3J81g

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
molecule keywords 18S rRNA
molecule tags Ribosome
source organism Saccharomyces cerevisiae
total genus 49
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j81g01
4FHLA 3IIYA 4ZOZA 1GXRA 2B4EA 4A08B 1P22A 4I79A 4K3JB 2PM9B 2H9MA 4GQ1A 4JSVC 4J81A 3K27A 4YVDA 1NR0A 3DXMC 4A0BB 5HE0B 3A0FA 5CXBA 3GFCA 4XYHA 5I5JA 3PSLA 1N6DA 4O45A 2HJBA 3GREA 5EMKB 2AGWA 3AL8B 1PI6A 4A0AB 2H13A 4FAND 3JZNA 2IWFA 2P9SC 3BG1A 5FXYA 2QC5A 4FAVD 4QRJA 1JMZB 4GM9A 2AH0A 4J78A 5CYKA 2B5LA 2EBSA 3KRWB 4J86A 4GGCA 3PSCB 4CY2A 2GNQA 4E5ZB 3JAMg 3IJ0A 4CZVA 4ESGA 2TRCB 3RLMD 3U4YA 3BWSA 3J81g 4GZ8A 2YNNA 1TBGA 4L1QD 4EWRA 4Z8LA 2H9LA 4L9OA 2HKRA 2OK4A 5I5MA 3VH0A 2OVRB 2AGXA 2XYIA 4L3GD 3EI4A 3FM0A 5CXBB 3NVQA 1SQJA 4NSXA 4X61B 4J8BA 3ZWLB 4J87A 5GSAA 3PVUB 3EI2A 4A2MA 4ZOYA 4ES0A 5B4WA 2IUQA 2OJYA 5IGOA 2P9PC 5FKRA 1B9XA 4H5JA 4Y5RD 5CYKB 4ZN4A 1B9YA 4IMMA 5EALA 3I2NA 3E0CA 4R7AB 1N6FA 2XL2A 5AFU3 4LG8A 1MG2A 1JOFA 5AMSA 2AGLA 4PXWA 2XL3A 2CO0C 3MKSB 2HKMA 3SMRA 5EAPA 3DM0A 3EI4B 2BBKH 2G9AA 1K32A 4XYIA 2BCJB 2H68A 3JB9L 3V7DB 5C9ZB 3L4OD 1N6EA 3RFGA 3SWSD 3EI2B 1SQ9A 1VYHC 2UZXB 5AJAA 4BL0A 3VA6A 4FB1D 4XEIC 1SHYB 3I8EA 4UI9R 5IGQA 2Z2OA 4PSXB 3JZGA 3SJLD 1PEVA 5FKSA 4GQBB 4GM3A 4LG9A 3AH8B 4FA5D 4OWRA 1XKSA 2I0TA 3FGBA 4A09A 4JT5C 5HE1B 3W15A 3B7FA 5TDHB 2H6QA 3IJ1A 2GC4A 5EAMA 4JD2C 3F3PA 5TEFA 4FA1D 4GGDA 3I8CA 3P4FA 5I5IA 3DWLC 3C75H 2O9KA 5EMMB 4OZUA 4FWWA 4G56B 5IC7A 1U4CA 5KDOB 3I7LA 2I3SA 3ORVD 2AGYA 3K26A 4GMBA 4TZ4A 2YNPA 3I7OA 3C5MA 3CFSB 3MKQA 3EWEA 3SHFA 2AQ5A 2IAAA 3RN0D 3SCYA 3OW8A 3MMYA 2CN3A 2Q7QA 2AH1A 3NVXA 4A09B 3SVWD 2HJ4A 4BUJC 4PSWB 4X3EA 2Z2NA 5IT9g 2P9UC 4D6VA 1OLZA 4H5IA 2H47A 2YB8B 2G99A 3OTTA 3EI3A 3RSEC 3I7HA 3EG6A 3SBQA 3SLED 1GG2B 4PC0A 4O3UB 2H9PA 4HDJA 1PGUA 4ZOXA 3OKYA 5K1CC 3VGZA 4ZOVA 1MDAH 2CE9A 2I0RA 2MTAH 4IA9A 4CY1A 4J82A 3EU7A 1XHMA 3C9CA 4FA9D 3PXTD 3EI1A 1JJUB 5A2Qg 5C2WB 3OL2A 5HQGA 4PBYA 1OMWB 3MZKA 4PBZA 4GQ2P 5H17A 2J56H 3PE7A 2OVQB 5EARA 3UR4A 1U2VC 3EI3B 1ERJA 1GP2B 1XIPA 4QT8A 4N14A 2OVPB 3EMHA 2YMUA 3PVWB 3OKYB 5HE2B 3V5WB 3AFCA 4A7JA 5THAA 2IUVA 2IUPA 5FLXg 1R5MA 4L3HD 3UVMA 3CFVA 4J0XA 3PXWD 1JMXB 4KFMB 4O9DA 2J55H 3EI1B 3MXXA 2PM6B 4ERYA 2PM7B 5HE3B 3OL2B 3PXSD 2HXCA 4A11A 4J8GA 4CZXA 2CNXA 4U1EI 2B5NA 4JT6C 4ERZA 3OKWA 3J80g 3JRPA 1MG3A 4CC9A 4J84A 3I7NA 3RN1D 3UKRC 3HFQA 2CE8A 3OKTA 4O3TB 2I3TA 4A2LA 4CI3A 2H9NA 5FKTA 4ERQA 1PBYB 2PBIB 4QQEA 5JWZA 3F3GA 3RMZD 3JZHA 2YBAA 5CXCA 3BG0A 3NVNA 5FA5B 2HESX 3UKUC 1TYQC 1GOTB 3UVNA 4JSXC 2IWKA 1FWXA 5K19A 2CO0A 5H14A 4A11B 3RRMC 3DSMA 1NEXB 5HYNB 2P9NC 5FKQA 4MK0B 2GC7A 4CI8A 3UVOA 1YFQA 4GGAA 4U7AA 3IKOA 3I7PA 2AGZA 4O1QD 2XU7A 4JXMA 4E54A 3JPXA 3CIKB 2QXVA 3KRXB 1K8KC 4J77A 2OIZA 4D0KA 3SBRA 5CXCB 4PNKB 1L0QA 5EM2A 3UVLA 4X60B 3F3FA 3SBPA 3IJCA 3I89A 4CY3A 2W18A 4QL1A 4CZYA 2J57G 5GXHA 5IJ8E 1A0RB 3RFHA 4AEZA 2B5MA 3SN6B 5C2VB 2P9KC 4LGNA 5GXIA 3MZLA 4J0WA 1RI6A 5FQDA 5TEEA 3L4MD 4J73A 2Z2PA 3ULEC 2H6KA 3IIWA 5H1MA 3UVKA 5EMJB 2UZYB 1QNIA 4E54B 5GMKn 4CI1A 3I7KA 5SXMA 4A08A 3SXTD 5TF2A 2H6NA 3DXKC 4CY5A 2PM9A 1Q47A 2I0SA 3V9FA 2CN2A 2P9IC 2HYEA 4A0BA 5EM2B 3ODTA 2YNOA 2IURA 2H14A 4Y7RA 3N0EA 3AL8A 4A0AA 4AOWA 3N0DA 3AL9A 4BH6A 1S4UX 2OK6A 4FA4D 4GM8A 4J79A 5EMLB 3SFZA 4JSNC 4X63B 3C99A 4JSPC 2P9LC 4E5ZA 2H3XA 5IJ7E 3JROA 4K3ID 4CI2A 3FRXA
