4FF2A 2ASLA 3MM7A 3OFGA 3IXQA 2R8KA 1UVNA 1L3TA 2ZNYA 3MZIA 2VODA 2GA7A 3LGMA 1UFLA 4K5RA 3MM5B 4RX6A 2RQMA 2DNMA 4RWWA 5KG4A 1FKOA 4DL4A 2CPZA 2HNZA 3PRBA 4USHA 2FHJD 4MJKA 4WK1A 4R8UA 2XG8A 3RAMA 1FNOA 1FRIA 2BUNA 5FDLB 3CJKA 1K0VA 3BQ2A 4ECSA 3M2VB 4OI6A 3KLGB 2MKKA 3MPYA 2D3ZA 1HBNA 1U26A 1AFIA 2WB4A 1HBUB 5J2MB 2ZH1A 1FO1A 4C8YA 1LWCB 1TKXB 5CZXA 3T5JA 1X7VA 2FJVA 3DU6A 1FE0A 3X1LB 3B78A 2ZFHA 2XLIA 3V81B 4DL2A 2HFNA 2XI2A 5KFQA 1HL6A 4N41A 3DOKB 1OSDA 1S0VA 2B0GA 1R31A 4MYTA 4I0WA 4NZ0A 4DL3A 4ZCIA 3C46A 4FXDA 4QYZJ 1URRA 1KONA 3RU0A 4DFMA 3I4HX 3S7RA 1IKVB 4NPOA 3M2RA 2ILZA 2ZE2B 2VG7A 1K8AT 3HKWA 5B09A 2DHAA 1S6UA 4CH7A 2G9OA 2RJZA 1YBAA 3MEEA 4O44A 2DH8A 3X3UA 3ULHA 5HMWA 5DM7Q 3DM2A 3NAIA 4DQRA 3THTA 1S1XA 3M8PB 2E66A 4ILMA 4DQQA 3J7Z5 3OPKA 2R7SA 4WU3A 5FJ4A 5KFMA 3LWMA 5KFHA 3GYXB 2N3OA 2HLTA 2OIHA 3TA1A 1YITS 5DQGA 4OZLA 5FIIA 3MR5A 4NA3A 2LCWA 3M30A 4AL6A 3R5BA 3C6TA 1JNZB 1EP4B 2FHKA 3RR8A 2DO4A 2ZOGA 4DWIA 2XS2A 2VQEF 3HT3A 2KVIA 2CQ0A 4UY85 3US5A 1DLOB 3EXCX 3TAQA 4LF7F 2CPIA 1OSCA 1H6KX 2B56A 2A1BA 5GAGU 1VBXA 4OFZA 2Z0GA 1DQ8A 2Q3PA 3Q8PB 4WK3A 5JVHQ 5H9EJ 1JLCB 4ZOSA 2XMMA 1ROFA 1HBOB 2YH0A 1KOHA 5HBMA 4DSEA 4XPCA 3KLFB 4F2SA 1IKWA 3QIPB 2EPIA 3Q24A 3NMRA 4IFYB 3C6UA 3NP5A 3EZUA 4DSJA 5KG1A 5GAEU 1BQMB 3NS6A 5DLFA 2HMIA 1M5SA 2C28A 1IKVA 2AYGA 4X4SA 4ID5A 3GFXA 2JVOA 4L3NA 2B4PA 1LFWA 3SCKE 2W7OA 2VFTA 3MEEB 3PFEA 1RISA 2FGOA 4QWCA 3MUMP 2CQ1A 1TAQA 2P9CA 3MMAA 4NA2A 3GR1A 3C66A 5KFXA 3HVWA 2OD4A 2AGOA 4O3PA 3F41A 5AXMA 3BO3A 4PCQA 1WTFA 3EXYA 3MECA 5GAEI 5J1EA 1ZTWA 2HHQA 3D28A 3UW1A 1U1NA 