3J81g

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 49
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j81g01
3EI1B 4QL1A 4JD2C 3PVWB 2AH1A 1L0QA 4BUJC 5EMKB 1N6EA 1NR0A 3I7OA 4LG9A 5CXBB 4FWWA 4PSXB 3N0EA 2IUPA 4D6VA 3SN6B 5HE2B 3EMHA 5GSAA 2B4EA 5AFU3 4GGCA 1XHMA 3EI4A 2Z2PA 2IUVA 3JRPA 4PXWA 3RLMD 1XKSA 3MMYA 2I0RA 2AGYA 1YFQA 1Q47A 2OIZA 4FAVD 4JSNC 5AJAA 4I79A 1N6FA 2XL3A 2I3TA 1PEVA 5FA5B 3OW8A 2P9SC 5GXIA 3L4OD 3UVKA 3RMZD 4FAND 1PBYB 5B4WA 3SJLD 4GMBA 4CY5A 3C99A 3NVNA 3EI4B 3F3FA 3PXWD 2EBSA 3GFCA 4FB1D 3SWSD 3UVLA 4Y5RD 2PM9A 4Y7RA 3SBQA 3J81g 2HXCA 3OL2B 5EAMA 4BH6A 3CFSB 1VYHC 4GM9A 3F3PA 3UVMA 1K8KC 2XU7A 2CO0C 4J78A 4U1EI 3L4MD 5FKQA 3IJCA 4N14A 1P22A 3UVOA 1R5MA 2CN2A 2H47A 3AFCA 2YNOA 3SBRA 5SXMA 3ULEC 2PM9B 2Z2NA 4O3TB 4BL0A 4G56B 2IUQA 2CNXA 1JJUB 3NVXA 4CZYA 3I2NA 4FA1D 3I7KA 4GQBB 2PBIB 1TYQC 4FA4D 1JOFA 3I7HA 4FA5D 4J84A 3K26A 5H1MA 1FWXA 2P9UC 4U7AA 1SQJA 5JWZA 3MZKA 4OWRA 4J73A 4QRJA 2HESX 4K3JB 4PBYA 4GGDA 3E0CA 3PSCB 3RFHA 3B7FA 3ORVD 4PNKB 3CIKB 4JT6C 4AEZA 1RI6A 3BG0A 4ES0A 4CZVA 4QQEA 4J77A 1NEXB 4A0AA 3JZGA 4GM8A 4E54A 2OJYA 1B9YA 1SHYB 2H9PA 3DM0A 5IC7A 5EALA 2GC7A 1XIPA 5TEFA 3GREA 3RFGA 5FKTA 3DSMA 3OTTA 3SHFA 2H14A 5I5JA 2P9LC 3C5MA 4A08A 4JXMA 3VGZA 4CY3A 4ZOYA 4CI1A 3BG1A 4GM3A 2BBKH 2Q7QA 3I89A 3BWSA 4O1QD 4A0AB 2P9IC 3N0DA 4E54B 4AOWA 1TBGA 3OL2A 4L3HD 5H14A 3EI2A 2CO0A 4UI9R 4J87A 3AL9A 4GZ8A 5IGOA 1PI6A 3IIYA 4IMMA 4JT5C 3I8EA 5I5IA 3JZHA 1B9XA 4CZXA 4A08B 2UZYB 2GNQA 4ERYA 2H9LA 2HYEA 2I0SA 3RN1D 4LG8A 5THAA 3MKQA 4ERQA 5TDHB 4FHLA 4ZN4A 4A0BA 5HYNB 2PM7B 2HKRA 3EI2B 1JMZB 4J8BA 3SCYA 4L1QD 2H6KA 4X60B 4OZUA 4IA9A 4H5JA 2H68A 4ZOZA 5EARA 2J55H 2G9AA 3JZNA 3UKRC 2OVPB 4A09A 3PVUB 2YNPA 4J79A 1OMWB 4GQ1A 2AGWA 4E5ZA 4A2LA 3OKWA 3IKOA 3PXTD 4J8GA 5C9ZB 5AMSA 5TEEA 1JMXB 3ODTA 4A0BB 2OVQB 5H17A 4O9DA 5HE1B 5K1CC 4R7AB 3IIWA 3JROA 5EM2A 2H9MA 3V5WB 4PC0A 4ESGA 4D0KA 2AH0A 2G99A 3P4FA 3FRXA 4A09B 2XL2A 3OKYB 3K27A 4CI2A 2AGZA 3EI3A 4J81A 4E5ZB 2CN3A 2OK4A 4H5IA 5EMMB 4CI8A 3SVWD 4L9OA 4JSXC 4X63B 4L3GD 2B5MA 4LGNA 3I8CA 3U4YA 2H13A 2UZXB 3F3GA 3FGBA 5EM2B 2QC5A 4MK0B 3RSEC 1N6DA 2BCJB 3UR4A 3JB9L 4GQ2P 2YB8B 3JAMg 3AL8A 5IGQA 2QXVA 5GXHA 4A2MA 3EI3B 1MG3A 4CI3A 2OK6A 2GC4A 3A0FA 2CE9A 4CY2A 2MTAH 3DWLC 5KDOB 4YVDA 5EMLB 3VA6A 4ZOXA 3RRMC 2AGXA 2W18A 1GXRA 3I7LA 2HJBA 3KRWB 3EG6A 3C9CA 4CC9A 1OLZA 1A0RB 4GGAA 2P9PC 2YNNA 3AL8B 4TZ4A 5FQDA 2IURA 4XYHA 3J80g 3I7NA 1K32A 3AH8B 4J82A 5C2WB 2XYIA 2P9NC 3PSLA 2CE8A 3DXKC 5CXCA 3ZWLB 5HE0B 4PSWB 2B5NA 3V9FA 4K3ID 1GP2B 5A2Qg 3IJ0A 3W15A 1MDAH 3UKUC 2IWKA 3RN0D 4X61B 4JSVC 5HE3B 4FA9D 3VH0A 5I5MA 2AQ5A 5EMJB 3EU7A 1U4CA 3SMRA 2HJ4A 2J56H 4O45A 5FXYA 5CYKA 1GOTB 1SQ9A 3CFVA 5FLXg 3MKSB 3OKYA 5GMKn 1GG2B 5CXCB 2AGLA 3PE7A 2I3SA 2H9NA 3SBPA 2I0TA 4XEIC 4J0WA 3DXMC 1U2VC 3FM0A 3I7PA 5FKSA 3SLED 3SXTD 4A11A 4PBZA 2TRCB 4O3UB 3NVQA 3V7DB 5C2VB 3EWEA 5HQGA 1PGUA 4ERZA 1QNIA 3C75H 4EWRA 2H6NA 3KRXB 5TF2A 5IJ8E 4XYIA 5CYKB 2H6QA 5FKRA 2P9KC 4QT8A 3JPXA 3EI1A 4JSPC 4A7JA 4J86A 2YMUA 2IAAA 5IT9g 5EAPA 4J0XA 2H3XA 4X3EA 2YBAA 4KFMB 3UVNA 4A11B 4NSXA 5CXBA 3MZLA 4HDJA 4ZOVA 3PXSD 1MG2A 1ERJA 2O9KA 3HFQA 2OVRB 3SFZA 3OKTA 2PM6B 2HKMA 2IWFA 2Z2OA 4Z8LA 5K19A 2B5LA 3MXXA 2J57G 3IJ1A 4CY1A 1S4UX 5IJ7E
chains in the Genus database with same CATH superfamily