chains in the Genus database with same CATH superfamily
4FHLA 3IIYA 4ZOZA 1GXRA 3O4IA 2B4EA 4A08B 1P22A 4RE5A 4I79A 4K3JB 2PM9B 2H9MA 4GQ1A 4JSVC 2JKXA 3V4VA 4J81A 5E6UA 3K27A 4YVDA 1NR0A 3DXMC 4A0BB 5HE0B 4AMZA 3A0FA 5CXBA 3GFCA 4XYHA 5I5JA 3PSLA 1N6DA 4MMXA 4O45A 2HJBA 3O4HA 3GREA 5EMKB 2AGWA 3AL8B 1PI6A 4A0AB 1I2MB 2H13A 4NAAA 4FAND 4AN0A 3JZNA 2IWFA 2P9SC 3BG1A 3ZDZA 5FXYA 2QC5A 4FAVD 1VZ3A 4QRJA 1JMZB 2VDKA 4GM9A 2AH0A 4J78A 5CYKA 2B5LA 2EBSA 1A12A 3KRWB 4J86A 3MUOA 3MUNA 4GGCA 3PSCB 4CY2A 2GNQA 4E5ZB 3JAMg 3IJ0A 3IUJA 3GC3B 4CZVA 4ESGA 2TRCB 3RLMD 5M5SA 3IJEA 3U4YA 3BWSA 3J81g 2HU5A 4GZ8A 2YNNA 1TBGA 4L1QD 4EWRA 4Z8LA 2H9LA 4L9OA 2VDOA 2HKRA 2OK4A 5I5MA 3VH0A 3VI4A 3O4JA 2OVRB 2AGXA 2XYIA 4L3GD 3EI4A 3FM0A 3IUNA 5CXBB 3NVQA 1SQJA 4NSXA 4X61B 4J8BA 3ZWLB 4J87A 1E5TA 5GSAA 5M61A 3PVUB 3EI2A 3ZE0A 4A2MA 4ZOYA 4ES0A 5B4WA 2IUQA 2OJYA 5IGOA 2P9PC 5FKRA 1B9XA 4H5JA 4Y5RD 5CYKB 4ZN4A 1B9YA 4IMMA 5EALA 3I2NA 3E0CA 4R7AB 1N6FA 2XL2A 5AFU3 5M5TA 4LG8A 1GOFA 1MG2A 3ZDXA 1O6FA 1JOFA 5AMSA 2AGLA 4PXWA 2XL3A 2CO0C 3MKSB 4WK4A 2HKMA 5M5UA 3SMRA 5EAPA 5M5RA 3DM0A 3EI4B 2BBKH 2G9AA 1K32A 3ZE1A 4XYIA 2BCJB 2H68A 3JB9L 2BKLA 3V7DB 5C9ZB 3L4OD 1N6EA 3RFGA 3SWSD 3EI2B 1SQ9A 1VYHC 2UZXB 3IULA 5E6RA 5AJAA 2EICA 4BL0A 2HU8A 1GOHA 3VA6A 4FB1D 4XEIC 1SHYB 1JV2A 1VZ2A 3I8EA 4UI9R 5IGQA 3VI3A 2Z2OA 4PSXB 3JZGA 3SJLD 1PEVA 5FKSA 4GQBB 4GM3A 4BCCA 4LG9A 3AH8B 4Z7QA 4MMZA 4FA5D 4OWRA 1XKSA 2I0TA 3FGBA 3O4GA 1H2XA 4A09A 4JT5C 5HE1B 3IUQA 3IVMA 3W15A 3B7FA 1H2YA 1VE6A 5TDHB 2H6QA 3IJ1A 2GC4A 5EAMA 4JD2C 3F3PA 5TEFA 4FA1D 4GGDA 3I8CA 3P4FA 5I5IA 3DWLC 3C75H 4G55A 1T2XA 2O9KA 4O02A 4DNUA 1UOPA 5EMMB 1M1XA 2XE4A 4G1EA 3MVDK 4OZUA 3QHYB 4FWWA 3IURA 4G56B 5IC7A 1U4CA 5KDOB 3I7LA 2I3SA 3ORVD 2AGYA 3K26A 4GMBA 4TZ4A 4WK2A 2YNPA 3I7OA 3C5MA 3CFSB 1E8NA 3MKQA 3EWEA 1YR2A 3QI0A 3SHFA 2AQ5A 2IAAA 5C86A 3RN0D 3SCYA 3OW8A 3MMYA 2CN3A 2Q7QA 2AH1A 5FFGA 2VDNA 3NVXA 4A09B 3SVWD 2HJ4A 4BUJC 1BPOA 4PSWB 1QFMA 4X3EA 2Z2NA 5IT9g 2P9UC 5HDBA 4D6VA 1OLZA 4H5IA 2H47A 1GOGA 2YB8B 2G99A 4NENA 3OTTA 1UOQA 3EI3A 3RSEC 3I7HA 3EG6A 3SBQA 3SLED 4RE6A 1GG2B 4PC0A 4O3UB 2H9PA 4HDJA 2VDRA 1PGUA 4ZOXA 3OKYA 5K1CC 3VGZA 4DNWA 4QAMA 4ZOVA 5E6SA 2CE9A 1MDAH 3EQ9A 4MMYA 3ZDYA 4AX4A 4Z7OA 3EQ8A 2I0RA 2MTAH 4IA9A 4CY1A 4J82A 3EU7A 1XHMA 4BP8A 3C9CA 4FA9D 3PXTD 3EI1A 1JJUB 3FCSA 4BCBA 5A2Qg 5C2WB 2EIBA 3OL2A 5HQGA 4PBYA 1OMWB 2XZGA 2QR5A 3MZKA 4GQ2P 4PBZA 5H17A 2J56H 3PE7A 2OVQB 4JHNA 5EARA 3UR4A 1U2VC 2VZ1A 4WJKA 2VC2A 3EI3B 1ERJA 1GP2B 1XIPA 4QT8A 3OF7A 4N14A 2OVPB 3EMHA 2YMUA 3FCUA 3PVWB 3OKYB 5HE2B 3V5WB 3AFCA 4A7JA 5THAA 2IUVA 2IUPA 5FLXg 1R5MA 1UTCA 4L3HD 3UVMA 2HU7A 3CFVA 1O6GA 4J0XA 3PXWD 4NC4A 4AN1A 1JMXB 4KFMB 4O9DA 2J55H 2VDQA 3EI1B 3MXXA 2PM6B 4ERYA 2PM7B 5HE3B 3OL2B 3PXSD 2HXCA 4A11A 4J8GA 4CZXA 2CNXA 4IRZA 4U1EI 2B5NA 4JT6C 4ERZA 3OKWA 3J80g 3JRPA 1MG3A 3T3MA 4CC9A 4J84A 3I7NA 3RN1D 3UKRC 1U8CA 3HFQA 2CE8A 2VDPA 3OKTA 4O3TB 2I3TA 4A2LA 4CI3A 2VDMA 2H9NA 5FKTA 4ERQA 1PBYB 2PBIB 2VZ3A 4QQEA 5JWZA 1C9LA 4O2WA 2QZPA 3F3GA 3RMZD 3EQ7A 3JZHA 2YBAA 5M5VA 4WK0A 5CXCA 3BG0A 3NVNA 5FA5B 2XDWA 2HESX 3UKUC 1TYQC 4D9SA 1GOTB 3IUMA 5C92A 4L1MA 3UVNA 4JSXC 2IWKA 1FWXA 5K19A 2CO0A 5H14A 4A11B 3RRMC 3DSMA 1NEXB 5HYNB 2P9NC 5FKQA 4MK0B 2GC7A 4CI8A 4DNVA 3UVOA 1YFQA 