4GO7X 2HNDB 1FNMA 1RT6B 2DK2A 2GGPA 3Q23A 4CIOA 3ZZ0A 1HI0P 3KK3A 2KG1A 4K4SA 3MOZA 2VH7A 4KJIA 6FDRA 2QZ8A 1O5JA 4EO6A 4IRCA 1FF2A 4MAKA 1S49A 3UWTA 4OI2A 5A8RA 2ZZMA 1Q8IA 4A8QA 2F3JA 3IC1A 3Q22A 2BA9A 2N7YA 2A10A 3VAHA 2ZOFA 1NK8A 1UAWA 5ITHA 1KTQA 1S7HA 3DLHA 4F4WA 1YJRA 2IFXA 1NJWA 2UVWA 5GAGI 4URSA 1C1BB 5HN0A 2NQPA 1MROB 3LO3A 3J7YU 2YWEA 3ZZYA 2E1AA 5EWEA 4ZP8A 2WTFA 4DSFA 2MQLA 2VKRA 3QZ8A 4B9VA 1FJCA 1AUDA 1VIXA 3CD5A 4J5OA 1QUPA 4H4MB 4DLEA 3QJLA 3JSYA 2DT9A 3E3XA 2HQIA 2V9WA 3JYTB 1R7IA 1BQMA 3PX4A 1NKEA 1RWUA 5IXUA 2N4DA 4B02A 5KFVA 3BSOA 4ID5B 4FVCA 3GG0A 4IO1A 5IT4A 3PIPQ 1NK4A 5E3AA 5J2PB 5I42B 3OVAA 1V3RA 1S9GA 2OPSB 4A48A 2BQRA 1KFSA 4TY9A 4DR4F 4OI0A 1TL1A 1C2PA 2IA0A 4H4KC 2B9YA 5AXNA 4ECYA 1TK8A 1Y3KA 1LW2A 4YOEA 1TFWA 1SJ3P 1M90T 5HP1A 3W2WB 2GGPB 4YR2A 1ZBTA 3KK3B 1IUJA 1H0HB 3MWBA 3HXMA 1GQEA 2I38A 5A6PA 4NXMF 3G6YA 4OZNA 2GX8A 4PXBA 1FRHA 2M0GB 2W8KA 1HYSB 4LQ3A 4XIUA 4J9QA 4ID8A 1HHSA 3TX8A 3RRGA 1FNXH 3PHEA 2RMLA 2DPJA 4AXJA 1P9QC 3I0RB 4FF1A 4FBTA 2R7XA 4KC5A 5HO4A 4NWBA 4O4GB 1Q16B 5K8OA 3KJVB 2WSEC 1N54B 3WC0A 2CQIA 2VASA 3QYYA 4A8SA 4Y2AA 3NWGA 2CG4A 2FLLA 4TXSA 4DV3F 1RGVA 1JK9B 3E8OA 4PQUA 1NK0A 2R9LA 2E5IA 4ECTA 1VQNS 1PSDA 1YWXA 4YEAA 1OPZA 4QWDA 2XSJB 4IG3B 3HHKA 1WG1A 5HL7Q 3CD7A 3KFWX 2G13A 2ZOMA 1TKDA 2ZKUA 2BANB 3NBPA 3HZEA 3PNIA 3POTA 5E3RA 3CCRS 4FXWA 4I2PB 4RBUA 2FIUA 4FNIA 1JJ2R 5IS2A 5J1PA 2O67A 2LVWA 2XB2D 3WX4A 1ZAXA 4NRUA 2O5DA 1LXJA 1WF2A 1X5OA 2OPSA 3SSQA 3DMJB 5AE2A 2GO8A 4PUOB 3MEDB 1K0TA 3K5PA 3MMCA 3GIIA 1U24A 2YX4A 3UCGA 1QAIA 3BM7A 2IYGA 3BGRA 1H7XA 3VAMA 