1H2ZA 3EI1B 4QL1A 4JD2C 3PVWB 2AH1A 1L0QA 4BUJC 5EMKB 4JHPC 1N6EA 1NR0A 3FCUA 3VI4A 3I7OA 5E6RA 4LG9A 5CXBB 3ZDXA 2VZ1A 2VDKA 4FWWA 4PSXB 3N0EA 2HU7A 2IUPA 4D6VA 3SN6B 5M5VA 2EIDA 5HE2B 3EMHA 2VDLA 5GSAA 2B4EA 4MMZA 1BPOA 4DNUA 5AFU3 4GGCA 5HDBA 1XHMA 3EI4A 2Z2PA 1GOGA 2IUVA 3JRPA 4PXWA 3RLMD 1TYEA 1XKSA 3MMYA 2I0RA 2AGYA 1L5GA 3QI0A 1YFQA 1Q47A 2OIZA 4FAVD 4JSNC 5AJAA 4I79A 4NAAA 2QZPA 1N6FA 2XL3A 5M5RA 2I3TA 1PEVA 5FA5B 4RE6A 3OW8A 2P9SC 5GXIA 3L4OD 3UVKA 3RMZD 4FAND 1PBYB 5B4WA 3SJLD 4GMBA 4CY5A 3C99A 3NVNA 3EI4B 3F3FA 1E8MA 3NIFA 3PXWD 2EBSA 3GFCA 1YR2A 4FB1D 2EICA 3SWSD 3UVLA 4G55A 4Y5RD 2PM9A 4Y7RA 3IJEA 3SBQA 3J81g 2HXCA 4WK2A 3OL2B 1JTDB 4AN1A 2XE4A 5EAMA 4BH6A 3CFSB 1H2XA 1VYHC 4GM9A 3F3PA 3UVMA 1K8KC 2XU7A 2CO0C 3DDUA 3K72A 4J78A 3L4MD 4U1EI 3V4PA 5FKQA 3IJCA 4N14A 1P22A 3UVOA 1R5MA 2CN2A 2H47A 3AFCA 4BCCA 4MMYA 2YNOA 3SBRA 4JHNA 5SXMA 3ULEC 2PM9B 2Z2NA 4O3TB 4BL0A 4G56B 2IUQA 4AX4A 2CNXA 1JJUB 3NVXA 4CZYA 3I2NA 4FA1D 3I7KA 1GOFA 4GQBB 4UM8A 3IURA 3ZE2A 2PBIB 1TYQC 4FA4D 2XDWA 3IUNA 1JOFA 3I7HA 4FA5D 4J84A 3K26A 3IUQA 5H1MA 3OF7A 3ZDYA 3GD1I 1H2WA 5M5UA 4MMXA 1FWXA 2P9UC 4U7AA 1SQJA 1H2YA 5JWZA 3MZKA 4OWRA 4J73A 4QRJA 2HESX 4K3JB 4PBYA 4GGDA 3E0CA 1QFMA 1T2XA 3PSCB 3RFHA 3B7FA 3ORVD 4BCDA 4PNKB 3CIKB 1QFSA 2EIEA 4JT6C 4AEZA 1RI6A 3BG0A 4ES0A 4CZVA 4QQEA 4J77A 3IUJA 1NEXB 2VDOA 4A0AA 3JZGA 4GM8A 4WJKA 3EQ8A 4E54A 1O6GA 1E5TA 1UOOA 1UOQA 2OJYA 1B9YA 1SHYB 2H9PA 3DM0A 5IC7A 5EALA 2GC7A 1XIPA 5TEFA 3GREA 2VZ3A 3RFGA 5FKTA 3DSMA 3OTTA 3SHFA 3ZDZA 2H14A 4BCBA 5I5JA 2P9LC 3K6SA 3C5MA 4A08A 4JXMA 3VGZA 4CY3A 4ZOYA 4AN0A 3NIGA 4CI1A 3BG1A 4GM3A 2BBKH 2Q7QA 3I89A 3BWSA 4O1QD 4A0AB 3IVMA 2P9IC 3N0DA 4E54B 4AOWA 1TBGA 5M5TA 3OL2A 4L3HD 5H14A 3EI2A 2CO0A 2VC2A 3ZE1A 4D9SA 4UI9R 4WK4A 4J87A 3AL9A 4AMYA 4GZ8A 5IGOA 1PI6A 3IIYA 4IMMA 4JT5C 3I8EA 5I5IA 3JZHA 1B9XA 4G1EA 4CZXA 4A08B 2UZYB 4NBMA 2GNQA 4ERYA 2H9LA 2HYEA 2I0SA 3RN1D 4WK0A 4Z7OA 4LG8A 5THAA 3MKQA 4ERQA 5TDHB 4FHLA 4ZN4A 4A0BA 5HYNB 2PM7B 4G1MA 2HKRA 3EI2B 1C9IA 1JMZB 4J8BA 3SCYA 4L1QD 2H6KA 4X60B 4OZUA 4IA9A 4H5JA 2H68A 4ZOZA 5EARA 2J55H 2G9AA 3JZNA 3UKRC 3V4VA 2OVPB 4A09A 4DNWA 3PVUB 2YNPA 4J79A 1OMWB 1E8NA 4GQ1A 2AGWA 3GC3B 4E5ZA 4A2LA 3OKWA 2HU8A 3IKOA 3PXTD 4J8GA 5C9ZB 5AMSA 5TEEA 1JMXB 3ODTA 4A0BB 2OVQB 5H17A 4O9DA 5HE1B 5K1CC 4R7AB 3IIWA 3JROA 5EM2A 5C86A 2H9MA 3V5WB 3NIDA 4PC0A 4ESGA 3T3MA 4D0KA 2AH0A 2G99A 3P4FA 3FRXA 3K71A 2VDPA 3O4HA 2XL2A 4A09B 3OKYB 4Z7QA 3K27A 4CI2A 2AGZA 1VE7A 1VZ3A 3EI3A 4BP9A 4J81A 4E5ZB 2CN3A 2OK4A 4H5IA 5EMMB 4CI8A 3ZE0A 3SVWD 4L9OA 4JSXC 1GOHA 4X63B 1VE6A 4IRZA 4L3GD 2B5MA 4LGNA 3I8CA 3U4YA 2H13A 2UZXB 3F3GA 3FGBA 4UM9A 5EM2B 2QC5A 4MK0B 3RSEC 1N6DA 2BCJB 3UR4A 3JB9L 1UTCA 3MVDK 4GQ2P 3IUMA 2YB8B 3JAMg 3AL8A 5IGQA 2QXVA 3T3PA 5GXHA 4A2MA 1VZ2A 3EI3B 1MG3A 4CI3A 2OK6A 2BKLA 2GC4A 4NENA 3A0FA 2CE9A 4CY2A 2MTAH 4RE5A 3DWLC 5KDOB 4YVDA 5EMLB 3VA6A 4ZOXA 2VDMA 3RRMC 2AGXA 4BP8A 2W18A 1GXRA 3I7LA 5E6SA 2HJBA 2QR5A 4AMZA 3KRWB 3EG6A 3C9CA 4CC9A 1OLZA 1A0RB 2VDRA 2HU5A 4GGAA 2P9PC 2YNNA 3AL8B 4TZ4A 5FQDA 2IURA 3MUOA 4XYHA 3J80g 5E6UA 3I7NA 1K32A 3AH8B 4J82A 5C2WB 2XYIA 2P9NC 3PSLA 2CE8A 3DXKC 3IULA 2WQ8A 5CXCA 3ZWLB 5HE0B 4DNVA 4PSWB 2B5NA 5C92A 3V9FA 4K3ID 1GP2B 5A2Qg 3IJ0A 3QHYB 3VI3A 3W15A 1MDAH 3UKUC 4O02A 2IWKA 3O4JA 3RN0D 4X61B 