4GGAA 4U7AA 2EIDA 3IKOA 3I7PA 1VE7A 2AGZA 4O1QD 2XU7A 4JXMA 4E54A 2WQ8A 3CIKB 3JPXA 1C9IA 2QXVA 1K3IA 3KRXB 1K8KC 4NBMA 4J77A 2OIZA 3T3PA 4AMYA 4D0KA 3SBRA 5CXCB 1QFSA 4PNKB 3K72A 1L0QA 2EIEA 5EM2A 3UVLA 4X60B 3F3FA 3K6SA 3SBPA 1TYEA 3IJCA 3I89A 4CY3A 2W18A 4QL1A 4CZYA 2J57G 5GXHA 5IJ8E 1A0RB 2VDLA 5FFOA 3NIGA 3RFHA 4Z7NA 4AEZA 3GD1I 2B5MA 3SN6B 5C2VB 2P9KC 4LGNA 5GXIA 3KCIA 3MZLA 4J0WA 1E8MA 1RI6A 1H2ZA 5FQDA 5TEEA 3L4MD 4J73A 3V4PA 2Z2PA 3ULEC 2H6KA 3IIWA 5H1MA 3UVKA 5EMJB 2UZYB 1QNIA 4E54B 5GMKn 4CI1A 1H2WA 3I7KA 5SXMA 4A08A 3SXTD 5TF2A 4BCDA 2H6NA 3DXKC 4CY5A 2PM9A 1Q47A 2I0SA 4JHPC 4UM9A 3V9FA 1JTDB 2CN2A 1UOOA 2P9IC 2HYEA 4A0BA 5EM2B 3K71A 3ODTA 2YNOA 2IURA 2H14A 4Y7RA 3N0EA 3AL8A 4A0AA 4AOWA 3N0DA 3ZE2A 3AL9A 4BH6A 3NIDA 1S4UX 2OK6A 4G1MA 4FA4D 1L5GA 4BP9A 4GM8A 4J79A 5EMLB 3SFZA 4UM8A 4JSNC 4X63B 3C99A 4JSPC 2P9LC 3NIFA 4E5ZA 2H3XA 3DDUA 5IJ7E 3JROA 4K3ID 4CI2A 3FRXA
chains in the Genus database with same CATH topology
4FHLA 3IIYA 4ZOZA 1GXRA 2B4EA 4A08B 1P22A 4I79A 4K3JB 2PM9B 2H9MA 4GQ1A 4JSVC 4J81A 3K27A 4YVDA 1NR0A 3DXMC 4A0BB 5HE0B 3A0FA 5CXBA 3GFCA 4XYHA 5I5JA 3PSLA 1N6DA 4O45A 2HJBA 3GREA 5EMKB 2AGWA 3AL8B 1PI6A 4A0AB 2H13A 4FAND 3JZNA 2IWFA 2P9SC 3BG1A 5FXYA 2QC5A 4FAVD 4QRJA 1JMZB 4GM9A 2AH0A 4J78A 5CYKA 2B5LA 2EBSA 3KRWB 4J86A 4GGCA 3PSCB 4CY2A 2GNQA 4E5ZB 3JAMg 3IJ0A 4CZVA 4ESGA 2TRCB 3RLMD 3U4YA 3BWSA 3J81g 4GZ8A 2YNNA 1TBGA 4L1QD 4EWRA 4Z8LA 2H9LA 4L9OA 2HKRA 2OK4A 5I5MA 3VH0A 2OVRB 2AGXA 2XYIA 4L3GD 3EI4A 3FM0A 5CXBB 3NVQA 1SQJA 4NSXA 4X61B 4J8BA 3ZWLB 4J87A 5GSAA 3PVUB 3EI2A 4A2MA 4ZOYA 4ES0A 5B4WA 2IUQA 2OJYA 5IGOA 2P9PC 5FKRA 1B9XA 4H5JA 4Y5RD 5CYKB 4ZN4A 1B9YA 4IMMA 5EALA 3I2NA 3E0CA 4R7AB 1N6FA 2XL2A 5AFU3 4LG8A 1MG2A 1JOFA 5AMSA 2AGLA 4PXWA 2XL3A 2CO0C 3MKSB 2HKMA 3SMRA 5EAPA 3DM0A 3EI4B 2BBKH 2G9AA 1K32A 4XYIA 2BCJB 2H68A 3JB9L 3V7DB 5C9ZB 3L4OD 1N6EA 3RFGA 3SWSD 3EI2B 1SQ9A 1VYHC 2UZXB 5AJAA 4BL0A 3VA6A 4FB1D 4XEIC 1SHYB 3I8EA 4UI9R 5IGQA 2Z2OA 4PSXB 3JZGA 3SJLD 1PEVA 5FKSA 4GQBB 4GM3A 4LG9A 3AH8B 4FA5D 4OWRA 1XKSA 2I0TA 3FGBA 4A09A 4JT5C 5HE1B 3W15A 3B7FA 5TDHB 2H6QA 3IJ1A 2GC4A 5EAMA 4JD2C 3F3PA 5TEFA 4FA1D 4GGDA 3I8CA 3P4FA 5I5IA 3DWLC 3C75H 2O9KA 5EMMB 4OZUA 4FWWA 4G56B 5IC7A 1U4CA 5KDOB 3I7LA 2I3SA 3ORVD 2AGYA 3K26A 4GMBA 4TZ4A 2YNPA 3I7OA 3C5MA 3CFSB 3MKQA 3EWEA 3SHFA 2AQ5A 2IAAA 3RN0D 3SCYA 3OW8A 3MMYA 2CN3A 2Q7QA 2AH1A 3NVXA 4A09B 3SVWD 2HJ4A 4BUJC 4PSWB 4X3EA 2Z2NA 5IT9g 2P9UC 4D6VA 1OLZA 4H5IA 2H47A 2YB8B 2G99A 3OTTA 3EI3A 3RSEC 3I7HA 3EG6A 3SBQA 3SLED 1GG2B 4PC0A 4O3UB 2H9PA 4HDJA 1PGUA 4ZOXA 3OKYA 5K1CC 3VGZA 4ZOVA 1MDAH 2CE9A 2I0RA 2MTAH 4IA9A 4CY1A 4J82A 3EU7A 1XHMA 3C9CA 4FA9D 3PXTD 3EI1A 1JJUB 5A2Qg 5C2WB 3OL2A 5HQGA 4PBYA 1OMWB 3MZKA 4PBZA 4GQ2P 5H17A 2J56H 3PE7A 2OVQB 5EARA 3UR4A 1U2VC 3EI3B 1ERJA 1GP2B 1XIPA 4QT8A 4N14A 2OVPB 3EMHA 2YMUA 3PVWB 3OKYB 5HE2B 3V5WB 3AFCA 4A7JA 5THAA 2IUVA 2IUPA 5FLXg 1R5MA 4L3HD 3UVMA 3CFVA 4J0XA 3PXWD 1JMXB 4KFMB 4O9DA 2J55H 3EI1B 3MXXA 2PM6B 4ERYA 2PM7B 5HE3B 3OL2B 3PXSD 2HXCA 4A11A 4J8GA 4CZXA 2CNXA 4U1EI 2B5NA 4JT6C 4ERZA 3OKWA 3J80g 3JRPA 1MG3A 4CC9A 4J84A 3I7NA 3RN1D 3UKRC 3HFQA 2CE8A 3OKTA 4O3TB 2I3TA 4A2LA 4CI3A 2H9NA 5FKTA 4ERQA 1PBYB 2PBIB 4QQEA 5JWZA 3F3GA 3RMZD 3JZHA 2YBAA 5CXCA 3BG0A 3NVNA 5FA5B 2HESX 3UKUC 1TYQC 1GOTB 3UVNA 4JSXC 2IWKA 1FWXA 