3MCSA 3HHDA 3MXHP 1HNVB 2ZM6F 5DG8A 2BABA 3UD3P 2OJ3A 2UXDF 3CJ4A 3OJSA 5B7WA 1JKHA 3W3SA 1SBRA 3CF5Q 1T02A 1ELOA 4NLWA 2HLUA 2OH2A 5KG3A 5EX3A 5G0RA 1BD6A 4G1IA 3CXCR 2EFPA 4QIWD 3DOLB 2F1FA 3I0RA 3CCMS 1UVIA 3CCSS 4XDDA 2UUCF 4WFBQ 3NGDA 3GMGA 1LW0B 1FCAA 1GTEA 4OZJA 2W9AA 3HVTA 3B4MA 1ZYQA 1RTJB 1IKXA 4QW8A 5I3UB 5DDRC 2MKIA 4JI4F 2E9ZA 3MOJB 3VF0B 2B9WA 2V8HA 4TNOA 4HL9A 4MH8A 1TL3A 2BRLA 4LFAF 1O51A 2IBOA 1P27B 1QVGR 4HKQA 1RT3A 2DNPA 2MJUA 4J9OA 4PQUB 1IR0A 4ECRA 2CVIA 4JYAF 1K73T 2EK6A 4I2QA 5F0WA 3RBDA 3NL0A 1VC5A 4HTJA 2EFOA 3G86A 3HVRA 4ATNA 1NK5A 1F9FA 2XSJA 4IG3A 2E5GA 3FFIB 4O3QA 3J7ZT 3OTDA 3UI3A 1R27B 3POTB 4OZ1A 2UV8A 1HW9A 4Z2XA 5DGAA 3OLAA 1QVFR 2K8GA 5KG2A 3G8QA 1KC8T 2FHMA 2LQ9A 1HQUA 4NA1A 1VFJA 2XI3A 5IM0B 3I31A 2W9BB 4Z37A 1UA0A 1DTTA 4RW4A 4DL5A 2J0QD 4KHPF 5J2NA 4Y6IA 3TVZA 1CG2A 4MIAA 1RT2B 3Q2SC 3GB0A 4C3MA 2VOPA 2DNHA 3MEDA 3L95X 1GT8A 2UXBF 2E5JA 2HGMA 2OO4A 3VQSA 1OQ6A 2Y1RI 4HYKA 2IC3A 5DS7A 2RB7A 4JOUA 4BC7A 3TQ1A 2YNGA 2N3LA 1KEKA 1YHQS 2V0NA 2HRYA 3IBWA 2R7RA 2L3MA 2WONA 1KVJA 1C4CA 2DD8S 6FD1A 2HWTA 2PDAA 3I0SB 4K0KF 4X4PA 1G3OA 3FSXA 2E5HA 1DFDA 2WSFC 3GV5B 2Z2MA 5F3ZA 2PI4A 3KK2B 1D3WA 5LJ3Y 2UUTA 1MW7A 3I9V9 2HS3A 3N6NA 3SV3A 3PIOQ 5DG7A 3P3DA 3PW0A 1TV6A 1P1TA 4F3MA 3T9ZA 5C25A 2JL9A 3CIMA 1FRJA 4WZMA 1S1TB 3GR0A 3HVTB 4F67A 5I3UA 2HVZA 2O01C 4I64A 3ISZA 3LPYA 1UVLA 1VBZA 4YQWA 4IQMA 2NXUA 5F9LA 3VAFA 4ZP6A 1JB0C 5IZHA 1K1QA 2VBZA 4DS4A 3DC2A 5K8MA 3RB3A 2X1FA 2OPRB 3TW0A 4RW8B 2UXCF 2KU7A 1AROP 5KG7A 4HLBA 1TVRB 1XEZA 1FXRA 4I1TA 5LL6d 4I2QB 3MR2A 3HLUA 4OHZA 3OSNA 4LSLB 