4JSVC 5HE3B 4FA9D 3VH0A 5I5MA 2AQ5A 5EMJB 3EU7A 3MUNA 1U4CA 3SMRA 2HJ4A 2J56H 4O45A 5FXYA 5FFGA 5CYKA 1GOTB 1SQ9A 3CFVA 5FLXg 3MKSB 3OKYA 5GMKn 1GG2B 5CXCB 2AGLA 3PE7A 2I3SA 2H9NA 3SBPA 1K3IA 2I0TA 4XEIC 1A12A 4QAMA 4J0WA 3DXMC 1U2VC 3FM0A 3I7PA 1M1XA 5FKSA 3SLED 3SXTD 4A11A 4NC4A 1O6FA 2TRCB 4O3UB 4PBZA 3NVQA 3V7DB 5C2VB 3EWEA 5HQGA 1PGUA 4ERZA 1UOPA 1QNIA 4Z7NA 2EIBA 1JV2A 3C75H 3EQ9A 4EWRA 2H6NA 3EQ7A 1U8CA 2VDQA 3KRXB 5TF2A 5IJ8E 4L1MA 4XYIA 1I2MB 5CYKB 2H6QA 5FKRA 2P9KC 4O2WA 4QT8A 3JPXA 2VDNA 2XZGA 3EI1A 5M5SA 4JSPC 4A7JA 3O4IA 4J86A 2YMUA 2IAAA 5IT9g 5EAPA 4J0XA 2H3XA 4X3EA 5FFOA 2YBAA 4KFMB 3FCSA 3UVNA 4A11B 4NSXA 5CXBA 3MZLA 4HDJA 4ZOVA 3PXSD 1MG2A 5M61A 2JKXA 1ERJA 2O9KA 3HFQA 2OVRB 3SFZA 3OKTA 2PM6B 2HKMA 2IWFA 2Z2OA 4Z8LA 5K19A 2B5LA 3MXXA 2J57G 3IJ1A 3KCIA 4CY1A 1C9LA 1S4UX 5IJ7E 3O4GA
chains in the Genus database with same CATH topology
3EI1B 4QL1A 4JD2C 3PVWB 2AH1A 1L0QA 4BUJC 5EMKB 1N6EA 1NR0A 3I7OA 4LG9A 5CXBB 4FWWA 4PSXB 3N0EA 2IUPA 4D6VA 3SN6B 5HE2B 3EMHA 5GSAA 2B4EA 5AFU3 4GGCA 1XHMA 3EI4A 2Z2PA 2IUVA 3JRPA 4PXWA 3RLMD 1XKSA 3MMYA 2I0RA 2AGYA 1YFQA 1Q47A 2OIZA 4FAVD 4JSNC 5AJAA 4I79A 1N6FA 2XL3A 2I3TA 1PEVA 5FA5B 3OW8A 2P9SC 5GXIA 3L4OD 3UVKA 3RMZD 4FAND 1PBYB 5B4WA 3SJLD 4GMBA 4CY5A 3C99A 3NVNA 3EI4B 3F3FA 3PXWD 2EBSA 3GFCA 4FB1D 3SWSD 3UVLA 4Y5RD 2PM9A 4Y7RA 3SBQA 3J81g 2HXCA 3OL2B 5EAMA 4BH6A 3CFSB 1VYHC 4GM9A 3F3PA 3UVMA 1K8KC 2XU7A 2CO0C 4J78A 4U1EI 3L4MD 5FKQA 3IJCA 4N14A 1P22A 3UVOA 1R5MA 2CN2A 2H47A 3AFCA 2YNOA 3SBRA 5SXMA 3ULEC 2PM9B 2Z2NA 4O3TB 4BL0A 4G56B 2IUQA 2CNXA 1JJUB 3NVXA 4CZYA 3I2NA 4FA1D 3I7KA 4GQBB 2PBIB 1TYQC 4FA4D 1JOFA 3I7HA 4FA5D 4J84A 3K26A 5H1MA 1FWXA 2P9UC 4U7AA 1SQJA 5JWZA 3MZKA 4OWRA 4J73A 4QRJA 2HESX 4K3JB 4PBYA 4GGDA 3E0CA 3PSCB 3RFHA 3B7FA 3ORVD 4PNKB 3CIKB 4JT6C 4AEZA 1RI6A 3BG0A 4ES0A 4CZVA 4QQEA 4J77A 1NEXB 4A0AA 3JZGA 4GM8A 4E54A 2OJYA 1B9YA 1SHYB 2H9PA 3DM0A 5IC7A 5EALA 2GC7A 1XIPA 5TEFA 3GREA 3RFGA 5FKTA 3DSMA 3OTTA 3SHFA 2H14A 5I5JA 2P9LC 3C5MA 4A08A 4JXMA 3VGZA 4CY3A 4ZOYA 4CI1A 3BG1A 4GM3A 2BBKH 2Q7QA 3I89A 3BWSA 4O1QD 4A0AB 2P9IC 3N0DA 4E54B 4AOWA 1TBGA 3OL2A 4L3HD 5H14A 3EI2A 2CO0A 4UI9R 4J87A 3AL9A 4GZ8A 5IGOA 1PI6A 3IIYA 4IMMA 4JT5C 3I8EA 5I5IA 3JZHA 1B9XA 4CZXA 4A08B 2UZYB 2GNQA 4ERYA 2H9LA 2HYEA 2I0SA 3RN1D 4LG8A 5THAA 3MKQA 4ERQA 5TDHB 4FHLA 4ZN4A 4A0BA 5HYNB 2PM7B 2HKRA 3EI2B 1JMZB 4J8BA 3SCYA 4L1QD 2H6KA 4X60B 4OZUA 4IA9A 4H5JA 2H68A 4ZOZA 5EARA 2J55H 2G9AA 3JZNA 3UKRC 2OVPB 4A09A 3PVUB 2YNPA 4J79A 1OMWB 4GQ1A 2AGWA 4E5ZA 4A2LA 3OKWA 3IKOA 3PXTD 4J8GA 5C9ZB 5AMSA 5TEEA 1JMXB 3ODTA 4A0BB 2OVQB 5H17A 4O9DA 5HE1B 5K1CC 4R7AB 3IIWA 3JROA 5EM2A 2H9MA 3V5WB 4PC0A 4ESGA 4D0KA 2AH0A 2G99A 3P4FA 3FRXA 4A09B 2XL2A 3OKYB 3K27A 4CI2A 2AGZA 3EI3A 4J81A 4E5ZB 2CN3A 2OK4A 4H5IA 5EMMB 4CI8A 3SVWD 4L9OA 4JSXC 4X63B 4L3GD 2B5MA 4LGNA 3I8CA 3U4YA 2H13A 2UZXB 3F3GA 3FGBA 5EM2B 2QC5A 4MK0B 3RSEC 1N6DA 2BCJB 3UR4A 3JB9L 4GQ2P 2YB8B 3JAMg 3AL8A 5IGQA 2QXVA 5GXHA 4A2MA 3EI3B 1MG3A 4CI3A 2OK6A 2GC4A 3A0FA 2CE9A 4CY2A 2MTAH 3DWLC 5KDOB 4YVDA 5EMLB 3VA6A 4ZOXA 3RRMC 2AGXA 2W18A 1GXRA 3I7LA 2HJBA 3KRWB 3EG6A 3C9CA 4CC9A 1OLZA 1A0RB 4GGAA 2P9PC 2YNNA 3AL8B 4TZ4A 5FQDA 2IURA 4XYHA 3J80g 3I7NA 1K32A 3AH8B 4J82A 5C2WB 2XYIA 2P9NC 3PSLA 2CE8A 3DXKC 5CXCA 3ZWLB 5HE0B 4PSWB 2B5NA 3V9FA 