5K19A 2CO0A 5H14A 4A11B 3RRMC 3DSMA 1NEXB 5HYNB 2P9NC 5FKQA 4MK0B 2GC7A 4CI8A 3UVOA 1YFQA 4GGAA 4U7AA 3IKOA 3I7PA 2AGZA 4O1QD 2XU7A 4JXMA 4E54A 3JPXA 3CIKB 2QXVA 3KRXB 1K8KC 4J77A 2OIZA 4D0KA 3SBRA 5CXCB 4PNKB 1L0QA 5EM2A 3UVLA 4X60B 3F3FA 3SBPA 3IJCA 3I89A 4CY3A 2W18A 4QL1A 4CZYA 2J57G 5GXHA 5IJ8E 1A0RB 3RFHA 4AEZA 2B5MA 3SN6B 5C2VB 2P9KC 4LGNA 5GXIA 3MZLA 4J0WA 1RI6A 5FQDA 5TEEA 3L4MD 4J73A 2Z2PA 3ULEC 2H6KA 3IIWA 5H1MA 3UVKA 5EMJB 2UZYB 1QNIA 4E54B 5GMKn 4CI1A 3I7KA 5SXMA 4A08A 3SXTD 5TF2A 2H6NA 3DXKC 4CY5A 2PM9A 1Q47A 2I0SA 3V9FA 2CN2A 2P9IC 2HYEA 4A0BA 5EM2B 3ODTA 2YNOA 2IURA 2H14A 4Y7RA 3N0EA 3AL8A 4A0AA 4AOWA 3N0DA 3AL9A 4BH6A 1S4UX 2OK6A 4FA4D 4GM8A 4J79A 5EMLB 3SFZA 4JSNC 4X63B 3C99A 4JSPC 2P9LC 4E5ZA 2H3XA 5IJ7E 3JROA 4K3ID 4CI2A 3FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHL A;  3IIY A;  4ZOZ A;  1GXR A;  2B4E A;  4A08 B;  1P22 A;  4I79 A;  4K3J B;  2PM9 B;  2H9M A;  4GQ1 A;  4JSV C;  4J81 A;  3K27 A;  4YVD A;  1NR0 A;  3DXM C;  4A0B B;  5HE0 B;  3A0F A;  5CXB A;  3GFC A;  4XYH A;  5I5J A;  3PSL A;  1N6D A;  4O45 A;  2HJB A;  3GRE A;  5EMK B;  2AGW A;  3AL8 B;  1PI6 A;  4A0A B;  2H13 A;  4FAN D;  3JZN A;  2IWF A;  2P9S C;  3BG1 A;  5FXY A;  2QC5 A;  4FAV D;  4QRJ A;  1JMZ B;  4GM9 A;  2AH0 A;  4J78 A;  5CYK A;  2B5L A;  2EBS A;  3KRW B;  4J86 A;  4GGC A;  3PSC B;  4CY2 A;  2GNQ A;  4E5Z B;  3JAM g;  3IJ0 A;  4CZV A;  4ESG A;  2TRC B;  3RLM D;  3U4Y A;  3BWS A;  3J81 g;  4GZ8 A;  2YNN A;  1TBG A;  4L1Q D;  4EWR A;  4Z8L A;  2H9L A;  4L9O A;  2HKR A;  2OK4 A;  5I5M A;  3VH0 A;  2OVR B;  2AGX A;  2XYI A;  4L3G D;  3EI4 A;  3FM0 A;  5CXB B;  3NVQ A;  1SQJ A;  4NSX A;  4X61 B;  4J8B A;  3ZWL B;  4J87 A;  5GSA A;  3PVU B;  3EI2 A;  4A2M A;  4ZOY A;  4ES0 A;  5B4W A;  2IUQ A;  2OJY A;  5IGO A;  2P9P C;  5FKR A;  1B9X A;  4H5J A;  4Y5R D;  5CYK B;  4ZN4 A;  1B9Y A;  4IMM A;  5EAL A;  3I2N A;  3E0C A;  4R7A B;  1N6F A;  2XL2 A;  5AFU 3;  4LG8 A;  1MG2 A;  1JOF A;  5AMS A;  2AGL A;  4PXW A;  2XL3 A;  2CO0 C;  3MKS B;  2HKM A;  3SMR A;  5EAP A;  3DM0 A;  3EI4 B;  2BBK H;  2G9A A;  1K32 A;  4XYI A;  2BCJ B;  2H68 A;  3JB9 L;  3V7D B;  5C9Z B;  3L4O D;  1N6E A;  3RFG A;  3SWS D;  3EI2 B;  1SQ9 A;  1VYH C;  2UZX B;  5AJA A;  4BL0 A;  3VA6 A;  4FB1 D;  4XEI C;  1SHY B;  3I8E A;  4UI9 R;  5IGQ A;  2Z2O A;  4PSX B;  3JZG A;  3SJL D;  1PEV A;  5FKS A;  4GQB B;  4GM3 A;  4LG9 A;  3AH8 B;  4FA5 D;  4OWR A;  1XKS A;  2I0T A;  3FGB A;  4A09 A;  4JT5 C;  5HE1 B;  3W15 A;  3B7F A;  5TDH B;  2H6Q A;  3IJ1 A;  2GC4 A;  5EAM A;  4JD2 C;  3F3P A;  5TEF A;  4FA1 D;  4GGD A;  3I8C A;  3P4F A;  5I5I A;  3DWL C;  3C75 H;  2O9K A;  5EMM B;  4OZU A;  4FWW A;  4G56 B;  5IC7 A;  1U4C A;  5KDO B;  3I7L A;  2I3S A;  3ORV D;  2AGY A;  3K26 A;  4GMB A;  4TZ4 A;  2YNP A;  3I7O A;  3C5M A;  3CFS B;  3MKQ A;  3EWE A;  3SHF A;  2AQ5 A;  2IAA A;  3RN0 D;  3SCY A;  3OW8 A;  3MMY A;  2CN3 A;  2Q7Q A;  2AH1 A;  3NVX A;  4A09 B;  3SVW D;  2HJ4 A;  4BUJ C;  4PSW B;  4X3E A;  2Z2N A;  5IT9 g;  2P9U C;  4D6V A;  1OLZ A;  4H5I A;  2H47 A;  2YB8 B;  2G99 A;  3OTT A;  3EI3 A;  3RSE C;  3I7H A;  3EG6 A;  3SBQ A;  3SLE D;  1GG2 B;  4PC0 A;  4O3U B;  2H9P A;  4HDJ A;  1PGU A;  4ZOX A;  3OKY A;  5K1C C;  3VGZ A;  4ZOV A;  1MDA H;  2CE9 A;  2I0R A;  2MTA H;  4IA9 A;  