4B08A 3JTOA 1M5KC 3KOAA 3U1MA 3AA9A 4KT0C 2BBEA 4TQSA 2DGTA 5J2QA 1Q7LB 1H3DA 1G2EA 2M3DA 4ED1A 3IS9A 1DRZA 1S99A 3I87A 4A8FA 4G3IA 4X65F 4EU0A 5CYQA 4ZHRA 5AE3A 1HI8A 4TLQA 2JRSA 1KNZA 2WHOA 3GYNA 2CPYA 3OSPA 3M6UA 5LSRA 2ZC4A 2COLA 2XS7A 3IA0A 3LP1B 5CQGA 4CT9A 5KT3A 4G1QA 1LWFA 1RT4A 1NU4A 1JWWA 4F2RA 5T7LB 1REVB 2C3MA 1LV5A 1TL4A 4O0IA 1HARA 3BN7A 1VRTA 4U7CA 2KH9A 2FPHX 1SH3A 2EFQA 2AWZA 1FKPA 2I0XA 1RA7A 2XSFA 3MM6B 1H2TZ 3OXGA 4OLOA 2MSSA 5HMYA 4Q8FA 3UQSA 4B9NA 4AUKA 3DI6A 1TL5A 4R5PA 3PZPA 2VBWA 3EYZA 1SKRA 3IN5A 4C8KA 3TI0A 4RW6B 3H59A 3MGJA 4HDHA 4NLUA 5LSLA 4NLXA 2RRBA 2UP1A 3GFZA 2ZJRQ 3NCRA 4I7FA 1DAXA 3CMAS 2DR7A 4OX8A 1APSA 5D3GA 3SSRA 3TA0A 1UJ6A 2KM8B 1TUVA 4RW8A 1X9SA 2M52A 3N4WA 2ASJA 3RRHA 2DNGA 4CNZA 1NJIT 2XLJA 2VD3A 2X1GA 2RQCA 1RI7A 1E6VA 1XR5A 4X4RA 3CB4A 1E6YB 1HW8A 1TK0A 2ZH4A 3CDWA 2DNOA 3BDEA 2YKQA 4P6QA 3MFHA 3FQKA 1WI6A 4I68A 1F5CA 2J0SD 4KRWA 4DFJA 1VMBA 4DQIA 4PKDB 3D1OA 2UV8G 2XY7A 4NCGA 3NAHA 5SZTA 3FJ2A 3LAMA 4G1QB 3PW2A 2CKWA 3QPIA 5CA5A 1V3ZA 5KFRA 4RUAA 4M8LA 2K7KA 5T7LA 2RKIA 2IMOA 1JLAA 1M0SA 1FRXA 2F9JA 3C2PA 4EGLA 1HWIA 2HHHF 4DR6F 2RF2A 3MM8A 2D9OA 1SB6A 2YWHA 2ZC3A 3MM6A 3HFKA 2PA8D 4OIXA 1YJVA 4ZVGA 2LLZA 3DN9A 4K59A 1N5VA 4X64F 3M9OB 1H38A 2MKSA 4JV0A 4PQAA 4C98A 2C2DA 1R3NA 2KTQA 5KFSA 2VFUA 5KFCA 3OR1B 2YNHB 4DOZA 2JEGA 2JX2A 4NYPA 4LIRA 3OJUA 4CZCA 3W2VB 2IVYA 3M6VA 4BWMA 2R7WA 4BHQA 4ELTA 3GSDA 1XBWA 3N6LA 4IO9Q 4YR3A 3KNGA 3MDFA 4KFBA 4F25A 1Y00A 3HP6A 4C97A 3DRRB 1UL3A 1U1RA 5DQIA 1Q53A 3DYAB 4HT7A 3DRPB 3H4DA 1JLEB 3CDEA 4GC7A 1BLUA 1TKZA 4J37A 2FVRA 4O3SA