4K3ID 1GP2B 5A2Qg 3IJ0A 3W15A 1MDAH 3UKUC 2IWKA 3RN0D 4X61B 4JSVC 5HE3B 4FA9D 3VH0A 5I5MA 2AQ5A 5EMJB 3EU7A 1U4CA 3SMRA 2HJ4A 2J56H 4O45A 5FXYA 5CYKA 1GOTB 1SQ9A 3CFVA 5FLXg 3MKSB 3OKYA 5GMKn 1GG2B 5CXCB 2AGLA 3PE7A 2I3SA 2H9NA 3SBPA 2I0TA 4XEIC 4J0WA 3DXMC 1U2VC 3FM0A 3I7PA 5FKSA 3SLED 3SXTD 4A11A 4PBZA 2TRCB 4O3UB 3NVQA 3V7DB 5C2VB 3EWEA 5HQGA 1PGUA 4ERZA 1QNIA 3C75H 4EWRA 2H6NA 3KRXB 5TF2A 5IJ8E 4XYIA 5CYKB 2H6QA 5FKRA 2P9KC 4QT8A 3JPXA 3EI1A 4JSPC 4A7JA 4J86A 2YMUA 2IAAA 5IT9g 5EAPA 4J0XA 2H3XA 4X3EA 2YBAA 4KFMB 3UVNA 4A11B 4NSXA 5CXBA 3MZLA 4HDJA 4ZOVA 3PXSD 1MG2A 1ERJA 2O9KA 3HFQA 2OVRB 3SFZA 3OKTA 2PM6B 2HKMA 2IWFA 2Z2OA 4Z8LA 5K19A 2B5LA 3MXXA 2J57G 3IJ1A 4CY1A 1S4UX 5IJ7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI1 B;  4QL1 A;  4JD2 C;  3PVW B;  2AH1 A;  1L0Q A;  4BUJ C;  5EMK B;  1N6E A;  1NR0 A;  3I7O A;  4LG9 A;  5CXB B;  4FWW A;  4PSX B;  3N0E A;  2IUP A;  4D6V A;  3SN6 B;  5HE2 B;  3EMH A;  5GSA A;  2B4E A;  5AFU 3;  4GGC A;  1XHM A;  3EI4 A;  2Z2P A;  2IUV A;  3JRP A;  4PXW A;  3RLM D;  1XKS A;  3MMY A;  2I0R A;  2AGY A;  1YFQ A;  1Q47 A;  2OIZ A;  4FAV D;  4JSN C;  5AJA A;  4I79 A;  1N6F A;  2XL3 A;  2I3T A;  1PEV A;  5FA5 B;  3OW8 A;  2P9S C;  5GXI A;  3L4O D;  3UVK A;  3RMZ D;  4FAN D;  1PBY B;  5B4W A;  3SJL D;  4GMB A;  4CY5 A;  3C99 A;  3NVN A;  3EI4 B;  3F3F A;  3PXW D;  2EBS A;  3GFC A;  4FB1 D;  3SWS D;  3UVL A;  4Y5R D;  2PM9 A;  4Y7R A;  3SBQ A;  3J81 g;  2HXC A;  3OL2 B;  5EAM A;  4BH6 A;  3CFS B;  1VYH C;  4GM9 A;  3F3P A;  3UVM A;  1K8K C;  2XU7 A;  2CO0 C;  4J78 A;  4U1E I;  3L4M D;  5FKQ A;  3IJC A;  4N14 A;  1P22 A;  3UVO A;  1R5M A;  2CN2 A;  2H47 A;  3AFC A;  2YNO A;  3SBR A;  5SXM A;  3ULE C;  2PM9 B;  2Z2N A;  4O3T B;  4BL0 A;  4G56 B;  2IUQ A;  2CNX A;  1JJU B;  3NVX A;  4CZY A;  3I2N A;  4FA1 D;  3I7K A;  4GQB B;  2PBI B;  1TYQ C;  4FA4 D;  1JOF A;  3I7H A;  4FA5 D;  4J84 A;  3K26 A;  5H1M A;  1FWX A;  2P9U C;  4U7A A;  1SQJ A;  5JWZ A;  3MZK A;  4OWR A;  4J73 A;  4QRJ A;  2HES X;  4K3J B;  4PBY A;  4GGD A;  3E0C A;  3PSC B;  3RFH A;  3B7F A;  3ORV D;  4PNK B;  3CIK B;  4JT6 C;  4AEZ A;  1RI6 A;  3BG0 A;  4ES0 A;  4CZV A;  4QQE A;  4J77 A;  1NEX B;  4A0A A;  3JZG A;  4GM8 A;  4E54 A;  2OJY A;  1B9Y A;  1SHY B;  2H9P A;  3DM0 A;  5IC7 A;  5EAL A;  2GC7 A;  1XIP A;  5TEF A;  3GRE A;  3RFG A;  5FKT A;  3DSM A;  3OTT A;  3SHF A;  2H14 A;  5I5J A;  2P9L C;  3C5M A;  4A08 A;  4JXM A;  3VGZ A;  4CY3 A;  4ZOY A;  4CI1 A;  3BG1 A;  4GM3 A;  2BBK H;  2Q7Q A;  3I89 A;  3BWS A;  4O1Q D;  4A0A B;  2P9I C;  3N0D A;  4E54 B;  4AOW A;  1TBG A;  3OL2 A;  4L3H D;  5H14 A;  3EI2 A;  2CO0 A;  4UI9 R;  4J87 A;  3AL9 A;  4GZ8 A;  5IGO A;  1PI6 A;  3IIY A;  4IMM A;  4JT5 C;  3I8E A;  5I5I A;  3JZH A;  1B9X A;  4CZX A;  4A08 B;  2UZY B;  2GNQ A;  4ERY A;  2H9L A;  2HYE A;  2I0S A;  3RN1 D;  4LG8 A;  5THA A;  3MKQ A;  4ERQ A;  5TDH B;  4FHL A;  4ZN4 A;  4A0B A;  5HYN B;  2PM7 B;  2HKR A;  3EI2 B;  1JMZ B;  4J8B A;  3SCY A;  4L1Q D;  2H6K A;  4X60 B;  4OZU A;  4IA9 A;  4H5J A;  2H68 A;  4ZOZ A;  5EAR A;  2J55 H;  2G9A A;  3JZN A;  3UKR C;  2OVP B;  4A09 A;  3PVU B;  2YNP A;  4J79 A;  1OMW B;  4GQ1 A;  2AGW A;  4E5Z A;  4A2L A;  3OKW A;  3IKO A;  3PXT D;  4J8G A;  5C9Z B;  5AMS A;  5TEE A;  1JMX B;  