4CY1 A;  4J82 A;  3EU7 A;  1XHM A;  3C9C A;  4FA9 D;  3PXT D;  3EI1 A;  1JJU B;  5A2Q g;  5C2W B;  3OL2 A;  5HQG A;  4PBY A;  1OMW B;  3MZK A;  4PBZ A;  4GQ2 P;  5H17 A;  2J56 H;  3PE7 A;  2OVQ B;  5EAR A;  3UR4 A;  1U2V C;  3EI3 B;  1ERJ A;  1GP2 B;  1XIP A;  4QT8 A;  4N14 A;  2OVP B;  3EMH A;  2YMU A;  3PVW B;  3OKY B;  5HE2 B;  3V5W B;  3AFC A;  4A7J A;  5THA A;  2IUV A;  2IUP A;  5FLX g;  1R5M A;  4L3H D;  3UVM A;  3CFV A;  4J0X A;  3PXW D;  1JMX B;  4KFM B;  4O9D A;  2J55 H;  3EI1 B;  3MXX A;  2PM6 B;  4ERY A;  2PM7 B;  5HE3 B;  3OL2 B;  3PXS D;  2HXC A;  4A11 A;  4J8G A;  4CZX A;  2CNX A;  4U1E I;  2B5N A;  4JT6 C;  4ERZ A;  3OKW A;  3J80 g;  3JRP A;  1MG3 A;  4CC9 A;  4J84 A;  3I7N A;  3RN1 D;  3UKR C;  3HFQ A;  2CE8 A;  3OKT A;  4O3T B;  2I3T A;  4A2L A;  4CI3 A;  2H9N A;  5FKT A;  4ERQ A;  1PBY B;  2PBI B;  4QQE A;  5JWZ A;  3F3G A;  3RMZ D;  3JZH A;  2YBA A;  5CXC A;  3BG0 A;  3NVN A;  5FA5 B;  2HES X;  3UKU C;  1TYQ C;  1GOT B;  3UVN A;  4JSX C;  2IWK A;  1FWX A;  5K19 A;  2CO0 A;  5H14 A;  4A11 B;  3RRM C;  3DSM A;  1NEX B;  5HYN B;  2P9N C;  5FKQ A;  4MK0 B;  2GC7 A;  4CI8 A;  3UVO A;  1YFQ A;  4GGA A;  4U7A A;  3IKO A;  3I7P A;  2AGZ A;  4O1Q D;  2XU7 A;  4JXM A;  4E54 A;  3JPX A;  3CIK B;  2QXV A;  3KRX B;  1K8K C;  4J77 A;  2OIZ A;  4D0K A;  3SBR A;  5CXC B;  4PNK B;  1L0Q A;  5EM2 A;  3UVL A;  4X60 B;  3F3F A;  3SBP A;  3IJC A;  3I89 A;  4CY3 A;  2W18 A;  4QL1 A;  4CZY A;  2J57 G;  5GXH A;  5IJ8 E;  1A0R B;  3RFH A;  4AEZ A;  2B5M A;  3SN6 B;  5C2V B;  2P9K C;  4LGN A;  5GXI A;  3MZL A;  4J0W A;  1RI6 A;  5FQD A;  5TEE A;  3L4M D;  4J73 A;  2Z2P A;  3ULE C;  2H6K A;  3IIW A;  5H1M A;  3UVK A;  5EMJ B;  2UZY B;  1QNI A;  4E54 B;  5GMK n;  4CI1 A;  3I7K A;  5SXM A;  4A08 A;  3SXT D;  5TF2 A;  2H6N A;  3DXK C;  4CY5 A;  2PM9 A;  1Q47 A;  2I0S A;  3V9F A;  2CN2 A;  2P9I C;  2HYE A;  4A0B A;  5EM2 B;  3ODT A;  2YNO A;  2IUR A;  2H14 A;  4Y7R A;  3N0E A;  3AL8 A;  4A0A A;  4AOW A;  3N0D A;  3AL9 A;  4BH6 A;  1S4U X;  2OK6 A;  4FA4 D;  4GM8 A;  4J79 A;  5EML B;  3SFZ A;  4JSN C;  4X63 B;  3C99 A;  4JSP C;  2P9L C;  4E5Z A;  2H3X A;  5IJ7 E;  3JRO A;  4K3I D;  4CI2 A;  3FRX A; 
#chains in the Genus database with same CATH topology
 4FHL A;  3IIY A;  4ZOZ A;  1GXR A;  3O4I A;  2B4E A;  4A08 B;  1P22 A;  4RE5 A;  4I79 A;  4K3J B;  2PM9 B;  2H9M A;  4GQ1 A;  4JSV C;  2JKX A;  3V4V A;  4J81 A;  5E6U A;  3K27 A;  4YVD A;  1NR0 A;  3DXM C;  4A0B B;  5HE0 B;  4AMZ A;  3A0F A;  5CXB A;  3GFC A;  4XYH A;  5I5J A;  3PSL A;  1N6D A;  4MMX A;  4O45 A;  2HJB A;  3O4H A;  3GRE A;  5EMK B;  2AGW A;  3AL8 B;  1PI6 A;  4A0A B;  1I2M B;  2H13 A;  4NAA A;  4FAN D;  4AN0 A;  3JZN A;  2IWF A;  2P9S C;  3BG1 A;  3ZDZ A;  5FXY A;  2QC5 A;  4FAV D;  1VZ3 A;  4QRJ A;  1JMZ B;  2VDK A;  4GM9 A;  2AH0 A;  4J78 A;  5CYK A;  2B5L A;  2EBS A;  1A12 A;  3KRW B;  4J86 A;  3MUO A;  3MUN A;  4GGC A;  3PSC B;  4CY2 A;  2GNQ A;  4E5Z B;  3JAM g;  3IJ0 A;  3IUJ A;  3GC3 B;  4CZV A;  4ESG A;  2TRC B;  3RLM D;  5M5S A;  3IJE A;  3U4Y A;  3BWS A;  3J81 g;  2HU5 A;  4GZ8 A;  2YNN A;  1TBG A;  4L1Q D;  4EWR A;  4Z8L A;  2H9L A;  4L9O A;  2VDO A;  2HKR A;  2OK4 A;  5I5M A;  3VH0 A;  3VI4 A;  3O4J A;  2OVR B;  2AGX A;  2XYI A;  4L3G D;  3EI4 A;  3FM0 A;  3IUN A;  5CXB B;  3NVQ A;  1SQJ A;  4NSX A;  4X61 B;  4J8B A;  3ZWL B;  4J87 A;  1E5T A;  5GSA A;  5M61 A;  3PVU B;  3EI2 A;  3ZE0 A;  4A2M A;  4ZOY A;  4ES0 A;  5B4W A;  2IUQ A;  2OJY A;  5IGO A;  2P9P C;  5FKR A;  1B9X A;  4H5J A;  4Y5R D;  5CYK B;  4ZN4 A;  1B9Y A;  4IMM A;  5EAL A;  3I2N A;  3E0C A;  4R7A B;  1N6F A;  2XL2 A;  5AFU 3;  5M5T A;  4LG8 A;  1GOF A;  1MG2 A;  3ZDX A;  1O6F A;  1JOF A;  5AMS A;  2AGL A;  4PXW A;  2XL3 A;  2CO0 C;  3MKS B;  4WK4 A;  2HKM A;  5M5U A;  3SMR A;  5EAP A;  5M5R A;  3DM0 A;  3EI4 B;  2BBK H;  2G9A A;  1K32 A;  3ZE1 A;  4XYI A;  2BCJ B;  2H68 A;  3JB9 L;  2BKL A;  3V7D B;  5C9Z B;  3L4O D;  1N6E A;  3RFG A;  3SWS D;  3EI2 B;  1SQ9 A;  1VYH C;  2UZX B;  3IUL A;  5E6R A;  5AJA A;  2EIC A;  4BL0 A;  2HU8 A;  1GOH A;  3VA6 A;  4FB1 D;  4XEI C;  1SHY B;  1JV2 A;  1VZ2 A;  3I8E A;  4UI9 R;  5IGQ A;  3VI3 A;  2Z2O A;  4PSX B;  3JZG A;  3SJL D;  1PEV A;  5FKS A;  4GQB B;  4GM3 A;  4BCC A;  4LG9 A;  3AH8 B;  4Z7Q A;  4MMZ A;  4FA5 D;  4OWR A;  1XKS A;  2I0T A;  3FGB A;  3O4G A;  1H2X A;  4A09 A;  4JT5 C;  5HE1 B;  3IUQ A;  3IVM A;  3W15 A;  3B7F A;  1H2Y A;  1VE6 A;  5TDH B;  2H6Q A;  3IJ1 A;  2GC4 A;  5EAM A;  4JD2 C;  3F3P A;  5TEF A;  4FA1 D;  4GGD A;  3I8C A;  3P4F A;  5I5I A;  3DWL C;  3C75 H;  4G55 A;  1T2X A;  2O9K A;  4O02 A;  4DNU A;  1UOP A;  5EMM B;  1M1X A;  2XE4 A;  4G1E A;  3MVD K;  4OZU A;  3QHY B;  4FWW A;  3IUR A;  4G56 B;  5IC7 A;  1U4C A;  5KDO B;  3I7L A;  2I3S A;  3ORV D;  2AGY A;  3K26 A;  4GMB A;  4TZ4 A;  4WK2 A;  2YNP A;  3I7O A;  3C5M A;  3CFS B;  1E8N A;  3MKQ A;  3EWE A;  1YR2 A;  3QI0 A;  3SHF A;  2AQ5 A;  2IAA A;  5C86 A;  3RN0 D;  3SCY A;  3OW8 A;  3MMY A;  2CN3 A;  2Q7Q A;  2AH1 A;  5FFG A;  2VDN A;  3NVX A;  4A09 B;  3SVW D;  2HJ4 A;  4BUJ C;  1BPO A;  4PSW B;  1QFM A;  4X3E A;  2Z2N A;  5IT9 g;  2P9U C;  5HDB A;  4D6V A;  1OLZ A;  4H5I A;  2H47 A;  1GOG A;  2YB8 B;  2G99 A;  4NEN A;  3OTT A;  1UOQ A;  3EI3 A;  3RSE C;  3I7H A;  3EG6 A;  3SBQ A;  3SLE D;  4RE6 A;  1GG2 B;  4PC0 A;  4O3U B;  2H9P A;  4HDJ A;  2VDR A;  1PGU A;  4ZOX A;  3OKY A;  5K1C C;  3VGZ A;  4DNW A;  4QAM A;  4ZOV A;  5E6S A;  2CE9 A;  1MDA H;  3EQ9 A;  4MMY A;  3ZDY A;  4AX4 A;  4Z7O A;  3EQ8 A;  2I0R A;  2MTA H;  4IA9 A;  4CY1 A;  4J82 A;  3EU7 A;  1XHM A;  4BP8 A;  3C9C A;  4FA9 D;  3PXT D;  3EI1 A;  1JJU B;  3FCS A;  4BCB A;  5A2Q g;  5C2W B;  2EIB A;  3OL2 A;  5HQG A;  4PBY A;  1OMW B;  2XZG A;  2QR5 A;  3MZK A;  4GQ2 P;  4PBZ A;  5H17 A;  2J56 H;  3PE7 A;  2OVQ B;  4JHN A;  5EAR A;  3UR4 A;  1U2V C;  2VZ1 A;  4WJK A;  2VC2 A;  3EI3 B;  1ERJ A;  1GP2 B;  1XIP A;  4QT8 A;  3OF7 A;  4N14 A;  2OVP B;  3EMH A;  2YMU A;  3FCU A;  3PVW B;  3OKY B;  5HE2 B;  3V5W B;  3AFC A;  4A7J A;  5THA A;  2IUV A;  2IUP A;  5FLX g;  1R5M A;  1UTC A;  4L3H D;  3UVM A;  2HU7 A;  3CFV A;  1O6G A;  4J0X A;  3PXW D;  4NC4 A;  4AN1 A;  1JMX B;  4KFM B;  4O9D A;  2J55 H;  2VDQ A;  3EI1 B;  3MXX A;  2PM6 B;  4ERY A;  2PM7 B;  5HE3 B;  3OL2 B;  3PXS D;  2HXC A;  4A11 A;  4J8G A;  4CZX A;  2CNX A;  4IRZ A;  4U1E I;  2B5N A;  4JT6 C;  4ERZ A;  3OKW A;  3J80 g;  3JRP A;  1MG3 A;  3T3M A;  4CC9 A;  4J84 A;  3I7N A;  3RN1 D;  3UKR C;  1U8C A;  3HFQ A;  2CE8 A;  2VDP A;  3OKT A;  4O3T B;  2I3T A;  4A2L A;  4CI3 A;  2VDM A;  2H9N A;  5FKT A;  4ERQ A;  1PBY B;  2PBI B;  2VZ3 A;  4QQE A;  5JWZ A;  1C9L A;  4O2W A;  2QZP A;  3F3G A;  3RMZ D;  3EQ7 A;  3JZH A;  2YBA A;  5M5V A;  4WK0 A;  5CXC A;  3BG0 A;  3NVN A;  5FA5 B;  2XDW A;  2HES X;  3UKU C;  1TYQ C;  4D9S A;  1GOT B;  3IUM A;  5C92 A;  4L1M A;  3UVN A;  4JSX C;  2IWK A;  1FWX A;  5K19 A;  2CO0 A;  5H14 A;  4A11 B;  3RRM C;  3DSM A;  1NEX B;  5HYN B;  2P9N C;  5FKQ A;  4MK0 B;  2GC7 A;  4CI8 A;  4DNV A;  3UVO A;  1YFQ A;  4GGA A;  4U7A A;  2EID A;  3IKO A;  3I7P A;  1VE7 A;  2AGZ A;  4O1Q D;  2XU7 A;  4JXM A;  4E54 A;  2WQ8 A;  3CIK B;  3JPX A;  1C9I A;  2QXV A;  1K3I A;  3KRX B;  1K8K C;  4NBM A;  4J77 A;  2OIZ A;  3T3P A;  4AMY A;  4D0K A;  3SBR A;  5CXC B;  1QFS A;  4PNK B;  3K72 A;  1L0Q A;  2EIE A;  5EM2 A;  3UVL A;  4X60 B;  3F3F A;  3K6S A;  3SBP A;  1TYE A;  3IJC A;  3I89 A;  4CY3 A;  2W18 A;  4QL1 A;  4CZY A;  2J57 G;  5GXH A;  5IJ8 E;  1A0R B;  2VDL A;  5FFO A;  3NIG A;  3RFH A;  4Z7N A;  4AEZ A;  3GD1 I;  2B5M A;  3SN6 B;  5C2V B;  2P9K C;  4LGN A;  5GXI A;  3KCI A;  3MZL A;  4J0W A;  1E8M A;  1RI6 A;  1H2Z A;  5FQD A;  5TEE A;  3L4M D;  4J73 A;  3V4P A;  2Z2P A;  3ULE C;  2H6K A;  3IIW A;  5H1M A;  3UVK A;  5EMJ B;  2UZY B;  1QNI A;  4E54 B;  5GMK n;  4CI1 A;  1H2W A;  3I7K A;  5SXM A;  4A08 A;  3SXT D;  5TF2 A;  4BCD A;  2H6N A;  3DXK C;  4CY5 A;  2PM9 A;  1Q47 A;  2I0S A;  4JHP C;  4UM9 A;  3V9F A;  1JTD B;  2CN2 A;  1UOO A;  2P9I C;  2HYE A;  4A0B A;  5EM2 B;  3K71 A;  3ODT A;  2YNO A;  2IUR A;  2H14 A;  4Y7R A;  3N0E A;  3AL8 A;  4A0A A;  4AOW A;  3N0D A;  3ZE2 A;  3AL9 A;  4BH6 A;  3NID A;  1S4U X;  2OK6 A;  4G1M A;  4FA4 D;  1L5G A;  4BP9 A;  4GM8 A;  4J79 A;  5EML B;  3SFZ A;  4UM8 A;  4JSN C;  4X63 B;  3C99 A;  4JSP C;  2P9L C;  3NIF A;  4E5Z A;  2H3X A;  3DDU A;  5IJ7 E;  3JRO A;  4K3I D;  4CI2 A;  3FRX A; 
#chains in the Genus database with same CATH homology
 4FHL A;  3IIY A;  4ZOZ A;  1GXR A;  2B4E A;  4A08 B;  1P22 A;  4I79 A;  4K3J B;  2PM9 B;  2H9M A;  4GQ1 A;  4JSV C;  4J81 A;  3K27 A;  4YVD A;  1NR0 A;  3DXM C;  4A0B B;  5HE0 B;  3A0F A;  5CXB A;  3GFC A;  4XYH A;  5I5J A;  3PSL A;  1N6D A;  4O45 A;  2HJB A;  3GRE A;  5EMK B;  2AGW A;  3AL8 B;  1PI6 A;  4A0A B;  2H13 A;  4FAN D;  3JZN A;  2IWF A;  2P9S C;  3BG1 A;  5FXY A;  2QC5 A;  4FAV D;  4QRJ A;  1JMZ B;  4GM9 A;  2AH0 A;  4J78 A;  5CYK A;  2B5L A;  2EBS A;  3KRW B;  4J86 A;  4GGC A;  3PSC B;  4CY2 A;  2GNQ A;  4E5Z B;  3JAM g;  3IJ0 A;  4CZV A;  4ESG A;  2TRC B;  3RLM D;  3U4Y A;  3BWS A;  3J81 g;  4GZ8 A;  2YNN A;  1TBG A;  4L1Q D;  4EWR A;  4Z8L A;  2H9L A;  4L9O A;  2HKR A;  2OK4 A;  5I5M A;  3VH0 A;  2OVR B;  2AGX A;  2XYI A;  4L3G D;  3EI4 A;  3FM0 A;  5CXB B;  3NVQ A;  1SQJ A;  4NSX A;  4X61 B;  4J8B A;  3ZWL B;  4J87 A;  5GSA A;  3PVU B;  3EI2 A;  4A2M A;  4ZOY A;  4ES0 A;  5B4W A;  2IUQ A;  2OJY A;  5IGO A;  2P9P C;  5FKR A;  1B9X A;  4H5J A;  4Y5R D;  5CYK B;  4ZN4 A;  1B9Y A;  4IMM A;  5EAL A;  3I2N A;  3E0C A;  4R7A B;  1N6F A;  2XL2 A;  5AFU 3;  4LG8 A;  1MG2 A;  1JOF A;  5AMS A;  2AGL A;  4PXW A;  2XL3 A;  2CO0 C;  3MKS B;  2HKM A;  3SMR A;  5EAP A;  3DM0 A;  3EI4 B;  2BBK H;  2G9A A;  1K32 A;  4XYI A;  2BCJ B;  2H68 A;  3JB9 L;  3V7D B;  5C9Z B;  3L4O D;  1N6E A;  3RFG A;  3SWS D;  3EI2 B;  1SQ9 A;  1VYH C;  2UZX B;  5AJA A;  