3ODT A;  4A0B B;  2OVQ B;  5H17 A;  4O9D A;  5HE1 B;  5K1C C;  4R7A B;  3IIW A;  3JRO A;  5EM2 A;  2H9M A;  3V5W B;  4PC0 A;  4ESG A;  4D0K A;  2AH0 A;  2G99 A;  3P4F A;  3FRX A;  4A09 B;  2XL2 A;  3OKY B;  3K27 A;  4CI2 A;  2AGZ A;  3EI3 A;  4J81 A;  4E5Z B;  2CN3 A;  2OK4 A;  4H5I A;  5EMM B;  4CI8 A;  3SVW D;  4L9O A;  4JSX C;  4X63 B;  4L3G D;  2B5M A;  4LGN A;  3I8C A;  3U4Y A;  2H13 A;  2UZX B;  3F3G A;  3FGB A;  5EM2 B;  2QC5 A;  4MK0 B;  3RSE C;  1N6D A;  2BCJ B;  3UR4 A;  3JB9 L;  4GQ2 P;  2YB8 B;  3JAM g;  3AL8 A;  5IGQ A;  2QXV A;  5GXH A;  4A2M A;  3EI3 B;  1MG3 A;  4CI3 A;  2OK6 A;  2GC4 A;  3A0F A;  2CE9 A;  4CY2 A;  2MTA H;  3DWL C;  5KDO B;  4YVD A;  5EML B;  3VA6 A;  4ZOX A;  3RRM C;  2AGX A;  2W18 A;  1GXR A;  3I7L A;  2HJB A;  3KRW B;  3EG6 A;  3C9C A;  4CC9 A;  1OLZ A;  1A0R B;  4GGA A;  2P9P C;  2YNN A;  3AL8 B;  4TZ4 A;  5FQD A;  2IUR A;  4XYH A;  3J80 g;  3I7N A;  1K32 A;  3AH8 B;  4J82 A;  5C2W B;  2XYI A;  2P9N C;  3PSL A;  2CE8 A;  3DXK C;  5CXC A;  3ZWL B;  5HE0 B;  4PSW B;  2B5N A;  3V9F A;  4K3I D;  1GP2 B;  5A2Q g;  3IJ0 A;  3W15 A;  1MDA H;  3UKU C;  2IWK A;  3RN0 D;  4X61 B;  4JSV C;  5HE3 B;  4FA9 D;  3VH0 A;  5I5M A;  2AQ5 A;  5EMJ B;  3EU7 A;  1U4C A;  3SMR A;  2HJ4 A;  2J56 H;  4O45 A;  5FXY A;  5CYK A;  1GOT B;  1SQ9 A;  3CFV A;  5FLX g;  3MKS B;  3OKY A;  5GMK n;  1GG2 B;  5CXC B;  2AGL A;  3PE7 A;  2I3S A;  2H9N A;  3SBP A;  2I0T A;  4XEI C;  4J0W A;  3DXM C;  1U2V C;  3FM0 A;  3I7P A;  5FKS A;  3SLE D;  3SXT D;  4A11 A;  4PBZ A;  2TRC B;  4O3U B;  3NVQ A;  3V7D B;  5C2V B;  3EWE A;  5HQG A;  1PGU A;  4ERZ A;  1QNI A;  3C75 H;  4EWR A;  2H6N A;  3KRX B;  5TF2 A;  5IJ8 E;  4XYI A;  5CYK B;  2H6Q A;  5FKR A;  2P9K C;  4QT8 A;  3JPX A;  3EI1 A;  4JSP C;  4A7J A;  4J86 A;  2YMU A;  2IAA A;  5IT9 g;  5EAP A;  4J0X A;  2H3X A;  4X3E A;  2YBA A;  4KFM B;  3UVN A;  4A11 B;  4NSX A;  5CXB A;  3MZL A;  4HDJ A;  4ZOV A;  3PXS D;  1MG2 A;  1ERJ A;  2O9K A;  3HFQ A;  2OVR B;  3SFZ A;  3OKT A;  2PM6 B;  2HKM A;  2IWF A;  2Z2O A;  4Z8L A;  5K19 A;  2B5L A;  3MXX A;  2J57 G;  3IJ1 A;  4CY1 A;  1S4U X;  5IJ7 E; 
#chains in the Genus database with same CATH topology
 1H2Z A;  3EI1 B;  4QL1 A;  4JD2 C;  3PVW B;  2AH1 A;  1L0Q A;  4BUJ C;  5EMK B;  4JHP C;  1N6E A;  1NR0 A;  3FCU A;  3VI4 A;  3I7O A;  5E6R A;  4LG9 A;  5CXB B;  3ZDX A;  2VZ1 A;  2VDK A;  4FWW A;  4PSX B;  3N0E A;  2HU7 A;  2IUP A;  4D6V A;  3SN6 B;  5M5V A;  2EID A;  5HE2 B;  3EMH A;  2VDL A;  5GSA A;  2B4E A;  4MMZ A;  1BPO A;  4DNU A;  5AFU 3;  4GGC A;  5HDB A;  1XHM A;  3EI4 A;  2Z2P A;  1GOG A;  2IUV A;  3JRP A;  4PXW A;  3RLM D;  1TYE A;  1XKS A;  3MMY A;  2I0R A;  2AGY A;  1L5G A;  3QI0 A;  1YFQ A;  1Q47 A;  2OIZ A;  4FAV D;  4JSN C;  5AJA A;  4I79 A;  4NAA A;  2QZP A;  1N6F A;  2XL3 A;  5M5R A;  2I3T A;  1PEV A;  5FA5 B;  4RE6 A;  3OW8 A;  2P9S C;  5GXI A;  3L4O D;  3UVK A;  3RMZ D;  4FAN D;  1PBY B;  5B4W A;  3SJL D;  4GMB A;  4CY5 A;  3C99 A;  3NVN A;  3EI4 B;  3F3F A;  1E8M A;  3NIF A;  3PXW D;  2EBS A;  3GFC A;  1YR2 A;  4FB1 D;  2EIC A;  3SWS D;  3UVL A;  4G55 A;  4Y5R D;  2PM9 A;  4Y7R A;  3IJE A;  3SBQ A;  3J81 g;  2HXC A;  4WK2 A;  3OL2 B;  1JTD B;  4AN1 A;  2XE4 A;  5EAM A;  4BH6 A;  3CFS B;  1H2X A;  1VYH C;  4GM9 A;  3F3P A;  3UVM A;  1K8K C;  2XU7 A;  2CO0 C;  3DDU A;  3K72 A;  4J78 A;  3L4M D;  4U1E I;  3V4P A;  5FKQ A;  3IJC A;  4N14 A;  1P22 A;  3UVO A;  1R5M A;  2CN2 A;  2H47 A;  3AFC A;  4BCC A;  4MMY A;  2YNO A;  3SBR A;  4JHN A;  5SXM A;  3ULE C;  2PM9 B;  2Z2N A;  4O3T B;  4BL0 A;  4G56 B;  2IUQ A;  4AX4 A;  2CNX A;  1JJU B;  3NVX A;  4CZY A;  3I2N A;  4FA1 D;  3I7K A;  1GOF A;  4GQB B;  4UM8 A;  3IUR A;  3ZE2 A;  2PBI B;  1TYQ C;  4FA4 D;  2XDW A;  3IUN A;  1JOF A;  3I7H A;  4FA5 D;  4J84 A;  3K26 A;  3IUQ A;  5H1M A;  3OF7 A;  3ZDY A;  3GD1 I;  1H2W A;  5M5U A;  4MMX A;  1FWX A;  2P9U C;  4U7A A;  1SQJ A;  1H2Y A;  5JWZ A;  3MZK A;  4OWR A;  4J73 A;  4QRJ A;  2HES X;  4K3J B;  4PBY A;  4GGD A;  3E0C A;  1QFM A;  1T2X A;  3PSC B;  3RFH A;  3B7F A;  3ORV D;  4BCD A;  4PNK B;  3CIK B;  1QFS A;  2EIE A;  4JT6 C;  4AEZ A;  1RI6 A;  3BG0 A;  4ES0 A;  4CZV A;  4QQE A;  4J77 A;  3IUJ A;  1NEX B;  2VDO A;  4A0A A;  3JZG A;  4GM8 A;  4WJK A;  3EQ8 A;  4E54 A;  1O6G A;  1E5T A;  1UOO A;  1UOQ A;  2OJY A;  1B9Y A;  1SHY B;  2H9P A;  3DM0 A;  5IC7 A;  5EAL A;  2GC7 A;  1XIP A;  5TEF A;  3GRE A;  2VZ3 A;  3RFG A;  5FKT A;  3DSM A;  3OTT A;  3SHF A;  3ZDZ A;  2H14 A;  4BCB A;  5I5J A;  2P9L C;  3K6S A;  3C5M A;  4A08 A;  4JXM A;  3VGZ A;  4CY3 A;  4ZOY A;  4AN0 A;  3NIG A;  4CI1 A;  3BG1 A;  4GM3 A;  2BBK H;  2Q7Q A;  3I89 A;  3BWS A;  4O1Q D;  4A0A B;  3IVM A;  2P9I C;  3N0D A;  4E54 B;  4AOW A;  1TBG A;  5M5T A;  3OL2 A;  4L3H D;  5H14 A;  3EI2 A;  2CO0 A;  2VC2 A;  3ZE1 A;  4D9S A;  4UI9 R;  4WK4 A;  4J87 A;  3AL9 A;  4AMY A;  4GZ8 A;  5IGO A;  1PI6 A;  3IIY A;  4IMM A;  4JT5 C;  3I8E A;  5I5I A;  3JZH A;  1B9X A;  4G1E A;  4CZX A;  4A08 B;  2UZY B;  4NBM A;  2GNQ A;  4ERY A;  2H9L A;  2HYE A;  2I0S A;  3RN1 D;  4WK0 A;  4Z7O A;  4LG8 A;  5THA A;  3MKQ A;  4ERQ A;  5TDH B;  4FHL A;  4ZN4 A;  4A0B A;  5HYN B;  2PM7 B;  4G1M A;  2HKR A;  3EI2 B;  1C9I A;  1JMZ B;  4J8B A;  3SCY A;  4L1Q D;  2H6K A;  4X60 B;  4OZU A;  4IA9 A;  4H5J A;  2H68 A;  4ZOZ A;  5EAR A;  2J55 H;  2G9A A;  3JZN A;  3UKR C;  3V4V A;  2OVP B;  4A09 A;  4DNW A;  3PVU B;  2YNP A;  4J79 A;  1OMW B;  1E8N A;  4GQ1 A;  2AGW A;  3GC3 B;  4E5Z A;  4A2L A;  3OKW A;  2HU8 A;  3IKO A;  3PXT D;  4J8G A;  5C9Z B;  5AMS A;  5TEE A;  1JMX B;  3ODT A;  4A0B B;  2OVQ B;  5H17 A;  4O9D A;  5HE1 B;  5K1C C;  4R7A B;  3IIW A;  3JRO A;  5EM2 A;  5C86 A;  2H9M A;  3V5W B;  3NID A;  4PC0 A;  4ESG A;  3T3M A;  4D0K A;  2AH0 A;  2G99 A;  3P4F A;  3FRX A;  3K71 A;  2VDP A;  3O4H A;  2XL2 A;  4A09 B;  3OKY B;  4Z7Q A;  3K27 A;  4CI2 A;  2AGZ A;  1VE7 A;  1VZ3 A;  3EI3 A;  4BP9 A;  4J81 A;  4E5Z B;  2CN3 A;  2OK4 A;  4H5I A;  5EMM B;  4CI8 A;  3ZE0 A;  3SVW D;  4L9O A;  4JSX C;  1GOH A;  4X63 B;  1VE6 A;  4IRZ A;  4L3G D;  2B5M A;  4LGN A;  3I8C A;  3U4Y A;  2H13 A;  2UZX B;  3F3G A;  3FGB A;  4UM9 A;  5EM2 B;  2QC5 A;  4MK0 B;  3RSE C;  1N6D A;  2BCJ B;  3UR4 A;  3JB9 L;  1UTC A;  3MVD K;  4GQ2 P;  3IUM A;  2YB8 B;  3JAM g;  3AL8 A;  5IGQ A;  2QXV A;  3T3P A;  5GXH A;  4A2M A;  1VZ2 A;  3EI3 B;  1MG3 A;  4CI3 A;  2OK6 A;  2BKL A;  2GC4 A;  4NEN A;  3A0F A;  2CE9 A;  4CY2 A;  2MTA H;  4RE5 A;  3DWL C;  5KDO B;  4YVD A;  5EML B;  3VA6 A;  4ZOX A;  2VDM A;  3RRM C;  2AGX A;  4BP8 A;  2W18 A;  1GXR A;  3I7L A;  5E6S A;  2HJB A;  2QR5 A;  4AMZ A;  3KRW B;  3EG6 A;  3C9C A;  4CC9 A;  1OLZ A;  1A0R B;  2VDR A;  2HU5 A;  4GGA A;  2P9P C;  2YNN A;  3AL8 B;  4TZ4 A;  5FQD A;  2IUR A;  3MUO A;  4XYH A;  3J80 g;  5E6U A;  3I7N A;  1K32 A;  3AH8 B;  4J82 A;  5C2W B;  2XYI A;  2P9N C;  3PSL A;  2CE8 A;  3DXK C;  3IUL A;  2WQ8 A;  5CXC A;  3ZWL B;  5HE0 B;  4DNV A;  4PSW B;  2B5N A;  5C92 A;  3V9F A;  4K3I D;  1GP2 B;  5A2Q g;  3IJ0 A;  3QHY B;  3VI3 A;  3W15 A;  1MDA H;  3UKU C;  4O02 A;  2IWK A;  3O4J A;  3RN0 D;  4X61 B;  4JSV C;  5HE3 B;  4FA9 D;  3VH0 A;  5I5M A;  2AQ5 A;  5EMJ B;  3EU7 A;  3MUN A;  1U4C A;  3SMR A;  2HJ4 A;  2J56 H;  4O45 A;  5FXY A;  5FFG A;  5CYK A;  1GOT B;  1SQ9 A;  3CFV A;  5FLX g;  3MKS B;  3OKY A;  5GMK n;  1GG2 B;  5CXC B;  2AGL A;  3PE7 A;  2I3S A;  2H9N A;  3SBP A;  1K3I A;  2I0T A;  4XEI C;  1A12 A;  4QAM A;  4J0W A;  3DXM C;  1U2V C;  3FM0 A;  3I7P A;  1M1X A;  5FKS A;  3SLE D;  3SXT D;  4A11 A;  4NC4 A;  1O6F A;  2TRC B;  4O3U B;  4PBZ A;  3NVQ A;  3V7D B;  5C2V B;  3EWE A;  5HQG A;  1PGU A;  4ERZ A;  1UOP A;  1QNI A;  4Z7N A;  2EIB A;  1JV2 A;  3C75 H;  3EQ9 A;  4EWR A;  2H6N A;  3EQ7 A;  1U8C A;  2VDQ A;  3KRX B;  5TF2 A;  5IJ8 E;  4L1M A;  4XYI A;  1I2M B;  5CYK B;  2H6Q A;  5FKR A;  2P9K C;  4O2W A;  4QT8 A;  3JPX A;  2VDN A;  2XZG A;  3EI1 A;  5M5S A;  4JSP C;  4A7J A;  3O4I A;  4J86 A;  2YMU A;  2IAA A;  5IT9 g;  5EAP A;  4J0X A;  2H3X A;  4X3E A;  5FFO A;  2YBA A;  4KFM B;  3FCS A;  3UVN A;  4A11 B;  4NSX A;  5CXB A;  3MZL A;  4HDJ A;  4ZOV A;  3PXS D;  1MG2 A;  5M61 A;  2JKX A;  1ERJ A;  2O9K A;  3HFQ A;  2OVR B;  3SFZ A;  3OKT A;  2PM6 B;  2HKM A;  2IWF A;  2Z2O A;  4Z8L A;  5K19 A;  2B5L A;  3MXX A;  2J57 G;  3IJ1 A;  3KCI A;  4CY1 A;  1C9L A;  1S4U X;  5IJ7 E;  3O4G A; 
#chains in the Genus database with same CATH homology
 3EI1 B;  4QL1 A;  4JD2 C;  3PVW B;  2AH1 A;  1L0Q A;  4BUJ C;  5EMK B;  1N6E A;  1NR0 A;  3I7O A;  4LG9 A;  5CXB B;  4FWW A;  4PSX B;  3N0E A;  2IUP A;  4D6V A;  3SN6 B;  5HE2 B;  3EMH A;  5GSA A;  2B4E A;  5AFU 3;  4GGC A;  1XHM A;  3EI4 A;  2Z2P A;  2IUV A;  3JRP A;  4PXW A;  3RLM D;  1XKS A;  3MMY A;  2I0R A;  2AGY A;  1YFQ A;  1Q47 A;  2OIZ A;  4FAV D;  4JSN C;  5AJA A;  4I79 A;  1N6F A;  2XL3 A;  2I3T A;  1PEV A;  5FA5 B;  3OW8 A;  2P9S C;  5GXI A;  3L4O D;  3UVK A;  3RMZ D;  4FAN D;  1PBY B;  5B4W A;  3SJL D;  4GMB A;  4CY5 A;  3C99 A;  3NVN A;  3EI4 B;  3F3F A;  3PXW D;  2EBS A;  3GFC A;  4FB1 D;  3SWS D;  3UVL A;  4Y5R D;  2PM9 A;  4Y7R A;  3SBQ A;  3J81 g;  2HXC A;  3OL2 B;  5EAM A;  4BH6 A;  3CFS B;  1VYH C;  4GM9 A;  3F3P A;  3UVM A;  1K8K C;  2XU7 A;  2CO0 C;  4J78 A;  4U1E I;  3L4M D;  5FKQ A;  3IJC A;  4N14 A;  1P22 A;  3UVO A;  1R5M A;  2CN2 A;  2H47 A;  3AFC A;  2YNO A;  3SBR A;  5SXM A;  3ULE C;  2PM9 B;  2Z2N A;  4O3T B;  4BL0 A;  4G56 B;  2IUQ A;  2CNX A;  1JJU B;  3NVX A;  4CZY A;  3I2N A;  4FA1 D;  3I7K A;  4GQB B;  2PBI B;  1TYQ C;  4FA4 D;  1JOF A;  3I7H A;  4FA5 D;  4J84 A;  3K26 A;  5H1M A;  1FWX A;  2P9U C;  4U7A A;  1SQJ A;  5JWZ A;  3MZK A;  4OWR A;  4J73 A;  4QRJ A;  2HES X;  4K3J B;  4PBY A;  4GGD A;  3E0C A;  3PSC B;  3RFH A;  3B7F A;  3ORV D;  4PNK B;  3CIK B;  4JT6 C;  4AEZ A;  1RI6 A;  3BG0 A;  4ES0 A;  4CZV A;  4QQE A;  4J77 