4BL0 A;  3VA6 A;  4FB1 D;  4XEI C;  1SHY B;  3I8E A;  4UI9 R;  5IGQ A;  2Z2O A;  4PSX B;  3JZG A;  3SJL D;  1PEV A;  5FKS A;  4GQB B;  4GM3 A;  4LG9 A;  3AH8 B;  4FA5 D;  4OWR A;  1XKS A;  2I0T A;  3FGB A;  4A09 A;  4JT5 C;  5HE1 B;  3W15 A;  3B7F A;  5TDH B;  2H6Q A;  3IJ1 A;  2GC4 A;  5EAM A;  4JD2 C;  3F3P A;  5TEF A;  4FA1 D;  4GGD A;  3I8C A;  3P4F A;  5I5I A;  3DWL C;  3C75 H;  2O9K A;  5EMM B;  4OZU A;  4FWW A;  4G56 B;  5IC7 A;  1U4C A;  5KDO B;  3I7L A;  2I3S A;  3ORV D;  2AGY A;  3K26 A;  4GMB A;  4TZ4 A;  2YNP A;  3I7O A;  3C5M A;  3CFS B;  3MKQ A;  3EWE A;  3SHF A;  2AQ5 A;  2IAA A;  3RN0 D;  3SCY A;  3OW8 A;  3MMY A;  2CN3 A;  2Q7Q A;  2AH1 A;  3NVX A;  4A09 B;  3SVW D;  2HJ4 A;  4BUJ C;  4PSW B;  4X3E A;  2Z2N A;  5IT9 g;  2P9U C;  4D6V A;  1OLZ A;  4H5I A;  2H47 A;  2YB8 B;  2G99 A;  3OTT A;  3EI3 A;  3RSE C;  3I7H A;  3EG6 A;  3SBQ A;  3SLE D;  1GG2 B;  4PC0 A;  4O3U B;  2H9P A;  4HDJ A;  1PGU A;  4ZOX A;  3OKY A;  5K1C C;  3VGZ A;  4ZOV A;  1MDA H;  2CE9 A;  2I0R A;  2MTA H;  4IA9 A;  4CY1 A;  4J82 A;  3EU7 A;  1XHM A;  3C9C A;  4FA9 D;  3PXT D;  3EI1 A;  1JJU B;  5A2Q g;  5C2W B;  3OL2 A;  5HQG A;  4PBY A;  1OMW B;  3MZK A;  4PBZ A;  4GQ2 P;  5H17 A;  2J56 H;  3PE7 A;  2OVQ B;  5EAR A;  3UR4 A;  1U2V C;  3EI3 B;  1ERJ A;  1GP2 B;  1XIP A;  4QT8 A;  4N14 A;  2OVP B;  3EMH A;  2YMU A;  3PVW B;  3OKY B;  5HE2 B;  3V5W B;  3AFC A;  4A7J A;  5THA A;  2IUV A;  2IUP A;  5FLX g;  1R5M A;  4L3H D;  3UVM A;  3CFV A;  4J0X A;  3PXW D;  1JMX B;  4KFM B;  4O9D A;  2J55 H;  3EI1 B;  3MXX A;  2PM6 B;  4ERY A;  2PM7 B;  5HE3 B;  3OL2 B;  3PXS D;  2HXC A;  4A11 A;  4J8G A;  4CZX A;  2CNX A;  4U1E I;  2B5N A;  4JT6 C;  4ERZ A;  3OKW A;  3J80 g;  3JRP A;  1MG3 A;  4CC9 A;  4J84 A;  3I7N A;  3RN1 D;  3UKR C;  3HFQ A;  2CE8 A;  3OKT A;  4O3T B;  2I3T A;  4A2L A;  4CI3 A;  2H9N A;  5FKT A;  4ERQ A;  1PBY B;  2PBI B;  4QQE A;  5JWZ A;  3F3G A;  3RMZ D;  3JZH A;  2YBA A;  5CXC A;  3BG0 A;  3NVN A;  5FA5 B;  2HES X;  3UKU C;  1TYQ C;  1GOT B;  3UVN A;  4JSX C;  2IWK A;  1FWX A;  5K19 A;  2CO0 A;  5H14 A;  4A11 B;  3RRM C;  3DSM A;  1NEX B;  5HYN B;  2P9N C;  5FKQ A;  4MK0 B;  2GC7 A;  4CI8 A;  3UVO A;  1YFQ A;  4GGA A;  4U7A A;  3IKO A;  3I7P A;  2AGZ A;  4O1Q D;  2XU7 A;  4JXM A;  4E54 A;  3JPX A;  3CIK B;  2QXV A;  3KRX B;  1K8K C;  4J77 A;  2OIZ A;  4D0K A;  3SBR A;  5CXC B;  4PNK B;  1L0Q A;  5EM2 A;  3UVL A;  4X60 B;  3F3F A;  3SBP A;  3IJC A;  3I89 A;  4CY3 A;  2W18 A;  4QL1 A;  4CZY A;  2J57 G;  5GXH A;  5IJ8 E;  1A0R B;  3RFH A;  4AEZ A;  2B5M A;  3SN6 B;  5C2V B;  2P9K C;  4LGN A;  5GXI A;  3MZL A;  4J0W A;  1RI6 A;  5FQD A;  5TEE A;  3L4M D;  4J73 A;  2Z2P A;  3ULE C;  2H6K A;  3IIW A;  5H1M A;  3UVK A;  5EMJ B;  2UZY B;  1QNI A;  4E54 B;  5GMK n;  4CI1 A;  3I7K A;  5SXM A;  4A08 A;  3SXT D;  5TF2 A;  2H6N A;  3DXK C;  4CY5 A;  2PM9 A;  1Q47 A;  2I0S A;  3V9F A;  2CN2 A;  2P9I C;  2HYE A;  4A0B A;  5EM2 B;  3ODT A;  2YNO A;  2IUR A;  2H14 A;  4Y7R A;  3N0E A;  3AL8 A;  4A0A A;  4AOW A;  3N0D A;  3AL9 A;  4BH6 A;  1S4U X;  2OK6 A;  4FA4 D;  4GM8 A;  4J79 A;  5EML B;  3SFZ A;  4JSN C;  4X63 B;  3C99 A;  4JSP C;  2P9L C;  4E5Z A;  2H3X A;  5IJ7 E;  3JRO A;  4K3I D;  4CI2 A;  3FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...