A;  1NEX B;  4A0A A;  3JZG A;  4GM8 A;  4E54 A;  2OJY A;  1B9Y A;  1SHY B;  2H9P A;  3DM0 A;  5IC7 A;  5EAL A;  2GC7 A;  1XIP A;  5TEF A;  3GRE A;  3RFG A;  5FKT A;  3DSM A;  3OTT A;  3SHF A;  2H14 A;  5I5J A;  2P9L C;  3C5M A;  4A08 A;  4JXM A;  3VGZ A;  4CY3 A;  4ZOY A;  4CI1 A;  3BG1 A;  4GM3 A;  2BBK H;  2Q7Q A;  3I89 A;  3BWS A;  4O1Q D;  4A0A B;  2P9I C;  3N0D A;  4E54 B;  4AOW A;  1TBG A;  3OL2 A;  4L3H D;  5H14 A;  3EI2 A;  2CO0 A;  4UI9 R;  4J87 A;  3AL9 A;  4GZ8 A;  5IGO A;  1PI6 A;  3IIY A;  4IMM A;  4JT5 C;  3I8E A;  5I5I A;  3JZH A;  1B9X A;  4CZX A;  4A08 B;  2UZY B;  2GNQ A;  4ERY A;  2H9L A;  2HYE A;  2I0S A;  3RN1 D;  4LG8 A;  5THA A;  3MKQ A;  4ERQ A;  5TDH B;  4FHL A;  4ZN4 A;  4A0B A;  5HYN B;  2PM7 B;  2HKR A;  3EI2 B;  1JMZ B;  4J8B A;  3SCY A;  4L1Q D;  2H6K A;  4X60 B;  4OZU A;  4IA9 A;  4H5J A;  2H68 A;  4ZOZ A;  5EAR A;  2J55 H;  2G9A A;  3JZN A;  3UKR C;  2OVP B;  4A09 A;  3PVU B;  2YNP A;  4J79 A;  1OMW B;  4GQ1 A;  2AGW A;  4E5Z A;  4A2L A;  3OKW A;  3IKO A;  3PXT D;  4J8G A;  5C9Z B;  5AMS A;  5TEE A;  1JMX B;  3ODT A;  4A0B B;  2OVQ B;  5H17 A;  4O9D A;  5HE1 B;  5K1C C;  4R7A B;  3IIW A;  3JRO A;  5EM2 A;  2H9M A;  3V5W B;  4PC0 A;  4ESG A;  4D0K A;  2AH0 A;  2G99 A;  3P4F A;  3FRX A;  4A09 B;  2XL2 A;  3OKY B;  3K27 A;  4CI2 A;  2AGZ A;  3EI3 A;  4J81 A;  4E5Z B;  2CN3 A;  2OK4 A;  4H5I A;  5EMM B;  4CI8 A;  3SVW D;  4L9O A;  4JSX C;  4X63 B;  4L3G D;  2B5M A;  4LGN A;  3I8C A;  3U4Y A;  2H13 A;  2UZX B;  3F3G A;  3FGB A;  5EM2 B;  2QC5 A;  4MK0 B;  3RSE C;  1N6D A;  2BCJ B;  3UR4 A;  3JB9 L;  4GQ2 P;  2YB8 B;  3JAM g;  3AL8 A;  5IGQ A;  2QXV A;  5GXH A;  4A2M A;  3EI3 B;  1MG3 A;  4CI3 A;  2OK6 A;  2GC4 A;  3A0F A;  2CE9 A;  4CY2 A;  2MTA H;  3DWL C;  5KDO B;  4YVD A;  5EML B;  3VA6 A;  4ZOX A;  3RRM C;  2AGX A;  2W18 A;  1GXR A;  3I7L A;  2HJB A;  3KRW B;  3EG6 A;  3C9C A;  4CC9 A;  1OLZ A;  1A0R B;  4GGA A;  2P9P C;  2YNN A;  3AL8 B;  4TZ4 A;  5FQD A;  2IUR A;  4XYH A;  3J80 g;  3I7N A;  1K32 A;  3AH8 B;  4J82 A;  5C2W B;  2XYI A;  2P9N C;  3PSL A;  2CE8 A;  3DXK C;  5CXC A;  3ZWL B;  5HE0 B;  4PSW B;  2B5N A;  3V9F A;  4K3I D;  1GP2 B;  5A2Q g;  3IJ0 A;  3W15 A;  1MDA H;  3UKU C;  2IWK A;  3RN0 D;  4X61 B;  4JSV C;  5HE3 B;  4FA9 D;  3VH0 A;  5I5M A;  2AQ5 A;  5EMJ B;  3EU7 A;  1U4C A;  3SMR A;  2HJ4 A;  2J56 H;  4O45 A;  5FXY A;  5CYK A;  1GOT B;  1SQ9 A;  3CFV A;  5FLX g;  3MKS B;  3OKY A;  5GMK n;  1GG2 B;  5CXC B;  2AGL A;  3PE7 A;  2I3S A;  2H9N A;  3SBP A;  2I0T A;  4XEI C;  4J0W A;  3DXM C;  1U2V C;  3FM0 A;  3I7P A;  5FKS A;  3SLE D;  3SXT D;  4A11 A;  4PBZ A;  2TRC B;  4O3U B;  3NVQ A;  3V7D B;  5C2V B;  3EWE A;  5HQG A;  1PGU A;  4ERZ A;  1QNI A;  3C75 H;  4EWR A;  2H6N A;  3KRX B;  5TF2 A;  5IJ8 E;  4XYI A;  5CYK B;  2H6Q A;  5FKR A;  2P9K C;  4QT8 A;  3JPX A;  3EI1 A;  4JSP C;  4A7J A;  4J86 A;  2YMU A;  2IAA A;  5IT9 g;  5EAP A;  4J0X A;  2H3X A;  4X3E A;  2YBA A;  4KFM B;  3UVN A;  4A11 B;  4NSX A;  5CXB A;  3MZL A;  4HDJ A;  4ZOV A;  3PXS D;  1MG2 A;  1ERJ A;  2O9K A;  3HFQ A;  2OVR B;  3SFZ A;  3OKT A;  2PM6 B;  2HKM A;  2IWF A;  2Z2O A;  4Z8L A;  5K19 A;  2B5L A;  3MXX A;  2J57 G;  3IJ1 A;  4CY1 A;  1S4U X;  5IJ7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...